4QJFB

X-ray crystal structure of thermocuccus kodakarensis rna polymerase rpp4/rpo7 (rpof/rpoe) complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
122
structure length
122
Chain Sequence
MIGRKKLEEHYITIAEAKELLERRHAEGLAENPEEPMFYEARVSLEHAERFAKLKPEQARELKEKLMGLFDWINERIAAKLVDILPEDYLDIRVIFAKEEYMPTPEEAEEIIKVIDEYRPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of euryarchaeal RNA polymerase and insight into the evolution of RNA polymerase II structure
rcsb
source organism Thermococcus kodakarensis
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase, subunit E'
total genus 39
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4qjfB02
1.10.287.420 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4qjfB01
3SAGA 2E1FA 2HBKA 2CPRA 2RRDA 2RHFA 2HBLA 3SAFA 2HBMA 2E1EA 5C0YA 4QJFB 1GO3F 2HBJA 3CYMA 2KV2A 4OO1J 4NLCA 3SAHA 1YT3A 4NLBA 1D8BA 4QIWF 4CGZA 1WUDA 2DGZA 2MA1A 4O3MA 4CDGA
chains in the Genus database with same CATH superfamily
1ENVA 2HHXA 4DV2O 3OGIB 4LH6A 2FPMA 5IIJA 1SB3C 4TUQA 3CXCU 4DV4O 4CRXA 5DBCA 5AKLA 4UBBA 2F44A 2E5LB 4QJFB 5J9PC 2HHHB 2R8GA 3T1YO 5LXTA 5IY5C 3R66A 3H40A 3ZJZA 5DKWA 5ALPA 4UB4A 4USAA 1BPDA 5KG2A 1JMSA 4H44B 1ZQRA 2YIBA 2N04A 3GIIA 4QZ9A 4UCTA 1X40A 1DOQA 4WFGA 1YSCA 3QO7A 4NB5A 2RQ5A 2QWOB 5ALVA 2ZTEA 1TGOA 4F6EA 2JV3A 3KHHA 3ZDBA 3ZHRA 5KMGB 4JYAB 4KLEA 4X20B 4ECSA 1ZWIC 1Q6HA 2WAMA 4F72A 4MTFA 1N32B 4OXSA 4EENA 2QM4A 4O3QA 4PHAA 4U7CA 1MMMA 3FX7A 4JI3B 5BOLA 1WLEA 4JI1B 5LMUB 5KG6A 3OW2U 4J11A 3DEEA 2BR0A 3JASA 4DL7A 4GUNA 3IGAC 1KFDA 4RNNA 3ONNA 1BPZA 1PKXA 1R3LC 1Z19A 4C8OA 2ZE7A 3K08A 1NJIW 4B6JA 2KSOB 2LYBA 3NXSA 1ZXIA 4P0PB 2EIKB 1K4DC 4NWIA 2X6CA 2M7WA 3ZRSA 5IIKA 1HUOA 1JCHA 2DQ3A 3HKDB 3HR0A 1AJNA 2QM8A 7ICUA 2JGDB 3QZ8A 3SZ2A 5KT7A 4PI2A 2XAFA 2V4QA 5HFLA 3CPWU 2R9RB 4MVUA 5JTIA 2R8HA 1Q43A 1SA0A 3RRGA 3BAAA 1RFYA 3BVOA 1BPBA 2QB0A 1HWYA 1WB8A 3JAKA 3OUFA 4G2KA 3IV6A 2XAJA 4ZBMA 2KJ5A 4UCOA 5DBBA 5LOVB 4WBNA 2WF8A 3KKAA 3SJBC 4UCVA 3QUBA 4RU9A 2HG5C 1FEZA 5KFFA 1J5EO 2BQUA 1ZQYA 1VDVA 5DM6V 2VWJA 2NV3A 3WK6A 4UAYA 3W7SA 1ZL8A 3EHBB 2KIWA 2B6GA 1SWWA 5DG8A 3UM7A 5KG4A 1KLNA 2XNDG 1JVMA 4FM0A 4BX9C 2FPLA 4I5SA 1RXVA 5ALQA 3OHBA 4MSWC 1SZHA 3OSPA 4XBFA 5LHIA 3ORYA 4KMUA 1KBUA 2H8PC 4JI7B 5B5EU 2G5IB 5JRTA 4DQSA 4DW0A 3FAVB 1NK8A 2QM7A 5KT5A 2OIGA 2MUTB 4UVCA 3TCUA 1LVHA 1R3JC 3OTFA 4UXNA 2CH7A 1CUKA 4WF9V 4LF8O 2DYSB 4FVMA 4TSFG 4CCHA 4RZRA 5L1MA 2ZIXB 3ZDEA 2AGAA 5ALIA 4DK1A 3H8WA 2Q0ZX 2RCVA 4KMOB 4IR9A 3L70H 3Q8KA 5J2AA 4WCEV 1F44A 1TAEA 1QSYA 1FKAO 1XBLA 2YI9A 3BDPA 1KDHA 2PFNA 5EIBD 3SQIA 2OM6A 1ZQPA 2NR5A 4CH6A 1U48A 4DR1B 5D5QA 4DV7B 4F93B 4Q44A 3AEIA 3CJHB 4LC1A 4Q6GA 2G08A 5FPRA 1K5SA 2HHSA 4PI0A 1N36O 1Z2GA 2JK5C 4MVRA 3T79A 1Y74B 4CS3A 1IBMO 5J2JA 2GLEA 4C4RA 1ZQLA 1KRPA 5KT4A 3U11A 1GM8A 3QNEA 3B8MA 1AR5A 2O57A 2IBZH 1OW5A 4LP8A 4TQDA 3RYHB 5JUMA 4LF5B 2AZ0A 2ZIVB 5TISZ 3WB2A 4IIJB 1TUEB 4YR3A 3RT3C 2PY5A 4RPXA 2XTAA 2XY7A 2LFSA 4RO2A 3OEEG 4AP9A 1FO4A 4EZ9A 2QE7G 4KX5A 3F5EA 2F1MA 4JAUA 4IGGA 4CS2A 9ICRA 2EIJB 4YN4A 4UCUA 4O0IA 2AHOB 4IHJA 4YXMA 3P3NA 1RPLA 2JZBB 2XUMA 2N05A 2ZR2A 3CCQV 4J9QA 3TKAA 4PDVA 4RQ3A 3RJIA 2CXYA 4QWAA 3M8RA 1ZJMA 4P2HA 5J2DA 3E8GA 2WB1F 3AL0B 1U97A 2KKPA 1GM9A 4KN7A 1T3NA 2DE0X 3S3XA 3X2QB 3CMAV 2P5OA 4JI6O 4QW8A 2W9CB 5T14A 2XASA 4BXOB 4BW5A 5KFYA 1YTFD 4GX5A 5AICA 1IIPA 2NO4A 4LF6B 4K0KO 4TUYA 5KFJA 4OJ5A 1Y88A 1Z4OA 4FLVA 1SV0C 1MZFA 4DOBA 9ICHA 4QE9A 2EJ7A 1SXDA 3SYQA 3V6JA 2OTLV 5AI8A 4P4OA 3DV9A 1IBLO 5A9GA 5KFVA 3UMBA 3RYFB 3RN4A 2NRZA 3ZDAA 3H1LH 3MR5A 4WFAV 3CYMA 1JALA 2EILB 4PZOA 1XS9D 4L8JA 4XDKA 5JWPA 2C22A 2CDYA 2K1EA 5GONA 5AKHA 3KZIU 2AXTU 2G07A 4YHHO 3HKZC 1BCCH 4AI8A 4J7KA 3HW8A 2H3QA 4DV6O 5IYCO 1N0NA 1L6NA 4BWJA 4IHJB 2H3IA 1K97A 2Y9UA 3CJHA 4JZGA 4IC9A 5EIBC 3MR6A 2UUBO 4M6WB 5DQIA 3Q8SB 3M8SA 1FYJA 5CRXA 1B22A 2ZD9A 1X59A 1NZ6A 2H3FA 3E0FA 4FLXA 5GTIZ 3E8HA 1CP9A 5AK4A 1UT5A 1AJQA 4O3RA 5LHGA 1S5LU 4J9LA 1HW7A 4IIJA 4FM2A 2P67A 1S3JA 3FB5C 2BTOA 4I2DA 2HHUA 4QW9A 1XSNA 2EZPA 4DUYB 2JMGA 4UAVA 3U10A 4FLZA 4U6PA 2ZJ8A 4B9LA 5IE9A 4JGSA 3CCEV 3U0ZA 2UVRA 5FNVA 2KICA 2J6TA 4I2FA 1SQFA 2DWDC 4DV5B 2P66A 2W9BB 1YDXA 2C28A 3QU4A 2AQ0A 2PTMA 1X9SA 5C93A 5ITZB 1NKEA 5CB4B 3THOA 3ZN1A 3AG2C 2PI5A 2EULA 4DW1A 1YZBA 4DL6A 2UXBO 4PZNA 1Z00B 3K5LA 3QNMA 3BHPA 1PZNA 5B5EZ 3UO2A 2ESEA 1JMKC 1SERA 2XO7A 2ZIWB 4RQ4A 1F4MA 4HAMA 3ZRXA 2UXDO 1BPYA 3ISBA 1XOUA 3JD1A 4Y2RA 1HIWA 1IZ3A 1HNXO 2ZIUA 5TZVA 3RBEA 3Q8RB 3G71V 2DPJA 1ZOLA 3E89A 4GYCB 1B6QA 3K5OA 1SQPH 5JVDA 1Y76B 5AM2A 1N62A 1RM1B 3LWMA 2EH9A 2HJFC 3ZMVA 2W11A 2IW5A 4PGQA 1IBKO 4DV0O 1ZRMA 1UFIA 4FM1A 3ML0A 4FZ1A 4BW9A 4OO1J 1KKXA 3HPOA 3T5JA 3D36A 1GRJA 1A77A 2I9GA 3PX0A 2ZE8A 5L1IA 1XO1A 5B1BC 4I55A 4LF4B 1D9DA 2UU9O 3IM1A 2YEVB 3ZDDA 4PDLA 2OCCC 2E8PA 4CDGA 1MSWD 1V54C 4ZH4A 5IDJA 2WAQF 1Y6XA 3ABLC 1QR9A 5LL6Y 1RYSA 2F4VO 3JSNA 2IM9A 4WFHA 3TARA 4EBEA 3AM9A 1A6SA 3LVVA 4DFDA 3P30A 3ZRVA 3BS7A 3WK4A 1URJA 9ICPA 3ETQA 3CCUV 1VQPV 1K7DA 1VIBA 2ZIWA 5KFWA 1IXMA 2GTSA 1NI8A 3Q8QB 3MHHC 4JYBA 3QU7A 1SIJA 2YB1A 1TVKA 1V54B 3TANA 2Y69C 1P49A 3V72A 1L7MA 2BDUA 4ECZA 2L35A 2F1JA 3KZIZ 3QF7A 2Q0AA 3NASA 4X20A 4N23A 3H4DA 3CS5A 4ZHQA 1NKDA 2JH7A 3KBBA 2KKWA 1DGJA 2H3ZA 3WG7C 4DR6B 2WTFA 7ICJA 3UT5B 2LW1A 1ZQTA 4X1IB 2YMMA 3JD3A 3JASB 2XAHA 2ZIOA 2OCEA 1M57B 8ICKA 5EOZA 5B3SB 3HRDD 3GVMA 4D7SA 1WN7A 3JALA 3JPQA 4HNAB 1JUDA 4O3OA 3OGUA 1XNRO 1N5XA 2I5HA 4R66A 2P22C 5F9LA 5IJ9B 2QKQA 2KHQA 4EB6A 1JX4A 2NYVA 4DR6O 4HAIA 3KTQA 4M04A 4CS4A 3V6KA 1BQZA 4CF5A 4JUZA 3ABMC 3GB7C 1VQLV 3ETRA 3F7VC 2IOHA 1XMOB 4LF7B 4GKKO 7ICOA 2FI1A 2DF4B 4MF2A 5GTIU 3CE2A 3T2MA 4TV9B 1HNZO 1US6A 4EFEA 4X64B 5LHHA 5J0RA 2LM1A 2LPEA 5AI4A 5AK5A 1TE2A 3MR2A 1UA0A 3ZMTA 1YI2V 3R65A 3H9VA 4EKWA 1M1KW 3L4PA 4GFJA 4KLGA 3G80A 1AP6A 3UQ2A 1AJPA 2VQFB 1VLBA 3HJEA 3I55V 1LB2B 2HBKA 5LMNO 3NVWA 3JPPA 1JPXA 2LI6A 5K4LA 3UQ0A 4YJ2A 1C7YA 2FDRA 4BWMA 2DN9A 2OCCB 4RT2A 4FLWA 1YEWA 3JATB 2WLMA 1RYRA 1RSOB 2YB4A 4NTYA 3TXSA 8ICYA 8ICZA 1MABG 1OV9A 3FYHA 2P06A 3HPLC 4NLGA 5ALMA 1Q86W 3G6VA 4LF4O 2W04A 4F5OA 3VQWA 4AILC 5J8YC 1L3UA 3Q4HA 4YR0A 2P7TC 1TFRA 3MBYA 1JRPA 2W9AA 4XA5A 2PI4A 3RFAA 2QWNB 3I56V 4OCZA 9ICVA 2CK3G 2KG7B 2Q7EA 4Z1VA 3RYCB 4X65O 2F8KA 5J2CA 2B5UA 3J7AU 4UVAA 4KLDA 3HX0A 1XNSA 4B3SO 3H1JH 3SPJA 5G5GA 5HR6A 4DV0B 2UXCO 4FFBA 1OCOC 2X6BA 1ZUQA 5IIMA 1TAUA 4KITB 4O4LA 1XU4A 3SPGA 5EE1A 1KBHA 1AI5A 1P7GA 3L72H 1Q5OA 4DQPA 4UCSA 4DR7B 3LDAA 1HNXB 3QU2A 5DLFA 2E75B 1KEJA 3JALB 1PVRA 3TADA 8ICNA 1X6JA 2GUZB 1KFTA 3IRUA 4FMTA 2UXDB 5JH7A 2BPGA 1JR9A 3GZFA 1B43A 3AG1C 3T3FA 3OUSA 3UXNA 1Q81W 2UXXA 5HMLA 2ITDC 5LOVA 2UXBB 2QB0B 4NXMB 5AK3A 4IYIA 2YXLA 1K8AW 5CEHA 5L3CA 4F4ZA 3JATA 4PDMA 2XVTA 3FDSA 3MFHA 2ZCEA 4JV5B 2OIEA 2HKOA 4DXWA 1RQLA 2R8JA 5EE0A 3MGVA 3WKDA 4CE6A 1WJZA 1X9XA 4DO2A 2F1HA 1KD1W 2XI9A 1EN5A 1L0LH 1M93A 4DWIA 4CGZA 1BMFG 4DUYO 1KW4A 4UBCA 2YI8A 3AG1B 3MABA 3SENA 4F4LA 2P4KA 3T5HA 2MSNA 2NRTA 2YY6A 1H2NA 4YIPA 5AKZA 4FLYA 2IJJA 2WF5A 2DL0A 1X66A 2E1FA 3RF9A 2IHNA 1TUBB 2WA4A 2YIDA 2UVVA 4ED2A 1HNWO 2CAZC 4E2LA 2G09A 4Z6EA 2IU3A 2E1EA 1FFVA 4I9QA 3B9JA 3SD7A 3C5GA 3M1YA 4MFFA 2Y0SF 2G38A 5ALDA 4ED0A 1M9NA 3K5MA 4DR2B 4TWKA 4XRHA 3RB0A 3ABLB 4IS7A 4C8NA 4QZGA 3O9OA 3RBDA 4UB6U 4P0QA 5ALOA 2QKAA 2E8MA 3K1ZA 2Q4TA 1NVPD 2IJHA 1HEKA 4KLOA 2R8IA 5J2BA 3SR2C 5FLXN 2K4PA 4RQ7A 2D6FC 4Z6FA 3CMEV 4G28B 3SYZA 1H2GA 2ZUDA 4IRKA 4Q8FA 2ODMA 1AR1B 2EIKC 2WB1C 1Y4MA 3ZEDA 4RQ5A 1GO3F 4ELVA 3TACB 1GH6A 1NTKH 1QLEB 1UHUA 4UAUA 2W9BA 2JEGA 2KMDA 1JQ0A 4U3JB 9ICEA 3GV5B 1U96A 5KUMA 5KFTA 1ZQCA 4R64A 1GKFA 3RH6A 1WP8A 4HZ3A 1G4YB 2EZYA 4X89A 5KFEA 3C23A 3JAMN 4C4SA 1YITV 2HR3A 2Y48A 1GN3A 2JXJA 2F3NA 1JROA 2E8OA 2JS3A 2MW2B 2GDSA 1KN5A 2YN4A 2XHBA 5CP2A 9ICOA 1ZQSA 2YSUB 2YTUA 1Q3UA 1SRYA 4ECRA 2LBOA 4US9A 8ICFA 4B9MA 4DS5A 2W0FC 1P84F 5KHIA 3G6EV 1QNMA 2GO7A 3RJGA 3F5TA 2DKXA 7ICHA 1Q3VA 5EK0A 1K92A 4Q45A 4UW9A 2PFPA 2YUAA 3B09A 4XDJA 3BRCA 1WWUA 5ALRA 4DSKA 2WF6A 4EBDA 5CWRA 1QCEA 4J80A 5LYJA 4EX6A 4RUAA 3NR7A 3UCSC 3LNNA 2M6YA 4YY3O 4MVMA 1VQNV 4ECVA 2VANA 1BQ0A 4AQYB 4RQMA 2BSKA 2EIMC 2K4HA 3FAHA 4GLXA 1Q82W 4QZDA 4LF5O 2JEFA 1NTZH 1ZLZA 2IBKA 9ICIA 1FAFA 2FJ6A 4DSEA 5JU5A 5ALYA 4I2EA 2WA3A 3ZHVA 5ALNA 4I4TA 4I4TB 1TV9A 5EE3A 2OYYA 3AEVA 2PFOA 4RUCA 3LDCA 4DV7O 2V7QG 4PDRA 3RYHA 2P35A 4ED7A 2ETNA 4X88A 2ZDIC 2F66C 1S8OA 3TJTA 2PMZF 4ICGA 1FFTB 4I2JA 2Q4PA 4PL1A 1IDSA 2ADPA 4I9WA 2VA8A 4B9SA 4UFZA 1KU9A 3SDLA 3AQFA 3PSIA 3M8AA 4UB2A 1BPEA 2K89A 3G6XA 1U9LA 3C21A 3L71H 4DFKA 3JPNA 3K9SA 4Z6DA 4RNOA 1E1RG 1BNOA 8ICRA 3ZMZA 4K4HA 3JPSA 2AJQA 2C2EA 2EX3A 2P6UA 1NJWA 3AG7A 3L9DA 2XGQA 4M9LA 1ZD5A 2DMXA 4EB6B 4BAYA 1PK3A 3BQ0A 4QGPA 1Z3EB 3DSQA 3ZD8A 2ZJAA 2W9CA 2OTJV 5DB7A 2ZUCA 1SQBH 5AIAA 3ED5A 5AM5A 1S5LZ 3PO4A 5J2GA 1SZXA 5KL8B 2KVSA 1VQOV 2ODGA 5AKEA 2WWWA 1BVSA 1N60A 4PHEA 2HVIA 2K9PA 5L3FA 4DK0A 1X2IA 5DB6A 1QVFU 2OYQA 5KMGA 5JQGB 1IXBA 3H1HH 5C8YA 3LVWA 3L75H 4EELA 4LZDA 4ECYA 3RYFA 4Z1MG 3GIJA 4D6TH 3H01A 2WLJA 4NTXA 4F4YA 2G06A 3OFNG 4L87A 5ALSA 2M9NA 2GV9A 1Q8IA 2X7RB 5DECA 5LP6C 5H6QA 3E58A 5L1JA 3OMAB 1IG6A 3OD4A 5EBMC 1S0NA 4YP3A 1OCRC 2ILMA 4R50A 5K1XA 3CXHF 4M9GA 4O4LB 1ZYQA 4WFFA 4BIOA 1GN2A 2ZE6A 3BEHA 3OJSA 5KA5A 3HILA 4GX2A 3K59A 5J2TB 2AZ2A 4QNLA 3M99B 2BDPA 4QZAA 4CBCA 1LKYA 2HMXA 1SZPA 4FO6A 2F93B 2KSDA 2QKSA 3ZCCA 4KLTA 3GFKB 3WK8A 4B3MO 3J81j 4AQYO 5LGNA 1T4GA 4YXJA 1X9WA 3NGDA 2BCCH 4I50B 4FK5C 3UXOA 1CRXA 2Y0IA 3HKBA 4ECWA 5CBHA 4JI1O 5LP6A 1VQ9V 3GWOA 4FE3A 5AKYA 3K04A 8ICBA 1SF9A 1H8EG 4UAWA 2FB5A 1P4RA 4FBUA 5F2VO 7ICFA 5KT6A 2MK3A 3G67A 3BZCA 4I2AA 1FS0G 2B0CA 4PGXA 2QEXV 2HHVA 2CTRA 2QDOA 4ZI7B 3GV7B 3F2BA 1NK7A 2EZOA 2AGQA 3E22B 1QBZA 3K9AA 1PUZA 5HFMA 2LKYA 3MC1A 4CF3A 2VIXA 4JV2A 3N2GB 3ZMSA 4E4EA 1YZ7A 7ICLA 4JTDB 4X8AA 2JR5A 3PW0A 1NTMH 4Y2QA 3IP4B 1O9HA 1RSOA 5J0XA 4JWMA 1JJOA 1L8DA 2DKZA 4XQ8A 3ZMUA 1R73A 3UQ8A 2HOQA 1B06A 3JD4A 3X2QC 5LGUA 4F2RA 4NXMO 1KSPA 5HNKA 4ECQA 1ZQQA 2DWEC 4IRCA 2KFZA 2HBJA 2V9WA 4UB5A 4MHVA 4DV2B 2AU0A 1PVQA 4QIWC 4IQVA 2QSAA 1XO0A 2A3VA 4FLUA 5IIIA 1XUQA 4LCUC 3A0HZ 3Q4HB 3ABTA 4DR4O 1SESA 1N33B 4GXIA 4DR7O 4HBNA 4UB1A 3CCMV 5KFNA 4O5EA 1SQXH 1H8HG 4J9SA 3H4BA 5DGAA 1NVPB 1N63A 4MVSA 1W2BU 1YXBA 1P7BA 2HBLA 5AKKA 4NV0A 4F4KA 5J0YA 4F5NA 3SV3A 2A1AA 4DR5B 3FD9A 1QH9A 2E76B 3WB1A 4TUYB 1LR1A 5HR7A 1SA0B 2WLKA 4UVBA 4DR2O 3N27A 2EIMB 1Z1VA 3APOA 4M6WA 1SWVA 3L74H 3PVXA 3N28A 4YJ2B 3QUQA 2MRLA 1HNWB 4DFMA 4KN4A 2JJ1G 4TQRA 2DQNB 3N7PD 7ICMA 4TQSA 3OE7G 1QLNA 3B40A 5LA6A 4PJ0Z 1KFSA 1XMQO 1CI4A 4GCZA 3C2MA 4J10A 4PJ0U 3UT5A 4F4XA 4O3NA 3RVYA 4BIZA 4FS1A 2KIVA 5K1PA 5KAIU 3N4MB 4AYBC 2WLLB 4C7ZA 1I08A 3ASNB 4FJCC 5GONB 5BR8B 1KQSU 2PUSA 4TOIA 4QZCA 4LWSB 5A2QN 2DFLA 3ETGA 2YIBD 2W7PA 5LMNB 4JI0B 1IX9A 4EX7A 5AKJA 3CCRV 1AR4A 2KVCA 2BPFA 3E2EA 3DC5A 4LNUA 4LNUB 3BQ7A 5C5JA 3UKMA 1AP5A 4PA3A 4Q8EA 5B66U 4O5CA 2CTQA 4DS4A 4ABMA 4IL6U 3QX7A 2ATLA 1WCLA 3CRQA 2IMWP 3MDCA 1V55B 5FL7G 1HNZB 1AI6A 4O4IB 2OHFA 1L7OA 2CGNA 1WP7A 1DK2A 2KSOA 3WKCA 4K8ZA 1YJWV 4TV8A 1R6KA 3QG5A 3RAQA 1KP3A 2C2RA 3ZBHA 3PW4A 3SI8A 1S0VA 2P6RA 1NS1A 3JSLA 2FE9A 3RW0A 5D4BA 3D8CA 8ICSA 1BPXA 1ZQJA 2D2CB 1XNRB 3Q8MA 3A2FA 3K3WA 2UXCB 1Q46A 2D8CA 3ZD9A 4KLLA 1OJHA 1PP9H 9ICCA 4FFKA 1L1FA 4ZHQB 1WA8A 4Q20A 3PZPA 3HKEA 3L3FX 3WFVA 4X65B 2VJ5A 1N48A 2GH1A 2BPCA 3WB0A 3RJHA 1KQQA 1NT2B 4G9BA 3PR5B 2Z3YA 4H0LB 3AN1A 2F77X 3RH5A 2AHYA 2LHTA 1H38A 4HNAA 1YJNV 1F4NA 4Y2UA 4BUGA 1NK4A 2ZIVA 1E79G 1RPOA 2VRZA 3K4GA 4N21A 1OHHG 4NY8A 2ZIUB 5KL1B 3RYCA 7ICVA 1YIJV 4EEQA 4NLCA 1WWVA 3JAKB 2FMPA 1G6UA 3I28A 3IJ4A 4BJQA 2JDIG 3KHRA 4B9VA 2KJ8A 5CBFA 5HP4A 2Z5UA 3V7LA 1NH2B 1I0HA 1XC9A 3B2EE 2PXIA 2VQFO 4TV9A 5AI9A 4NYKA 2JGUA 4FIPC 4M9NA 1S5JA 3H0RB 2ITCC 1ZD3A 4LBEC 4CH3A 3G4SV 1TVKB 1A76A 3CP8A 2KD1A 1J97A 4I2GA 5A0LA 2LJ2A 1R1BA 5L3GA 5DB9A 1FFXB 1C20A 4F6RB 4F6RA 4KX3A 4J9RA 2ALZA 5B1AC 1Z4NA 5KFGA 3V6HA 1ZQIA 4F5QA 2UU9B 4GKKB 4O2AB 3C2KA 5ALFA 1G8MA 1BHAA 5KAFU 4NKGB 3GILA 5CJ7A 4ZOLB 5CA1B 4B9NA 4WJ3B 4QWCA 3IAYA 3C28A 5J8YA 4DV1B 1CXZB 1KTQA 4DL4A 2BOBC 1ROPA 1NK0A 3K0GA 1K1QA 2UUAO 1L3SA 1YTFB 2K8CB 4Y2TA 5FPOA 3WU2Z 4DSFA 1KL9A 4RPYA 3QEBZ 1R3IC 4O3PA 3ZHTA 1SL2A 2WFAA 3QXGA 4C0ZA 4GC7A 3BFRA 2JRZA 3BPZA 3JPOA 2W6JG 3WK5A 1D8BA 9ICKA 5L9XA 1V38A 1S0OA 2A06H 1VQ5V 2BGWA 4O3MA 4J9NA 2Q68A 4X1YB 3AG4C 4ZI7A 3HKEB 1T94A 2RDIA 1QU7A 4K3AA 2RLTA 3RGBA 4Y2VA 2R72A 2HVHA 2DYSC 3ALRA 1VF5B 5AKGA 1KMIZ 2QA4V 1O08A 4I28A 3SYCA 1D5AA 1IBMB 3N97B 5BZBA 3RBZA 1M56B 4RPZA 2KG5A 2PGGA 4AHCA 1R6TA 5IYZB 5CA7A 1Y67A 4U7NA 3I76A 1L3VA 4H37A 3LDDA 2KZ3A 2N74A 3PX4A 4JI0O 4ICAA 1JXLA 3GIKA 4NTWA 2HW3A 3E86A 4DQQA 4R7CA 5EWFA 2DYRB 2XOKG 5EC1C 5JJEB 4PV1B 2F4VB 1LKYB 4R6ZA 1K34A 2XICA 2WLIA 5IJ0B 3DXRA 3ETDA 1PL0A 1MQ3A 1XMQB 5H2FU 4P0QB 2V1DA 1MG1A 2H3OA 2Y0PA 1ZQ1C 1SKRA 2I6XA 5KAIZ 1KUQA 1OCZB 4DRXA 5J2UB 3RRHA 3TI0A 1DK1A 1D8LA 5KFAA 5KG5A 5J0TA 4UB8U 2W7OA 4O3SA 5KFOA 2QWRB 3APQA 3BA9A 4RQ6A 4OPAA 4CC6A 3MDAA 2EDUA 5KFSA 3GQCA 3EW9A 5ALZA 2XC9A 4ELUA 1JFFB 3BS5B 1NH2D 1TUBA 4DV6B 1L8OA 4QIWF 2QWQB 1QQ6A 1DF4A 4YHHB 2Y1JA 4LF9B 1F7YA 4JYYA 1MA1A 4EEYA 2MA1A 2EJRA 1YHQV 1GN4A 1WNSA 4YD1A 3F53A 5DDYA 9ICUA 2IHMA 1N33O 4DR4B 4UV8A 5ALHA 1VF6C 1IBLB 5IT9N 1NJYA 3QVNA 2FMLA 2BQRA 3IHQB 4EBCA 4QPKA 4DL2A 5CB1A 5LBQA 4PD4F 2LYAA 4CNQA 5DB8A 1TK5A 2ADQB 3NVVA 5J2TA 4X66O 7ICQA 1ZD4A 3C1ZA 4H13B 1DXSA 1COOA 3ZX6A 4K0KB 1SL0A 1NQTA 5AK6A 4ED8A 4KLUA 2JS5A 3K0DA 1PPJH 2WAQC 1XWLA 5KFXA 3QU9A 3AU6A 3ISCA 1PNLA 5H9CA 3H0MB 3PNCA 5BMVB 4DRXB 1XQ8A 2JVDA 3ABKC 1MA7A 2A3QA 2Q67A 3HKDA 4TT3G 2VA3A 2AHZA 1FXKB 3QEAZ 1N56A 1MC8A 1B0XA 5CA3A 4OJPA 3O65A 3WG7B 3SYPA 4RQ8A 4FZMA 3N7SC 5B1NA 5KFZA 2ASLA 5KFCA 3STLC 2IJIA 3FFQA 2Q5ZA 3LSSA 3A0BZ 5ALLA 2MUTA 9ICAA 3A0BU 2EZXA 5DGBA 3PSPA 4P4PA 1UPGA 5IY5B 1UJWB 1EN4A 2UUBB 1VQMV 1M5IA 9ICMA 4G27B 4C8LA 4DOCA 3E8BA 1ZQZA 1FXKC 2PYJA 5IILA 4JV1A 4B3MB 2CPRA 5IWAB 1JI7A 3SJQC 3IN5A 3F7YC 4IQWA 2Q6AA 1SV0A 4ZKIA 5CBGA 1XHZA 2ZINA 4U3JA 5J2EA 1NK6A 1FPOA 5F9NA 4I2CA 1PK1B 1FFUA 1PK1A 1OCRB 2WHEA 4FZ0A 2DYRC 3E8FA 3TAPA 3RB6A 5KHJA 2H5XA 4NLBA 2HLDG 4D7TA 4E0DA 1N2XA 1U47A 3K03A 3EUB2 4MEYA 1ZQXA 4JK1A 2LM4A 4M9HA 3C90A 4O4JA 4O4JB 5DN6G 5J0QA 1LUWA 2NN4A 3LUTB 3SGIA 3BJYA 1D8YA 1E1QG 2VJ4A 4W4KA 1V85A 4LF6O 4PA7A 4J9MA 3WU2U 1PM9A 4IQUA 1QSSA 4DEZA 1N34O 3C29A 1P7DA 1K5OA 3MAQA 4MS2A 3HP6A 2BQ3A 3CC7V 4LF8B 2QARB 3O0FA 1HR0B 2Y0SC 8ICMA 4O4HA 4F4WA 1SL1A 2W6IG 5EBWC 2NRWA 3ETLA 3C3TA 3ZRWA 4BDPA 1JA8A 3LNMB 4X9QA 2YDEA 1S77D 4DR3B 4RUEA 1W0JG 2WLHA 4DLGA 4F8RA 2K8BB 2K4IA 1WCNA 5E79Z 3B77A 1BZKA 1FXVA 3K79A 2JEIA 2GWSA 3AK2A 4UV9A 2RMKB 3LK9A 1ZETA 3ABUA 4QWEA 2AXTZ 1DGSA 2HVKC 3OPXA 1I5YA 3AG3B 2ZTCA 2EANA 1Z1BA 2HOFA 4J7ZA 3H8MA 1ZQEA 4O4IA 1M57C 3C5FA 1ZAUA 3HKBB 1THZA 4B9UA 3RH4A 2QR4A 2YX8A 3ZHQA 1M56C 2RQ6A 4JF3A 1I94O 1PVPA 2Q9LA 4AYBF 2CN1A 3CB2A 2CTWA 1IXRA 2KK0A 2QB1A 3AQEA 4MT8A 4RQ0A 4OJ6A 5KHHA 2AGOA 1J95A 4ACOA 3GWKC 1NK9A 3CC4V 3OEHG 4MFCA 4UCRA 1D9FA 5KUKA 2LQTA 4EYHB 3VOUA 4F2SA 5D49A 2ZXWB 2HDOA 2WSSG 2JEJA 4J9OA 4I2BA 5KT2A 1RXWA 1EFRG 1QHTA 2KZMA 3NRZA 3D3IA 3FYEB 3CC2V 2ATKC 2JGDA 2HFEC 1WUDA 3OR7C 2YEVA 2ES6A 4C4TA 3RWRD 5KTQA 3MR3A 5L1LA 9ICBA 4YY3B 2YS8A 5ALEA 4P0PA 3FYIB 4Y2SA 3ICXA 5ITZA 2MAXA 4J41A 5LMUO 1N5WA 2JEXA 5KG7A 1ED1A 2UVWA 1FXKA 4JI3O 2CUGA 5EZYA 4DSLA 2ZNIA 4JI7O 2YQEA 4RUFA 5CHGA 2J6SA 1U45A 4NVPA 4YFKA 1XREA 4B7EA 5AKIA 2AH5A 2QTOA 3RJFA 2A0LA 3RR8A 2HI0A 1RZTA 3MHSC 4JYAO 3BQ2A 4XDLA 5BXZA 2ZIXA 4I2IA 4R8UB 2XAGA 3UO3A 5GW7A 4WBNB 3ETEA 4HYOA 3L5KA 2NNUA 8ICCA 4LFCO 1GTOA 2DGZA 3CRXA 4K8XA 4KLJA 1HP8A 5L3BA 2JJ2G 4X1YA 2KE7A 7ICKA 4EFBA 4Y2XA 3RTVA 3ASOC 1J5EB 1SKSA 2Q7GA 3T1YB 4JPRA 5LYJB 5AI6A 4IR1A 3QUTA 1X4TA 1YZ6A 2HVJC 2EIJC 1Z00A 3OT7A 4GZRB 1I5XA 5ALUA 4DV4B 2ZR3A 4KLHA 2AW9A 4MTGA 1ZQGA 1KC8W 1NOMA 1R3KC 3PJSK 2KTQA 1VQ6V 1RPRA 4UAZA 1ZQFA 3W7UA 3N2KB 3VC8A 4IQTA 3C2LA 3HKCB 1XDCA 4JI2O 2LGQA 5KG1A 1ZQNA 4LWSA 1D5NA 2D3OW 2FLLA 1CEZA 2KG7A 1Y76A 3SAGA 3PSFA 3H7IA 1OCZC 3BQ1A 3A8TA 8ICHA 2HBMA 2NLJC 1SGGA 2Q7HA 5J2UA 3AG3C 4QZ8A 1F0MA 4TUPA 5CA0A 1COWG 4MTOA 2Y9TA 9ICQA 5E79U 4PA4A 4RQFA 3W7WA 4F3OA 4M0AA 2RNBA 2ISPA 2JGAA 4PHDA 5ALJA 3CX5F 2Y4TA 2LMRA 1AB3A 1MZEA 5AI5A 3SR6A 3M7DA 4UQGA 3DTUB 4FFBB 2YMLA 1N32O 1VARA 3KCYA 4YMMA 1NI3A 4YMNA 1PNKA 3T1HB 1JFFA 1VF6A 2ARHA 2XAQA 5IYZA 5KFMA 4IL6Z 4JYCA 1Y74A 2XIDA 3NRWA 2VA2A 2FL4A 5JVDB 1N61A 3IC9A 4DV3O 4C80A 1BT8A 3OTOO 4J7JA 2P90A 2DUYA 2CRXA 2A7WA 3T1CA 3K5NA 2OXOA 3TFRA 9ICJA 3JAWA 4GC6A 5G5HA 3L73H 4JAVA 5HHIA 1BGXT 1VQ7V 1N8RW 2XCPA 4JV5O 3J80N 4YCXA 3G6BA 5BMVA 1YT3A 2HHHO 1OXJA 4BGDA 3VBBA 3LSQA 2E5LO 3B0XA 3GDXA 4MW3A 9ICSA 1KKDA 5LGTA 2FMSA 2BCVA 5L3EA 2OWOA 3N7RC 1M4UA 2HJDA 3D2NA 1MNGA 2EBOA 1FJGB 3PY8A 2DJVA 5C8YB 1K3EA 1NKCA 2I1QA 3K1RB 1Q7YW 4J9PA 2BCRA 1OUQA 7ICEA 1OCCC 1S5HC 3M9MB 3SJCC 2E3CA 2KHVA 3CSXA 4EYIB 5JCOA 4F5PA 3CWBH 2E3TA 4NXNO 3M6KA 1EZJA 4DSJA 3AUOA 4DQRA 4ECUA 2YMQA 5TISU 2PMZC 5KNIA 2FLPA 2KEYA 4C8MA 2K8AA 3S6JA 1IVSA 1GN6A 4B3TB 1WPXA 4DLEA 3K06A 3V7JA 1QQ5A 5DQGA 4B3SB 3LYSA 1O03A 4ZOHC 1H2MA 1X6IA 2IH3C 2YC0A 3K58A 1N0JA 1XNQO 4O4HB 2EAPA 8ICIA 2CTPA 4JI4O 2A19A 3JCZA 1S72V 1A0PA 1EXNA 1PL4A 1K4CC 4I29A 3MDSA 4MVQA 5BY1A 3H0LB 1QQCA 2Y4UA 1S97A 2W8LA 4J9YB 2W54A 5J0WA 3IC7A 4YMOA 1SETA 2ZKOA 4JI5O 4X1IA 2BTQB 4QE7A 3TXQA 1RM1C 3WKBA 3OMIB 4QZFA 5AIBA 1XSPA 1QSLA 4LH7A 4GKJO 2V4DA 1SXEA 3D2SA 2ZM6O 4KL1A 1SQQH 2QWPB 5FNVB 2EILC 2Z7JA 3F2CA 2IH1C 3SPIA 3KOOA 3T5LA 3S3WA 1SC5B 4C7YA 3Q8LA 4NLNA 2G5HB 4B3RO 3E35A 3OTOB 4DSIA 3RB3A 2P6JA 4JV0A 1BGYH 1VJ5A 5LXTB 3MFIA 4F71A 4X64O 1PNMA 4J9KA 4C7UA 1NK5A 2W8KA 2QTSA 2PZSA 5KFIA 3VQYA 2IOFA 5IIOA 4R8UA 2LP7A 1XMOO 4LF7O 1RQNA 3H8SA 3THVA 1U4BA 1TVAA 1MQ2A 5JH7B 2WLLA 4R63A 3PSTA 5J2FA 1Q6UA 4J9ZB 2ZG6A 4UUJC 2DBYA 1UA1A 1VQ4V 1FD9A 2D3DA 1H2SB 3WK7A 2W03A 3I5DA 4WFBV 3ASOB 1NZBA 1RYUA 3IFXA 4QZBA 3CRMA 1IV8A 3QUCA 4LR3A 1F5SA 2OH2A 3CRAA 3FB6C 4PHZA 3T4DA 1M90W 4LFBO 2RP5A 3JD0A 5JJNB 1Q90D 2FLNA 1SV4A 4KUMA 4NR1A 4I0XB 3CP1A 1AI7A 2B9ZA 1VQKV 2BHNA 2HHWA 3UMGA 1NKBA 1NBMG 4DF4A 2JHDA 3E83A 1ZQAA 4ED6A 1YF2A 4X62O 4QNHB 2ZTDA 4LFAB 1CPYA 2JIZG 3AG4B 2BOCC 3PMNA 4DUZB 5EWEA 3SMVA 4LJXA 3IG8A 4RT3A 4F92B 2ZDIA 5IJ9A 2YXYA 4FLTA 2F23A 3JCUZ 2M0NA 4PELA 4KFMA 1JX9A 1ZRNA 4P9OA 5BOMA 4ECTA 3TGUH 3IDWA 3CEIA 1L5UA 1EN6A 2A1JA 1NNLA 5B1OA 5LA6B 3CHXA 1DK3A 2UXNA 1LUVA 1TA8A 2R18A 3PO5A 7ICTA 1TAMA 4LFCB 1HDJA 4K4IA 2B1GA 4M47A 3FB8C 5CR0A 2B21A 5J0UA 5CMUA 3EXAA 5L1KA 5AM4A 2DOSA 1JJ2U 4CZZA 3QYPA 5KX5B 1Z5WA 1COKA 7ICRA 2ASDA 2Q0OC 2H94A 4KP4A 8ICEA 1UQVA 1WA8B 5F3XB 4OX9B 1YJ9V 5AM3A 4OPHA 2IJKA 3D2QA 1X42A 1BNPA 2CH7B 3HB3B 4FS2A 2OEHA 5J0OA 1UT8A 2E74B 4UB3A 1XHXA 3GU3A 5KFRA 1IBKB 4KLSA 1IURA 3HWTA 2XT9A 3KG2A 1ZQUA 3CNHA 8ICLA 4IT5A 1L7PA 5KFPA 4M9JA 5IINA 4CH5A 1AI4A 3OMNB 1QTMA 1BS3A 5KFLA 4GXJA 5J2HA 1UPHA 1V97A 3RJJA 2IOFK 2RDCA 1RM6C 2XGPA 2Y69B 2KJ9A 3SPHA 2A1JB 3CYOA 3I1YA 1Q3EA 3ZS8C 1NR1A 4JZ2A 3TQ1A 2UUCO 4KLQA 4KLMA 1VEWA 1UCVA 2H3VA 9ICWA 4DF8A 1I94B 4CH4A 5D46A 2HCFA 3PR4A 1W0KG 4DL5A 4Z2WA 4UATA 1G1XB 3PW5A 4YD2A 2ZUBA 4TQFA 2W3RA 1OZ0A 2GUZA 4ECXA 3JD2A 2W43A 2KB1A 4C8KA 4RWUA 2A79B 3Q8PB 1NU1H 4DV5O 4EEKA 4YJ3A 5B3SC 3NVYA 4PGYA 2ASJA 5KFHA 7ICGA 3OJUA 2BZFA 3VCBA 3M9OB 3ZRWB 2L5YA 5H5NA 8ICJA 4OJOA 3WKAA 2W9MA 4PHPA 4X1KB 3RJEA 4GXKA 3DXRB 4TUSA 1V9PA 5EYPA 5CN0A 3B8NA 2PYLA 2KV2A 1JXEA 5JQGA 3RYIB 2LW7A 8ICOA 3C3SA 4DR3O 3SAHA 3T5KA 3JYCA 4P4MA 4K35A 3U26A 1DRGA 1WAZA 3FKSG 4KXRA 4QPJA 5E1AC 3KZXA 9ICGA 2NRXA 3SEIA 4MTXA 2BKEA 1HR0O 5J2IA 4QZEA 3KD3A 4JI8O 1N34B 2R8KA 2LGWA 4NXZA 4J42A 1ZQKA 3K57A 1XI1A 3KKYA 2QGNA 4JTCB 1ZL8B 2HEPA 3RFRA 4RAIA 2PKEA 4MVZA 2HP8A 5KG3A 4P9PA 2F43G 4PPXA 3OM3B 4HYKA 3EZ5A 3AK3A 5EBLC 9ICXA 1KYOF 2ZXWC 3PN1A 3SYOA 3RB4A 4O9MA 3JAWB 4YQWA 2ZXHA 4B9TA 2Q8VA 4WFEA 5CB4A 4F50A 1Y66A 3A0RA 5IYDO 4I50A 3KHLA 2PF4E 4YG2A 1S9FA 1XL4A 3JARA 2G0AA 2VS0A 4X1KA 2OT5A 5C0YA 3BCCH 5IWAO 5DLGA 1L0NH 4JI8B 5J29A 3ZIAG 1KKCA 1RG6A 4JI6B 3RYIA 4Y2YA 3PX6A 3LWLA 8ICQA 4QZHA 4O2BA 4KHPB 1B04A 5GTHZ 2B1IA 5KFUA 5L3DA 3SYAA 1NJXA 4DFJA 4RNMA 4PA6A 2GHYA 1TK0A 3EFFK 4Y2PA 2ISOA 1QLEC 2XCAA 2QKCA 1X9MA 2HHQA 3QO8A 7ICNA 1H2LA 4H33A 4OGQB 4NL9A 2DPIA 5KLVH 1O9GA 5HMMA 5DDMA 2KNJA 1HJPA 3M6ZA 4QZIA 3BABA 1Q8KA 3SV4A 3LSUA 4XUSA 3RJKA 2DQ0A 2RHFA 3SAFA 4BR6A 4YR2A 2BCQA 5ALGA 4O5KA 3CRRA 3EYZA 2FYUH 1JOYA 3AU2A 2ZQMA 4LVSA 4KHPO 3OR6C 4I55B 3AG2B 2EZZA 3C1YA 3TK1A 5KA6A 2BTQA 2BCUA 3DC6A 1WG8A 1SKWA 3P32A 1ZJNA 2JZBA 3A0HU 3BZKA 2Y1IA 1QQ7A 1EBOA 3M9NB 4J03A 3QE9Y 1L3TA 5JJJB 3DDHA 1DF5A 1U49A 2F76X 4U7OA 2CGOA 1ZD2P 4X66B 1N36B 4GX0A 4PA9A 2UUCB 4JB3A 3UXPA 4FZLA 3H1IH 4BWAA 1EZVH 2RN9A 4DR1O 1K9MW 1LV5A 2XY6A 4MVOA 2RDJA 1QCKA 5KHKA 2O6KA 3OTQA 4B08A 1TAQA 3HT3A 3WK9A 4O2BB 4CC5A 5AHXA 3GV8B 2FKXA 2WPDG 4PL2A 4ZIBA 1AILA 1SS3A 4LF9O 1BE3H 3V7KA 4FPPA 2W55A 5KFQA 2E8NA 5AM0A 4M2YA 4UARA 4LZGA 1GAXA 3PMLA 1SQVH 4I0XA 2A9HA 3B4SA 5DEDA 4RQEA 7ICSA 2RRDA 2EQYA 1V55C 5EC2C 2PFQA 1SQGA 8ICTA 4NLKA 1A32A 4OX9O 3GIMA 1K5QA 1FFXA 2F8LA 5KHGA 2R70A 1ORQC 2YXHA 1PV0A 3OHAA 4I7ZB 1DLBA 3KKAC 3E22A 2C2DA 4ED1A 2XY5A 5AM1A 1B3QA 3VQVA 5HHHA 1S0MA 4JAAA 3W7TA 2MU2A 2K4EA 2HHTA 1NR7A 4CF4A 2KQXA 1QVGU 4X5VA 1MSDA 3F2DA 5AG2A 1KP2A 2EINC 2QARA 3FC4A 7ICIA 1EM1A 3EVKA 2YICA 4DYLA 3NS1A 3MGIA 3F5WC 1KECA 3AK1A 4DOAA 2ZJ5A 4NL9C 4TURA 8ICAA 3TFSA 5DBAA 3EPGA 2LFRA 5J0PA 1TKDA 2HSZA 3F5AA 1ZTEA 1GK9A 1AVMA 3OGCC 3BY6A 4DUZO 9ICNA 3AMZA 5H2FZ 1J2MA 1XEQA 4LFAO 2J6UA 1D2DA 1Z5VA 5GTHU 8ICWA 1BSMA 3IG5A 2BCSA 8ICXA 1XL6A 4DO9A 1IM4A 5AKXA 5ALWA 8ICUA 4JTAB 2V4RA 2BE3A 3TADC 5FP0A 1K33A 4ZOLA 5CA1A 2RJZA 4K4GA 3JPRA 4RQ2A 3T4ZA 1ZQWA 1DTOA 3CD6V 4O2AA 3QZ7A 3ISDA 5DG7A 3FAVA 4ASUG 2UUAB 2ZXIA 3N2KA 3H8JA 4RQ1A 2KN7A 4QWDA 4IRDA 1S76D 3QTCA 1ZX3A 4DV1O 4OD0A 2EAMA 2WF9A 5J0SA 8ICPA 3RAXA 1AQ6A 2WLNA 4GIBA 2GSMB 4KLIA 1H2KA 5J2KA 3UPQA 3ZHUA 3M7MX 2F95B 3EPIA 4F91B 2KKVA 5CA0B 2X6AA 1F23A 4YJ3B 5B1BB 1L7NA 4W4LA 4KTQA 9ICTA 3JARB 1W59A 1ZSPA 1ZQOA 2F2AB 4FFDA 3STZC 4TV8B 4MEXA 3LDEA 3NUQA 4B3RB 3OAAG 4FZNA 3SPCA 2LYHA 2VKQA 5KX5A 1SZTA 2HOIA 1M6YA 1S10A 4QWBA 2VWKA 1AROP 1F51A 1ZQBA 3ZI4A 3UM9A 4DL3A 7ICPA 2ZM6B 1K1SA 2Z0AA 4B7KA 4GX1A 4GKJB 1VQ8V 3SJAC 1KB9F 1FIQA 2EAOA 3OSNA 2UVUA 5KAFZ 9ICLA 5EZYB 5KFDA 3MGHA 2KZZA 3K75D 4Z6CA 1XSLA 3W7XA 2JEUA 1WPBA 2WF7A 4OJLA 3BQTA 4PH5A 4BXOA 4A8EA 1R6NA 5EWGA 3P3PA 2Q73A 3ZDCA 3R9KA 4U3FH 4NM2A 5KFKA 2KFNA 3TAQA 2AQ4A 2Q69A 2IU0A 5D5PA 3KFUF 4JASA 4X62B 5KT3A 5KG0A 1NZPA 4R65A 1YVWA 3CCVV 4UASA 4JI4B 4RQNA 1OCOB 1WB7A 4JMUA 3ZN0A 4I27A 4FBTA 3B0YA 2ZT9B 2YMPA 4IYHA 2VQEO 2E5SA 5EYPB 4LFBB 5DQHA 9ICFA 1FXHA 4P30A 3WKEA 4JWNA 1T5EA 4KLFA 1BHBA 3RVZA 4NXNB 2JRIA 2GBOA 5LP6B 5DG9A 2F1IA 1J2NA 3ZHSA 1XILA 1JIHA 1ZQHA 2ZNJA 1VF7A 1PD3A 3CCLV 1ZQVA 3NVZA 4YXWG 1GMGA 1FJGO 3D3QA 1TK8A 3ABMB 3D6JA 3PV8A 1LNQA 1YCIA 3HKCA 3VQXA 3CCJV 4YVZA 5EE9A 4MW8A 5BPCA 2GOLA 4G3IA 5B1AB 3QU5A 1SKVA 4F5RA 3KCXA 5JCOC 1ECWA 3JPTA 3J81N 3N2GA 5IJ0A 2WLIB 3NTUA 2NRVA 1RP3B 1WYGA 1ZQDA 4US8A 1T7PA 3QO5A 4MFAA 4UB6Z 4GT1A 4DQIA 3FB7C 4I2HA 3CW2C 3BA8A 3EWAA 3CRCA 1VMGA 2L6LA 3DGEA 1BL8A 4DV3B 2GTAA 5BR8O 4UB8Z 4NLZA 2DWQA 2W0XA 2KP7A 4JI5B 4MF8A 2KOBA 2NO5A 3PW2A 2FMQA 4A5UB 1URFA 3PW7A 3FM9A 2BSKB 3T1HO 3BS5A 8ICGA 1HUZA 1MOFA 4P2ZA 5KFBA 3G6YA 1I7FA 3UMCA 3RR7A 2QJ1A 1Q6IA 1XNQB 1T3QA 5B66Z 2P4VA 1MN8A 2LO1A 2DW4A 3ASNC 4ELTA 4NM1A 1OCCB 1T8EA 5H6RA 1JN3A 2EINB 5ALKA 2IA6A 2X0LA 2YIAA 4Q43A 4DR5O 2W3SA 1B4FA 4B3TO 1RDFA 4DCCA 3D36C 2JH1A 1N4CA 2VQEB 5IYBO 2ZE5A 1L8LA 4NJ8A 2FPKA 4YIOA 1VP7A 3TETA 3KHGA 4R8CA 5ALTA 3MD0A 2FTKA 3CCSV 4JI2B 4EZ6A 2OCHA 2R9IA 2CE4A 3ABKB 1K73W 2N1RA 5ALXA 4DFPA 1NJZA 3H1KH 2QLTA 1GM7A 4Y2JA 2R9AA 1ZQMA 2AGPA 1QR8A 5AI0A 2C2AA 2ZIMA 2K60A 3HKZF 4BIUA 8ICVA 4ED3A
chains in the Genus database with same CATH topology
3OUSA 1T94A 1ENVA 1Q81W 2UXXA 2M0NA 4PELA 2ITDC 4KFMA 2DYSC 3CXCU 4CRXA 1JX9A 3ALRA 1K8AW 4P9OA 4QJFB 5J9PC 5L3CA 2QA4V 4PDMA 2XVTA 3SYCA 5IY5C 3ZJZA 5BZBA 2HKOA 1M56B 5B1OA 3RBZA 4DXWA 4U7NA 3MGVA 2UXNA 4H37A 3LDDA 1KD1W 4DO2A 2R18A 2XI9A 4ICAA 1TAMA 2B1GA 3E86A 3FB8C 4R7CA 2DYRB 2XOKG 4WFGA 5EC1C 4CGZA 1BMFG 5CMUA 1YSCA 3QO7A 4R6ZA 1K34A 2XICA 3AG1B 2WLIA 4F4LA 3ETDA 1JJ2U 1PL0A 4CZZA 2IJJA 1ZWIC 4P0QB 2V1DA 1MG1A 2WAMA 2E1FA 1ZQ1C 3RF9A 2H94A 4KP4A 4MTFA 1OCZB 4OXSA 4E2LA 2G09A 4U7CA 2W7OA 2IU3A 2E1EA 1YJ9V 2IJKA 3D2QA 1WLEA 3OW2U 3HB3B 2Y0SF 3DEEA 1M9NA 4TWKA 3ABLB 3IGAC 3ONNA 3GU3A 1PKXA 1R3LC 1NH2D 1Z19A 4P0QA 4QIWF 3K08A 3K1ZA 1DF4A 3KG2A 1NJIW 2Q4TA 1NVPD 2IJHA 1HEKA 2LYBA 2MA1A 2EJRA 3NXSA 2D6FC 4P0PB 2EIKB 3CMEV 1K4DC 1AI4A 4NWIA 2X6CA 2M7WA 3OMNB 4G28B 2DQ3A 3ZRSA 3F53A 1JCHA 1H2GA 1YHQV 1UPHA 1AJNA 4UV8A 1AR1B 2QM8A 2EIKC 2WB1C 1Y4MA 1GO3F 2Y69B 2KJ9A 4QPKA 3SPHA 2XAFA 3CYOA 5LBQA 1QLEB 2LYAA 1JQ0A 1NR1A 5HFLA 2R9RB 3CPWU 4MVUA 5KUMA 2H3VA 3OUFA 1GKFA 1HWYA 4HZ3A 1G4YB 4G2KA 2XAJA 4X89A 4ZBMA 2KJ5A 1W0KG 1YITV 2HR3A 1NQTA 2HG5C 2Y48A 3K0DA 1OZ0A 2WAQC 3JD2A 2KB1A 1PNLA 5DM6V 2A79B 5H9CA 3H0MB 2NV3A 3W7SA 3EHBB 5B3SC 2YSUB 2KIWA 3ABKC 1Q3UA 3VCBA 1MA7A 1SRYA 2Q67A 2LBOA 4TT3G 3UM7A 2AHZA 3ZRWB 1FXKB 2W0FC 2XNDG 4OJOA 1JVMA 4BX9C 5CA3A 4OJPA 3WG7B 4I5SA 3SYPA 4FZMA 5CN0A 3N7SC 3B8NA 5B1NA 2KV2A 3G6EV 4MSWC 3STLC 1Q3VA 5EK0A 2IJIA 1SZHA 1K92A 4XDJA 4XBFA 5LHIA 1KBUA 3LSSA 2H8PC 3SAHA 2G5IB 3JYCA 1QCEA 2QM7A 1DRGA 3TCUA 3PSPA 3FKSG 4QPJA 4UVCA 5E1AC 5IY5B 1UJWB 3KZXA 1R3JC 4UXNA 1VQMV 4MTXA 4WF9V 4MVMA 1VQNV 4G27B 2DYSB 4TSFG 3E8BA 1FXKC 2EIMC 2K4HA 2CPRA 1Q82W 3SJQC 3IN5A 3F7YC 2ZIXB 2Q6AA 5CBGA 4ZKIA 4KMOB 4JTCB 4RAIA 1OCRB 4MVZA 4WCEV 4P9PA 1F44A 2DYRC 2F43G 2OYYA 3E8FA 3OM3B 3LDCA 5EBLC 2V7QG 4PDRA 4NLBA 2HLDG 4X88A 3SQIA 2OM6A 2ZDIC 2ZXWC 3SYOA 3K03A 2ZXHA 4WFEA 2PMZF 1FFTB 3AEIA 1Y66A 4PL1A 3A0RA 2G08A 4LC1A 5IYDO 1K5SA 5DN6G 2JK5C 4I9WA 4MVRA 3T79A 1XL4A 3LUTB 2G0AA 1GM8A 3AQFA 2VJ4A 1E1QG 3B8MA 3QNEA 3PSIA 4PA7A 2OT5A 5C0YA 4LP8A 2K89A 3C29A 2ZIVB 1P7DA 3ZIAG 1E1RG 1TUEB 4MS2A 3ZMZA 3CC7V 2B1IA 3O0FA 5L3DA 2Y0SC 2LFSA 3SYAA 4PA6A 3OEEG 2GHYA 4RO2A 3EFFK 4BAYA 2W6IG 5EBWC 3ZRWA 2QE7G 1QLEC 4KX5A 3F5EA 4JAUA 3QO8A 3LNMB 4H33A 2EIJB 1S77D 2OTJV 4RUEA 1W0JG 2WLHA 2KNJA 3M6ZA 2K8BB 2K4IA 3B77A 2DQ0A 2ZR2A 1FXVA 2RHFA 3K79A 3CCQV 3SAFA 4UV9A 4PDVA 5KL8B 1VQOV 3ABUA 3E8GA 2WB1F 2WWWA 1JOYA 3AL0B 2ZQMA 5L3FA 2HVKC 1I5YA 2KKPA 3OPXA 1GM9A 3AG2B 3AG3B 3OR6C 3X2QB 1QVFU 1Z1BA 3CMAV 2HOFA 3TK1A 3LVWA 5T14A 2XASA 5KA6A 1M57C 4BW5A 1YTFD 4Z1MG 1THZA 4GX5A 1IIPA 3P32A 3H01A 2WLJA 2YX8A 1M56C 1EBOA 4OJ5A 2G06A 1DF5A 4JF3A 2F76X 1PVPA 3OFNG 4U7OA 4AYBF 4L87A 4GX0A 2CN1A 4PA9A 2X7RB 4QE9A 4FZLA 3AQEA 4MT8A 5H6QA 3SYQA 4OJ6A 3OMAB 2OTLV 1J95A 1K9MW 4ACOA 5EBMC 3CC4V 3OEHG 1OCRC 4MVOA 4R50A 5KUKA 4WFFA 3VOUA 4WFAV 3CYMA 3BEHA 2EILB 2WPDG 4XDKA 5KA5A 2ZXWB 4GX2A 4PL2A 4QNLA 2K1EA 2WSSG 3M99B 1EFRG 3FYEB 3D3IA 3CC2V 4CBCA 2G07A 2HMXA 2QKSA 3HKZC 2ATKC 3ZCCA 4FPPA 2HFEC 1WUDA 2H3QA 3OR7C 5IYCO 2YEVA 5LGNA 1L6NA 2H3IA 1K97A 4FK5C 1CRXA 4P0PA 2A9HA 4IC9A 3FYIB 3ICXA 5CBHA 4RQEA 1YJWV 2RRDA 2JEXA 1VQ9V 1ED1A 1V55C 3GWOA 4FE3A 3K04A 1FXKA 5EC2C 1K5QA 5CRXA 1H8EG 2ZD9A 2H3FA 3E0FA 1P4RA 2F8LA 4RUFA 2MK3A 3E8HA 1CP9A 1ORQC 2QEXV 1FS0G 1AJQA 5LHGA 2QTOA 1DLBA 2A0LA 3F2BA 2P67A 1S3JA 3FB5C 3MHSC 2EZOA 4XDLA 2ZIXA 1QBZA 2XAGA 3W7TA 2EZPA 3K9AA 2JMGA 5GW7A 2LKYA 3ETEA 2K4EA 5HFMA 4U6PA 4HYOA 2NNUA 4JGSA 1NR7A 1GTOA 2VIXA 2DGZA 3CCEV 1QVGU 3CRXA 3ZMSA 4JTDB 2KICA 4X8AA 2DWDC 3IP4B 2JJ2G 5L3BA 3F2DA 3ASOC 1KP2A 2EINC 5C93A 3ZMUA 4JPRA 1R73A 3ZN1A 2HOQA 3AG2C 3JD4A 3X2QC 5LGUA 3F5WC 2PI5A 1KECA 2HVJC 2EIJC 2DWEC 1I5XA 2HBJA 2ZR3A 2LFRA 4MTGA 1PVQA 3F5AA 4QIWC 1GK9A 1KC8W 1XO0A 2A3VA 1R3KC 3PJSK 1SERA 3OGCC 2ZIWB 1F4MA 3BY6A 4HAMA 3ZRXA 4LCUC 1VQ6V 1RPRA 3W7UA 3ABTA 1SESA 3VC8A 3JD1A 1HIWA 3IG5A 1XL6A 2ZIUA 3CCMV 3G71V 4JTAB 2D3OW 3E89A 1CEZA 1K33A 1H8HG 1B6QA 3SAGA 3PSFA 1OCZC 4MVSA 1W2BU 1NVPB 3T4ZA 1RM1B 1DTOA 2HBLA 1P7BA 2HJFC 4NV0A 3ZMVA 3CD6V 2HBMA 2NLJC 2IW5A 3AG3C 4ASUG 2ZXIA 1COWG 4MTOA 1S76D 5HR7A 3ML0A 4PA4A 4RQFA 2WLKA 4UVBA 4OO1J 3W7WA 2EIMB 2JGAA 3D36A 4WFBV 3M7DA 2WLNA 5B1BC 2MRLA 2GSMB 3DTUB 2KKVA 2YEVB 2JJ1G 1PNKA 2X6AA 4PDLA 1F23A 2DQNB 3N7PD 2OCCC 4CDGA 1V54C 2XAQA 3OE7G 5B1BB 1QLNA 5IDJA 1MSWD 4GCZA 2WAQF 3RVYA 4JYCA 4BIZA 3ABLC 2F2AB 1QR9A 2XIDA 3NRWA 4AYBC 2WLLB 3ASNB 3STZC 4FJCC 1KQSU 3LDEA 4WFHA 3NUQA 3OAAG 2P90A 1A6SA 2CRXA 4FZNA 3ETGA 3T1CA 2W7PA 2OXOA 3LVVA 3P30A 4JAVA 3SPCA 3ZRVA 2VKQA 1URJA 1VQ7V 3CCUV 1N8RW 1SZTA 1K7DA 3CCRV 1VQPV 2HOIA 2ZIWA 1IXMA 1AROP 2KVCA 1F51A 3E2EA 1YT3A 3MHHC 4JYBA 3VBBA 3LSQA 2YB1A 3UKMA 4GX1A 4MW3A 4PA3A 1V54B 1VQ8V 1KKDA 5LGTA 5L3EA 2Y69C 3N7RC 2BDUA 3D2NA 4N23A 1V55B 5FL7G 3W7XA 2EBOA 1AI6A 2JEUA 4OJLA 1R6NA 4A8EA 1K3EA 1NKDA 2JH7A 1Q7YW 1OCCC 1OUQA 1S5HC 1R6KA 2H3ZA 2Q69A 3KFUF 4JASA 2IU0A 1KP3A 2KHVA 3WG7C 3CCVV 1S0VA 1OCOB 3JD3A 4JMUA 3ZN0A 3RW0A 3M6KA 2XAHA 1EZJA 1M57B 5B3SB 2PMZC 3K3WA 2KEYA 2K8AA 1L1FA 2E5SA 1WPXA 3K06A 4Q20A 1FXHA 3LYSA 3PZPA 4P30A 3L3FX 2IH3C 3WFVA 3RVZA 1BHBA 2VJ5A 2KHQA 2GH1A 1S72V 3JCZA 1A0PA 1K4CC 2Z3YA 3ABMC 4MVQA 1PD3A 2AHYA 2F77X 3H0LB 3F7VC 2LHTA 3GB7C 3CCLV 1VQLV 1F4NA 1YJNV 1H38A 4J9YB 4BUGA 4YXWG 2ZIVA 2DF4B 1E79G 1GMGA 3IC7A 1RPOA 1SETA 3ABMB 3T2MA 4N21A 1LNQA 1OHHG 2ZIUB 5KL1B 4QE7A 3CCJV 1RM1C 3OMIB 5LHHA 4NLCA 1YIJV 4MW8A 3ZMTA 2GOLA 5B1AB 1YI2V 3R65A 4BJQA 2JDIG 4EKWA 3D2SA 1M1KW 1ECWA 2KJ8A 5CBFA 4GFJA 2EILC 2WLIB 2Z7JA 3F2CA 2Z5UA 1NH2B 2IH1C 3QO5A 3SPIA 1AJPA 4GT1A 3FB7C 3I55V 4FIPC 2HBKA 3H0RB 2ITCC 1JPXA 4LBEC 2G5HB 3E35A 3G4SV 3DGEA 1BL8A 2P6JA 3CP8A 2KD1A 5A0LA 2OCCB 5L3GA 1PNMA 2WLMA 2KOBA 2YB4A 4KX3A 5B1AC 1MABG 3HPLC 1MOFA 4P2ZA 1Q86W 2W04A 2LP7A 1G8MA 2P7TC 1BHAA 2WLLA 2PI4A 3PSTA 3RFAA 4J9ZB 3I56V 2ZG6A 4UUJC 1VQ4V 2CK3G 4WJ3B 2B5UA 2DW4A 2W03A 3C28A 1OCCB 3ASNC 1XNSA 3ASOB 4UVAA 1NZBA 2EINB 3IFXA 2X0LA 5H6RA 2BOBC 3SPJA 1ROPA 5HR6A 3K0GA 2OH2A 3FB6C 1M90W 3T4DA 2JH1A 2RP5A 1OCOC 3JD0A 5IYBO 1YTFB 2K8CB 2X6BA 4KUMA 3TETA 1R3IC 3CP1A 3SPGA 1AI7A 4C0ZA 1VQKV 1AI5A 4R8CA 1NBMG 3MD0A 2FTKA 3CCSV 2JHDA 2W6JG 3E83A 1D8BA 2R9IA 3ABKB 4QNHB 1K73W 2N1RA 1CPYA 2JIZG 3AG4B 2BOCC 1GM7A 1PVRA 4FMTA 3SMVA 1QR8A 3IG8A 1VQ5V 2C2AA 4O3MA 2Q68A 3GZFA 2ZDIA 3HKZF 4BIUA 3AG1C 3AG4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SAG A;  2E1F A;  2HBK A;  2CPR A;  2RRD A;  2RHF A;  2HBL A;  3SAF A;  2HBM A;  2E1E A;  5C0Y A;  4QJF B;  1GO3 F;  2HBJ A;  3CYM A;  2KV2 A;  4OO1 J;  4NLC A;  3SAH A;  1YT3 A;  4NLB A;  1D8B A;  4QIW F;  4CGZ A;  1WUD A;  2DGZ A;  2MA1 A;  4O3M A;  4CDG A; 
#chains in the Genus database with same CATH topology
 1ENV A;  2HHX A;  4DV2 O;  3OGI B;  4LH6 A;  2FPM A;  5IIJ A;  1SB3 C;  4TUQ A;  3CXC U;  4DV4 O;  4CRX A;  5DBC A;  5AKL A;  4UBB A;  2F44 A;  2E5L B;  4QJF B;  5J9P C;  2HHH B;  2R8G A;  3T1Y O;  5LXT A;  5IY5 C;  3R66 A;  3H40 A;  3ZJZ A;  5DKW A;  5ALP A;  4UB4 A;  4USA A;  1BPD A;  5KG2 A;  1JMS A;  4H44 B;  1ZQR A;  2YIB A;  2N04 A;  3GII A;  4QZ9 A;  4UCT A;  1X40 A;  1DOQ A;  4WFG A;  1YSC A;  3QO7 A;  4NB5 A;  2RQ5 A;  2QWO B;  5ALV A;  2ZTE A;  1TGO A;  4F6E A;  2JV3 A;  3KHH A;  3ZDB A;  3ZHR A;  5KMG B;  4JYA B;  4KLE A;  4X20 B;  4ECS A;  1ZWI C;  1Q6H A;  2WAM A;  4F72 A;  4MTF A;  1N32 B;  4OXS A;  4EEN A;  2QM4 A;  4O3Q A;  4PHA A;  4U7C A;  1MMM A;  3FX7 A;  4JI3 B;  5BOL A;  1WLE A;  4JI1 B;  5LMU B;  5KG6 A;  3OW2 U;  4J11 A;  3DEE A;  2BR0 A;  3JAS A;  4DL7 A;  4GUN A;  3IGA C;  1KFD A;  4RNN A;  3ONN A;  1BPZ A;  1PKX A;  1R3L C;  1Z19 A;  4C8O A;  2ZE7 A;  3K08 A;  1NJI W;  4B6J A;  2KSO B;  2LYB A;  3NXS A;  1ZXI A;  4P0P B;  2EIK B;  1K4D C;  4NWI A;  2X6C A;  2M7W A;  3ZRS A;  5IIK A;  1HUO A;  1JCH A;  2DQ3 A;  3HKD B;  3HR0 A;  1AJN A;  2QM8 A;  7ICU A;  2JGD B;  3QZ8 A;  3SZ2 A;  5KT7 A;  4PI2 A;  2XAF A;  2V4Q A;  5HFL A;  3CPW U;  2R9R B;  4MVU A;  5JTI A;  2R8H A;  1Q43 A;  1SA0 A;  3RRG A;  3BAA A;  1RFY A;  3BVO A;  1BPB A;  2QB0 A;  1HWY A;  1WB8 A;  3JAK A;  3OUF A;  4G2K A;  3IV6 A;  2XAJ A;  4ZBM A;  2KJ5 A;  4UCO A;  5DBB A;  5LOV B;  4WBN A;  2WF8 A;  3KKA A;  3SJB C;  4UCV A;  3QUB A;  4RU9 A;  2HG5 C;  1FEZ A;  5KFF A;  1J5E O;  2BQU A;  1ZQY A;  1VDV A;  5DM6 V;  2VWJ A;  2NV3 A;  3WK6 A;  4UAY A;  3W7S A;  1ZL8 A;  3EHB B;  2KIW A;  2B6G A;  1SWW A;  5DG8 A;  3UM7 A;  5KG4 A;  1KLN A;  2XND G;  1JVM A;  4FM0 A;  4BX9 C;  2FPL A;  4I5S A;  1RXV A;  5ALQ A;  3OHB A;  4MSW C;  1SZH A;  3OSP A;  4XBF A;  5LHI A;  3ORY A;  4KMU A;  1KBU A;  2H8P C;  4JI7 B;  5B5E U;  2G5I B;  5JRT A;  4DQS A;  4DW0 A;  3FAV B;  1NK8 A;  2QM7 A;  5KT5 A;  2OIG A;  2MUT B;  4UVC A;  3TCU A;  1LVH A;  1R3J C;  3OTF A;  4UXN A;  2CH7 A;  1CUK A;  4WF9 V;  4LF8 O;  2DYS B;  4FVM A;  4TSF G;  4CCH A;  4RZR A;  5L1M A;  2ZIX B;  3ZDE A;  2AGA A;  5ALI A;  4DK1 A;  3H8W A;  2Q0Z X;  2RCV A;  4KMO B;  4IR9 A;  3L70 H;  3Q8K A;  5J2A A;  4WCE V;  1F44 A;  1TAE A;  1QSY A;  1FKA O;  1XBL A;  2YI9 A;  3BDP A;  1KDH A;  2PFN A;  5EIB D;  3SQI A;  2OM6 A;  1ZQP A;  2NR5 A;  4CH6 A;  1U48 A;  4DR1 B;  5D5Q A;  4DV7 B;  4F93 B;  4Q44 A;  3AEI A;  3CJH B;  4LC1 A;  4Q6G A;  2G08 A;  5FPR A;  1K5S A;  2HHS A;  4PI0 A;  1N36 O;  1Z2G A;  2JK5 C;  4MVR A;  3T79 A;  1Y74 B;  4CS3 A;  1IBM O;  5J2J A;  2GLE A;  4C4R A;  1ZQL A;  1KRP A;  5KT4 A;  3U11 A;  1GM8 A;  3QNE A;  3B8M A;  1AR5 A;  2O57 A;  2IBZ H;  1OW5 A;  4LP8 A;  4TQD A;  3RYH B;  5JUM A;  4LF5 B;  2AZ0 A;  2ZIV B;  5TIS Z;  3WB2 A;  4IIJ B;  1TUE B;  4YR3 A;  3RT3 C;  2PY5 A;  4RPX A;  2XTA A;  2XY7 A;  2LFS A;  4RO2 A;  3OEE G;  4AP9 A;  1FO4 A;  4EZ9 A;  2QE7 G;  4KX5 A;  3F5E A;  2F1M A;  4JAU A;  4IGG A;  4CS2 A;  9ICR A;  2EIJ B;  4YN4 A;  4UCU A;  4O0I A;  2AHO B;  4IHJ A;  4YXM A;  3P3N A;  1RPL A;  2JZB B;  2XUM A;  2N05 A;  2ZR2 A;  3CCQ V;  4J9Q A;  3TKA A;  4PDV A;  4RQ3 A;  3RJI A;  2CXY A;  4QWA A;  3M8R A;  1ZJM A;  4P2H A;  5J2D A;  3E8G A;  2WB1 F;  3AL0 B;  1U97 A;  2KKP A;  1GM9 A;  4KN7 A;  1T3N A;  2DE0 X;  3S3X A;  3X2Q B;  3CMA V;  2P5O A;  4JI6 O;  4QW8 A;  2W9C B;  5T14 A;  2XAS A;  4BXO B;  4BW5 A;  5KFY A;  1YTF D;  4GX5 A;  5AIC A;  1IIP A;  2NO4 A;  4LF6 B;  4K0K O;  4TUY A;  5KFJ A;  4OJ5 A;  1Y88 A;  1Z4O A;  4FLV A;  1SV0 C;  1MZF A;  4DOB A;  9ICH A;  4QE9 A;  2EJ7 A;  1SXD A;  3SYQ A;  3V6J A;  2OTL V;  5AI8 A;  4P4O A;  3DV9 A;  1IBL O;  5A9G A;  5KFV A;  3UMB A;  3RYF B;  3RN4 A;  2NRZ A;  3ZDA A;  3H1L H;  3MR5 A;  4WFA V;  3CYM A;  1JAL A;  2EIL B;  4PZO A;  1XS9 D;  4L8J A;  4XDK A;  5JWP A;  2C22 A;  2CDY A;  2K1E A;  5GON A;  5AKH A;  3KZI U;  2AXT U;  2G07 A;  4YHH O;  3HKZ C;  1BCC H;  4AI8 A;  4J7K A;  3HW8 A;  2H3Q A;  4DV6 O;  5IYC O;  1N0N A;  1L6N A;  4BWJ A;  4IHJ B;  2H3I A;  1K97 A;  2Y9U A;  3CJH A;  4JZG A;  4IC9 A;  5EIB C;  3MR6 A;  2UUB O;  4M6W B;  5DQI A;  3Q8S B;  3M8S A;  1FYJ A;  5CRX A;  1B22 A;  2ZD9 A;  1X59 A;  1NZ6 A;  2H3F A;  3E0F A;  4FLX A;  5GTI Z;  3E8H A;  1CP9 A;  5AK4 A;  1UT5 A;  1AJQ A;  4O3R A;  5LHG A;  1S5L U;  4J9L A;  1HW7 A;  4IIJ A;  4FM2 A;  2P67 A;  1S3J A;  3FB5 C;  2BTO A;  4I2D A;  2HHU A;  4QW9 A;  1XSN A;  2EZP A;  4DUY B;  2JMG A;  4UAV A;  3U10 A;  4FLZ A;  4U6P A;  2ZJ8 A;  4B9L A;  5IE9 A;  4JGS A;  3CCE V;  3U0Z A;  2UVR A;  5FNV A;  2KIC A;  2J6T A;  4I2F A;  1SQF A;  2DWD C;  4DV5 B;  2P66 A;  2W9B B;  1YDX A;  2C28 A;  3QU4 A;  2AQ0 A;  2PTM A;  1X9S A;  5C93 A;  5ITZ B;  1NKE A;  5CB4 B;  3THO A;  3ZN1 A;  3AG2 C;  2PI5 A;  2EUL A;  4DW1 A;  1YZB A;  4DL6 A;  2UXB O;  4PZN A;  1Z00 B;  3K5L A;  3QNM A;  3BHP A;  1PZN A;  5B5E Z;  3UO2 A;  2ESE A;  1JMK C;  1SER A;  2XO7 A;  2ZIW B;  4RQ4 A;  1F4M A;  4HAM A;  3ZRX A;  2UXD O;  1BPY A;  3ISB A;  1XOU A;  3JD1 A;  4Y2R A;  1HIW A;  1IZ3 A;  1HNX O;  2ZIU A;  5TZV A;  3RBE A;  3Q8R B;  3G71 V;  2DPJ A;  1ZOL A;  3E89 A;  4GYC B;  1B6Q A;  3K5O A;  1SQP H;  5JVD A;  1Y76 B;  5AM2 A;  1N62 A;  1RM1 B;  3LWM A;  2EH9 A;  2HJF C;  3ZMV A;  2W11 A;  2IW5 A;  4PGQ A;  1IBK O;  4DV0 O;  1ZRM A;  1UFI A;  4FM1 A;  3ML0 A;  4FZ1 A;  4BW9 A;  4OO1 J;  1KKX A;  3HPO A;  3T5J A;  3D36 A;  1GRJ A;  1A77 A;  2I9G A;  3PX0 A;  2ZE8 A;  5L1I A;  1XO1 A;  5B1B C;  4I55 A;  4LF4 B;  1D9D A;  2UU9 O;  3IM1 A;  2YEV B;  3ZDD A;  4PDL A;  2OCC C;  2E8P A;  4CDG A;  1MSW D;  1V54 C;  4ZH4 A;  5IDJ A;  2WAQ F;  1Y6X A;  3ABL C;  1QR9 A;  5LL6 Y;  1RYS A;  2F4V O;  3JSN A;  2IM9 A;  4WFH A;  3TAR A;  4EBE A;  3AM9 A;  1A6S A;  3LVV A;  4DFD A;  3P30 A;  3ZRV A;  3BS7 A;  3WK4 A;  1URJ A;  9ICP A;  3ETQ A;  3CCU V;  1VQP V;  1K7D A;  1VIB A;  2ZIW A;  5KFW A;  1IXM A;  2GTS A;  1NI8 A;  3Q8Q B;  3MHH C;  4JYB A;  3QU7 A;  1SIJ A;  2YB1 A;  1TVK A;  1V54 B;  3TAN A;  2Y69 C;  1P49 A;  3V72 A;  1L7M A;  2BDU A;  4ECZ A;  2L35 A;  2F1J A;  3KZI Z;  3QF7 A;  2Q0A A;  3NAS A;  4X20 A;  4N23 A;  3H4D A;  3CS5 A;  4ZHQ A;  1NKD A;  2JH7 A;  3KBB A;  2KKW A;  1DGJ A;  2H3Z A;  3WG7 C;  4DR6 B;  2WTF A;  7ICJ A;  3UT5 B;  2LW1 A;  1ZQT A;  4X1I B;  2YMM A;  3JD3 A;  3JAS B;  2XAH A;  2ZIO A;  2OCE A;  1M57 B;  8ICK A;  5EOZ A;  5B3S B;  3HRD D;  3GVM A;  4D7S A;  1WN7 A;  3JAL A;  3JPQ A;  4HNA B;  1JUD A;  4O3O A;  3OGU A;  1XNR O;  1N5X A;  2I5H A;  4R66 A;  2P22 C;  5F9L A;  5IJ9 B;  2QKQ A;  2KHQ A;  4EB6 A;  1JX4 A;  2NYV A;  4DR6 O;  4HAI A;  3KTQ A;  4M04 A;  4CS4 A;  3V6K A;  1BQZ A;  4CF5 A;  4JUZ A;  3ABM C;  3GB7 C;  1VQL V;  3ETR A;  3F7V C;  2IOH A;  1XMO B;  4LF7 B;  4GKK O;  7ICO A;  2FI1 A;  2DF4 B;  4MF2 A;  5GTI U;  3CE2 A;  3T2M A;  4TV9 B;  1HNZ O;  1US6 A;  4EFE A;  4X64 B;  5LHH A;  5J0R A;  2LM1 A;  2LPE A;  5AI4 A;  5AK5 A;  1TE2 A;  3MR2 A;  1UA0 A;  3ZMT A;  1YI2 V;  3R65 A;  3H9V A;  4EKW A;  1M1K W;  3L4P A;  4GFJ A;  4KLG A;  3G80 A;  1AP6 A;  3UQ2 A;  1AJP A;  2VQF B;  1VLB A;  3HJE A;  3I55 V;  1LB2 B;  2HBK A;  5LMN O;  3NVW A;  3JPP A;  1JPX A;  2LI6 A;  5K4L A;  3UQ0 A;  4YJ2 A;  1C7Y A;  2FDR A;  4BWM A;  2DN9 A;  2OCC B;  4RT2 A;  4FLW A;  1YEW A;  3JAT B;  2WLM A;  1RYR A;  1RSO B;  2YB4 A;  4NTY A;  3TXS A;  8ICY A;  8ICZ A;  1MAB G;  1OV9 A;  3FYH A;  2P06 A;  3HPL C;  4NLG A;  5ALM A;  1Q86 W;  3G6V A;  4LF4 O;  2W04 A;  4F5O A;  3VQW A;  4AIL C;  5J8Y C;  1L3U A;  3Q4H A;  4YR0 A;  2P7T C;  1TFR A;  3MBY A;  1JRP A;  2W9A A;  4XA5 A;  2PI4 A;  3RFA A;  2QWN B;  3I56 V;  4OCZ A;  9ICV A;  2CK3 G;  2KG7 B;  2Q7E A;  4Z1V A;  3RYC B;  4X65 O;  2F8K A;  5J2C A;  2B5U A;  3J7A U;  4UVA A;  4KLD A;  3HX0 A;  1XNS A;  4B3S O;  3H1J H;  3SPJ A;  5G5G A;  5HR6 A;  4DV0 B;  2UXC O;  4FFB A;  1OCO C;  2X6B A;  1ZUQ A;  5IIM A;  1TAU A;  4KIT B;  4O4L A;  1XU4 A;  3SPG A;  5EE1 A;  1KBH A;  1AI5 A;  1P7G A;  3L72 H;  1Q5O A;  4DQP A;  4UCS A;  4DR7 B;  3LDA A;  1HNX B;  3QU2 A;  5DLF A;  2E75 B;  1KEJ A;  3JAL B;  1PVR A;  3TAD A;  8ICN A;  1X6J A;  2GUZ B;  1KFT A;  3IRU A;  4FMT A;  2UXD B;  5JH7 A;  2BPG A;  1JR9 A;  3GZF A;  1B43 A;  3AG1 C;  3T3F A;  3OUS A;  3UXN A;  1Q81 W;  2UXX A;  5HML A;  2ITD C;  5LOV A;  2UXB B;  2QB0 B;  4NXM B;  5AK3 A;  4IYI A;  2YXL A;  1K8A W;  5CEH A;  5L3C A;  4F4Z A;  3JAT A;  4PDM A;  2XVT A;  3FDS A;  3MFH A;  2ZCE A;  4JV5 B;  2OIE A;  2HKO A;  4DXW A;  1RQL A;  2R8J A;  5EE0 A;  3MGV A;  3WKD A;  4CE6 A;  1WJZ A;  1X9X A;  4DO2 A;  2F1H A;  1KD1 W;  2XI9 A;  1EN5 A;  1L0L H;  1M93 A;  4DWI A;  4CGZ A;  1BMF G;  4DUY O;  1KW4 A;  4UBC A;  2YI8 A;  3AG1 B;  3MAB A;  3SEN A;  4F4L A;  2P4K A;  3T5H A;  2MSN A;  2NRT A;  2YY6 A;  1H2N A;  4YIP A;  5AKZ A;  4FLY A;  2IJJ A;  2WF5 A;  2DL0 A;  1X66 A;  2E1F A;  3RF9 A;  2IHN A;  1TUB B;  2WA4 A;  2YID A;  2UVV A;  4ED2 A;  1HNW O;  2CAZ C;  4E2L A;  2G09 A;  4Z6E A;  2IU3 A;  2E1E A;  1FFV A;  4I9Q A;  3B9J A;  3SD7 A;  3C5G A;  3M1Y A;  4MFF A;  2Y0S F;  2G38 A;  5ALD A;  4ED0 A;  1M9N A;  3K5M A;  4DR2 B;  4TWK A;  4XRH A;  3RB0 A;  3ABL B;  4IS7 A;  4C8N A;  4QZG A;  3O9O A;  3RBD A;  4UB6 U;  4P0Q A;  5ALO A;  2QKA A;  2E8M A;  3K1Z A;  2Q4T A;  1NVP D;  2IJH A;  1HEK A;  4KLO A;  2R8I A;  5J2B A;  3SR2 C;  5FLX N;  2K4P A;  4RQ7 A;  2D6F C;  4Z6F A;  3CME V;  4G28 B;  3SYZ A;  1H2G A;  2ZUD A;  4IRK A;  4Q8F A;  2ODM A;  1AR1 B;  2EIK C;  2WB1 C;  1Y4M A;  3ZED A;  4RQ5 A;  1GO3 F;  4ELV A;  3TAC B;  1GH6 A;  1NTK H;  1QLE B;  1UHU A;  4UAU A;  2W9B A;  2JEG A;  2KMD A;  1JQ0 A;  4U3J B;  9ICE A;  3GV5 B;  1U96 A;  5KUM A;  5KFT A;  1ZQC A;  4R64 A;  1GKF A;  3RH6 A;  1WP8 A;  4HZ3 A;  1G4Y B;  2EZY A;  4X89 A;  5KFE A;  3C23 A;  3JAM N;  4C4S A;  1YIT V;  2HR3 A;  2Y48 A;  1GN3 A;  2JXJ A;  2F3N A;  1JRO A;  2E8O A;  2JS3 A;  2MW2 B;  2GDS A;  1KN5 A;  2YN4 A;  2XHB A;  5CP2 A;  9ICO A;  1ZQS A;  2YSU B;  2YTU A;  1Q3U A;  1SRY A;  4ECR A;  2LBO A;  4US9 A;  8ICF A;  4B9M A;  4DS5 A;  2W0F C;  1P84 F;  5KHI A;  3G6E V;  1QNM A;  2GO7 A;  3RJG A;  3F5T A;  2DKX A;  7ICH A;  1Q3V A;  5EK0 A;  1K92 A;  4Q45 A;  4UW9 A;  2PFP A;  2YUA A;  3B09 A;  4XDJ A;  3BRC A;  1WWU A;  5ALR A;  4DSK A;  2WF6 A;  4EBD A;  5CWR A;  1QCE A;  4J80 A;  5LYJ A;  4EX6 A;  4RUA A;  3NR7 A;  3UCS C;  3LNN A;  2M6Y A;  4YY3 O;  4MVM A;  1VQN V;  4ECV A;  2VAN A;  1BQ0 A;  4AQY B;  4RQM A;  2BSK A;  2EIM C;  2K4H A;  3FAH A;  4GLX A;  1Q82 W;  4QZD A;  4LF5 O;  2JEF A;  1NTZ H;  1ZLZ A;  2IBK A;  9ICI A;  1FAF A;  2FJ6 A;  4DSE A;  5JU5 A;  5ALY A;  4I2E A;  2WA3 A;  3ZHV A;  5ALN A;  4I4T A;  4I4T B;  1TV9 A;  5EE3 A;  2OYY A;  3AEV A;  2PFO A;  4RUC A;  3LDC A;  4DV7 O;  2V7Q G;  4PDR A;  3RYH A;  2P35 A;  4ED7 A;  2ETN A;  4X88 A;  2ZDI C;  2F66 C;  1S8O A;  3TJT A;  2PMZ F;  4ICG A;  1FFT B;  4I2J A;  2Q4P A;  4PL1 A;  1IDS A;  2ADP A;  4I9W A;  2VA8 A;  4B9S A;  4UFZ A;  1KU9 A;  3SDL A;  3AQF A;  3PSI A;  3M8A A;  4UB2 A;  1BPE A;  2K89 A;  3G6X A;  1U9L A;  3C21 A;  3L71 H;  4DFK A;  3JPN A;  3K9S A;  4Z6D A;  4RNO A;  1E1R G;  1BNO A;  8ICR A;  3ZMZ A;  4K4H A;  3JPS A;  2AJQ A;  2C2E A;  2EX3 A;  2P6U A;  1NJW A;  3AG7 A;  3L9D A;  2XGQ A;  4M9L A;  1ZD5 A;  2DMX A;  4EB6 B;  4BAY A;  1PK3 A;  3BQ0 A;  4QGP A;  1Z3E B;  3DSQ A;  3ZD8 A;  2ZJA A;  2W9C A;  2OTJ V;  5DB7 A;  2ZUC A;  1SQB H;  5AIA A;  3ED5 A;  5AM5 A;  1S5L Z;  3PO4 A;  5J2G A;  1SZX A;  5KL8 B;  2KVS A;  1VQO V;  2ODG A;  5AKE A;  2WWW A;  1BVS A;  1N60 A;  4PHE A;  2HVI A;  2K9P A;  5L3F A;  4DK0 A;  1X2I A;  5DB6 A;  1QVF U;  2OYQ A;  5KMG A;  5JQG B;  1IXB A;  3H1H H;  5C8Y A;  3LVW A;  3L75 H;  4EEL A;  4LZD A;  4ECY A;  3RYF A;  4Z1M G;  3GIJ A;  4D6T H;  3H01 A;  2WLJ A;  4NTX A;  4F4Y A;  2G06 A;  3OFN G;  4L87 A;  5ALS A;  2M9N A;  2GV9 A;  1Q8I A;  2X7R B;  5DEC A;  5LP6 C;  5H6Q A;  3E58 A;  5L1J A;  3OMA B;  1IG6 A;  3OD4 A;  5EBM C;  1S0N A;  4YP3 A;  1OCR C;  2ILM A;  4R50 A;  5K1X A;  3CXH F;  4M9G A;  4O4L B;  1ZYQ A;  4WFF A;  4BIO A;  1GN2 A;  2ZE6 A;  3BEH A;  3OJS A;  5KA5 A;  3HIL A;  4GX2 A;  3K59 A;  5J2T B;  2AZ2 A;  4QNL A;  3M99 B;  2BDP A;  4QZA A;  4CBC A;  1LKY A;  2HMX A;  1SZP A;  4FO6 A;  2F93 B;  2KSD A;  2QKS A;  3ZCC A;  4KLT A;  3GFK B;  3WK8 A;  4B3M O;  3J81 j;  4AQY O;  5LGN A;  1T4G A;  4YXJ A;  1X9W A;  3NGD A;  2BCC H;  4I50 B;  4FK5 C;  3UXO A;  1CRX A;  2Y0I A;  3HKB A;  4ECW A;  5CBH A;  4JI1 O;  5LP6 A;  1VQ9 V;  3GWO A;  4FE3 A;  5AKY A;  3K04 A;  8ICB A;  1SF9 A;  1H8E G;  4UAW A;  2FB5 A;  1P4R A;  4FBU A;  5F2V O;  7ICF A;  5KT6 A;  2MK3 A;  3G67 A;  3BZC A;  4I2A A;  1FS0 G;  2B0C A;  4PGX A;  2QEX V;  2HHV A;  2CTR A;  2QDO A;  4ZI7 B;  3GV7 B;  3F2B A;  1NK7 A;  2EZO A;  2AGQ A;  3E22 B;  1QBZ A;  3K9A A;  1PUZ A;  5HFM A;  2LKY A;  3MC1 A;  4CF3 A;  2VIX A;  4JV2 A;  3N2G B;  3ZMS A;  4E4E A;  1YZ7 A;  7ICL A;  4JTD B;  4X8A A;  2JR5 A;  3PW0 A;  1NTM H;  4Y2Q A;  3IP4 B;  1O9H A;  1RSO A;  5J0X A;  4JWM A;  1JJO A;  1L8D A;  2DKZ A;  4XQ8 A;  3ZMU A;  1R73 A;  3UQ8 A;  2HOQ A;  1B06 A;  3JD4 A;  3X2Q C;  5LGU A;  4F2R A;  4NXM O;  1KSP A;  5HNK A;  4ECQ A;  1ZQQ A;  2DWE C;  4IRC A;  2KFZ A;  2HBJ A;  2V9W A;  4UB5 A;  4MHV A;  4DV2 B;  2AU0 A;  1PVQ A;  4QIW C;  4IQV A;  2QSA A;  1XO0 A;  2A3V A;  4FLU A;  5III A;  1XUQ A;  4LCU C;  3A0H Z;  3Q4H B;  3ABT A;  4DR4 O;  1SES A;  1N33 B;  4GXI A;  4DR7 O;  4HBN A;  4UB1 A;  3CCM V;  5KFN A;  4O5E A;  1SQX H;  1H8H G;  4J9S A;  3H4B A;  5DGA A;  1NVP B;  1N63 A;  4MVS A;  1W2B U;  1YXB A;  1P7B A;  2HBL A;  5AKK A;  4NV0 A;  4F4K A;  5J0Y A;  4F5N A;  3SV3 A;  2A1A A;  4DR5 B;  3FD9 A;  1QH9 A;  2E76 B;  3WB1 A;  4TUY B;  1LR1 A;  5HR7 A;  1SA0 B;  2WLK A;  4UVB A;  4DR2 O;  3N27 A;  2EIM B;  1Z1V A;  3APO A;  4M6W A;  1SWV A;  3L74 H;  3PVX A;  3N28 A;  4YJ2 B;  3QUQ A;  2MRL A;  1HNW B;  4DFM A;  4KN4 A;  2JJ1 G;  4TQR A;  2DQN B;  3N7P D;  7ICM A;  4TQS A;  3OE7 G;  1QLN A;  3B40 A;  5LA6 A;  4PJ0 Z;  1KFS A;  1XMQ O;  1CI4 A;  4GCZ A;  3C2M A;  4J10 A;  4PJ0 U;  3UT5 A;  4F4X A;  4O3N A;  3RVY A;  4BIZ A;  4FS1 A;  2KIV A;  5K1P A;  5KAI U;  3N4M B;  4AYB C;  2WLL B;  4C7Z A;  1I08 A;  3ASN B;  4FJC C;  5GON B;  5BR8 B;  1KQS U;  2PUS A;  4TOI A;  4QZC A;  4LWS B;  5A2Q N;  2DFL A;  3ETG A;  2YIB D;  2W7P A;  5LMN B;  4JI0 B;  1IX9 A;  4EX7 A;  5AKJ A;  3CCR V;  1AR4 A;  2KVC A;  2BPF A;  3E2E A;  3DC5 A;  4LNU A;  4LNU B;  3BQ7 A;  5C5J A;  3UKM A;  1AP5 A;  4PA3 A;  4Q8E A;  5B66 U;  4O5C A;  2CTQ A;  4DS4 A;  4ABM A;  4IL6 U;  3QX7 A;  2ATL A;  1WCL A;  3CRQ A;  2IMW P;  3MDC A;  1V55 B;  5FL7 G;  1HNZ B;  1AI6 A;  4O4I B;  2OHF A;  1L7O A;  2CGN A;  1WP7 A;  1DK2 A;  2KSO A;  3WKC A;  4K8Z A;  1YJW V;  4TV8 A;  1R6K A;  3QG5 A;  3RAQ A;  1KP3 A;  2C2R A;  3ZBH A;  3PW4 A;  3SI8 A;  1S0V A;  2P6R A;  1NS1 A;  3JSL A;  2FE9 A;  3RW0 A;  5D4B A;  3D8C A;  8ICS A;  1BPX A;  1ZQJ A;  2D2C B;  1XNR B;  3Q8M A;  3A2F A;  3K3W A;  2UXC B;  1Q46 A;  2D8C A;  3ZD9 A;  4KLL A;  1OJH A;  1PP9 H;  9ICC A;  4FFK A;  1L1F A;  4ZHQ B;  1WA8 A;  4Q20 A;  3PZP A;  3HKE A;  3L3F X;  3WFV A;  4X65 B;  2VJ5 A;  1N48 A;  2GH1 A;  2BPC A;  3WB0 A;  3RJH A;  1KQQ A;  1NT2 B;  4G9B A;  3PR5 B;  2Z3Y A;  4H0L B;  3AN1 A;  2F77 X;  3RH5 A;  2AHY A;  2LHT A;  1H38 A;  4HNA A;  1YJN V;  1F4N A;  4Y2U A;  4BUG A;  1NK4 A;  2ZIV A;  1E79 G;  1RPO A;  2VRZ A;  3K4G A;  4N21 A;  1OHH G;  4NY8 A;  2ZIU B;  5KL1 B;  3RYC A;  7ICV A;  1YIJ V;  4EEQ A;  4NLC A;  1WWV A;  3JAK B;  2FMP A;  1G6U A;  3I28 A;  3IJ4 A;  4BJQ A;  2JDI G;  3KHR A;  4B9V A;  2KJ8 A;  5CBF A;  5HP4 A;  2Z5U A;  3V7L A;  1NH2 B;  1I0H A;  1XC9 A;  3B2E E;  2PXI A;  2VQF O;  4TV9 A;  5AI9 A;  4NYK A;  2JGU A;  4FIP C;  4M9N A;  1S5J A;  3H0R B;  2ITC C;  1ZD3 A;  4LBE C;  4CH3 A;  3G4S V;  1TVK B;  1A76 A;  3CP8 A;  2KD1 A;  1J97 A;  4I2G A;  5A0L A;  2LJ2 A;  1R1B A;  5L3G A;  5DB9 A;  1FFX B;  1C20 A;  4F6R B;  4F6R A;  4KX3 A;  4J9R A;  2ALZ A;  5B1A C;  1Z4N A;  5KFG A;  3V6H A;  1ZQI A;  4F5Q A;  2UU9 B;  4GKK B;  4O2A B;  3C2K A;  5ALF A;  1G8M A;  1BHA A;  5KAF U;  4NKG B;  3GIL A;  5CJ7 A;  4ZOL B;  5CA1 B;  4B9N A;  4WJ3 B;  4QWC A;  3IAY A;  3C28 A;  5J8Y A;  4DV1 B;  1CXZ B;  1KTQ A;  4DL4 A;  2BOB C;  1ROP A;  1NK0 A;  3K0G A;  1K1Q A;  2UUA O;  1L3S A;  1YTF B;  2K8C B;  4Y2T A;  5FPO A;  3WU2 Z;  4DSF A;  1KL9 A;  4RPY A;  3QEB Z;  1R3I C;  4O3P A;  3ZHT A;  1SL2 A;  2WFA A;  3QXG A;  4C0Z A;  4GC7 A;  3BFR A;  2JRZ A;  3BPZ A;  3JPO A;  2W6J G;  3WK5 A;  1D8B A;  9ICK A;  5L9X A;  1V38 A;  1S0O A;  2A06 H;  1VQ5 V;  2BGW A;  4O3M A;  4J9N A;  2Q68 A;  4X1Y B;  3AG4 C;  4ZI7 A;  3HKE B;  1T94 A;  2RDI A;  1QU7 A;  4K3A A;  2RLT A;  3RGB A;  4Y2V A;  2R72 A;  2HVH A;  2DYS C;  3ALR A;  1VF5 B;  5AKG A;  1KMI Z;  2QA4 V;  1O08 A;  4I28 A;  3SYC A;  1D5A A;  1IBM B;  3N97 B;  5BZB A;  3RBZ A;  1M56 B;  4RPZ A;  2KG5 A;  2PGG A;  4AHC A;  1R6T A;  5IYZ B;  5CA7 A;  1Y67 A;  4U7N A;  3I76 A;  1L3V A;  4H37 A;  3LDD A;  2KZ3 A;  2N74 A;  3PX4 A;  4JI0 O;  4ICA A;  1JXL A;  3GIK A;  4NTW A;  2HW3 A;  3E86 A;  4DQQ A;  4R7C A;  5EWF A;  2DYR B;  2XOK G;  5EC1 C;  5JJE B;  4PV1 B;  2F4V B;  1LKY B;  4R6Z A;  1K34 A;  2XIC A;  2WLI A;  5IJ0 B;  3DXR A;  3ETD A;  1PL0 A;  1MQ3 A;  1XMQ B;  5H2F U;  4P0Q B;  2V1D A;  1MG1 A;  2H3O A;  2Y0P A;  1ZQ1 C;  1SKR A;  2I6X A;  5KAI Z;  1KUQ A;  1OCZ B;  4DRX A;  5J2U B;  3RRH A;  3TI0 A;  1DK1 A;  1D8L A;  5KFA A;  5KG5 A;  5J0T A;  4UB8 U;  2W7O A;  4O3S A;  5KFO A;  2QWR B;  3APQ A;  3BA9 A;  4RQ6 A;  4OPA A;  4CC6 A;  3MDA A;  2EDU A;  5KFS A;  3GQC A;  3EW9 A;  5ALZ A;  2XC9 A;  4ELU A;  1JFF B;  3BS5 B;  1NH2 D;  1TUB A;  4DV6 B;  1L8O A;  4QIW F;  2QWQ B;  1QQ6 A;  1DF4 A;  4YHH B;  2Y1J A;  4LF9 B;  1F7Y A;  4JYY A;  1MA1 A;  4EEY A;  2MA1 A;  2EJR A;  1YHQ V;  1GN4 A;  1WNS A;  4YD1 A;  3F53 A;  5DDY A;  9ICU A;  2IHM A;  1N33 O;  4DR4 B;  4UV8 A;  5ALH A;  1VF6 C;  1IBL B;  5IT9 N;  1NJY A;  3QVN A;  2FML A;  2BQR A;  3IHQ B;  4EBC A;  4QPK A;  4DL2 A;  5CB1 A;  5LBQ A;  4PD4 F;  2LYA A;  4CNQ A;  5DB8 A;  1TK5 A;  2ADQ B;  3NVV A;  5J2T A;  4X66 O;  7ICQ A;  1ZD4 A;  3C1Z A;  4H13 B;  1DXS A;  1COO A;  3ZX6 A;  4K0K B;  1SL0 A;  1NQT A;  5AK6 A;  4ED8 A;  4KLU A;  2JS5 A;  3K0D A;  1PPJ H;  2WAQ C;  1XWL A;  5KFX A;  3QU9 A;  3AU6 A;  3ISC A;  1PNL A;  5H9C A;  3H0M B;  3PNC A;  5BMV B;  4DRX B;  1XQ8 A;  2JVD A;  3ABK C;  1MA7 A;  2A3Q A;  2Q67 A;  3HKD A;  4TT3 G;  2VA3 A;  2AHZ A;  1FXK B;  3QEA Z;  1N56 A;  1MC8 A;  1B0X A;  5CA3 A;  4OJP A;  3O65 A;  3WG7 B;  3SYP A;  4RQ8 A;  4FZM A;  3N7S C;  5B1N A;  5KFZ A;  2ASL A;  5KFC A;  3STL C;  2IJI A;  3FFQ A;  2Q5Z A;  3LSS A;  3A0B Z;  5ALL A;  2MUT A;  9ICA A;  3A0B U;  2EZX A;  5DGB A;  3PSP A;  4P4P A;  1UPG A;  5IY5 B;  1UJW B;  1EN4 A;  2UUB B;  1VQM V;  1M5I A;  9ICM A;  4G27 B;  4C8L A;  4DOC A;  3E8B A;  1ZQZ A;  1FXK C;  2PYJ A;  5IIL A;  4JV1 A;  4B3M B;  2CPR A;  5IWA B;  1JI7 A;  3SJQ C;  3IN5 A;  3F7Y C;  4IQW A;  2Q6A A;  1SV0 A;  4ZKI A;  5CBG A;  1XHZ A;  2ZIN A;  4U3J A;  5J2E A;  1NK6 A;  1FPO A;  5F9N A;  4I2C A;  1PK1 B;  1FFU A;  1PK1 A;  1OCR B;  2WHE A;  4FZ0 A;  2DYR C;  3E8F A;  3TAP A;  3RB6 A;  5KHJ A;  2H5X A;  4NLB A;  2HLD G;  4D7T A;  4E0D A;  1N2X A;  1U47 A;  3K03 A;  3EUB 2;  4MEY A;  1ZQX A;  4JK1 A;  2LM4 A;  4M9H A;  3C90 A;  4O4J A;  4O4J B;  5DN6 G;  5J0Q A;  1LUW A;  2NN4 A;  3LUT B;  3SGI A;  3BJY A;  1D8Y A;  1E1Q G;  2VJ4 A;  4W4K A;  1V85 A;  4LF6 O;  4PA7 A;  4J9M A;  3WU2 U;  1PM9 A;  4IQU A;  1QSS A;  4DEZ A;  1N34 O;  3C29 A;  1P7D A;  1K5O A;  3MAQ A;  4MS2 A;  3HP6 A;  2BQ3 A;  3CC7 V;  4LF8 B;  2QAR B;  3O0F A;  1HR0 B;  2Y0S C;  8ICM A;  4O4H A;  4F4W A;  1SL1 A;  2W6I G;  5EBW C;  2NRW A;  3ETL A;  3C3T A;  3ZRW A;  4BDP A;  1JA8 A;  3LNM B;  4X9Q A;  2YDE A;  1S77 D;  4DR3 B;  4RUE A;  1W0J G;  2WLH A;  4DLG A;  4F8R A;  2K8B B;  2K4I A;  1WCN A;  5E79 Z;  3B77 A;  1BZK A;  1FXV A;  3K79 A;  2JEI A;  2GWS A;  3AK2 A;  4UV9 A;  2RMK B;  3LK9 A;  1ZET A;  3ABU A;  4QWE A;  2AXT Z;  1DGS A;  2HVK C;  3OPX A;  1I5Y A;  3AG3 B;  2ZTC A;  2EAN A;  1Z1B A;  2HOF A;  4J7Z A;  3H8M A;  1ZQE A;  4O4I A;  1M57 C;  3C5F A;  1ZAU A;  3HKB B;  1THZ A;  4B9U A;  3RH4 A;  2QR4 A;  2YX8 A;  3ZHQ A;  1M56 C;  2RQ6 A;  4JF3 A;  1I94 O;  1PVP A;  2Q9L A;  4AYB F;  2CN1 A;  3CB2 A;  2CTW A;  1IXR A;  2KK0 A;  2QB1 A;  3AQE A;  4MT8 A;  4RQ0 A;  4OJ6 A;  5KHH A;  2AGO A;  1J95 A;  4ACO A;  3GWK C;  1NK9 A;  3CC4 V;  3OEH G;  4MFC A;  4UCR A;  1D9F A;  5KUK A;  2LQT A;  4EYH B;  3VOU A;  4F2S A;  5D49 A;  2ZXW B;  2HDO A;  2WSS G;  2JEJ A;  4J9O A;  4I2B A;  5KT2 A;  1RXW A;  1EFR G;  1QHT A;  2KZM A;  3NRZ A;  3D3I A;  3FYE B;  3CC2 V;  2ATK C;  2JGD A;  2HFE C;  1WUD A;  3OR7 C;  2YEV A;  2ES6 A;  4C4T A;  3RWR D;  5KTQ A;  3MR3 A;  5L1L A;  9ICB A;  4YY3 B;  2YS8 A;  5ALE A;  4P0P A;  3FYI B;  4Y2S A;  3ICX A;  5ITZ A;  2MAX A;  4J41 A;  5LMU O;  1N5W A;  2JEX A;  5KG7 A;  1ED1 A;  2UVW A;  1FXK A;  4JI3 O;  2CUG A;  5EZY A;  4DSL A;  2ZNI A;  4JI7 O;  2YQE A;  4RUF A;  5CHG A;  2J6S A;  1U45 A;  4NVP A;  4YFK A;  1XRE A;  4B7E A;  5AKI A;  2AH5 A;  2QTO A;  3RJF A;  2A0L A;  3RR8 A;  2HI0 A;  1RZT A;  3MHS C;  4JYA O;  3BQ2 A;  4XDL A;  5BXZ A;  2ZIX A;  4I2I A;  4R8U B;  2XAG A;  3UO3 A;  5GW7 A;  4WBN B;  3ETE A;  4HYO A;  3L5K A;  2NNU A;  8ICC A;  4LFC O;  1GTO A;  2DGZ A;  3CRX A;  4K8X A;  4KLJ A;  1HP8 A;  5L3B A;  2JJ2 G;  4X1Y A;  2KE7 A;  7ICK A;  4EFB A;  4Y2X A;  3RTV A;  3ASO C;  1J5E B;  1SKS A;  2Q7G A;  3T1Y B;  4JPR A;  5LYJ B;  5AI6 A;  4IR1 A;  3QUT A;  1X4T A;  1YZ6 A;  2HVJ C;  2EIJ C;  1Z00 A;  3OT7 A;  4GZR B;  1I5X A;  5ALU A;  4DV4 B;  2ZR3 A;  4KLH A;  2AW9 A;  4MTG A;  1ZQG A;  1KC8 W;  1NOM A;  1R3K C;  3PJS K;  2KTQ A;  1VQ6 V;  1RPR A;  4UAZ A;  1ZQF A;  3W7U A;  3N2K B;  3VC8 A;  4IQT A;  3C2L A;  3HKC B;  1XDC A;  4JI2 O;  2LGQ A;  5KG1 A;  1ZQN A;  4LWS A;  1D5N A;  2D3O W;  2FLL A;  1CEZ A;  2KG7 A;  1Y76 A;  3SAG A;  3PSF A;  3H7I A;  1OCZ C;  3BQ1 A;  3A8T A;  8ICH A;  2HBM A;  2NLJ C;  1SGG A;  2Q7H A;  5J2U A;  3AG3 C;  4QZ8 A;  1F0M A;  4TUP A;  5CA0 A;  1COW G;  4MTO A;  2Y9T A;  9ICQ A;  5E79 U;  4PA4 A;  4RQF A;  3W7W A;  4F3O A;  4M0A A;  2RNB A;  2ISP A;  2JGA A;  4PHD A;  5ALJ A;  3CX5 F;  2Y4T A;  2LMR A;  1AB3 A;  1MZE A;  5AI5 A;  3SR6 A;  3M7D A;  4UQG A;  3DTU B;  4FFB B;  2YML A;  1N32 O;  1VAR A;  3KCY A;  4YMM A;  1NI3 A;  4YMN A;  1PNK A;  3T1H B;  1JFF A;  1VF6 A;  2ARH A;  2XAQ A;  5IYZ A;  5KFM A;  4IL6 Z;  4JYC A;  1Y74 A;  2XID A;  3NRW A;  2VA2 A;  2FL4 A;  5JVD B;  1N61 A;  3IC9 A;  4DV3 O;  4C80 A;  1BT8 A;  3OTO O;  4J7J A;  2P90 A;  2DUY A;  2CRX A;  2A7W A;  3T1C A;  3K5N A;  2OXO A;  3TFR A;  9ICJ A;  3JAW A;  4GC6 A;  5G5H A;  3L73 H;  4JAV A;  5HHI A;  1BGX T;  1VQ7 V;  1N8R W;  2XCP A;  4JV5 O;  3J80 N;  4YCX A;  3G6B A;  5BMV A;  1YT3 A;  2HHH O;  1OXJ A;  4BGD A;  3VBB A;  3LSQ A;  2E5L O;  3B0X A;  3GDX A;  4MW3 A;  9ICS A;  1KKD A;  5LGT A;  2FMS A;  2BCV A;  5L3E A;  2OWO A;  3N7R C;  1M4U A;  2HJD A;  3D2N A;  1MNG A;  2EBO A;  1FJG B;  3PY8 A;  2DJV A;  5C8Y B;  1K3E A;  1NKC A;  2I1Q A;  3K1R B;  1Q7Y W;  4J9P A;  2BCR A;  1OUQ A;  7ICE A;  1OCC C;  1S5H C;  3M9M B;  3SJC C;  2E3C A;  2KHV A;  3CSX A;  4EYI B;  5JCO A;  4F5P A;  3CWB H;  2E3T A;  4NXN O;  3M6K A;  1EZJ A;  4DSJ A;  3AUO A;  4DQR A;  4ECU A;  2YMQ A;  5TIS U;  2PMZ C;  5KNI A;  2FLP A;  2KEY A;  4C8M A;  2K8A A;  3S6J A;  1IVS A;  1GN6 A;  4B3T B;  1WPX A;  4DLE A;  3K06 A;  3V7J A;  1QQ5 A;  5DQG A;  4B3S B;  3LYS A;  1O03 A;  4ZOH C;  1H2M A;  1X6I A;  2IH3 C;  2YC0 A;  3K58 A;  1N0J A;  1XNQ O;  4O4H B;  2EAP A;  8ICI A;  2CTP A;  4JI4 O;  2A19 A;  3JCZ A;  1S72 V;  1A0P A;  1EXN A;  1PL4 A;  1K4C C;  4I29 A;  3MDS A;  4MVQ A;  5BY1 A;  3H0L B;  1QQC A;  2Y4U A;  1S97 A;  2W8L A;  4J9Y B;  2W54 A;  5J0W A;  3IC7 A;  4YMO A;  1SET A;  2ZKO A;  4JI5 O;  4X1I A;  2BTQ B;  4QE7 A;  3TXQ A;  1RM1 C;  3WKB A;  3OMI B;  4QZF A;  5AIB A;  1XSP A;  1QSL A;  4LH7 A;  4GKJ O;  2V4D A;  1SXE A;  3D2S A;  2ZM6 O;  4KL1 A;  1SQQ H;  2QWP B;  5FNV B;  2EIL C;  2Z7J A;  3F2C A;  2IH1 C;  3SPI A;  3KOO A;  3T5L A;  3S3W A;  1SC5 B;  4C7Y A;  3Q8L A;  4NLN A;  2G5H B;  4B3R O;  3E35 A;  3OTO B;  4DSI A;  3RB3 A;  2P6J A;  4JV0 A;  1BGY H;  1VJ5 A;  5LXT B;  3MFI A;  4F71 A;  4X64 O;  1PNM A;  4J9K A;  4C7U A;  1NK5 A;  2W8K A;  2QTS A;  2PZS A;  5KFI A;  3VQY A;  2IOF A;  5IIO A;  4R8U A;  2LP7 A;  1XMO O;  4LF7 O;  1RQN A;  3H8S A;  3THV A;  1U4B A;  1TVA A;  1MQ2 A;  5JH7 B;  2WLL A;  4R63 A;  3PST A;  5J2F A;  1Q6U A;  4J9Z B;  2ZG6 A;  4UUJ C;  2DBY A;  1UA1 A;  1VQ4 V;  1FD9 A;  2D3D A;  1H2S B;  3WK7 A;  2W03 A;  3I5D A;  4WFB V;  3ASO B;  1NZB A;  1RYU A;  3IFX A;  4QZB A;  3CRM A;  1IV8 A;  3QUC A;  4LR3 A;  1F5S A;  2OH2 A;  3CRA A;  3FB6 C;  4PHZ A;  3T4D A;  1M90 W;  4LFB O;  2RP5 A;  3JD0 A;  5JJN B;  1Q90 D;  2FLN A;  1SV4 A;  4KUM A;  4NR1 A;  4I0X B;  3CP1 A;  1AI7 A;  2B9Z A;  1VQK V;  2BHN A;  2HHW A;  3UMG A;  1NKB A;  1NBM G;  4DF4 A;  2JHD A;  3E83 A;  1ZQA A;  4ED6 A;  1YF2 A;  4X62 O;  4QNH B;  2ZTD A;  4LFA B;  1CPY A;  2JIZ G;  3AG4 B;  2BOC C;  3PMN A;  4DUZ B;  5EWE A;  3SMV A;  4LJX A;  3IG8 A;  4RT3 A;  4F92 B;  2ZDI A;  5IJ9 A;  2YXY A;  4FLT A;  2F23 A;  3JCU Z;  2M0N A;  4PEL A;  4KFM A;  1JX9 A;  1ZRN A;  4P9O A;  5BOM A;  4ECT A;  3TGU H;  3IDW A;  3CEI A;  1L5U A;  1EN6 A;  2A1J A;  1NNL A;  5B1O A;  5LA6 B;  3CHX A;  1DK3 A;  2UXN A;  1LUV A;  1TA8 A;  2R18 A;  3PO5 A;  7ICT A;  1TAM A;  4LFC B;  1HDJ A;  4K4I A;  2B1G A;  4M47 A;  3FB8 C;  5CR0 A;  2B21 A;  5J0U A;  5CMU A;  3EXA A;  5L1K A;  5AM4 A;  2DOS A;  1JJ2 U;  4CZZ A;  3QYP A;  5KX5 B;  1Z5W A;  1COK A;  7ICR A;  2ASD A;  2Q0O C;  2H94 A;  4KP4 A;  8ICE A;  1UQV A;  1WA8 B;  5F3X B;  4OX9 B;  1YJ9 V;  5AM3 A;  4OPH A;  2IJK A;  3D2Q A;  1X42 A;  1BNP A;  2CH7 B;  3HB3 B;  4FS2 A;  2OEH A;  5J0O A;  1UT8 A;  2E74 B;  4UB3 A;  1XHX A;  3GU3 A;  5KFR A;  1IBK B;  4KLS A;  1IUR A;  3HWT A;  2XT9 A;  3KG2 A;  1ZQU A;  3CNH A;  8ICL A;  4IT5 A;  1L7P A;  5KFP A;  4M9J A;  5IIN A;  4CH5 A;  1AI4 A;  3OMN B;  1QTM A;  1BS3 A;  5KFL A;  4GXJ A;  5J2H A;  1UPH A;  1V97 A;  3RJJ A;  2IOF K;  2RDC A;  1RM6 C;  2XGP A;  2Y69 B;  2KJ9 A;  3SPH A;  2A1J B;  3CYO A;  3I1Y A;  1Q3E A;  3ZS8 C;  1NR1 A;  4JZ2 A;  3TQ1 A;  2UUC O;  4KLQ A;  4KLM A;  1VEW A;  1UCV A;  2H3V A;  9ICW A;  4DF8 A;  1I94 B;  4CH4 A;  5D46 A;  2HCF A;  3PR4 A;  1W0K G;  4DL5 A;  4Z2W A;  4UAT A;  1G1X B;  3PW5 A;  4YD2 A;  2ZUB A;  4TQF A;  2W3R A;  1OZ0 A;  2GUZ A;  4ECX A;  3JD2 A;  2W43 A;  2KB1 A;  4C8K A;  4RWU A;  2A79 B;  3Q8P B;  1NU1 H;  4DV5 O;  4EEK A;  4YJ3 A;  5B3S C;  3NVY A;  4PGY A;  2ASJ A;  5KFH A;  7ICG A;  3OJU A;  2BZF A;  3VCB A;  3M9O B;  3ZRW B;  2L5Y A;  5H5N A;  8ICJ A;  4OJO A;  3WKA A;  2W9M A;  4PHP A;  4X1K B;  3RJE A;  4GXK A;  3DXR B;  4TUS A;  1V9P A;  5EYP A;  5CN0 A;  3B8N A;  2PYL A;  2KV2 A;  1JXE A;  5JQG A;  3RYI B;  2LW7 A;  8ICO A;  3C3S A;  4DR3 O;  3SAH A;  3T5K A;  3JYC A;  4P4M A;  4K35 A;  3U26 A;  1DRG A;  1WAZ A;  3FKS G;  4KXR A;  4QPJ A;  5E1A C;  3KZX A;  9ICG A;  2NRX A;  3SEI A;  4MTX A;  2BKE A;  1HR0 O;  5J2I A;  4QZE A;  3KD3 A;  4JI8 O;  1N34 B;  2R8K A;  2LGW A;  4NXZ A;  4J42 A;  1ZQK A;  3K57 A;  1XI1 A;  3KKY A;  2QGN A;  4JTC B;  1ZL8 B;  2HEP A;  3RFR A;  4RAI A;  2PKE A;  4MVZ A;  2HP8 A;  5KG3 A;  4P9P A;  2F43 G;  4PPX A;  3OM3 B;  4HYK A;  3EZ5 A;  3AK3 A;  5EBL C;  9ICX A;  1KYO F;  2ZXW C;  3PN1 A;  3SYO A;  3RB4 A;  4O9M A;  3JAW B;  4YQW A;  2ZXH A;  4B9T A;  2Q8V A;  4WFE A;  5CB4 A;  4F50 A;  1Y66 A;  3A0R A;  5IYD O;  4I50 A;  3KHL A;  2PF4 E;  4YG2 A;  1S9F A;  1XL4 A;  3JAR A;  2G0A A;  2VS0 A;  4X1K A;  2OT5 A;  5C0Y A;  3BCC H;  5IWA O;  5DLG A;  1L0N H;  4JI8 B;  5J29 A;  3ZIA G;  1KKC A;  1RG6 A;  4JI6 B;  3RYI A;  4Y2Y A;  3PX6 A;  3LWL A;  8ICQ A;  4QZH A;  4O2B A;  4KHP B;  1B04 A;  5GTH Z;  2B1I A;  5KFU A;  5L3D A;  3SYA A;  1NJX A;  4DFJ A;  4RNM A;  4PA6 A;  2GHY A;  1TK0 A;  3EFF K;  4Y2P A;  2ISO A;  1QLE C;  2XCA A;  2QKC A;  1X9M A;  2HHQ A;  3QO8 A;  7ICN A;  1H2L A;  4H33 A;  4OGQ B;  4NL9 A;  2DPI A;  5KLV H;  1O9G A;  5HMM A;  5DDM A;  2KNJ A;  1HJP A;  3M6Z A;  4QZI A;  3BAB A;  1Q8K A;  3SV4 A;  3LSU A;  4XUS A;  3RJK A;  2DQ0 A;  2RHF A;  3SAF A;  4BR6 A;  4YR2 A;  2BCQ A;  5ALG A;  4O5K A;  3CRR A;  3EYZ A;  2FYU H;  1JOY A;  3AU2 A;  2ZQM A;  4LVS A;  4KHP O;  3OR6 C;  4I55 B;  3AG2 B;  2EZZ A;  3C1Y A;  3TK1 A;  5KA6 A;  2BTQ A;  2BCU A;  3DC6 A;  1WG8 A;  1SKW A;  3P32 A;  1ZJN A;  2JZB A;  3A0H U;  3BZK A;  2Y1I A;  1QQ7 A;  1EBO A;  3M9N B;  4J03 A;  3QE9 Y;  1L3T A;  5JJJ B;  3DDH A;  1DF5 A;  1U49 A;  2F76 X;  4U7O A;  2CGO A;  1ZD2 P;  4X66 B;  1N36 B;  4GX0 A;  4PA9 A;  2UUC B;  4JB3 A;  3UXP A;  4FZL A;  3H1I H;  4BWA A;  1EZV H;  2RN9 A;  4DR1 O;  1K9M W;  1LV5 A;  2XY6 A;  4MVO A;  2RDJ A;  1QCK A;  5KHK A;  2O6K A;  3OTQ A;  4B08 A;  1TAQ A;  3HT3 A;  3WK9 A;  4O2B B;  4CC5 A;  5AHX A;  3GV8 B;  2FKX A;  2WPD G;  4PL2 A;  4ZIB A;  1AIL A;  1SS3 A;  4LF9 O;  1BE3 H;  3V7K A;  4FPP A;  2W55 A;  5KFQ A;  2E8N A;  5AM0 A;  4M2Y A;  4UAR A;  4LZG A;  1GAX A;  3PML A;  1SQV H;  4I0X A;  2A9H A;  3B4S A;  5DED A;  4RQE A;  7ICS A;  2RRD A;  2EQY A;  1V55 C;  5EC2 C;  2PFQ A;  1SQG A;  8ICT A;  4NLK A;  1A32 A;  4OX9 O;  3GIM A;  1K5Q A;  1FFX A;  2F8L A;  5KHG A;  2R70 A;  1ORQ C;  2YXH A;  1PV0 A;  3OHA A;  4I7Z B;  1DLB A;  3KKA C;  3E22 A;  2C2D A;  4ED1 A;  2XY5 A;  5AM1 A;  1B3Q A;  3VQV A;  5HHH A;  1S0M A;  4JAA A;  3W7T A;  2MU2 A;  2K4E A;  2HHT A;  1NR7 A;  4CF4 A;  2KQX A;  1QVG U;  4X5V A;  1MSD A;  3F2D A;  5AG2 A;  1KP2 A;  2EIN C;  2QAR A;  3FC4 A;  7ICI A;  1EM1 A;  3EVK A;  2YIC A;  4DYL A;  3NS1 A;  3MGI A;  3F5W C;  1KEC A;  3AK1 A;  4DOA A;  2ZJ5 A;  4NL9 C;  4TUR A;  8ICA A;  3TFS A;  5DBA A;  3EPG A;  2LFR A;  5J0P A;  1TKD A;  2HSZ A;  3F5A A;  1ZTE A;  1GK9 A;  1AVM A;  3OGC C;  3BY6 A;  4DUZ O;  9ICN A;  3AMZ A;  5H2F Z;  1J2M A;  1XEQ A;  4LFA O;  2J6U A;  1D2D A;  1Z5V A;  5GTH U;  8ICW A;  1BSM A;  3IG5 A;  2BCS A;  8ICX A;  1XL6 A;  4DO9 A;  1IM4 A;  5AKX A;  5ALW A;  8ICU A;  4JTA B;  2V4R A;  2BE3 A;  3TAD C;  5FP0 A;  1K33 A;  4ZOL A;  5CA1 A;  2RJZ A;  4K4G A;  3JPR A;  4RQ2 A;  3T4Z A;  1ZQW A;  1DTO A;  3CD6 V;  4O2A A;  3QZ7 A;  3ISD A;  5DG7 A;  3FAV A;  4ASU G;  2UUA B;  2ZXI A;  3N2K A;  3H8J A;  4RQ1 A;  2KN7 A;  4QWD A;  4IRD A;  1S76 D;  3QTC A;  1ZX3 A;  4DV1 O;  4OD0 A;  2EAM A;  2WF9 A;  5J0S A;  8ICP A;  3RAX A;  1AQ6 A;  2WLN A;  4GIB A;  2GSM B;  4KLI A;  1H2K A;  5J2K A;  3UPQ A;  3ZHU A;  3M7M X;  2F95 B;  3EPI A;  4F91 B;  2KKV A;  5CA0 B;  2X6A A;  1F23 A;  4YJ3 B;  5B1B B;  1L7N A;  4W4L A;  4KTQ A;  9ICT A;  3JAR B;  1W59 A;  1ZSP A;  1ZQO A;  2F2A B;  4FFD A;  3STZ C;  4TV8 B;  4MEX A;  3LDE A;  3NUQ A;  4B3R B;  3OAA G;  4FZN A;  3SPC A;  2LYH A;  2VKQ A;  5KX5 A;  1SZT A;  2HOI A;  1M6Y A;  1S10 A;  4QWB A;  2VWK A;  1ARO P;  1F51 A;  1ZQB A;  3ZI4 A;  3UM9 A;  4DL3 A;  7ICP A;  2ZM6 B;  1K1S A;  2Z0A A;  4B7K A;  4GX1 A;  4GKJ B;  1VQ8 V;  3SJA C;  1KB9 F;  1FIQ A;  2EAO A;  3OSN A;  2UVU A;  5KAF Z;  9ICL A;  5EZY B;  5KFD A;  3MGH A;  2KZZ A;  3K75 D;  4Z6C A;  1XSL A;  3W7X A;  2JEU A;  1WPB A;  2WF7 A;  4OJL A;  3BQT A;  4PH5 A;  4BXO A;  4A8E A;  1R6N A;  5EWG A;  3P3P A;  2Q73 A;  3ZDC A;  3R9K A;  4U3F H;  4NM2 A;  5KFK A;  2KFN A;  3TAQ A;  2AQ4 A;  2Q69 A;  2IU0 A;  5D5P A;  3KFU F;  4JAS A;  4X62 B;  5KT3 A;  5KG0 A;  1NZP A;  4R65 A;  1YVW A;  3CCV V;  4UAS A;  4JI4 B;  4RQN A;  1OCO B;  1WB7 A;  4JMU A;  3ZN0 A;  4I27 A;  4FBT A;  3B0Y A;  2ZT9 B;  2YMP A;  4IYH A;  2VQE O;  2E5S A;  5EYP B;  4LFB B;  5DQH A;  9ICF A;  1FXH A;  4P30 A;  3WKE A;  4JWN A;  1T5E A;  4KLF A;  1BHB A;  3RVZ A;  4NXN B;  2JRI A;  2GBO A;  5LP6 B;  5DG9 A;  2F1I A;  1J2N A;  3ZHS A;  1XIL A;  1JIH A;  1ZQH A;  2ZNJ A;  1VF7 A;  1PD3 A;  3CCL V;  1ZQV A;  3NVZ A;  4YXW G;  1GMG A;  1FJG O;  3D3Q A;  1TK8 A;  3ABM B;  3D6J A;  3PV8 A;  1LNQ A;  1YCI A;  3HKC A;  3VQX A;  3CCJ V;  4YVZ A;  5EE9 A;  4MW8 A;  5BPC A;  2GOL A;  4G3I A;  5B1A B;  3QU5 A;  1SKV A;  4F5R A;  3KCX A;  5JCO C;  1ECW A;  3JPT A;  3J81 N;  3N2G A;  5IJ0 A;  2WLI B;  3NTU A;  2NRV A;  1RP3 B;  1WYG A;  1ZQD A;  4US8 A;  1T7P A;  3QO5 A;  4MFA A;  4UB6 Z;  4GT1 A;  4DQI A;  3FB7 C;  4I2H A;  3CW2 C;  3BA8 A;  3EWA A;  3CRC A;  1VMG A;  2L6L A;  3DGE A;  1BL8 A;  4DV3 B;  2GTA A;  5BR8 O;  4UB8 Z;  4NLZ A;  2DWQ A;  2W0X A;  2KP7 A;  4JI5 B;  4MF8 A;  2KOB A;  2NO5 A;  3PW2 A;  2FMQ A;  4A5U B;  1URF A;  3PW7 A;  3FM9 A;  2BSK B;  3T1H O;  3BS5 A;  8ICG A;  1HUZ A;  1MOF A;  4P2Z A;  5KFB A;  3G6Y A;  1I7F A;  3UMC A;  3RR7 A;  2QJ1 A;  1Q6I A;  1XNQ B;  1T3Q A;  5B66 Z;  2P4V A;  1MN8 A;  2LO1 A;  2DW4 A;  3ASN C;  4ELT A;  4NM1 A;  1OCC B;  1T8E A;  5H6R A;  1JN3 A;  2EIN B;  5ALK A;  2IA6 A;  2X0L A;  2YIA A;  4Q43 A;  4DR5 O;  2W3S A;  1B4F A;  4B3T O;  1RDF A;  4DCC A;  3D36 C;  2JH1 A;  1N4C A;  2VQE B;  5IYB O;  2ZE5 A;  1L8L A;  4NJ8 A;  2FPK A;  4YIO A;  1VP7 A;  3TET A;  3KHG A;  4R8C A;  5ALT A;  3MD0 A;  2FTK A;  3CCS V;  4JI2 B;  4EZ6 A;  2OCH A;  2R9I A;  2CE4 A;  3ABK B;  1K73 W;  2N1R A;  5ALX A;  4DFP A;  1NJZ A;  3H1K H;  2QLT A;  1GM7 A;  4Y2J A;  2R9A A;  1ZQM A;  2AGP A;  1QR8 A;  5AI0 A;  2C2A A;  2ZIM A;  2K60 A;  3HKZ F;  4BIU A;  8ICV A;  4ED3 A; 
#chains in the Genus database with same CATH homology
 3OUS A;  1T94 A;  1ENV A;  1Q81 W;  2UXX A;  2M0N A;  4PEL A;  2ITD C;  4KFM A;  2DYS C;  3CXC U;  4CRX A;  1JX9 A;  3ALR A;  1K8A W;  4P9O A;  4QJF B;  5J9P C;  5L3C A;  2QA4 V;  4PDM A;  2XVT A;  3SYC A;  5IY5 C;  3ZJZ A;  5BZB A;  2HKO A;  1M56 B;  5B1O A;  3RBZ A;  4DXW A;  4U7N A;  3MGV A;  2UXN A;  4H37 A;  3LDD A;  1KD1 W;  4DO2 A;  2R18 A;  2XI9 A;  4ICA A;  1TAM A;  2B1G A;  3E86 A;  3FB8 C;  4R7C A;  2DYR B;  2XOK G;  4WFG A;  5EC1 C;  4CGZ A;  1BMF G;  5CMU A;  1YSC A;  3QO7 A;  4R6Z A;  1K34 A;  2XIC A;  3AG1 B;  2WLI A;  4F4L A;  3ETD A;  1JJ2 U;  1PL0 A;  4CZZ A;  2IJJ A;  1ZWI C;  4P0Q B;  2V1D A;  1MG1 A;  2WAM A;  2E1F A;  1ZQ1 C;  3RF9 A;  2H94 A;  4KP4 A;  4MTF A;  1OCZ B;  4OXS A;  4E2L A;  2G09 A;  4U7C A;  2W7O A;  2IU3 A;  2E1E A;  1YJ9 V;  2IJK A;  3D2Q A;  1WLE A;  3OW2 U;  3HB3 B;  2Y0S F;  3DEE A;  1M9N A;  4TWK A;  3ABL B;  3IGA C;  3ONN A;  3GU3 A;  1PKX A;  1R3L C;  1NH2 D;  1Z19 A;  4P0Q A;  4QIW F;  3K08 A;  3K1Z A;  1DF4 A;  3KG2 A;  1NJI W;  2Q4T A;  1NVP D;  2IJH A;  1HEK A;  2LYB A;  2MA1 A;  2EJR A;  3NXS A;  2D6F C;  4P0P B;  2EIK B;  3CME V;  1K4D C;  1AI4 A;  4NWI A;  2X6C A;  2M7W A;  3OMN B;  4G28 B;  2DQ3 A;  3ZRS A;  3F53 A;  1JCH A;  1H2G A;  1YHQ V;  1UPH A;  1AJN A;  4UV8 A;  1AR1 B;  2QM8 A;  2EIK C;  2WB1 C;  1Y4M A;  1GO3 F;  2Y69 B;  2KJ9 A;  4QPK A;  3SPH A;  2XAF A;  3CYO A;  5LBQ A;  1QLE B;  2LYA A;  1JQ0 A;  1NR1 A;  5HFL A;  2R9R B;  3CPW U;  4MVU A;  5KUM A;  2H3V A;  3OUF A;  1GKF A;  1HWY A;  4HZ3 A;  1G4Y B;  4G2K A;  2XAJ A;  4X89 A;  4ZBM A;  2KJ5 A;  1W0K G;  1YIT V;  2HR3 A;  1NQT A;  2HG5 C;  2Y48 A;  3K0D A;  1OZ0 A;  2WAQ C;  3JD2 A;  2KB1 A;  1PNL A;  5DM6 V;  2A79 B;  5H9C A;  3H0M B;  2NV3 A;  3W7S A;  3EHB B;  5B3S C;  2YSU B;  2KIW A;  3ABK C;  1Q3U A;  3VCB A;  1MA7 A;  1SRY A;  2Q67 A;  2LBO A;  4TT3 G;  3UM7 A;  2AHZ A;  3ZRW B;  1FXK B;  2W0F C;  2XND G;  4OJO A;  1JVM A;  4BX9 C;  5CA3 A;  4OJP A;  3WG7 B;  4I5S A;  3SYP A;  4FZM A;  5CN0 A;  3N7S C;  3B8N A;  5B1N A;  2KV2 A;  3G6E V;  4MSW C;  3STL C;  1Q3V A;  5EK0 A;  2IJI A;  1SZH A;  1K92 A;  4XDJ A;  4XBF A;  5LHI A;  1KBU A;  3LSS A;  2H8P C;  3SAH A;  2G5I B;  3JYC A;  1QCE A;  2QM7 A;  1DRG A;  3TCU A;  3PSP A;  3FKS G;  4QPJ A;  4UVC A;  5E1A C;  5IY5 B;  1UJW B;  3KZX A;  1R3J C;  4UXN A;  1VQM V;  4MTX A;  4WF9 V;  4MVM A;  1VQN V;  4G27 B;  2DYS B;  4TSF G;  3E8B A;  1FXK C;  2EIM C;  2K4H A;  2CPR A;  1Q82 W;  3SJQ C;  3IN5 A;  3F7Y C;  2ZIX B;  2Q6A A;  5CBG A;  4ZKI A;  4KMO B;  4JTC B;  4RAI A;  1OCR B;  4MVZ A;  4WCE V;  4P9P A;  1F44 A;  2DYR C;  2F43 G;  2OYY A;  3E8F A;  3OM3 B;  3LDC A;  5EBL C;  2V7Q G;  4PDR A;  4NLB A;  2HLD G;  4X88 A;  3SQI A;  2OM6 A;  2ZDI C;  2ZXW C;  3SYO A;  3K03 A;  2ZXH A;  4WFE A;  2PMZ F;  1FFT B;  3AEI A;  1Y66 A;  4PL1 A;  3A0R A;  2G08 A;  4LC1 A;  5IYD O;  1K5S A;  5DN6 G;  2JK5 C;  4I9W A;  4MVR A;  3T79 A;  1XL4 A;  3LUT B;  2G0A A;  1GM8 A;  3AQF A;  2VJ4 A;  1E1Q G;  3B8M A;  3QNE A;  3PSI A;  4PA7 A;  2OT5 A;  5C0Y A;  4LP8 A;  2K89 A;  3C29 A;  2ZIV B;  1P7D A;  3ZIA G;  1E1R G;  1TUE B;  4MS2 A;  3ZMZ A;  3CC7 V;  2B1I A;  3O0F A;  5L3D A;  2Y0S C;  2LFS A;  3SYA A;  4PA6 A;  3OEE G;  2GHY A;  4RO2 A;  3EFF K;  4BAY A;  2W6I G;  5EBW C;  3ZRW A;  2QE7 G;  1QLE C;  4KX5 A;  3F5E A;  4JAU A;  3QO8 A;  3LNM B;  4H33 A;  2EIJ B;  1S77 D;  2OTJ V;  4RUE A;  1W0J G;  2WLH A;  2KNJ A;  3M6Z A;  2K8B B;  2K4I A;  3B77 A;  2DQ0 A;  2ZR2 A;  1FXV A;  2RHF A;  3K79 A;  3CCQ V;  3SAF A;  4UV9 A;  4PDV A;  5KL8 B;  1VQO V;  3ABU A;  3E8G A;  2WB1 F;  2WWW A;  1JOY A;  3AL0 B;  2ZQM A;  5L3F A;  2HVK C;  1I5Y A;  2KKP A;  3OPX A;  1GM9 A;  3AG2 B;  3AG3 B;  3OR6 C;  3X2Q B;  1QVF U;  1Z1B A;  3CMA V;  2HOF A;  3TK1 A;  3LVW A;  5T14 A;  2XAS A;  5KA6 A;  1M57 C;  4BW5 A;  1YTF D;  4Z1M G;  1THZ A;  4GX5 A;  1IIP A;  3P32 A;  3H01 A;  2WLJ A;  2YX8 A;  1M56 C;  1EBO A;  4OJ5 A;  2G06 A;  1DF5 A;  4JF3 A;  2F76 X;  1PVP A;  3OFN G;  4U7O A;  4AYB F;  4L87 A;  4GX0 A;  2CN1 A;  4PA9 A;  2X7R B;  4QE9 A;  4FZL A;  3AQE A;  4MT8 A;  5H6Q A;  3SYQ A;  4OJ6 A;  3OMA B;  2OTL V;  1J95 A;  1K9M W;  4ACO A;  5EBM C;  3CC4 V;  3OEH G;  1OCR C;  4MVO A;  4R50 A;  5KUK A;  4WFF A;  3VOU A;  4WFA V;  3CYM A;  3BEH A;  2EIL B;  2WPD G;  4XDK A;  5KA5 A;  2ZXW B;  4GX2 A;  4PL2 A;  4QNL A;  2K1E A;  2WSS G;  3M99 B;  1EFR G;  3FYE B;  3D3I A;  3CC2 V;  4CBC A;  2G07 A;  2HMX A;  2QKS A;  3HKZ C;  2ATK C;  3ZCC A;  4FPP A;  2HFE C;  1WUD A;  2H3Q A;  3OR7 C;  5IYC O;  2YEV A;  5LGN A;  1L6N A;  2H3I A;  1K97 A;  4FK5 C;  1CRX A;  4P0P A;  2A9H A;  4IC9 A;  3FYI B;  3ICX A;  5CBH A;  4RQE A;  1YJW V;  2RRD A;  2JEX A;  1VQ9 V;  1ED1 A;  1V55 C;  3GWO A;  4FE3 A;  3K04 A;  1FXK A;  5EC2 C;  1K5Q A;  5CRX A;  1H8E G;  2ZD9 A;  2H3F A;  3E0F A;  1P4R A;  2F8L A;  4RUF A;  2MK3 A;  3E8H A;  1CP9 A;  1ORQ C;  2QEX V;  1FS0 G;  1AJQ A;  5LHG A;  2QTO A;  1DLB A;  2A0L A;  3F2B A;  2P67 A;  1S3J A;  3FB5 C;  3MHS C;  2EZO A;  4XDL A;  2ZIX A;  1QBZ A;  2XAG A;  3W7T A;  2EZP A;  3K9A A;  2JMG A;  5GW7 A;  2LKY A;  3ETE A;  2K4E A;  5HFM A;  4U6P A;  4HYO A;  2NNU A;  4JGS A;  1NR7 A;  1GTO A;  2VIX A;  2DGZ A;  3CCE V;  1QVG U;  3CRX A;  3ZMS A;  4JTD B;  2KIC A;  4X8A A;  2DWD C;  3IP4 B;  2JJ2 G;  5L3B A;  3F2D A;  3ASO C;  1KP2 A;  2EIN C;  5C93 A;  3ZMU A;  4JPR A;  1R73 A;  3ZN1 A;  2HOQ A;  3AG2 C;  3JD4 A;  3X2Q C;  5LGU A;  3F5W C;  2PI5 A;  1KEC A;  2HVJ C;  2EIJ C;  2DWE C;  1I5X A;  2HBJ A;  2ZR3 A;  2LFR A;  4MTG A;  1PVQ A;  3F5A A;  4QIW C;  1GK9 A;  1KC8 W;  1XO0 A;  2A3V A;  1R3K C;  3PJS K;  1SER A;  3OGC C;  2ZIW B;  1F4M A;  3BY6 A;  4HAM A;  3ZRX A;  4LCU C;  1VQ6 V;  1RPR A;  3W7U A;  3ABT A;  1SES A;  3VC8 A;  3JD1 A;  1HIW A;  3IG5 A;  1XL6 A;  2ZIU A;  3CCM V;  3G71 V;  4JTA B;  2D3O W;  3E89 A;  1CEZ A;  1K33 A;  1H8H G;  1B6Q A;  3SAG A;  3PSF A;  1OCZ C;  4MVS A;  1W2B U;  1NVP B;  3T4Z A;  1RM1 B;  1DTO A;  2HBL A;  1P7B A;  2HJF C;  4NV0 A;  3ZMV A;  3CD6 V;  2HBM A;  2NLJ C;  2IW5 A;  3AG3 C;  4ASU G;  2ZXI A;  1COW G;  4MTO A;  1S76 D;  5HR7 A;  3ML0 A;  4PA4 A;  4RQF A;  2WLK A;  4UVB A;  4OO1 J;  3W7W A;  2EIM B;  2JGA A;  3D36 A;  4WFB V;  3M7D A;  2WLN A;  5B1B C;  2MRL A;  2GSM B;  3DTU B;  2KKV A;  2YEV B;  2JJ1 G;  1PNK A;  2X6A A;  4PDL A;  1F23 A;  2DQN B;  3N7P D;  2OCC C;  4CDG A;  1V54 C;  2XAQ A;  3OE7 G;  5B1B B;  1QLN A;  5IDJ A;  1MSW D;  4GCZ A;  2WAQ F;  3RVY A;  4JYC A;  4BIZ A;  3ABL C;  2F2A B;  1QR9 A;  2XID A;  3NRW A;  4AYB C;  2WLL B;  3ASN B;  3STZ C;  4FJC C;  1KQS U;  3LDE A;  4WFH A;  3NUQ A;  3OAA G;  2P90 A;  1A6S A;  2CRX A;  4FZN A;  3ETG A;  3T1C A;  2W7P A;  2OXO A;  3LVV A;  3P30 A;  4JAV A;  3SPC A;  3ZRV A;  2VKQ A;  1URJ A;  1VQ7 V;  3CCU V;  1N8R W;  1SZT A;  1K7D A;  3CCR V;  1VQP V;  2HOI A;  2ZIW A;  1IXM A;  1ARO P;  2KVC A;  1F51 A;  3E2E A;  1YT3 A;  3MHH C;  4JYB A;  3VBB A;  3LSQ A;  2YB1 A;  3UKM A;  4GX1 A;  4MW3 A;  4PA3 A;  1V54 B;  1VQ8 V;  1KKD A;  5LGT A;  5L3E A;  2Y69 C;  3N7R C;  2BDU A;  3D2N A;  4N23 A;  1V55 B;  5FL7 G;  3W7X A;  2EBO A;  1AI6 A;  2JEU A;  4OJL A;  1R6N A;  4A8E A;  1K3E A;  1NKD A;  2JH7 A;  1Q7Y W;  1OCC C;  1OUQ A;  1S5H C;  1R6K A;  2H3Z A;  2Q69 A;  3KFU F;  4JAS A;  2IU0 A;  1KP3 A;  2KHV A;  3WG7 C;  3CCV V;  1S0V A;  1OCO B;  3JD3 A;  4JMU A;  3ZN0 A;  3RW0 A;  3M6K A;  2XAH A;  1EZJ A;  1M57 B;  5B3S B;  2PMZ C;  3K3W A;  2KEY A;  2K8A A;  1L1F A;  2E5S A;  1WPX A;  3K06 A;  4Q20 A;  1FXH A;  3LYS A;  3PZP A;  4P30 A;  3L3F X;  2IH3 C;  3WFV A;  3RVZ A;  1BHB A;  2VJ5 A;  2KHQ A;  2GH1 A;  1S72 V;  3JCZ A;  1A0P A;  1K4C C;  2Z3Y A;  3ABM C;  4MVQ A;  1PD3 A;  2AHY A;  2F77 X;  3H0L B;  3F7V C;  2LHT A;  3GB7 C;  3CCL V;  1VQL V;  1F4N A;  1YJN V;  1H38 A;  4J9Y B;  4BUG A;  4YXW G;  2ZIV A;  2DF4 B;  1E79 G;  1GMG A;  3IC7 A;  1RPO A;  1SET A;  3ABM B;  3T2M A;  4N21 A;  1LNQ A;  1OHH G;  2ZIU B;  5KL1 B;  4QE7 A;  3CCJ V;  1RM1 C;  3OMI B;  5LHH A;  4NLC A;  1YIJ V;  4MW8 A;  3ZMT A;  2GOL A;  5B1A B;  1YI2 V;  3R65 A;  4BJQ A;  2JDI G;  4EKW A;  3D2S A;  1M1K W;  1ECW A;  2KJ8 A;  5CBF A;  4GFJ A;  2EIL C;  2WLI B;  2Z7J A;  3F2C A;  2Z5U A;  1NH2 B;  2IH1 C;  3QO5 A;  3SPI A;  1AJP A;  4GT1 A;  3FB7 C;  3I55 V;  4FIP C;  2HBK A;  3H0R B;  2ITC C;  1JPX A;  4LBE C;  2G5H B;  3E35 A;  3G4S V;  3DGE A;  1BL8 A;  2P6J A;  3CP8 A;  2KD1 A;  5A0L A;  2OCC B;  5L3G A;  1PNM A;  2WLM A;  2KOB A;  2YB4 A;  4KX3 A;  5B1A C;  1MAB G;  3HPL C;  1MOF A;  4P2Z A;  1Q86 W;  2W04 A;  2LP7 A;  1G8M A;  2P7T C;  1BHA A;  2WLL A;  2PI4 A;  3PST A;  3RFA A;  4J9Z B;  3I56 V;  2ZG6 A;  4UUJ C;  1VQ4 V;  2CK3 G;  4WJ3 B;  2B5U A;  2DW4 A;  2W03 A;  3C28 A;  1OCC B;  3ASN C;  1XNS A;  3ASO B;  4UVA A;  1NZB A;  2EIN B;  3IFX A;  2X0L A;  5H6R A;  2BOB C;  3SPJ A;  1ROP A;  5HR6 A;  3K0G A;  2OH2 A;  3FB6 C;  1M90 W;  3T4D A;  2JH1 A;  2RP5 A;  1OCO C;  3JD0 A;  5IYB O;  1YTF B;  2K8C B;  2X6B A;  4KUM A;  3TET A;  1R3I C;  3CP1 A;  3SPG A;  1AI7 A;  4C0Z A;  1VQK V;  1AI5 A;  4R8C A;  1NBM G;  3MD0 A;  2FTK A;  3CCS V;  2JHD A;  2W6J G;  3E83 A;  1D8B A;  2R9I A;  3ABK B;  4QNH B;  1K73 W;  2N1R A;  1CPY A;  2JIZ G;  3AG4 B;  2BOC C;  1GM7 A;  1PVR A;  4FMT A;  3SMV A;  1QR8 A;  3IG8 A;  1VQ5 V;  2C2A A;  4O3M A;  2Q68 A;  3GZF A;  2ZDI A;  3HKZ F;  4BIU A;  3AG1 C;  3AG4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...