4QJFB

X-ray crystal structure of thermocuccus kodakarensis rna polymerase rpp4/rpo7 (rpof/rpoe) complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
122
structure length
122
Chain Sequence
MIGRKKLEEHYITIAEAKELLERRHAEGLAENPEEPMFYEARVSLEHAERFAKLKPEQARELKEKLMGLFDWINERIAAKLVDILPEDYLDIRVIFAKEEYMPTPEEAEEIIKVIDEYRPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of euryarchaeal RNA polymerase and insight into the evolution of RNA polymerase II structure
rcsb
source organism Thermococcus kodakarensis
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase, subunit E'
total genus 39
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4qjfB02
1.10.287.420 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4qjfB01
2E1FA 4QIWF 5C0YA 4CGZA 2HBKA 2RHFA 4OO1J 1YT3A 4NLBA 4O3MA 1WUDA 1GO3F 4NLCA 2MA1A 4QJFB 2HBJA 3SAFA 1D8BA 2KV2A 2HBMA 3CYMA 2CPRA 2DGZA 4CDGA 3SAHA 2E1EA 2HBLA 3SAGA 2RRDA
chains in the Genus database with same CATH superfamily
4ECSA 1VF6C 2BQRA 2UXCB 4DR7O 3A0RA 3C90A 3CCRV 5L1LA 4B3MB 2HHTA 4JI5O 4J7JA 4QWEA 4X88A 4C8LA 4UCTA 1RM6C 2VKQA 3W7WA 2W03A 1N5XA 2WF5A 1UT8A 5DGAA 3QTCA 2DJVA 3RYFA 5LHHA 4DSFA 4NM2A 2JH7A 3OJUA 3P3PA 1Y66A 2V9WA 5EE9A 1QLNA 2CH7B 9ICXA 1P4RA 4QNHB 3GV5B 1FFTB 2HVKC 3L74H 3VQVA 3OAAG 1XO1A 5AKXA 3ZDEA 2EZOA 5KT3A 4P2ZA 3O65A 1SKWA 4IIJA 3NUQA 1JA8A 3ZRVA 4DUZB 1EBOA 2BCQA 2PY5A 4CF4A 4B7EA 3W7TA 3C3SA 1M57C 1NH2D 1TUBB 3RVZA 4QZ9A 2IJHA 3E58A 5DKWA 4PDLA 2M0NA 3HKEB 3RJEA 4H33A 3PO4A 1XI1A 3ICXA 1WAZA 4CC6A 4NKGB 1I94B 2WF7A 4G9BA 3BY6A 2AZ0A 2PGGA 1BQ0A 2EULA 2FPMA 2HBJA 1SKVA 3OE7G 4PDVA 4RQ5A 1GTOA 3QNMA 1YEWA 3CCEV 1NJYA 4F93B 1LUVA 2Y0PA 1R1BA 2JS3A 7ICLA 3TACB 5LYJA 1M5IA 4US9A 3LVVA 2XT9A 1S0VA 3K3WA 4Y2SA 5KG1A 4RUEA 4O5KA 1N62A 5B5EZ 4MVUA 4EB6B 2XY6A 2YS8A 1QCKA 3AL0B 3D36C 5LL6Y 3JASB 3MC1A 3ABLC 2B5UA 1KL9A 1GM9A 2UUCO 4QWCA 2KKVA 4TSFG 3OUFA 3E0FA 5AM4A 2JHDA 1MQ3A 1CI4A 1UT5A 2MAXA 2XAFA 3QEAZ 4Y2UA 3GIIA 2CRXA 4TQDA 1ZETA 4F5RA 1S3JA 1S9FA 2I6XA 4FJCC 4YIOA 2EAPA 2L5YA 3VQXA 4RQ6A 1ROPA 3ZHTA 4JI2B 4QPKA 2Q0ZX 3RYCA 3J7AU 2DW4A 3PSPA 3H4BA 3B4SA 4CZZA 2LMRA 2P35A 5B66U 5KAFU 2N74A 4RQ7A 5IE9A 3RRHA 2KNJA 2KSOA 3ZMSA 1QVGU 4B3RO 4DQIA 3EVKA 1FAFA 3UM9A 3A0BU 5H5NA 1UHUA 3UKMA 4HNAB 1N34B 5KG5A 4I28A 4DR3O 2FMLA 2GTSA 1DTOA 5DDMA 4BGDA 2ITCC 2IMWP 4UB2A 3PNCA 2KJ9A 5KMGA 4P4OA 1R3JC 4I4TB 1JMKC 1TUBA 1KP3A 4RQMA 3HILA 1LVHA 2LQTA 2E8PA 1SQGA 1MNGA 1XL4A 4DQQA 3ZDCA 1F4NA 4ZBMA 2EANA 5A0LA 3QVNA 1FJGO 4O3PA 1NK6A 3JPQA 1IM4A 2ZCEA 1ZQYA 1VP7A 2LJ2A 2QWNB 3SJCC 4X62B 2W0FC 1Z00A 4OD0A 3C28A 1J2MA 2R72A 4UCUA 1GN6A 1QCEA 1XHXA 1SERA 5IYZB 3T1HB 4B9SA 4YY3O 4C0ZA 2IHMA 2IHNA 3JPTA 1NH2B 2IU0A 2QSAA 4EB6A 2W43A 4DR5O 2K4HA 5AIBA 5LGNA 4OX9B 2QB0A 1GM7A 2RDIA 4ED0A 3K03A 2KB1A 3SD7A 2F1HA 3ETLA 9ICOA 1PPJH 5KFVA 4OO1J 3BQ0A 5H2FU 4K4HA 5JRTA 2J6TA 5IIOA 4FM1A 2K89A 4FLUA 3ZHSA 4DSIA 2X6AA 3F5TA 5J9PC 3V7KA 4JI8O 1LB2B 2RQ5A 1D5NA 4I9WA 2ZR2A 1IBLO 2UUAB 2FLNA 3ISCA 4DFMA 1SQQH 3L4PA 4L87A 3OJSA 3T1CA 2FDRA 4ED8A 3DGEA 2E3TA 4KMOB 2Q7EA 1H8EG 1T4GA 2ITDC 1BPYA 3LSQA 3TJTA 5KT2A 3T4DA 3P30A 2JIZG 4HYOA 4RQ2A 1D5AA 3ZRSA 4O3RA 3WK7A 2NR5A 4CC5A 5C8YB 3GIJA 1MA7A 4KN7A 4WFFA 1EN5A 2QKSA 2XAJA 2UXNA 4PD4F 3ZJZA 8ICSA 3ISBA 4JTDB 1DOQA 3BCCH 2W9AA 2MRLA 4US8A 2X7RB 4O3NA 2DE0X 2JEXA 1RPLA 4M9HA 3DC6A 3K9SA 1K73W 1FJGB 5H6RA 3A0BZ 4A5UB 4P0PB 3EFFK 3RJKA 4ECUA 3CCJV 3ALRA 3M9NB 1SXEA 7ICKA 3N7RC 2AQ4A 3BHPA 2CXYA 5EBMC 2ALZA 5EBWC 1VQ9V 2Y69B 1K1QA 9ICTA 3JASA 4X1IB 1WG8A 2KVCA 2WLHA 3WKBA 4LF5O 4WBNB 4MS2A 4XDLA 2P6UA 2E1FA 5J29A 3CMAV 1OCCC 3CJHB 1F7YA 2YQEA 1NU1H 5BMVB 2ZE5A 5AI0A 2DKXA 2ZIUB 4C8MA 4DV2B 2KSDA 4JYAO 2VJ5A 4UATA 4JI3O 1NVPD 2A3VA 1HEKA 1Y67A 1ZQUA 3CJHA 4B3SO 3D36A 5KFRA 3PZPA 8ICZA 1Q46A 5J0YA 1KKDA 3NS1A 4F5NA 3ETGA 5JQGB 2ODMA 3PMLA 3RB3A 3I56V 5IINA 2XAHA 1J2NA 4DEZA 2PYLA 3SYCA 2R8IA 5DBAA 2NRVA 4PELA 4B6JA 5LP6B 2Q0OC 3Q8KA 5HFLA 4BWAA 1MMMA 3ZCCA 4IRDA 2CH7A 5HR7A 1S5LU 1VQ5V 4F6EA 1DF4A 1CP9A 3N7SC 3KD3A 2OCEA 4C4SA 2IJJA 3F5AA 2K4EA 3JD0A 1HIWA 4NR1A 4PA7A 1IV8A 2UVWA 2CTRA 5KG7A 4HAIA 1ZQEA 4MW3A 3ZN1A 4LF5B 2P4VA 1XREA 1Q8KA 5F9NA 1Q5OA 4UCRA 4QNLA 5DBBA 4RQFA 5AM3A 1L1FA 1JJ2U 2WAQC 1PUZA 3JARB 2ZXHA 2F44A 5J0UA 4O4IA 1RG6A 3FB5C 1O9GA 5HHHA 2ASDA 3JPSA 3PX4A 2OTJV 1TK8A 4TT3G 4HAMA 3SYZA 2N04A 4DOAA 1SQXH 4GXKA 3UQ2A 2LW7A 7ICFA 2PI5A 2KFZA 4OJOA 1WB7A 4OPAA 4JI7O 1AQ6A 1H2MA 2M9NA 3LVWA 2HHVA 5ALTA 1QQCA 4KLSA 3TFSA 2Z0AA 4X65B 1D8LA 4DS5A 4EFBA 4TUSA 2PZSA 3K06A 3J81j 4YMMA 2QWRB 1B0XA 2YI8A 1D9DA 4X5VA 1ZQXA 3CNHA 2EILB 2DWQA 1QSLA 4DL5A 4I29A 4RT3A 2CGNA 4UCOA 1PV0A 5AKKA 1BPZA 4LF8B 1AI4A 5ALJA 4CH5A 1B04A 4GIBA 1KC8W 2LYHA 3DXRA 1DGSA 1RP3B 2EINC 3THOA 2PTMA 4FLZA 2HI0A 4DF4A 2WPDG 5LP6A 4K4GA 3O0FA 3RR8A 3UMBA 3LDAA 2ZXWB 3MAQA 5BOLA 5DLGA 2NO4A 3CRXA 4ZH4A 1JXLA 5C5JA 1I0HA 4J9NA 3AG1C 5C93A 1I08A 3AG3B 3NVZA 5ALDA 3FAVB 5IY5B 2BPFA 1W2BU 1N34O 1YSCA 4Q8EA 1ZXIA 2ZIVB 3SQIA 5KMGB 4GXJA 2ZINA 2KMDA 5AK6A 5HR6A 2I5HA 3N2GA 1JMSA 4X1IA 1MN8A 1ZD4A 2R8HA 2BR0A 2VA3A 5KFXA 5T14A 4Z6EA 2LGQA 4GT1A 4WBNA 1D8BA 4U3FH 3EW9A 3A0HZ 1UQVA 5ALRA 5FLXN 5KFGA 5H9CA 3OSPA 4JAUA 1K34A 2ZE6A 5J0XA 3MD0A 4L8JA 3SZ2A 1QNMA 4ZOHC 2YIDA 1SV4A 1S8OA 4Y2YA 3ZBHA 1UPGA 2EIMC 2IOFK 2KG7B 2AH5A 2Q4TA 2YN4A 4LFBO 3RTVA 1XL6A 4NLNA 4M6WB 5TISU 3I76A 4Y2VA 1HNZB 2JRIA 3K5NA 2BE3A 4CS4A 1J5EB 4OXSA 2EZXA 4TWKA 1J97A 1JPXA 1PKXA 2GUZB 2FMQA 2VJ4A 5AM0A 3A8TA 2DPIA 2Y0SF 4JTCB 2EIJB 5EWFA 1QR8A 3MGIA 1FFVA 2QM7A 3LNNA 2AGOA 1RXWA 1JUDA 3QNEA 4G2KA 4FBTA 3B77A 1N4CA 4RNNA 2YB1A 2HHUA 2GBOA 2AQ0A 2G09A 1WA8B 5AM2A 4R7CA 4XDJA 2WLLA 4LF7O 4QZHA 5L3DA 3GV8B 1HR0O 4DV3O 3KZIU 4U6PA 3BQ2A 5KFIA 1D8YA 4KLLA 3K0GA 4LFCO 2G5IB 4J03A 3OEEG 4MT8A 2A19A 4IHJB 3WK6A 3JARA 4DSLA 3RN4A 1WCLA 2ZD9A 2X6BA 8ICIA 1G6UA 2IU3A 3IHQB 2JGUA 1U96A 1TGOA 3AG7A 4DXWA 2EX3A 1JI7A 1K5QA 5CB1A 3HKDA 2XVTA 4JUZA 4P9PA 1VQNV 2P66A 4NLKA 3FYEB 1Q82W 5BY1A 1FYJA 4RUFA 3H7IA 3WKCA 5F9LA 4I2JA 1ZQAA 2V1DA 1E1RG 5J2FA 1X9MA 5AK4A 3GU3A 5ITZA 4KLQA 2P22C 2CGOA 5B1BC 3UT5B 4RPYA 5KFHA 2A1JA 4FZLA 4YMNA 2A9HA 4G27B 4JI1B 5ITZB 2ZJ5A 4F91B 1KFSA 4G28B 4MFFA 2DGZA 4ECYA 2A1JB 3PW7A 1WN7A 2YXHA 3JATA 4FFDA 4JK1A 2G07A 4YJ2A 1K33A 4ZHQB 1AP6A 2PMZF 2OH2A 2XI9A 2VWJA 2ZXWC 4ACOA 4U7OA 4FLXA 2EIMB 2W6IG 3RT3C 4DQRA 2BZFA 9ICIA 4DW1A 5KAIU 1H2GA 5KFKA 1CRXA 5ALPA 1B06A 4FLWA 2YICA 1CEZA 2QARB 2JJ1G 3HJEA 1X40A 3G4SV 3FAVA 2VS0A 9ICLA 1JFFA 3CYMA 2JEUA 1JIHA 2VQEB 1RSOA 1ZJNA 4EZ6A 1DK1A 4KITB 4RQ3A 5J8YA 4YD1A 1PP9H 3JPPA 2XO7A 1N36B 1Q6UA 1EN4A 2BDUA 2JXJA 3DTUB 1ZQIA 2AHYA 5KFJA 1K97A 2YMQA 3SYOA 5CMUA 2DYSC 3RBEA 1NKDA 1VLBA 1W0KG 3ZDAA 3GILA 1BGYH 4MTFA 5H6QA 3SI8A 3DEEA 2H3FA 3NGDA 1URFA 4X89A 1NJIW 4MHVA 3WFVA 2ODGA 1X42A 2A06H 3KHRA 4KLIA 2FL4A 5L3FA 3TFRA 1Y4MA 4X64O 1N56A 2PXIA 3A2FA 3N2KA 3M7MX 3H9VA 5IDJA 2P06A 4ED7A 1R6TA 3CCQV 1XNQO 3HKBA 1S0MA 3AN1A 1KN5A 3B0XA 2KZMA 4JAVA 4F6RA 4B9MA 1MABG 1ZRMA 4FFBA 4NXMO 2DWDC 2FTKA 1JX9A 5B1NA 4JI6B 3WB2A 3SR6A 4GYCB 4DV4B 1N0NA 2UU9O 3AG4B 1KP2A 1WA8A 3HKBB 3NXSA 2QJ1A 2ZE7A 3K5OA 4QPJA 2QDOA 3WU2U 4DFKA 1YJ9V 1VQLV 4M9JA 3C1ZA 2EZPA 4EEYA 4Q20A 1NI3A 3MDAA 5KHHA 2WF6A 4KHPB 4I2BA 2BTQB 1D9FA 5EZYA 4QW9A 3QXGA 3E22A 5LHGA 3JAKA 4AYBF 7ICMA 3K04A 5J2KA 3ASNB 2W11A 2JZBA 3QE9Y 3SMVA 1YF2A 2D3OW 2BTQA 1JROA 3E2EA 2Q9LA 5LA6B 1SL2A 1NZBA 4UB6U 1JN3A 1CXZB 1PL4A 1OXJA 3IV6A 4RU9A 5LMNB 1OV9A 3SJQC 3SAFA 3L72H 5A2QN 3MDCA 4J10A 5KFPA 4NB5A 4I2CA 2W7PA 3PN1A 2F76X 1PVRA 2FLLA 2XHBA 1QQ6A 3T5LA 2XC9A 1XQ8A 1NS1A 2R18A 4B9TA 1FXKA 1YJWV 5E79U 1ZD5A 4R8UB 4DQPA 4RPXA 2G06A 2R8GA 5HFMA 5HNKA 8ICTA 4FE3A 4R65A 1R6KA 5ALKA 1OHHG 1IBMO 5KFCA 8ICUA 2Q4PA 4DW0A 3F2DA 1MOFA 1K4DC 5ALIA 2E76B 1XMOO 8ICRA 1X6IA 2UU9B 7ICNA 4MF8A 4R8CA 3ABKB 1NVPB 1Y88A 2CDYA 2HW3A 5IYBO 4I9QA 3N2KB 1IDSA 3M6ZA 1YZ7A 4O4JA 3HRDD 3RAQA 1DK2A 1V54C 3ASOB 3QU7A 2ZR3A 1XNRO 1GN2A 1ED1A 3VQWA 5JJEB 3C3TA 4K3AA 3AEIA 3ZDBA 5KFWA 4M2YA 8ICWA 1PNLA 4LZGA 1L5UA 1L3SA 4ED2A 3BQ7A 4NYKA 4DK0A 4Q44A 2EDUA 4KLJA 3G6BA 5DB7A 5DQGA 1EZVH 4I55B 1WNSA 2NO5A 4YFKA 1RSOB 4UCVA 2RDJA 4FM0A 2BOCC 2AGPA 1NK7A 2PYJA 4F4XA 2DYSB 4NTWA 2W04A 1LKYB 2IJKA 2ZIWA 3MHSC 4NM1A 1BSMA 5IWAB 2GSMB 3E22B 3BZCA 3ETEA 3B8NA 4ASUG 1N32O 4KUMA 5J2UA 1TVAA 4B08A 5J2GA 4R50A 1F0MA 4CS3A 4PDMA 2LYAA 2AXTZ 1Z3EB 5EYPB 5DECA 5AKZA 3EPIA 5DGBA 2WLNA 2G08A 1OCZC 3RJIA 2ZNJA 5TZVA 1L3VA 4W4KA 2WFAA 1ZQDA 4QJFB 4EEKA 1SQFA 3F7VC 4DSEA 4X20A 4O5CA 3HX0A 2PFOA 2IBKA 3EYZA 2WSSG 3E8HA 4I50A 4AQYB 1L7OA 3DC5A 4BR6A 4R66A 5B3SB 2AGAA 3ED5A 5IWAO 2K8BB 8ICPA 5E79Z 4TUPA 4I2AA 2UXXA 3D3IA 2NRWA 3ZHRA 5BR8O 2VQFB 4LNUA 4QGPA 3UT5A 3Q4HB 2W3RA 1TK0A 1YHQV 2N05A 3L73H 4DR2O 3KHLA 2Y9TA 2JMGA 5AKYA 1ZQBA 3I5DA 3JSNA 2QE7G 1AP5A 8ICBA 3T4ZA 4NLZA 3D6JA 4NXNO 3RYIA 4DLGA 4UVBA 2WB1F 4DFDA 4O2AB 5KFTA 3LDEA 3TI0A 1SQPH 2ZT9B 4KN4A 2DOSA 4XBFA 4CH6A 3R9KA 5EOZA 4ZIBA 5HMLA 5LA6A 4DV7O 3EHBB 4K0KB 9ICFA 2QARA 3R66A 2B21A 7ICSA 4BX9C 1N32B 4H44B 1BPBA 2BPCA 2UVRA 5FP0A 4FM2A 4AP9A 3APQA 3BEHA 4LFBB 4ZOLA 1S72V 4U3JB 2C28A 4Z1VA 1TFRA 4QZGA 2OCCB 5LMUO 5J2UB 1U4BA 1WP7A 1XO0A 3THVA 2RMKB 3K57A 1UA1A 4KLEA 3BDPA 3K75D 5EE3A 3QZ7A 2HBLA 3CMEV 3V6HA 1B43A 4RUCA 2JGDB 3RF9A 4LF7B 1H8HG 3BABA 4QE7A 3VCBA 4F72A 4TUYB 5CB4A 1X66A 3RYHA 2YSUB 1XSPA 1KUQA 3V6JA 2F23A 1KSPA 2V7QG 5LP6C 4PDRA 4DR1B 1S0OA 1OCOB 4EBDA 2HFEC 3Q8MA 1Z4OA 4PPXA 2YEVA 2K8AA 2F93B 2NRXA 4DV6O 1Q3EA 4ECWA 4OJ6A 3QEBZ 3SPHA 2KEYA 2OCCC 5CN0A 2MA1A 2CTQA 1KBUA 5DG7A 1UPHA 2E5LO 4DV7B 2H3QA 1HWYA 1FFXA 4GUNA 5AG2A 3VC8A 5IJ9A 5L3GA 1RDFA 3MGHA 3ORYA 2QWQB 4GX1A 4X64B 3JD1A 5ALMA 3CPWU 4DL7A 3SAGA 4JYAB 4F6RB 4FS2A 3TK1A 2A1AA 5KX5A 3QUQA 9ICHA 3PO5A 1V97A 4MVRA 3GZFA 5KG2A 4NLGA 5KFZA 4ABMA 4TURA 4JV1A 5LOVA 4AILC 3TARA 1G4YB 5KX5B 2WHEA 2Y69C 8ICNA 3OR7C 1SQBH 3QG5A 3CCSV 1Q43A 1JCHA 1DGJA 2A3QA 4NJ8A 1NI8A 3HW8A 1KYOF 1HNXO 3BA8A 5DEDA 3VQYA 4E0DA 2Y1IA 5CR0A 1D2DA 3C2MA 5KFSA 2MUTA 2JK5C 1T7PA 2WA3A 3HR0A 3TAPA 2QWPB 3JSLA 1NR7A 3GVMA 3H8JA 1C20A 3RH4A 2JEJA 3H1IH 1U47A 3UQ8A 4ZI7B 1RM1B 5AKIA 4MFAA 5ALQA 4DL2A 4DS4A 3B2EE 4LFAB 1BQZA 4Q45A 3RH6A 8ICMA 3Q8QB 1P84F 1XDCA 2MW2B 3LSSA 2FB5A 3RW0A 4QWBA 4YP3A 4EENA 2KJ5A 3OHAA 2C2RA 3K1RB 3FFQA 4M47A 1IXRA 1ZQOA 1RQLA 5J0TA 3PX6A 4JYYA 9ICMA 1GM8A 1XSNA 1VQMV 2KN7A 1JX4A 1KEJA 4ECXA 5ALNA 4DR3B 4GX5A 4LH7A 1N0JA 4JTAB 4TUQA 3LWLA 1O9HA 2ZIXA 2H3ZA 4YQWA 3K5MA 4J9LA 2EJRA 4TOIA 1SETA 2YIAA 3CE2A 3OHBA 4GXIA 4E2LA 2OYQA 5KHIA 3OMNB 3G6VA 1M4UA 4EEQA 3GV7B 4EBCA 1AVMA 5AI8A 4PGQA 1XNRB 3FYHA 5ALOA 3F7YC 1QU7A 5EC1C 3L5KA 3RBZA 2ILMA 3IRUA 2ZM6O 5ALYA 1TKDA 4CRXA 4UB8U 2KTQA 1K9MW 2F3NA 2YY6A 5AIAA 9ICSA 2CE4A 3FM9A 3D2NA 3FKSG 2Q69A 1Z2GA 1EXNA 2VA2A 1WUDA 5AHXA 2W9BA 5CA0A 2ASLA 5KT4A 4JI4B 4DR6O 4JWNA 8ICJA 1WP8A 4TV9A 2KIWA 2OYYA 1LNQA 2ZG6A 1BL8A 4O9MA 5G5GA 7ICTA 4KLOA 2EIKC 3QYPA 5AI6A 5IIMA 1M90W 3OFNG 2PKEA 3WK5A 3PV8A 3F2BA 5L1JA 1FFUA 5LXTB 4ZI7A 1XUQA 4FZNA 1OCOC 5B1BB 2W9MA 2QTOA 1SWWA 3CC2V 1B3QA 1URJA 1NJXA 2DFLA 4I2GA 3M8SA 3ZX6A 3IGAC 3JCZA 3BS7A 3QUBA 5FPRA 3UO3A 3JALB 4BAYA 5FNVA 3MR6A 4FS1A 3T5HA 2ZUBA 3AG2B 3RFRA 3NASA 2BCVA 4HZ3A 2KG5A 2EZYA 4PGYA 4IL6Z 5FNVB 3ML0A 3CCLV 2FE9A 2W9CB 1ZD3A 3BJYA 4LP8A 1XMQB 1J95A 4AHCA 1Q6HA 3UO2A 1UA0A 2E8NA 2DL0A 3AK1A 2A7WA 2BCUA 4PL2A 4YXMA 5CA1A 5J2JA 1S5HC 3ETDA 1U45A 2JS5A 4PHDA 4F71A 5DQIA 4UQGA 5J2TB 1RQNA 2OIGA 4NWIA 4DRXA 4PI0A 4UW9A 9ICKA 3WK9A 5J2AA 1L8DA 4J41A 2RCVA 1VJ5A 4MTGA 3H1HH 4O2AA 2XIDA 2ISPA 4LFCB 2MUTB 2E75B 2XAQA 1GH6A 3SJBC 3M1YA 4I2HA 5L3CA 2K8CB 2NYVA 3B0YA 3QUTA 3FD9A 4YHHO 1N33O 4PHPA 1L8OA 1PL0A 2F43G 4DR7B 1SB3C 2ZJ8A 4QWDA 3BFRA 3W7XA 2EH9A 3GQCA 2KVSA 2P6RA 1R73A 4WF9V 4QW8A 1AJPA 4ED3A 3EWAA 4F3OA 5CEHA 5K1PA 1MSWD 5DB9A 3JCUZ 1E1QG 4UFZA 5CA0B 4CGZA 1M57B 3F5EA 5LYJB 1T8EA 4D7TA 3N4MB 4X62O 8ICFA 4P0QA 1XMOB 3AU2A 5LGUA 1XC9A 1S0NA 3NRZA 2Y4UA 4M9NA 4JZGA 4DLEA 4CCHA 4Q6GA 4YY3B 2C2EA 5HHIA 1P7DA 4PA4A 4YJ3B 2XY7A 1U48A 1ZRNA 3RJJA 4X1KB 2LP7A 9ICRA 3CRQA 4MVOA 1OCRB 2KV2A 4YR2A 1F5SA 4TUYA 1HUOA 2M7WA 4DL6A 3X2QC 2Q0AA 1IIPA 3PW0A 4GX2A 2ATLA 1L3TA 4NL9A 1AI7A 1GK9A 7ICJA 4DR1O 4Y2QA 3HWTA 5ALXA 3QU5A 2YEVB 2BCCH 4I7ZB 2YX8A 4I27A 1TVKB 1SL0A 1T3NA 4WFEA 4DR4B 4TQRA 2BTOA 1FFXB 1XWLA 4EELA 4LVSA 3K0DA 4TV8A 3U11A 4PJ0U 4KP4A 3SPGA 2GLEA 3ZHVA 3T1YO 3ZD8A 1BPEA 4B9NA 3CRRA 5KFEA 2HHHB 3D2SA 4XA5A 5GONA 3T1HO 5DQHA 4X66O 1COWG 2ZTCA 3GDXA 1KKCA 1ZQSA 3RYFB 1Q6IA 1IZ3A 5EIBD 2EINB 1L0NH 4P4PA 3D3QA 3OTOB 3CRMA 1ZQVA 1R3IC 5LGTA 4X65O 5KFLA 3G71V 1US6A 3QO8A 1RXVA 3RJFA 5IIIA 4DUYO 2G5HB 3RR7A 4J80A 4DF8A 4IIJB 4PL1A 1BE3H 2BKEA 1IBLB 3SENA 5BXZA 3NVYA 5LXTA 4H37A 4O4IB 1VARA 2DWEC 5K1XA 5ALFA 5KFUA 4FLVA 4B3TO 3HKEA 2XY5A 3OSNA 4C7YA 4R64A 1NTMH 4DO2A 3QUCA 1ZTEA 2HBMA 2ZTEA 1YXBA 4BJQA 3OD4A 5CHGA 4YR3A 1K1SA 5D5PA 2WLJA 2L35A 3K58A 3ZHUA 1A77A 1XBLA 4P0PA 4LFAO 1GN4A 2E3CA 3RB4A 5EE0A 5KNIA 3TXQA 3EZ5A 3OTQA 1EZJA 7ICVA 3T79A 2P7TC 1F44A 3QU9A 4JI4O 3F53A 2JEGA 2YI9A 5CBHA 4DR6B 2HVIA 4F5OA 2AJQA 2RN9A 2Y4TA 5FPOA 5KA6A 5LHIA 5B1OA 4DV3B 2LHTA 1AJQA 3GFKB 4DV2O 3UXOA 1E79G 1ZQZA 4I2FA 1SQVH 4KL1A 4UASA 3RFAA 1ZQNA 1ZQFA 4UARA 3PMNA 3R65A 4F4WA 4I5SA 2HHWA 1WJZA 1QQ7A 2OWOA 2JH1A 4PHZA 3DXRB 5J8YC 1ENVA 3RJGA 4GKKB 3MHHC 5EWEA 3AU6A 1Y6XA 3HPLC 4BUGA 4KLUA 5J0SA 1KQQA 5JQGA 3VBBA 1RYUA 4RQ4A 1S77D 1VDVA 4J9QA 3ISDA 2F1MA 5EIBC 4C4RA 4JV5B 1TAEA 3UM7A 1YTFB 1V9PA 4DV0B 3PY8A 4KMUA 1S5LZ 3MR3A 4AI8A 4QZEA 5B66Z 3W7SA 1SZXA 3ABMB 4G3IA 2B1GA 1XU4A 4I4TA 4PZNA 3IG8A 4EYHB 1UCVA 3FC4A 2EIJC 3B09A 4F4LA 4JYCA 4I2IA 2W7OA 1KU9A 3CSXA 1U97A 3L75H 1BZKA 2VWKA 1K92A 3CP1A 1B22A 3JAWB 5AI4A 3PVXA 5KUKA 4DV6B 1VQ7V 2W3SA 5IT9N 2HR3A 1IXMA 2NRTA 1QSYA 7ICRA 7ICHA 1Z4NA 1Z00B 3M6KA 3CW2C 5LMNO 3QX7A 1VIBA 2RNBA 5KTQA 4J9YB 2LI6A 5DDYA 1L7PA 2NRZA 1ZUQA 2WF9A 3SPCA 5IYZA 2E5SA 1QR9A 2HKOA 3OGUA 3QU4A 4F50A 1YDXA 3MGVA 1Q7YW 1AR4A 3LDDA 1EN6A 4OGQB 4DV5O 4DO9A 2H5XA 4FK5C 1M6YA 2IOFA 4DCCA 3JPNA 3L3FX 5J2HA 4FPPA 4WCEV 1ZD2P 5AICA 1TVKA 1ZWIC 5D46A 3E8FA 2ZNIA 1HJPA 4CNQA 3N97B 2UXDB 2KHVA 2FI1A 5E1AC 5KFDA 4F4YA 1QSSA 2M6YA 3AUOA 3WB1A 5JJJB 1VQ6V 1PNKA 2RJZA 5CBFA 3FB6C 1X9SA 4LF6O 2F1JA 1KECA 3M8RA 1XMQO 3G6YA 3RRGA 1L6NA 1XOUA 4JPRA 4F5PA 4NLBA 3AG1B 2BHNA 3KCYA 2QB0B 3KBBA 4IL6U 5IJ0A 5JWPA 1AB3A 2UVUA 4NTXA 4PZOA 3KCXA 4C7ZA 5KHKA 1THZA 4C7UA 4RQEA 1ZQJA 4PA9A 2D8CA 2Y0SC 4I0XA 3M8AA 5IJ0B 4QZAA 3LDCA 4ZKIA 7ICEA 4B7KA 2D3DA 2ARHA 3RYCB 4CF3A 3TANA 2ISOA 2Y9UA 4EYIB 1QLEB 3QU2A 4KX5A 3Q8PB 4PGXA 2W0XA 4YMOA 2F8LA 4MVMA 3MR5A 5EE1A 2D6FC 2AHZA 3CYOA 1H2LA 3K79A 5B1AC 5JUMA 2JEFA 1FXHA 4NXMB 4C4TA 4J9SA 1X59A 2R9RB 4P30A 4O3MA 1QVFU 2JDIG 1I5XA 4JI8B 1Z5WA 5C8YA 1DRGA 3SYPA 4H0LB 3RAXA 4W4LA 3C21A 1SZTA 3RJHA 1L0LH 1V55C 2N1RA 4IQTA 2IM9A 3UCSC 1SZHA 3L9DA 2RQ6A 2Q68A 1UFIA 2UUCB 5GTHZ 2LW1A 2DF4B 5D4BA 1PVPA 4DV4O 5J0PA 4GKKO 1KKXA 2K4IA 4ECVA 3SJAC 2BCSA 3KKAC 3KTQA 1ZQHA 1SF9A 3HKCA 4D7SA 4HBNA 1F4MA 3FB7C 4DSKA 3S6JA 4IR1A 1N2XA 8ICLA 2DKZA 2GOLA 1NTZH 2XUMA 3ZS8C 4KHPO 2XASA 2BQ3A 3M7DA 2JJ2G 1QQ5A 3BA9A 1ZQPA 4BWMA 2Q73A 3HKCB 3JATB 2Q67A 1V54B 1RYSA 3ASOC 8ICCA 2MU2A 4M0AA 4KFMA 3C5GA 1KB9F 2OT5A 4ED6A 2PFNA 2IJIA 7ICOA 2LGWA 2ZIUA 2ZE8A 3OTFA 2HMXA 3V7JA 1KDHA 2WB1C 3ZN0A 2O57A 2EZZA 3S3XA 4PHAA 3ASNC 1Z1VA 1VEWA 4RQ0A 5J2IA 2WTFA 1HR0B 5L1IA 5KL8B 3PW4A 3Q8SB 5C0YA 4Z6DA 4YD2A 2YDEA 4C8OA 2PMZC 2NN4A 4GFJA 2YB4A 3TQ1A 9ICVA 1X6JA 4JYBA 4GKJO 3H8MA 2KZ3A 1BNOA 3CS5A 4RQNA 4R6ZA 3MR2A 2R9AA 4PJ0Z 4XDKA 1VQKV 1XSLA 5BOMA 2WLIA 2LBOA 4KLFA 5KFNA 4DSJA 2ZTDA 5FL7G 2ZQMA 2WAMA 4ELUA 5AI5A 4LF9O 1U9LA 2WLIB 5EC2C 3ETQA 2VA8A 4IHJA 4I2EA 5L1MA 2YIBA 4DV0O 3CC4V 4D6TH 5AK3A 2K60A 4B3TB 2F77X 1SXDA 3LWMA 1H2NA 2QM4A 2ZJAA 1VQOV 2JVDA 2F8KA 4Q8FA 3LSUA 4EX6A 2KIVA 4IQVA 2HEPA 3EXAA 5KFFA 1JJOA 1X4TA 1N61A 2PFQA 1IBKO 3HB3B 5ALGA 3JPRA 1IURA 2VRZA 4UAYA 2ADQB 2HHSA 1BNPA 2KHQA 1YZBA 1WPBA 3M9OB 1QTMA 4DV1B 3WU2Z 1BS3A 3NVWA 1K4CC 2XCPA 4FZ0A 5BMVA 4MFCA 4A8EA 1QBZA 7ICGA 4WFGA 4EKWA 2QEXV 2ZKOA 2XGPA 3ZDDA 2C2AA 2AGQA 1SA0B 1B4FA 3KKYA 1A6SA 3E8GA 2IH1C 3MBYA 2NNUA 4YIPA 5ALZA 3X2QB 4FLYA 2E74B 9ICGA 1QLEC 1TUEB 2AW9A 2FPLA 3KHGA 2LFRA 4RUAA 1DLBA 3TXSA 2XICA 1KRPA 3VOUA 3CD6V 2KOBA 2Z5UA 4JAAA 4BIOA 4GC7A 1NK9A 1TAQA 1JXEA 1YCIA 2IW5A 4ECQA 3ZMTA 3WKDA 8ICEA 1NT2B 2K9PA 2QGNA 4AQYO 2ASJA 1Y74B 5KHGA 1ZQTA 1S97A 5HP4A 2KSOB 2XOKG 3KZXA 3TGUH 4FZMA 2GV9A 2WLKA 1RM1C 4Z6FA 5ALLA 5KG6A 1BMFG 9ICQA 4CS2A 5KAFZ 4M9LA 3H40A 3HKDB 1S76D 4DV1O 3ZRXA 1L7NA 5ALUA 3K5LA 3L71H 3NTUA 2PUSA 4Y2TA 1NKCA 1NK0A 9ICBA 2HOQA 1VMGA 5GTHU 3L70H 4XUSA 1N63A 4IYIA 3BVOA 3SGIA 1KFDA 1L8LA 1R6NA 4JV2A 4BDPA 1IBKB 4UVCA 4Z1MG 3G6EV 2WAQF 2CPRA 2YMMA 3EPGA 3V72A 4QZCA 2FMPA 4LH6A 2HHHO 4N23A 3E8BA 3SV4A 4ICGA 2KKPA 2V4QA 2QB1A 7ICUA 2KE7A 3ONNA 4B3RB 1OW5A 4JI6O 3AK2A 4LR3A 4MVZA 1YJNV 4UB1A 2A79B 1X9XA 3DDHA 2UXDO 1VQ8V 2QKCA 3GIMA 4J9KA 2ZIOA 3ZMUA 4BW5A 1L7MA 4QWAA 4EBEA 1ZQMA 1K5SA 1N60A 4DV5B 1VF6A 3Q8LA 1BT8A 3PW5A 3IN5A 5KFAA 3CB2A 3C2KA 4BW9A 3IG5A 3KOOA 2DQ0A 7ICPA 3U0ZA 3P32A 1RYRA 1FXKC 5IILA 1JFFB 1GN3A 4OJ5A 8ICGA 5A9GA 3MABA 2ZIWB 4YG2A 4I0XB 3KZIZ 3I55V 3K4GA 4F92B 1JR9A 2HJFC 3M99B 2UXBB 3LNMB 3IP4B 2CAZC 3D2QA 3GIKA 4K8ZA 4ICAA 2FLPA 1Y74A 3AQFA 4UB6Z 4X9QA 2QTSA 2Z3YA 2OEHA 4JI0B 4IR9A 3IC9A 4N21A 2P90A 4NXNB 2DPJA 2IBZH 3MFHA 1ZYQA 3ZEDA 4IQUA 4DFPA 1ZLZA 5KFMA 2ZIVA 4TQFA 9ICJA 4DL3A 5L3BA 3O9OA 4EZ9A 4QZDA 3AG2C 4X1YA 4JF3A 3ZIAG 1SV0C 1NK5A 4NY8A 3ZMZA 4WFAV 4LF4O 2V4RA 2HLDG 2YUAA 5GONB 5LBQA 2VANA 1FD9A 1T5EA 4MEYA 1RZTA 4O4LB 4X1YB 1H38A 5DM6V 4LZDA 4FFKA 4LBEC 1ZOLA 1ZQGA 4IC9A 1Z1BA 1JALA 4OJPA 5ALHA 4ELTA 9ICPA 2XCAA 2P4KA 1SA0A 3AG4C 2BOBC 4K0KO 2UXCO 2EIKB 2KG7A 4DWIA 5KT5A 3M9MB 2XAGA 4O4LA 2X0LA 2B0CA 2OHFA 4LF8O 1AILA 5BZBA 5KG3A 3TETA 2HOIA 4EFEA 4HYKA 5K4LA 3IM1A 1ECWA 1Q90D 2W55A 2H8PC 3C1YA 2K1EA 1SKRA 2DQ3A 5TISZ 2EAOA 1PVQA 5B3SC 1ZQQA 2A0LA 2HHQA 1A32A 4FZ1A 1IVSA 5KAIZ 1HP8A 1NKBA 2QKQA 2KJ8A 2DN9A 3ZMVA 1WB8A 4FVMA 3DV9A 2EAMA 3UMGA 5DLFA 1ZQLA 1LR1A 1ZL8B 2WLLB 1JRPA 3UQ0A 1FEZA 4LC1A 2FJ6A 2ZDIA 4ECTA 1XNQB 3ZD9A 2EILC 3OT7A 4NVPA 1OZ0A 5KL1B 3H0RB 3FYIB 2KICA 3IAYA 2DYRB 3N2GB 1N5WA 4KX3A 1AJNA 4LF6B 3RH5A 4JI1O 4GKJB 4YR0A 4WJ3B 1M56B 1EM1A 4OX9O 5IYCO 4RQ8A 2F4VB 3WKAA 1T3QA 1NOMA 1YIJV 3FDSA 4JGSA 2J6UA 2XTAA 3ZRWB 1XS9D 1MZFA 2BSKA 2HP8A 4NLCA 2RDCA 2KFNA 2JRZA 3RYHB 3N7PD 4YCXA 1F51A 5AM5A 4NV0A 1VQ4V 5F3XB 1WWUA 4K4IA 3G80A 3ZRWA 3STLC 1Q86W 3SAHA 3E89A 4M6WA 3CP8A 2H94A 4UAZA 1HNZO 1XEQA 2JGAA 3ZI4A 3RGBA 3SR2C 3J81N 4FO6A 1NJZA 4ELVA 2Y1JA 4Y2PA 4DFJA 3JAMN 4GC6A 4FFBB 3C29A 3H01A 1HNXB 2RHFA 2OM6A 9ICCA 3PJSK 1CUKA 2VQEO 2MK3A 2KD1A 4K8XA 1BHAA 4UAWA 4DYLA 3T1YB 1K8AW 1AI6A 2B6GA 3G67A 3ABKC 1O08A 5KFQA 4J9ZB 1LV5A 3C5FA 3E86A 2CUGA 8ICKA 2ESEA 2HOFA 2EQYA 4DR4O 3H4DA 1TK5A 4MW8A 5J2DA 3STZC 4YJ2B 3KKAA 1HNWO 2HSZA 2UVVA 5J2BA 2GO7A 1COOA 2H3VA 3OTOO 9ICWA 5AKJA 4CH3A 5KG4A 2GHYA 5AK5A 2YMLA 8ICAA 3OR6C 4J42A 1P7GA 5L3EA 4WFHA 4RQ1A 3IFXA 1BHBA 4JI2O 1V38A 3BZKA 5KFBA 5KUMA 4KTQA 3HPOA 4OJLA 5EBLC 4DOCA 2J6SA 4O4HB 1RFYA 1RPOA 2ES6A 4MTOA 3MDSA 4MEXA 3CCUV 4XQ8A 3CXHF 2GH1A 4O4HA 2ZDIC 5G5HA 4MF2A 3NR7A 4FLTA 2EBOA 4F2RA 3CCMV 1SL1A 3K9AA 2Q8VA 3SPIA 3F5WC 3ABLB 4YXJA 4DK1A 5CJ7A 2JR5A 3HKZC 2JV3A 2KP7A 1P49A 5LMUB 3CXCU 1X2IA 3BPZA 1FS0G 4QIWF 4I50B 4QZ8A 4M9GA 4USAA 4P9OA 5JU5A 3NRWA 4GLXA 3QO7A 1YI2V 1FXKB 2YIBD 2Y0IA 5DN6G 1A76A 2OXOA 8ICYA 3F2CA 2FPKA 3SYQA 2GWSA 1MG1A 2QWOB 3AEVA 3WG7B 2CN1A 4JI0O 5KLVH 1NK8A 3D8CA 3PSTA 2DMXA 3A0HU 2LKYA 4ZHQA 1PZNA 1JVMA 1KFTA 4UV8A 1L3UA 1I94O 4KLHA 1M9NA 2LPEA 1PNMA 2NV3A 5HMMA 3DSQA 1KW4A 2ETNA 4DQSA 3RBDA 4MVQA 1BPDA 5F2VO 1PK3A 1Y76A 4RNMA 3V7LA 4PHEA 3S3WA 4PH5A 2GUZA 4B9VA 3SEIA 4JI5B 1X9WA 3HT3A 5IJ9B 1SZPA 1FXVA 4I2DA 4FMTA 1OCCB 4UAVA 4R63A 4CH4A 1T94A 1Y76B 2FYUH 3BQTA 5AKHA 2F2AB 1TAUA 3GWOA 1MSDA 5IYDO 2QKAA 3N28A 4J9PA 4IRKA 4M04A 3E35A 5BR8B 2KZZA 4NXZA 1KMIZ 4I55A 3TAQA 4UCSA 1G1XB 2H3OA 2ZUCA 1V55B 2QR4A 1SGGA 1AR5A 2RP5A 5ALEA 3JAKB 3I1YA 4U7NA 1PD3A 3JPOA 4U3JA 2LM1A 1M56C 3RB0A 4X8AA 3PR5B 2AHOB 4X20B 1WPXA 3AMZA 2W6JG 2DBYA 4QZBA 4LF4B 3G6XA 1K7DA 3Q8RB 1ZX3A 4QZIA 5L9XA 2LM4A 2R70A 5CA7A 5L1KA 1JQ0A 1VF5B 3QZ8A 4RT2A 5KA5A 3BS5B 4OCZA 3OMAB 2XGQA 4CF5A 3FX7A 8ICHA 5JCOA 2YC0A 3OPXA 3LYSA 3PW2A 4DOBA 4PA6A 3T3FA 4H13B 4LWSA 5KT6A 4J9RA 4P4MA 5DBCA 2P67A 3LK9A 1BVSA 1K3EA 5D49A 3K59A 2JEIA 3H1LH 2YMPA 1K5OA 4RAIA 1U49A 4JI3B 4B3SB 1ORQC 1GO3F 4J9MA 3JD3A 4BXOB 4FBUA 1ZQ1C 1SC5B 2F95B 3FB8C 3CRCA 3WG7C 4C8NA 3AK3A 3CWBH 5KG0A 2DUYA 5EZYB 1SKSA 4UUJC 2PFPA 2X6CA 3ETRA 4BXOA 4IT5A 2HDOA 2IH3C 2AU0A 1YZ6A 4ECZA 1NBMG 3RYIB 2F66C 2O6KA 5CP2A 2GTAA 4UB3A 4GZRB 1WLEA 4JASA 2P5OA 3RVYA 3C23A 1J5EO 1XHZA 4ZOLB 1FKAO 4AYBC 2LO1A 8ICVA 3OGIB 1ZL8A 1IBMB 4IS7A 1NZ6A 4CBCA 3T2MA 4R8UA 1HUZA 4KLMA 3APOA 2E5LB 3TADA 3W7UA 2UUAO 4O3QA 4RO2A 5CRXA 4X66B 4Y2RA 2QM8A 4QE9A 3K08A 3WKEA 1DF5A 2WA4A 2E1EA 1YVWA 2HHXA 4Q43A 3ABMC 5EK0A 1UJWB 3OUSA 2ZUDA 4JV5O 2BSKB 5ALVA 3NVVA 1AROP 3MFIA 4DL4A 1SWVA 1ZQRA 2BCRA 5IIKA 1SIJA 4F5QA 1NTKH 5JJNB 4OPHA 2AXTU 5J0WA 5J0OA 1NK4A 1WWVA 2PF4E 5DG8A 4IGGA 2Q7HA 3JD4A 4UAUA 1B6QA 4YN4A 4O4JB 3H8WA 5GW7A 1PM9A 2W54A 4RZRA 3N27A 3U10A 2ZXIA 5BPCA 2Q6AA 3OMIB 1IXBA 5J0RA 1ZSPA 1FO4A 1W59A 4UBBA 4LNUB 4TQSA 2OTLV 3UMCA 1XILA 3Q4HA 2GDSA 4UXNA 3ABTA 2G0AA 4J7KA 4DR5B 3T5JA 1F23A 4RNOA 1KQSU 4F2SA 4UB8Z 5ALWA 2F1IA 3WK8A 4O0IA 1KLNA 5KT7A 1ZJMA 2AZ2A 2CTPA 3CX5F 5AKLA 2B9ZA 3RWRD 4J11A 9ICUA 5DG9A 2IA6A 1FPOA 3PX0A 4UV9A 1YTFD 1N8RW 5AM1A 3LUTB 5J2TA 4B9LA 4FIPC 1NNLA 3E83A 8ICOA 1HW7A 3HP6A 1IG6A 1NJWA 1QH9A 2KQXA 1Z5VA 1Q8IA 1A0PA 2I1QA 2C2DA 4GCZA 4F4ZA 3I28A 5DB6A 3ZHQA 1GKFA 3TCUA 3J80N 5IIJA 1DK3A 1WCNA 4NL9C 4CE6A 4BIUA 5EYPA 2I9GA 2JZBB 2HVHA 1W0JG 3JD2A 9ICNA 3SDLA 4BIZA 1S5JA 2R9IA 1YITV 1HNWB 1PK1A 2HJDA 3B9JA 4BWJA 5J2CA 1I7FA 3EUB2 4KLTA 2DQNB 5KFOA 4F4KA 3AG3C 5JH7B 2VQFO 4IQWA 4O5EA 2HG5C 5J2EA 1MQ2A 7ICIA 1COKA 2K4PA 3CCVV 4Z2WA 4KXRA 3H0MB 5JH7A 3BRCA 1ZQCA 2BDPA 5EWGA 1SV0A 2VIXA 3H1JH 4IYHA 4LWSB 2JGDA 1LUWA 1SESA 4J9OA 4O3SA 4C80A 2LFSA 2UUBO 2W9CA 1OCZB 1QHTA 4UB4A 2OIEA 1NZPA 1N48A 1C7YA 2BPGA 2RRDA 4JB3A 4LJXA 3BQ1A 1TAMA 2LYBA 5D5QA 2OCHA 3B8MA 5JVDB 3PSFA 1Q81W 4WFBV 2NLJC 3IDWA 9ICAA 1CPYA 3UXNA 4ECRA 2YXYA 4PA3A 3TADC 1TV9A 5J0QA 1TE2A 2DYRC 4RWUA 1NR1A 4RPZA 2ATKC 3H1KH 1N36O 3H0LB 5KFYA 4DR2B 3T5KA 1R3LC 4Z6CA 1H2KA 4GX0A 1ZAUA 2HVJC 4JWMA 1OCRC 5AKEA 2ZIXB 4JI7B 4JMUA 3QO5A 4TV8B 1V85A 2H3IA 7ICQA 1BPXA 2C22A 2HCFA 2EJ7A 1SS3A 3BAAA 4DUYB 5LOVB 2E8OA 2W9BB 2V4DA 2CTWA 2F4VO 3AQEA 3SV3A 4KLGA 1VQPV 4B3MO 3K1ZA 4ED1A 4JZ2A 5KHJA 3JAWA 1Q3UA 3KG2A 3AM9A 1LKYA 3PR4A 3CC7V 3OEHG 1G8MA 3RB6A 4O3OA 2KK0A 3KFUF 1DXSA 1IX9A 2P6JA 4QZFA 1H2SB 4YXWG 3CEIA 1AI5A 1PK1B 3CRAA 3ABUA 1VF7A 3PSIA 2CK3G 5CB4B 5ALSA 2KKWA 4CDGA 2UUBB 1M93A 1ZQWA 1P7BA 4YJ3A 4TV9B 3OGCC 1WYGA 4B9UA 1RPRA 5DB8A 2R8KA 4X1KA 1SRYA 5CWRA 5JCOC 3OW2U 2QLTA 5H2FZ 3SPJA 1KD1W 3BS5A 2ZM6B 1MA1A 4U7CA 3JALA 4MVSA 5CA1B 1BGXT 2YXLA 4Y2XA 4UB5A 4F8RA 4LCUC 3WK4A 3GWKC 1KTQA 3IJ4A 8ICXA 3JYCA 1GMGA 2E8MA 4YHHB 1N33B 4E4EA 1JOYA 2W8KA 2YTUA 1I5YA 5GTIZ 3WB0A 2RLTA 2PI4A 4KLDA 5GTIU 3P3NA 2BGWA 2B1IA 1R3KC 4XRHA 3H8SA 4MTXA 2Y48A 4QIWC 4LF9B 2IOHA 2BQUA 3SYAA 2QA4V 1XNSA 4O2BA 1OJHA 2HBKA 2R8JA 1Q3VA 3U26A 5AKGA 1YT3A 3CHXA 2UXBO 2D2CB 2Q5ZA 1NQTA 4DRXB 4Y2JA 4UVAA 4O2BB 2Z7JA 3TKAA 1NKEA 2W8LA 3UXPA 1AR1B 2ZIMA 2XNDG 4JV0A 1HDJA 5JTIA 2WF8A 4PI2A 3KHHA 1O03A 1Z19A 2WWWA 4J7ZA 2FMSA 1MC8A 1TA8A 3OM3B 4IRCA 2G38A 1GRJA 5IY5C 4HNAA 2MSNA 5B5EU 5B1AB 4K35A 3UPQA 3FAHA 4UBCA 4PV1B 1OUQA 4DUZO 1BCCH 8ICQA 2FKXA 4EX7A 3B40A 4P2HA 1MZEA 1KBHA 1FIQA 2ADPA 4YVZA 3QF7A 4P0QB 4MSWC 1GAXA 5JVDA 1ZQKA 9ICEA 5CA3A 3GB7C 5AI9A 1S10A 3IC7A 5CBGA 4NTYA 4C8KA 2L6LA 2Q7GA 3C2LA 2WLMA 3V6KA 1EFRG 3HKZF 1M1KW
chains in the Genus database with same CATH topology
2DYRB 4KX3A 1AJNA 2YX8A 3A0RA 3CCRV 4WJ3B 1M56B 4WFEA 4X88A 3W7WA 2VKQA 5IYCO 2W03A 2BDUA 3DTUB 1YIJV 3K0DA 4JGSA 4KP4A 2AHYA 3SPGA 1K97A 3ZRWB 5LHHA 3SYOA 5CMUA 2JH7A 3D2SA 2DYSC 4NLCA 1NKDA 1W0KG 1Y66A 5H6QA 1COWG 4MTFA 1QLNA 3DEEA 3N7PD 2H3FA 1F51A 4NV0A 1FFTB 1P4RA 2HVKC 4X89A 3ZRWA 4QNHB 1NJIW 3STLC 3OAAG 1VQ4V 3WFVA 1Q86W 3SAHA 2EZOA 3E89A 2EINB 4P2ZA 3CP8A 2H94A 3NUQA 3ZRVA 2JGAA 1R3IC 5LGTA 1EBOA 3G71V 5L3FA 1Y4MA 3QO8A 3W7TA 3C29A 3H01A 1M57C 1NH2D 2RHFA 5IDJA 2G5HB 2OM6A 3PJSK 3RVZA 2IJHA 4PL1A 4PDLA 3CCQV 2M0NA 2MK3A 2KD1A 1BHAA 4H33A 4JAVA 3ICXA 1MABG 1AI6A 1K8AW 4H37A 2DWDC 2FTKA 1JX9A 3ABKC 5B1NA 3BY6A 2DWEC 4J9ZB 3AG4B 2HBJA 1KP2A 3E86A 2HOFA 3OE7G 4PDVA 3NXSA 1GTOA 4MW8A 4DO2A 3STZC 3CCEV 2HBMA 4QPJA 1YJ9V 4BJQA 1VQLV 2H3VA 2EZPA 4Q20A 3LVVA 2GHYA 1S0VA 2WLJA 3K3WA 3OR6C 5L3EA 4P0PA 4WFHA 4RUEA 3IFXA 1BHBA 4MVUA 5KUMA 5LHGA 4AYBF 3K04A 4OJLA 1EZJA 3T79A 3AL0B 2P7TC 3ASNB 5EBLC 1F44A 3SMVA 3F53A 5CBHA 2D3OW 1RPOA 3ABLC 5LHIA 3E2EA 4MTOA 5KA6A 2B5UA 5B1OA 2LHTA 1AJQA 1GM9A 1NZBA 3CCUV 1E79G 2KKVA 4TSFG 3OUFA 2GH1A 3E0FA 3SJQC 2JHDA 3RFAA 3SAFA 2ZDIC 3R65A 2EBOA 4I5SA 3CCMV 3K9AA 2XAFA 2W7PA 3SPIA 2F76X 1PVRA 2JH1A 2CRXA 3ABLB 3F5WC 1S3JA 2R18A 1ENVA 3HKZC 1FXKA 3MHHC 4FJCC 1YJWV 3HPLC 4BUGA 3CXCU 2G06A 1FS0G 4QIWF 1ROPA 4QPKA 3VBBA 1S77D 4P9OA 5HFMA 3UM7A 1YTFB 1R6KA 4FE3A 3NRWA 3PSPA 2DW4A 3QO7A 4CZZA 1FXKB 1YI2V 5DN6G 1OHHG 2OXOA 3W7SA 3F2CA 2KNJA 3F2DA 1MOFA 3ABMB 1K4DC 3SYQA 1MG1A 3ZMSA 1QVGU 2B1GA 3WG7B 2CN1A 3UKMA 3IG8A 2EIJC 2ITCC 3PSTA 1DTOA 4JYCA 4F4LA 4R8CA 2LKYA 1JVMA 3ABKB 2W7OA 4UV8A 2KJ9A 1NVPB 5IYBO 1K92A 3CP1A 1R3JC 1M9NA 5KUKA 1VQ7V 1PNMA 3M6ZA 1KP3A 2NV3A 1V54C 3ASOB 2HR3A 2ZR3A 1IXMA 1ED1A 4MVQA 1XL4A 3AEIA 1PNLA 1F4NA 3M6KA 4ZBMA 5A0LA 4J9YB 1FXVA 4FMTA 1OCCB 3SPCA 1T94A 2E5SA 1QR9A 2HKOA 3MGVA 1Q7YW 2F2AB 2W0FC 3LDDA 3C28A 3GWOA 5IYDO 2BOCC 4FK5C 3L3FX 1QCEA 3E35A 4FPPA 2DYSB 1SERA 4WCEV 1ZWIC 2W04A 2IJKA 3E8FA 4C0ZA 2ZIWA 3MHSC 2GSMB 1V55B 1NH2B 2IU0A 2KHVA 2RP5A 4U7NA 5E1AC 1PD3A 3ETEA 2K4HA 5LGNA 3B8NA 1GM7A 4ASUG 1M56C 4KUMA 1VQ6V 3K03A 1PNKA 2KB1A 5CBFA 3FB6C 4X8AA 1KECA 4R50A 4OO1J 1L6NA 4JPRA 4PDMA 2LYAA 1WPXA 2K89A 4NLBA 3AG1B 2X6AA 5J9PC 2W6JG 2WLNA 2G08A 1K7DA 1OCZC 4I9WA 2ZR2A 4L87A 4QJFB 1JQ0A 1THZA 3F7VC 4RQEA 4PA9A 3T1CA 2Y0SC 3DGEA 5KA5A 4KMOB 1H8EG 3LDCA 2WSSG 3E8HA 3OMAB 4ZKIA 2ITDC 3LSQA 5B3SB 3T4DA 1QLEB 3P30A 2K8BB 4KX5A 3OPXA 2JIZG 4HYOA 3ZRSA 2F8LA 3LYSA 2UXXA 3D3IA 2D6FC 4MVMA 4PA6A 1MA7A 2AHZA 4WFFA 3CYOA 3K79A 5B1AC 2QKSA 2XAJA 1YHQV 2P67A 1FXHA 2UXNA 3ZJZA 1K3EA 2R9RB 4P30A 4O3MA 1QVFU 2JDIG 1I5XA 4JTDB 2JMGA 2MRLA 2X7RB 4RAIA 2QE7G 1DRGA 2JEXA 1ORQC 3SYPA 1GO3F 3JD3A 1K73W 1SZTA 3T4ZA 5H6RA 1ZQ1C 1V55C 2N1RA 3FB8C 4P0PB 1SZHA 3EFFK 3CCJV 3WG7C 2Q68A 3ALRA 2WB1F 4UVBA 3N7RC 2DF4B 4UUJC 1PVPA 2X6CA 3LDEA 5EBMC 5EBWC 4XBFA 1VQ9V 2Y69B 2IH3C 2K4IA 1NBMG 2KVCA 2WLHA 4MS2A 1WLEA 4XDLA 2E1FA 1F4MA 3EHBB 1OCCC 3FB7C 4JASA 3CMAV 3RVYA 2GOLA 2XASA 3M7DA 4BX9C 2JJ2G 2ZIUB 4AYBC 2VJ5A 1NVPD 2A3VA 1HEKA 2Q67A 1V54B 3ASOC 3D36A 4KFMA 3PZPA 3BEHA 4CBCA 2OT5A 1KKDA 3T2MA 2IJIA 3ETGA 2ZIUA 1S72V 3W7UA 2HMXA 4RO2A 5CRXA 3I56V 2WB1C 2OCCB 2QM8A 2XAHA 4QE9A 3ZN0A 3K08A 1XO0A 3ASNC 1DF5A 3SYCA 2E1EA 3CMEV 2HBLA 4PELA 3ABMC 5EK0A 5KL8B 1UJWB 3OUSA 5HFLA 3RF9A 5C0YA 1H8HG 4QE7A 1AROP 3ZCCA 3VCBA 5HR7A 2PMZC 2YSUB 4GFJA 2YB4A 4JYBA 1DF4A 1CP9A 3N7SC 1VQ5V 4R6ZA 4XDKA 2V7QG 4PDRA 1OCOB 2IJJA 2HFEC 1VQKV 3F5AA 2K4EA 2YEVA 1HIWA 2K8AA 1B6QA 3JD0A 3JD4A 4PA7A 2WLIA 4OJ6A 3SPHA 5GW7A 2KEYA 2OCCC 5CN0A 2MA1A 2LBOA 1KBUA 2ZXIA 1UPHA 2Q6AA 3OMIB 2H3QA 4MW3A 3ZN1A 1HWYA 5FL7G 4QNLA 2WAMA 2ZQMA 3VC8A 5L3GA 4RQFA 2OTLV 4GX1A 2WLIB 4UXNA 3JD1A 5EC2C 1L1FA 1JJ2U 3ABTA 2G0AA 2WAQC 3CPWU 1F23A 3SAGA 1KQSU 3TK1A 2ZXHA 3FB5C 3CC4V 4MVRA 2F77X 3GZFA 2OTJV 4TT3G 4HAMA 1VQOV 4UV9A 1YTFD 1N8RW 3LUTB 1G4YB 4FIPC 2Y69C 3OR7C 3E83A 3CCSV 4OJOA 1JCHA 3HB3B 2PI5A 3LVWA 1A0PA 2KHQA 4GCZA 1GKFA 3TCUA 4BIUA 2JK5C 1K4CC 1W0JG 3JD2A 4A8EA 4BIZA 1QBZA 4WFGA 2R9IA 4EKWA 1NR7A 3K06A 1YITV 2QEXV 2C2AA 3AG3C 1RM1B 2DQNB 2EILB 1A6SA 3E8GA 2HG5C 2IH1C 3X2QB 2NNUA 1AI4A 1QLEC 1TUEB 3CCVV 2LFRA 3H0MB 1DLBA 3LSSA 2XICA 1KC8W 3RW0A 3VOUA 2EINC 2VIXA 3CD6V 2KOBA 2Z5UA 2KJ5A 2WPDG 2IW5A 3ZMTA 1SESA 3O0FA 2LFSA 2ZXWB 1OCZB 1GM8A 2RRDA 3CRXA 2XOKG 3AG1C 1TAMA 3KZXA 2LYBA 5C93A 4FZMA 1VQMV 2WLKA 3AG3B 1RM1C 3B8MA 1Q81W 3PSFA 1BMFG 5IY5B 1W2BU 4WFBV 2NLJC 4GX5A 1CPYA 1YSCA 4PA3A 4JTAB 3SQIA 2ZIVB 2ZIXA 2DYRC 2H3ZA 1S76D 1NR1A 3ZRXA 5HR6A 2ATKC 2EJRA 3H0LB 1SETA 1R3LC 4GX0A 4E2LA 4GT1A 5T14A 3OMNB 2HOQA 2HVJC 1D8BA 1OCRC 2ZIXB 1R6NA 4JMUA 4UVCA 4Z1MG 3QO5A 3F7YC 5EC1C 3RBZA 2H3IA 2WAQF 2CPRA 5H9CA 3G6EV 4JAUA 1K34A 3MD0A 4N23A 3E8BA 4CRXA 2EIMC 2KKPA 1K9MW 3AQEA 2Q4TA 1VQPV 3K1ZA 3ONNA 1Q3UA 3KG2A 1XL6A 3D2NA 3FKSG 2Q69A 3CC7V 3OEHG 4MVZA 1YJNV 1G8MA 1WUDA 2A79B 3KFUF 1VQ8V 4OXSA 4TWKA 1JPXA 1PKXA 3ZMUA 4BW5A 2VJ4A 2Y0SF 2P6JA 2KIWA 2OYYA 1LNQA 2ZG6A 1BL8A 1K5SA 2EIKC 4JTCB 1AI5A 4YXWG 2EIJB 3ABUA 1QR8A 3OFNG 1M90W 3F2BA 3PSIA 2CK3G 2QM7A 3IN5A 4FZNA 1OCOC 3QNEA 4G2KA 4CDGA 2QTOA 1P7BA 5B1BB 3CC2V 3B77A 1URJA 3OGCC 3IG5A 2DQ0A 2YB1A 1RPRA 3P32A 3IGAC 3JCZA 2G09A 1SRYA 1FXKC 4R7CA 4XDJA 4BAYA 2WLLA 4OJ5A 5L3DA 2ZIWB 3AG2B 3OW2U 3FYIB 4U6PA 3K0GA 3SPJA 1KD1W 4HZ3A 3I55V 4U7CA 2G5IB 2HJFC 3M99B 4MVSA 3LNMB 3OEEG 3ML0A 3IP4B 4MT8A 3D2QA 3CCLV 4ICAA 4LCUC 3AQFA 1J95A 4LP8A 2Z3YA 2ZD9A 3JYCA 1GMGA 2X6BA 4N21A 2IU3A 2P90A 4PL2A 4DXWA 1JOYA 2WLMA 1I5YA 1S5HC 3ETDA 2PI4A 1K5QA 2B1IA 1R3KC 1M1KW 4MTXA 2Y48A 2ZIVA 4QIWC 2XVTA 4P9PA 3SYAA 4NWIA 5L3BA 2QA4V 1VQNV 1XNSA 3FYEB 1Q82W 2HBKA 3AG2C 4JF3A 4RUFA 3ZIAG 2V1DA 1Q3VA 4MTGA 3ZMZA 4WFAV 1E1RG 1YT3A 2XIDA 2HLDG 3GU3A 5LBQA 1NQTA 4UVAA 2XAQA 2Z7JA 1AR1B 1H38A 5DM6V 2XNDG 5B1BC 5L3CA 2K8CB 4LBEC 4FZLA 4IC9A 4OJPA 1Z1BA 1PL0A 2A9HA 2F43G 4G27B 3AG4C 2BOBC 2EIKB 3W7XA 4G28B 2XAGA 2DGZA 2X0LA 1Z19A 2WWWA 1R73A 4WF9V 1AJPA 3OM3B 5BZBA 5IY5C 3TETA 2HOIA 1MSWD 1E1QG 2G07A 5B1AB 1K33A 4CGZA 1M57B 2PMZF 1ECWA 3F5EA 2OH2A 2H8PC 2XI9A 2K1EA 2ZXWC 4P0QA 4ACOA 4U7OA 2DQ3A 2EIMB 2W6IG 1OUQA 5LGUA 1PVQA 5B3SC 2A0LA 1H2GA 1CRXA 1P7DA 4PA4A 1CEZA 2KJ8A 4P0QB 3ZMVA 2JJ1G 4MSWC 2LP7A 3G4SV 4MVOA 1OCRB 2KV2A 2WLLB 3GB7C 5CA3A 2M7WA 4LC1A 3X2QC 3CYMA 1IIPA 2JEUA 3IC7A 5CBGA 4GX2A 2ZDIA 2EILC 1OZ0A 1AI7A 5KL1B 3H0RB 1GK9A 2KICA 1EFRG 3HKZF 2YEVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1F A;  4QIW F;  5C0Y A;  4CGZ A;  2HBK A;  2RHF A;  4OO1 J;  1YT3 A;  4NLB A;  4O3M A;  1WUD A;  1GO3 F;  4NLC A;  2MA1 A;  4QJF B;  2HBJ A;  3SAF A;  1D8B A;  2KV2 A;  2HBM A;  3CYM A;  2CPR A;  2DGZ A;  4CDG A;  3SAH A;  2E1E A;  2HBL A;  3SAG A;  2RRD A; 
#chains in the Genus database with same CATH topology
 4ECS A;  1VF6 C;  2BQR A;  2UXC B;  4DR7 O;  3A0R A;  3C90 A;  3CCR V;  5L1L A;  4B3M B;  2HHT A;  4JI5 O;  4J7J A;  4QWE A;  4X88 A;  4C8L A;  4UCT A;  1RM6 C;  2VKQ A;  3W7W A;  2W03 A;  1N5X A;  2WF5 A;  1UT8 A;  5DGA A;  3QTC A;  2DJV A;  3RYF A;  5LHH A;  4DSF A;  4NM2 A;  2JH7 A;  3OJU A;  3P3P A;  1Y66 A;  2V9W A;  5EE9 A;  1QLN A;  2CH7 B;  9ICX A;  1P4R A;  4QNH B;  3GV5 B;  1FFT B;  2HVK C;  3L74 H;  3VQV A;  3OAA G;  1XO1 A;  5AKX A;  3ZDE A;  2EZO A;  5KT3 A;  4P2Z A;  3O65 A;  1SKW A;  4IIJ A;  3NUQ A;  1JA8 A;  3ZRV A;  4DUZ B;  1EBO A;  2BCQ A;  2PY5 A;  4CF4 A;  4B7E A;  3W7T A;  3C3S A;  1M57 C;  1NH2 D;  1TUB B;  3RVZ A;  4QZ9 A;  2IJH A;  3E58 A;  5DKW A;  4PDL A;  2M0N A;  3HKE B;  3RJE A;  4H33 A;  3PO4 A;  1XI1 A;  3ICX A;  1WAZ A;  4CC6 A;  4NKG B;  1I94 B;  2WF7 A;  4G9B A;  3BY6 A;  2AZ0 A;  2PGG A;  1BQ0 A;  2EUL A;  2FPM A;  2HBJ A;  1SKV A;  3OE7 G;  4PDV A;  4RQ5 A;  1GTO A;  3QNM A;  1YEW A;  3CCE V;  1NJY A;  4F93 B;  1LUV A;  2Y0P A;  1R1B A;  2JS3 A;  7ICL A;  3TAC B;  5LYJ A;  1M5I A;  4US9 A;  3LVV A;  2XT9 A;  1S0V A;  3K3W A;  4Y2S A;  5KG1 A;  4RUE A;  4O5K A;  1N62 A;  5B5E Z;  4MVU A;  4EB6 B;  2XY6 A;  2YS8 A;  1QCK A;  3AL0 B;  3D36 C;  5LL6 Y;  3JAS B;  3MC1 A;  3ABL C;  2B5U A;  1KL9 A;  1GM9 A;  2UUC O;  4QWC A;  2KKV A;  4TSF G;  3OUF A;  3E0F A;  5AM4 A;  2JHD A;  1MQ3 A;  1CI4 A;  1UT5 A;  2MAX A;  2XAF A;  3QEA Z;  4Y2U A;  3GII A;  2CRX A;  4TQD A;  1ZET A;  4F5R A;  1S3J A;  1S9F A;  2I6X A;  4FJC C;  4YIO A;  2EAP A;  2L5Y A;  3VQX A;  4RQ6 A;  1ROP A;  3ZHT A;  4JI2 B;  4QPK A;  2Q0Z X;  3RYC A;  3J7A U;  2DW4 A;  3PSP A;  3H4B A;  3B4S A;  4CZZ A;  2LMR A;  2P35 A;  5B66 U;  5KAF U;  2N74 A;  4RQ7 A;  5IE9 A;  3RRH A;  2KNJ A;  2KSO A;  3ZMS A;  1QVG U;  4B3R O;  4DQI A;  3EVK A;  1FAF A;  3UM9 A;  3A0B U;  5H5N A;  1UHU A;  3UKM A;  4HNA B;  1N34 B;  5KG5 A;  4I28 A;  4DR3 O;  2FML A;  2GTS A;  1DTO A;  5DDM A;  4BGD A;  2ITC C;  2IMW P;  4UB2 A;  3PNC A;  2KJ9 A;  5KMG A;  4P4O A;  1R3J C;  4I4T B;  1JMK C;  1TUB A;  1KP3 A;  4RQM A;  3HIL A;  1LVH A;  2LQT A;  2E8P A;  1SQG A;  1MNG A;  1XL4 A;  4DQQ A;  3ZDC A;  1F4N A;  4ZBM A;  2EAN A;  5A0L A;  3QVN A;  1FJG O;  4O3P A;  1NK6 A;  3JPQ A;  1IM4 A;  2ZCE A;  1ZQY A;  1VP7 A;  2LJ2 A;  2QWN B;  3SJC C;  4X62 B;  2W0F C;  1Z00 A;  4OD0 A;  3C28 A;  1J2M A;  2R72 A;  4UCU A;  1GN6 A;  1QCE A;  1XHX A;  1SER A;  5IYZ B;  3T1H B;  4B9S A;  4YY3 O;  4C0Z A;  2IHM A;  2IHN A;  3JPT A;  1NH2 B;  2IU0 A;  2QSA A;  4EB6 A;  2W43 A;  4DR5 O;  2K4H A;  5AIB A;  5LGN A;  4OX9 B;  2QB0 A;  1GM7 A;  2RDI A;  4ED0 A;  3K03 A;  2KB1 A;  3SD7 A;  2F1H A;  3ETL A;  9ICO A;  1PPJ H;  5KFV A;  4OO1 J;  3BQ0 A;  5H2F U;  4K4H A;  5JRT A;  2J6T A;  5IIO A;  4FM1 A;  2K89 A;  4FLU A;  3ZHS A;  4DSI A;  2X6A A;  3F5T A;  5J9P C;  3V7K A;  4JI8 O;  1LB2 B;  2RQ5 A;  1D5N A;  4I9W A;  2ZR2 A;  1IBL O;  2UUA B;  2FLN A;  3ISC A;  4DFM A;  1SQQ H;  3L4P A;  4L87 A;  3OJS A;  3T1C A;  2FDR A;  4ED8 A;  3DGE A;  2E3T A;  4KMO B;  2Q7E A;  1H8E G;  1T4G A;  2ITD C;  1BPY A;  3LSQ A;  3TJT A;  5KT2 A;  3T4D A;  3P30 A;  2JIZ G;  4HYO A;  4RQ2 A;  1D5A A;  3ZRS A;  4O3R A;  3WK7 A;  2NR5 A;  4CC5 A;  5C8Y B;  3GIJ A;  1MA7 A;  4KN7 A;  4WFF A;  1EN5 A;  2QKS A;  2XAJ A;  2UXN A;  4PD4 F;  3ZJZ A;  8ICS A;  3ISB A;  4JTD B;  1DOQ A;  3BCC H;  2W9A A;  2MRL A;  4US8 A;  2X7R B;  4O3N A;  2DE0 X;  2JEX A;  1RPL A;  4M9H A;  3DC6 A;  3K9S A;  1K73 W;  1FJG B;  5H6R A;  3A0B Z;  4A5U B;  4P0P B;  3EFF K;  3RJK A;  4ECU A;  3CCJ V;  3ALR A;  3M9N B;  1SXE A;  7ICK A;  3N7R C;  2AQ4 A;  3BHP A;  2CXY A;  5EBM C;  2ALZ A;  5EBW C;  1VQ9 V;  2Y69 B;  1K1Q A;  9ICT A;  3JAS A;  4X1I B;  1WG8 A;  2KVC A;  2WLH A;  3WKB A;  4LF5 O;  4WBN B;  4MS2 A;  4XDL A;  2P6U A;  2E1F A;  5J29 A;  3CMA V;  1OCC C;  3CJH B;  1F7Y A;  2YQE A;  1NU1 H;  5BMV B;  2ZE5 A;  5AI0 A;  2DKX A;  2ZIU B;  4C8M A;  4DV2 B;  2KSD A;  4JYA O;  2VJ5 A;  4UAT A;  4JI3 O;  1NVP D;  2A3V A;  1HEK A;  1Y67 A;  1ZQU A;  3CJH A;  4B3S O;  3D36 A;  5KFR A;  3PZP A;  8ICZ A;  1Q46 A;  5J0Y A;  1KKD A;  3NS1 A;  4F5N A;  3ETG A;  5JQG B;  2ODM A;  3PML A;  3RB3 A;  3I56 V;  5IIN A;  2XAH A;  1J2N A;  4DEZ A;  2PYL A;  3SYC A;  2R8I A;  5DBA A;  2NRV A;  4PEL A;  4B6J A;  5LP6 B;  2Q0O C;  3Q8K A;  5HFL A;  4BWA A;  1MMM A;  3ZCC A;  4IRD A;  2CH7 A;  5HR7 A;  1S5L U;  1VQ5 V;  4F6E A;  1DF4 A;  1CP9 A;  3N7S C;  3KD3 A;  2OCE A;  4C4S A;  2IJJ A;  3F5A A;  2K4E A;  3JD0 A;  1HIW A;  4NR1 A;  4PA7 A;  1IV8 A;  2UVW A;  2CTR A;  5KG7 A;  4HAI A;  1ZQE A;  4MW3 A;  3ZN1 A;  4LF5 B;  2P4V A;  1XRE A;  1Q8K A;  5F9N A;  1Q5O A;  4UCR A;  4QNL A;  5DBB A;  4RQF A;  5AM3 A;  1L1F A;  1JJ2 U;  2WAQ C;  1PUZ A;  3JAR B;  2ZXH A;  2F44 A;  5J0U A;  4O4I A;  1RG6 A;  3FB5 C;  1O9G A;  5HHH A;  2ASD A;  3JPS A;  3PX4 A;  2OTJ V;  1TK8 A;  4TT3 G;  4HAM A;  3SYZ A;  2N04 A;  4DOA A;  1SQX H;  4GXK A;  3UQ2 A;  2LW7 A;  7ICF A;  2PI5 A;  2KFZ A;  4OJO A;  1WB7 A;  4OPA A;  4JI7 O;  1AQ6 A;  1H2M A;  2M9N A;  3LVW A;  2HHV A;  5ALT A;  1QQC A;  4KLS A;  3TFS A;  2Z0A A;  4X65 B;  1D8L A;  4DS5 A;  4EFB A;  4TUS A;  2PZS A;  3K06 A;  3J81 j;  4YMM A;  2QWR B;  1B0X A;  2YI8 A;  1D9D A;  4X5V A;  1ZQX A;  3CNH A;  2EIL B;  2DWQ A;  1QSL A;  4DL5 A;  4I29 A;  4RT3 A;  2CGN A;  4UCO A;  1PV0 A;  5AKK A;  1BPZ A;  4LF8 B;  1AI4 A;  5ALJ A;  4CH5 A;  1B04 A;  4GIB A;  1KC8 W;  2LYH A;  3DXR A;  1DGS A;  1RP3 B;  2EIN C;  3THO A;  2PTM A;  4FLZ A;  2HI0 A;  4DF4 A;  2WPD G;  5LP6 A;  4K4G A;  3O0F A;  3RR8 A;  3UMB A;  3LDA A;  2ZXW B;  3MAQ A;  5BOL A;  5DLG A;  2NO4 A;  3CRX A;  4ZH4 A;  1JXL A;  5C5J A;  1I0H A;  4J9N A;  3AG1 C;  5C93 A;  1I08 A;  3AG3 B;  3NVZ A;  5ALD A;  3FAV B;  5IY5 B;  2BPF A;  1W2B U;  1N34 O;  1YSC A;  4Q8E A;  1ZXI A;  2ZIV B;  3SQI A;  5KMG B;  4GXJ A;  2ZIN A;  2KMD A;  5AK6 A;  5HR6 A;  2I5H A;  3N2G A;  1JMS A;  4X1I A;  1MN8 A;  1ZD4 A;  2R8H A;  2BR0 A;  2VA3 A;  5KFX A;  5T14 A;  4Z6E A;  2LGQ A;  4GT1 A;  4WBN A;  1D8B A;  4U3F H;  3EW9 A;  3A0H Z;  1UQV A;  5ALR A;  5FLX N;  5KFG A;  5H9C A;  3OSP A;  4JAU A;  1K34 A;  2ZE6 A;  5J0X A;  3MD0 A;  4L8J A;  3SZ2 A;  1QNM A;  4ZOH C;  2YID A;  1SV4 A;  1S8O A;  4Y2Y A;  3ZBH A;  1UPG A;  2EIM C;  2IOF K;  2KG7 B;  2AH5 A;  2Q4T A;  2YN4 A;  4LFB O;  3RTV A;  1XL6 A;  4NLN A;  4M6W B;  5TIS U;  3I76 A;  4Y2V A;  1HNZ B;  2JRI A;  3K5N A;  2BE3 A;  4CS4 A;  1J5E B;  4OXS A;  2EZX A;  4TWK A;  1J97 A;  1JPX A;  1PKX A;  2GUZ B;  2FMQ A;  2VJ4 A;  5AM0 A;  3A8T A;  2DPI A;  2Y0S F;  4JTC B;  2EIJ B;  5EWF A;  1QR8 A;  3MGI A;  1FFV A;  2QM7 A;  3LNN A;  2AGO A;  1RXW A;  1JUD A;  3QNE A;  4G2K A;  4FBT A;  3B77 A;  1N4C A;  4RNN A;  2YB1 A;  2HHU A;  2GBO A;  2AQ0 A;  2G09 A;  1WA8 B;  5AM2 A;  4R7C A;  4XDJ A;  2WLL A;  4LF7 O;  4QZH A;  5L3D A;  3GV8 B;  1HR0 O;  4DV3 O;  3KZI U;  4U6P A;  3BQ2 A;  5KFI A;  1D8Y A;  4KLL A;  3K0G A;  4LFC O;  2G5I B;  4J03 A;  3OEE G;  4MT8 A;  2A19 A;  4IHJ B;  3WK6 A;  3JAR A;  4DSL A;  3RN4 A;  1WCL A;  2ZD9 A;  2X6B A;  8ICI A;  1G6U A;  2IU3 A;  3IHQ B;  2JGU A;  1U96 A;  1TGO A;  3AG7 A;  4DXW A;  2EX3 A;  1JI7 A;  1K5Q A;  5CB1 A;  3HKD A;  2XVT A;  4JUZ A;  4P9P A;  1VQN V;  2P66 A;  4NLK A;  3FYE B;  1Q82 W;  5BY1 A;  1FYJ A;  4RUF A;  3H7I A;  3WKC A;  5F9L A;  4I2J A;  1ZQA A;  2V1D A;  1E1R G;  5J2F A;  1X9M A;  5AK4 A;  3GU3 A;  5ITZ A;  4KLQ A;  2P22 C;  2CGO A;  5B1B C;  3UT5 B;  4RPY A;  5KFH A;  2A1J A;  4FZL A;  4YMN A;  2A9H A;  4G27 B;  4JI1 B;  5ITZ B;  2ZJ5 A;  4F91 B;  1KFS A;  4G28 B;  4MFF A;  2DGZ A;  4ECY A;  2A1J B;  3PW7 A;  1WN7 A;  2YXH A;  3JAT A;  4FFD A;  4JK1 A;  2G07 A;  4YJ2 A;  1K33 A;  4ZHQ B;  1AP6 A;  2PMZ F;  2OH2 A;  2XI9 A;  2VWJ A;  2ZXW C;  4ACO A;  4U7O A;  4FLX A;  2EIM B;  2W6I G;  3RT3 C;  4DQR A;  2BZF A;  9ICI A;  4DW1 A;  5KAI U;  1H2G A;  5KFK A;  1CRX A;  5ALP A;  1B06 A;  4FLW A;  2YIC A;  1CEZ A;  2QAR B;  2JJ1 G;  3HJE A;  1X40 A;  3G4S V;  3FAV A;  2VS0 A;  9ICL A;  1JFF A;  3CYM A;  2JEU A;  1JIH A;  2VQE B;  1RSO A;  1ZJN A;  4EZ6 A;  1DK1 A;  4KIT B;  4RQ3 A;  5J8Y A;  4YD1 A;  1PP9 H;  3JPP A;  2XO7 A;  1N36 B;  1Q6U A;  1EN4 A;  2BDU A;  2JXJ A;  3DTU B;  1ZQI A;  2AHY A;  5KFJ A;  1K97 A;  2YMQ A;  3SYO A;  5CMU A;  2DYS C;  3RBE A;  1NKD A;  1VLB A;  1W0K G;  3ZDA A;  3GIL A;  1BGY H;  4MTF A;  5H6Q A;  3SI8 A;  3DEE A;  2H3F A;  3NGD A;  1URF A;  4X89 A;  1NJI W;  4MHV A;  3WFV A;  2ODG A;  1X42 A;  2A06 H;  3KHR A;  4KLI A;  2FL4 A;  5L3F A;  3TFR A;  1Y4M A;  4X64 O;  1N56 A;  2PXI A;  3A2F A;  3N2K A;  3M7M X;  3H9V A;  5IDJ A;  2P06 A;  4ED7 A;  1R6T A;  3CCQ V;  1XNQ O;  3HKB A;  1S0M A;  3AN1 A;  1KN5 A;  3B0X A;  2KZM A;  4JAV A;  4F6R A;  4B9M A;  1MAB G;  1ZRM A;  4FFB A;  4NXM O;  2DWD C;  2FTK A;  1JX9 A;  5B1N A;  4JI6 B;  3WB2 A;  3SR6 A;  4GYC B;  4DV4 B;  1N0N A;  2UU9 O;  3AG4 B;  1KP2 A;  1WA8 A;  3HKB B;  3NXS A;  2QJ1 A;  2ZE7 A;  3K5O A;  4QPJ A;  2QDO A;  3WU2 U;  4DFK A;  1YJ9 V;  1VQL V;  4M9J A;  3C1Z A;  2EZP A;  4EEY A;  4Q20 A;  1NI3 A;  3MDA A;  5KHH A;  2WF6 A;  4KHP B;  4I2B A;  2BTQ B;  1D9F A;  5EZY A;  4QW9 A;  3QXG A;  3E22 A;  5LHG A;  3JAK A;  4AYB F;  7ICM A;  3K04 A;  5J2K A;  3ASN B;  2W11 A;  2JZB A;  3QE9 Y;  3SMV A;  1YF2 A;  2D3O W;  2BTQ A;  1JRO A;  3E2E A;  2Q9L A;  5LA6 B;  1SL2 A;  1NZB A;  4UB6 U;  1JN3 A;  1CXZ B;  1PL4 A;  1OXJ A;  3IV6 A;  4RU9 A;  5LMN B;  1OV9 A;  3SJQ C;  3SAF A;  3L72 H;  5A2Q N;  3MDC A;  4J10 A;  5KFP A;  4NB5 A;  4I2C A;  2W7P A;  3PN1 A;  2F76 X;  1PVR A;  2FLL A;  2XHB A;  1QQ6 A;  3T5L A;  2XC9 A;  1XQ8 A;  1NS1 A;  2R18 A;  4B9T A;  1FXK A;  1YJW V;  5E79 U;  1ZD5 A;  4R8U B;  4DQP A;  4RPX A;  2G06 A;  2R8G A;  5HFM A;  5HNK A;  8ICT A;  4FE3 A;  4R65 A;  1R6K A;  5ALK A;  1OHH G;  1IBM O;  5KFC A;  8ICU A;  2Q4P A;  4DW0 A;  3F2D A;  1MOF A;  1K4D C;  5ALI A;  2E76 B;  1XMO O;  8ICR A;  1X6I A;  2UU9 B;  7ICN A;  4MF8 A;  4R8C A;  3ABK B;  1NVP B;  1Y88 A;  2CDY A;  2HW3 A;  5IYB O;  4I9Q A;  3N2K B;  1IDS A;  3M6Z A;  1YZ7 A;  4O4J A;  3HRD D;  3RAQ A;  1DK2 A;  1V54 C;  3ASO B;  3QU7 A;  2ZR3 A;  1XNR O;  1GN2 A;  1ED1 A;  3VQW A;  5JJE B;  3C3T A;  4K3A A;  3AEI A;  3ZDB A;  5KFW A;  4M2Y A;  8ICW A;  1PNL A;  4LZG A;  1L5U A;  1L3S A;  4ED2 A;  3BQ7 A;  4NYK A;  4DK0 A;  4Q44 A;  2EDU A;  4KLJ A;  3G6B A;  5DB7 A;  5DQG A;  1EZV H;  4I55 B;  1WNS A;  2NO5 A;  4YFK A;  1RSO B;  4UCV A;  2RDJ A;  4FM0 A;  2BOC C;  2AGP A;  1NK7 A;  2PYJ A;  4F4X A;  2DYS B;  4NTW A;  2W04 A;  1LKY B;  2IJK A;  2ZIW A;  3MHS C;  4NM1 A;  1BSM A;  5IWA B;  2GSM B;  3E22 B;  3BZC A;  3ETE A;  3B8N A;  4ASU G;  1N32 O;  4KUM A;  5J2U A;  1TVA A;  4B08 A;  5J2G A;  4R50 A;  1F0M A;  4CS3 A;  4PDM A;  2LYA A;  2AXT Z;  1Z3E B;  5EYP B;  5DEC A;  5AKZ A;  3EPI A;  5DGB A;  2WLN A;  2G08 A;  1OCZ C;  3RJI A;  2ZNJ A;  5TZV A;  1L3V A;  4W4K A;  2WFA A;  1ZQD A;  4QJF B;  4EEK A;  1SQF A;  3F7V C;  4DSE A;  4X20 A;  4O5C A;  3HX0 A;  2PFO A;  2IBK A;  3EYZ A;  2WSS G;  3E8H A;  4I50 A;  4AQY B;  1L7O A;  3DC5 A;  4BR6 A;  4R66 A;  5B3S B;  2AGA A;  3ED5 A;  5IWA O;  2K8B B;  8ICP A;  5E79 Z;  4TUP A;  4I2A A;  2UXX A;  3D3I A;  2NRW A;  3ZHR A;  5BR8 O;  2VQF B;  4LNU A;  4QGP A;  3UT5 A;  3Q4H B;  2W3R A;  1TK0 A;  1YHQ V;  2N05 A;  3L73 H;  4DR2 O;  3KHL A;  2Y9T A;  2JMG A;  5AKY A;  1ZQB A;  3I5D A;  3JSN A;  2QE7 G;  1AP5 A;  8ICB A;  3T4Z A;  4NLZ A;  3D6J A;  4NXN O;  3RYI A;  4DLG A;  4UVB A;  2WB1 F;  4DFD A;  4O2A B;  5KFT A;  3LDE A;  3TI0 A;  1SQP H;  2ZT9 B;  4KN4 A;  2DOS A;  4XBF A;  4CH6 A;  3R9K A;  5EOZ A;  4ZIB A;  5HML A;  5LA6 A;  4DV7 O;  3EHB B;  4K0K B;  9ICF A;  2QAR A;  3R66 A;  2B21 A;  7ICS A;  4BX9 C;  1N32 B;  4H44 B;  1BPB A;  2BPC A;  2UVR A;  5FP0 A;  4FM2 A;  4AP9 A;  3APQ A;  3BEH A;  4LFB B;  4ZOL A;  1S72 V;  4U3J B;  2C28 A;  4Z1V A;  1TFR A;  4QZG A;  2OCC B;  5LMU O;  5J2U B;  1U4B A;  1WP7 A;  1XO0 A;  3THV A;  2RMK B;  3K57 A;  1UA1 A;  4KLE A;  3BDP A;  3K75 D;  5EE3 A;  3QZ7 A;  2HBL A;  3CME V;  3V6H A;  1B43 A;  4RUC A;  2JGD B;  3RF9 A;  4LF7 B;  1H8H G;  3BAB A;  4QE7 A;  3VCB A;  4F72 A;  4TUY B;  5CB4 A;  1X66 A;  3RYH A;  2YSU B;  1XSP A;  1KUQ A;  3V6J A;  2F23 A;  1KSP A;  2V7Q G;  5LP6 C;  4PDR A;  4DR1 B;  1S0O A;  1OCO B;  4EBD A;  2HFE C;  3Q8M A;  1Z4O A;  4PPX A;  2YEV A;  2K8A A;  2F93 B;  2NRX A;  4DV6 O;  1Q3E A;  4ECW A;  4OJ6 A;  3QEB Z;  3SPH A;  2KEY A;  2OCC C;  5CN0 A;  2MA1 A;  2CTQ A;  1KBU A;  5DG7 A;  1UPH A;  2E5L O;  4DV7 B;  2H3Q A;  1HWY A;  1FFX A;  4GUN A;  5AG2 A;  3VC8 A;  5IJ9 A;  5L3G A;  1RDF A;  3MGH A;  3ORY A;  2QWQ B;  4GX1 A;  4X64 B;  3JD1 A;  5ALM A;  3CPW U;  4DL7 A;  3SAG A;  4JYA B;  4F6R B;  4FS2 A;  3TK1 A;  2A1A A;  5KX5 A;  3QUQ A;  9ICH A;  3PO5 A;  1V97 A;  4MVR A;  3GZF A;  5KG2 A;  4NLG A;  5KFZ A;  4ABM A;  4TUR A;  4JV1 A;  5LOV A;  4AIL C;  3TAR A;  1G4Y B;  5KX5 B;  2WHE A;  2Y69 C;  8ICN A;  3OR7 C;  1SQB H;  3QG5 A;  3CCS V;  1Q43 A;  1JCH A;  1DGJ A;  2A3Q A;  4NJ8 A;  1NI8 A;  3HW8 A;  1KYO F;  1HNX O;  3BA8 A;  5DED A;  3VQY A;  4E0D A;  2Y1I A;  5CR0 A;  1D2D A;  3C2M A;  5KFS A;  2MUT A;  2JK5 C;  1T7P A;  2WA3 A;  3HR0 A;  3TAP A;  2QWP B;  3JSL A;  1NR7 A;  3GVM A;  3H8J A;  1C20 A;  3RH4 A;  2JEJ A;  3H1I H;  1U47 A;  3UQ8 A;  4ZI7 B;  1RM1 B;  5AKI A;  4MFA A;  5ALQ A;  4DL2 A;  4DS4 A;  3B2E E;  4LFA B;  1BQZ A;  4Q45 A;  3RH6 A;  8ICM A;  3Q8Q B;  1P84 F;  1XDC A;  2MW2 B;  3LSS A;  2FB5 A;  3RW0 A;  4QWB A;  4YP3 A;  4EEN A;  2KJ5 A;  3OHA A;  2C2R A;  3K1R B;  3FFQ A;  4M47 A;  1IXR A;  1ZQO A;  1RQL A;  5J0T A;  3PX6 A;  4JYY A;  9ICM A;  1GM8 A;  1XSN A;  1VQM V;  2KN7 A;  1JX4 A;  1KEJ A;  4ECX A;  5ALN A;  4DR3 B;  4GX5 A;  4LH7 A;  1N0J A;  4JTA B;  4TUQ A;  3LWL A;  1O9H A;  2ZIX A;  2H3Z A;  4YQW A;  3K5M A;  4J9L A;  2EJR A;  4TOI A;  1SET A;  2YIA A;  3CE2 A;  3OHB A;  4GXI A;  4E2L A;  2OYQ A;  5KHI A;  3OMN B;  3G6V A;  1M4U A;  4EEQ A;  3GV7 B;  4EBC A;  1AVM A;  5AI8 A;  4PGQ A;  1XNR B;  3FYH A;  5ALO A;  3F7Y C;  1QU7 A;  5EC1 C;  3L5K A;  3RBZ A;  2ILM A;  3IRU A;  2ZM6 O;  5ALY A;  1TKD A;  4CRX A;  4UB8 U;  2KTQ A;  1K9M W;  2F3N A;  2YY6 A;  5AIA A;  9ICS A;  2CE4 A;  3FM9 A;  3D2N A;  3FKS G;  2Q69 A;  1Z2G A;  1EXN A;  2VA2 A;  1WUD A;  5AHX A;  2W9B A;  5CA0 A;  2ASL A;  5KT4 A;  4JI4 B;  4DR6 O;  4JWN A;  8ICJ A;  1WP8 A;  4TV9 A;  2KIW A;  2OYY A;  1LNQ A;  2ZG6 A;  1BL8 A;  4O9M A;  5G5G A;  7ICT A;  4KLO A;  2EIK C;  3QYP A;  5AI6 A;  5IIM A;  1M90 W;  3OFN G;  2PKE A;  3WK5 A;  3PV8 A;  3F2B A;  5L1J A;  1FFU A;  5LXT B;  4ZI7 A;  1XUQ A;  4FZN A;  1OCO C;  5B1B B;  2W9M A;  2QTO A;  1SWW A;  3CC2 V;  1B3Q A;  1URJ A;  1NJX A;  2DFL A;  4I2G A;  3M8S A;  3ZX6 A;  3IGA C;  3JCZ A;  3BS7 A;  3QUB A;  5FPR A;  3UO3 A;  3JAL B;  4BAY A;  5FNV A;  3MR6 A;  4FS1 A;  3T5H A;  2ZUB A;  3AG2 B;  3RFR A;  3NAS A;  2BCV A;  4HZ3 A;  2KG5 A;  2EZY A;  4PGY A;  4IL6 Z;  5FNV B;  3ML0 A;  3CCL V;  2FE9 A;  2W9C B;  1ZD3 A;  3BJY A;  4LP8 A;  1XMQ B;  1J95 A;  4AHC A;  1Q6H A;  3UO2 A;  1UA0 A;  2E8N A;  2DL0 A;  3AK1 A;  2A7W A;  2BCU A;  4PL2 A;  4YXM A;  5CA1 A;  5J2J A;  1S5H C;  3ETD A;  1U45 A;  2JS5 A;  4PHD A;  4F71 A;  5DQI A;  4UQG A;  5J2T B;  1RQN A;  2OIG A;  4NWI A;  4DRX A;  4PI0 A;  4UW9 A;  9ICK A;  3WK9 A;  5J2A A;  1L8D A;  4J41 A;  2RCV A;  1VJ5 A;  4MTG A;  3H1H H;  4O2A A;  2XID A;  2ISP A;  4LFC B;  2MUT B;  2E75 B;  2XAQ A;  1GH6 A;  3SJB C;  3M1Y A;  4I2H A;  5L3C A;  2K8C B;  2NYV A;  3B0Y A;  3QUT A;  3FD9 A;  4YHH O;  1N33 O;  4PHP A;  1L8O A;  1PL0 A;  2F43 G;  4DR7 B;  1SB3 C;  2ZJ8 A;  4QWD A;  3BFR A;  3W7X A;  2EH9 A;  3GQC A;  2KVS A;  2P6R A;  1R73 A;  4WF9 V;  4QW8 A;  1AJP A;  4ED3 A;  3EWA A;  4F3O A;  5CEH A;  5K1P A;  1MSW D;  5DB9 A;  3JCU Z;  1E1Q G;  4UFZ A;  5CA0 B;  4CGZ A;  1M57 B;  3F5E A;  5LYJ B;  1T8E A;  4D7T A;  3N4M B;  4X62 O;  8ICF A;  4P0Q A;  1XMO B;  3AU2 A;  5LGU A;  1XC9 A;  1S0N A;  3NRZ A;  2Y4U A;  4M9N A;  4JZG A;  4DLE A;  4CCH A;  4Q6G A;  4YY3 B;  2C2E A;  5HHI A;  1P7D A;  4PA4 A;  4YJ3 B;  2XY7 A;  1U48 A;  1ZRN A;  3RJJ A;  4X1K B;  2LP7 A;  9ICR A;  3CRQ A;  4MVO A;  1OCR B;  2KV2 A;  4YR2 A;  1F5S A;  4TUY A;  1HUO A;  2M7W A;  4DL6 A;  3X2Q C;  2Q0A A;  1IIP A;  3PW0 A;  4GX2 A;  2ATL A;  1L3T A;  4NL9 A;  1AI7 A;  1GK9 A;  7ICJ A;  4DR1 O;  4Y2Q A;  3HWT A;  5ALX A;  3QU5 A;  2YEV B;  2BCC H;  4I7Z B;  2YX8 A;  4I27 A;  1TVK B;  1SL0 A;  1T3N A;  4WFE A;  4DR4 B;  4TQR A;  2BTO A;  1FFX B;  1XWL A;  4EEL A;  4LVS A;  3K0D A;  4TV8 A;  3U11 A;  4PJ0 U;  4KP4 A;  3SPG A;  2GLE A;  3ZHV A;  3T1Y O;  3ZD8 A;  1BPE A;  4B9N A;  3CRR A;  5KFE A;  2HHH B;  3D2S A;  4XA5 A;  5GON A;  3T1H O;  5DQH A;  4X66 O;  1COW G;  2ZTC A;  3GDX A;  1KKC A;  1ZQS A;  3RYF B;  1Q6I A;  1IZ3 A;  5EIB D;  2EIN B;  1L0N H;  4P4P A;  3D3Q A;  3OTO B;  3CRM A;  1ZQV A;  1R3I C;  5LGT A;  4X65 O;  5KFL A;  3G71 V;  1US6 A;  3QO8 A;  1RXV A;  3RJF A;  5III A;  4DUY O;  2G5H B;  3RR7 A;  4J80 A;  4DF8 A;  4IIJ B;  4PL1 A;  1BE3 H;  2BKE A;  1IBL B;  3SEN A;  5BXZ A;  3NVY A;  5LXT A;  4H37 A;  4O4I B;  1VAR A;  2DWE C;  5K1X A;  5ALF A;  5KFU A;  4FLV A;  4B3T O;  3HKE A;  2XY5 A;  3OSN A;  4C7Y A;  4R64 A;  1NTM H;  4DO2 A;  3QUC A;  1ZTE A;  2HBM A;  2ZTE A;  1YXB A;  4BJQ A;  3OD4 A;  5CHG A;  4YR3 A;  1K1S A;  5D5P A;  2WLJ A;  2L35 A;  3K58 A;  3ZHU A;  1A77 A;  1XBL A;  4P0P A;  4LFA O;  1GN4 A;  2E3C A;  3RB4 A;  5EE0 A;  5KNI A;  3TXQ A;  3EZ5 A;  3OTQ A;  1EZJ A;  7ICV A;  3T79 A;  2P7T C;  1F44 A;  3QU9 A;  4JI4 O;  3F53 A;  2JEG A;  2YI9 A;  5CBH A;  4DR6 B;  2HVI A;  4F5O A;  2AJQ A;  2RN9 A;  2Y4T A;  5FPO A;  5KA6 A;  5LHI A;  5B1O A;  4DV3 B;  2LHT A;  1AJQ A;  3GFK B;  4DV2 O;  3UXO A;  1E79 G;  1ZQZ A;  4I2F A;  1SQV H;  4KL1 A;  4UAS A;  3RFA A;  1ZQN A;  1ZQF A;  4UAR A;  3PMN A;  3R65 A;  4F4W A;  4I5S A;  2HHW A;  1WJZ A;  1QQ7 A;  2OWO A;  2JH1 A;  4PHZ A;  3DXR B;  5J8Y C;  1ENV A;  3RJG A;  4GKK B;  3MHH C;  5EWE A;  3AU6 A;  1Y6X A;  3HPL C;  4BUG A;  4KLU A;  5J0S A;  1KQQ A;  5JQG A;  3VBB A;  1RYU A;  4RQ4 A;  1S77 D;  1VDV A;  4J9Q A;  3ISD A;  2F1M A;  5EIB C;  4C4R A;  4JV5 B;  1TAE A;  3UM7 A;  1YTF B;  1V9P A;  4DV0 B;  3PY8 A;  4KMU A;  1S5L Z;  3MR3 A;  4AI8 A;  4QZE A;  5B66 Z;  3W7S A;  1SZX A;  3ABM B;  4G3I A;  2B1G A;  1XU4 A;  4I4T A;  4PZN A;  3IG8 A;  4EYH B;  1UCV A;  3FC4 A;  2EIJ C;  3B09 A;  4F4L A;  4JYC A;  4I2I A;  2W7O A;  1KU9 A;  3CSX A;  1U97 A;  3L75 H;  1BZK A;  2VWK A;  1K92 A;  3CP1 A;  1B22 A;  3JAW B;  5AI4 A;  3PVX A;  5KUK A;  4DV6 B;  1VQ7 V;  2W3S A;  5IT9 N;  2HR3 A;  1IXM A;  2NRT A;  1QSY A;  7ICR A;  7ICH A;  1Z4N A;  1Z00 B;  3M6K A;  3CW2 C;  5LMN O;  3QX7 A;  1VIB A;  2RNB A;  5KTQ A;  4J9Y B;  2LI6 A;  5DDY A;  1L7P A;  2NRZ A;  1ZUQ A;  2WF9 A;  3SPC A;  5IYZ A;  2E5S A;  1QR9 A;  2HKO A;  3OGU A;  3QU4 A;  4F50 A;  1YDX A;  3MGV A;  1Q7Y W;  1AR4 A;  3LDD A;  1EN6 A;  4OGQ B;  4DV5 O;  4DO9 A;  2H5X A;  4FK5 C;  1M6Y A;  2IOF A;  4DCC A;  3JPN A;  3L3F X;  5J2H A;  4FPP A;  4WCE V;  1ZD2 P;  5AIC A;  1TVK A;  1ZWI C;  5D46 A;  3E8F A;  2ZNI A;  1HJP A;  4CNQ A;  3N97 B;  2UXD B;  2KHV A;  2FI1 A;  5E1A C;  5KFD A;  4F4Y A;  1QSS A;  2M6Y A;  3AUO A;  3WB1 A;  5JJJ B;  1VQ6 V;  1PNK A;  2RJZ A;  5CBF A;  3FB6 C;  1X9S A;  4LF6 O;  2F1J A;  1KEC A;  3M8R A;  1XMQ O;  3G6Y A;  3RRG A;  1L6N A;  1XOU A;  4JPR A;  4F5P A;  4NLB A;  3AG1 B;  2BHN A;  3KCY A;  2QB0 B;  3KBB A;  4IL6 U;  5IJ0 A;  5JWP A;  1AB3 A;  2UVU A;  4NTX A;  4PZO A;  3KCX A;  4C7Z A;  5KHK A;  1THZ A;  4C7U A;  4RQE A;  1ZQJ A;  4PA9 A;  2D8C A;  2Y0S C;  4I0X A;  3M8A A;  5IJ0 B;  4QZA A;  3LDC A;  4ZKI A;  7ICE A;  4B7K A;  2D3D A;  2ARH A;  3RYC B;  4CF3 A;  3TAN A;  2ISO A;  2Y9U A;  4EYI B;  1QLE B;  3QU2 A;  4KX5 A;  3Q8P B;  4PGX A;  2W0X A;  4YMO A;  2F8L A;  4MVM A;  3MR5 A;  5EE1 A;  2D6F C;  2AHZ A;  3CYO A;  1H2L A;  3K79 A;  5B1A C;  5JUM A;  2JEF A;  1FXH A;  4NXM B;  4C4T A;  4J9S A;  1X59 A;  2R9R B;  4P30 A;  4O3M A;  1QVF U;  2JDI G;  1I5X A;  4JI8 B;  1Z5W A;  5C8Y A;  1DRG A;  3SYP A;  4H0L B;  3RAX A;  4W4L A;  3C21 A;  1SZT A;  3RJH A;  1L0L H;  1V55 C;  2N1R A;  4IQT A;  2IM9 A;  3UCS C;  1SZH A;  3L9D A;  2RQ6 A;  2Q68 A;  1UFI A;  2UUC B;  5GTH Z;  2LW1 A;  2DF4 B;  5D4B A;  1PVP A;  4DV4 O;  5J0P A;  4GKK O;  1KKX A;  2K4I A;  4ECV A;  3SJA C;  2BCS A;  3KKA C;  3KTQ A;  1ZQH A;  1SF9 A;  3HKC A;  4D7S A;  4HBN A;  1F4M A;  3FB7 C;  4DSK A;  3S6J A;  4IR1 A;  1N2X A;  8ICL A;  2DKZ A;  2GOL A;  1NTZ H;  2XUM A;  3ZS8 C;  4KHP O;  2XAS A;  2BQ3 A;  3M7D A;  2JJ2 G;  1QQ5 A;  3BA9 A;  1ZQP A;  4BWM A;  2Q73 A;  3HKC B;  3JAT B;  2Q67 A;  1V54 B;  1RYS A;  3ASO C;  8ICC A;  2MU2 A;  4M0A A;  4KFM A;  3C5G A;  1KB9 F;  2OT5 A;  4ED6 A;  2PFN A;  2IJI A;  7ICO A;  2LGW A;  2ZIU A;  2ZE8 A;  3OTF A;  2HMX A;  3V7J A;  1KDH A;  2WB1 C;  3ZN0 A;  2O57 A;  2EZZ A;  3S3X A;  4PHA A;  3ASN C;  1Z1V A;  1VEW A;  4RQ0 A;  5J2I A;  2WTF A;  1HR0 B;  5L1I A;  5KL8 B;  3PW4 A;  3Q8S B;  5C0Y A;  4Z6D A;  4YD2 A;  2YDE A;  4C8O A;  2PMZ C;  2NN4 A;  4GFJ A;  2YB4 A;  3TQ1 A;  9ICV A;  1X6J A;  4JYB A;  4GKJ O;  3H8M A;  2KZ3 A;  1BNO A;  3CS5 A;  4RQN A;  4R6Z A;  3MR2 A;  2R9A A;  4PJ0 Z;  4XDK A;  1VQK V;  1XSL A;  5BOM A;  2WLI A;  2LBO A;  4KLF A;  5KFN A;  4DSJ A;  2ZTD A;  5FL7 G;  2ZQM A;  2WAM A;  4ELU A;  5AI5 A;  4LF9 O;  1U9L A;  2WLI B;  5EC2 C;  3ETQ A;  2VA8 A;  4IHJ A;  4I2E A;  5L1M A;  2YIB A;  4DV0 O;  3CC4 V;  4D6T H;  5AK3 A;  2K60 A;  4B3T B;  2F77 X;  1SXD A;  3LWM A;  1H2N A;  2QM4 A;  2ZJA A;  1VQO V;  2JVD A;  2F8K A;  4Q8F A;  3LSU A;  4EX6 A;  2KIV A;  4IQV A;  2HEP A;  3EXA A;  5KFF A;  1JJO A;  1X4T A;  1N61 A;  2PFQ A;  1IBK O;  3HB3 B;  5ALG A;  3JPR A;  1IUR A;  2VRZ A;  4UAY A;  2ADQ B;  2HHS A;  1BNP A;  2KHQ A;  1YZB A;  1WPB A;  3M9O B;  1QTM A;  4DV1 B;  3WU2 Z;  1BS3 A;  3NVW A;  1K4C C;  2XCP A;  4FZ0 A;  5BMV A;  4MFC A;  4A8E A;  1QBZ A;  7ICG A;  4WFG A;  4EKW A;  2QEX V;  2ZKO A;  2XGP A;  3ZDD A;  2C2A A;  2AGQ A;  1SA0 B;  1B4F A;  3KKY A;  1A6S A;  3E8G A;  2IH1 C;  3MBY A;  2NNU A;  4YIP A;  5ALZ A;  3X2Q B;  4FLY A;  2E74 B;  9ICG A;  1QLE C;  1TUE B;  2AW9 A;  2FPL A;  3KHG A;  2LFR A;  4RUA A;  1DLB A;  3TXS A;  2XIC A;  1KRP A;  3VOU A;  3CD6 V;  2KOB A;  2Z5U A;  4JAA A;  4BIO A;  4GC7 A;  1NK9 A;  1TAQ A;  1JXE A;  1YCI A;  2IW5 A;  4ECQ A;  3ZMT A;  3WKD A;  8ICE A;  1NT2 B;  2K9P A;  2QGN A;  4AQY O;  2ASJ A;  1Y74 B;  5KHG A;  1ZQT A;  1S97 A;  5HP4 A;  2KSO B;  2XOK G;  3KZX A;  3TGU H;  4FZM A;  2GV9 A;  2WLK A;  1RM1 C;  4Z6F A;  5ALL A;  5KG6 A;  1BMF G;  9ICQ A;  4CS2 A;  5KAF Z;  4M9L A;  3H40 A;  3HKD B;  1S76 D;  4DV1 O;  3ZRX A;  1L7N A;  5ALU A;  3K5L A;  3L71 H;  3NTU A;  2PUS A;  4Y2T A;  1NKC A;  1NK0 A;  9ICB A;  2HOQ A;  1VMG A;  5GTH U;  3L70 H;  4XUS A;  1N63 A;  4IYI A;  3BVO A;  3SGI A;  1KFD A;  1L8L A;  1R6N A;  4JV2 A;  4BDP A;  1IBK B;  4UVC A;  4Z1M G;  3G6E V;  2WAQ F;  2CPR A;  2YMM A;  3EPG A;  3V72 A;  4QZC A;  2FMP A;  4LH6 A;  2HHH O;  4N23 A;  3E8B A;  3SV4 A;  4ICG A;  2KKP A;  2V4Q A;  2QB1 A;  7ICU A;  2KE7 A;  3ONN A;  4B3R B;  1OW5 A;  4JI6 O;  3AK2 A;  4LR3 A;  4MVZ A;  1YJN V;  4UB1 A;  2A79 B;  1X9X A;  3DDH A;  2UXD O;  1VQ8 V;  2QKC A;  3GIM A;  4J9K A;  2ZIO A;  3ZMU A;  4BW5 A;  1L7M A;  4QWA A;  4EBE A;  1ZQM A;  1K5S A;  1N60 A;  4DV5 B;  1VF6 A;  3Q8L A;  1BT8 A;  3PW5 A;  3IN5 A;  5KFA A;  3CB2 A;  3C2K A;  4BW9 A;  3IG5 A;  3KOO A;  2DQ0 A;  7ICP A;  3U0Z A;  3P32 A;  1RYR A;  1FXK C;  5IIL A;  1JFF B;  1GN3 A;  4OJ5 A;  8ICG A;  5A9G A;  3MAB A;  2ZIW B;  4YG2 A;  4I0X B;  3KZI Z;  3I55 V;  3K4G A;  4F92 B;  1JR9 A;  2HJF C;  3M99 B;  2UXB B;  3LNM B;  3IP4 B;  2CAZ C;  3D2Q A;  3GIK A;  4K8Z A;  4ICA A;  2FLP A;  1Y74 A;  3AQF A;  4UB6 Z;  4X9Q A;  2QTS A;  2Z3Y A;  2OEH A;  4JI0 B;  4IR9 A;  3IC9 A;  4N21 A;  2P90 A;  4NXN B;  2DPJ A;  2IBZ H;  3MFH A;  1ZYQ A;  3ZED A;  4IQU A;  4DFP A;  1ZLZ A;  5KFM A;  2ZIV A;  4TQF A;  9ICJ A;  4DL3 A;  5L3B A;  3O9O A;  4EZ9 A;  4QZD A;  3AG2 C;  4X1Y A;  4JF3 A;  3ZIA G;  1SV0 C;  1NK5 A;  4NY8 A;  3ZMZ A;  4WFA V;  4LF4 O;  2V4R A;  2HLD G;  2YUA A;  5GON B;  5LBQ A;  2VAN A;  1FD9 A;  1T5E A;  4MEY A;  1RZT A;  4O4L B;  4X1Y B;  1H38 A;  5DM6 V;  4LZD A;  4FFK A;  4LBE C;  1ZOL A;  1ZQG A;  4IC9 A;  1Z1B A;  1JAL A;  4OJP A;  5ALH A;  4ELT A;  9ICP A;  2XCA A;  2P4K A;  1SA0 A;  3AG4 C;  2BOB C;  4K0K O;  2UXC O;  2EIK B;  2KG7 A;  4DWI A;  5KT5 A;  3M9M B;  2XAG A;  4O4L A;  2X0L A;  2B0C A;  2OHF A;  4LF8 O;  1AIL A;  5BZB A;  5KG3 A;  3TET A;  2HOI A;  4EFE A;  4HYK A;  5K4L A;  3IM1 A;  1ECW A;  1Q90 D;  2W55 A;  2H8P C;  3C1Y A;  2K1E A;  1SKR A;  2DQ3 A;  5TIS Z;  2EAO A;  1PVQ A;  5B3S C;  1ZQQ A;  2A0L A;  2HHQ A;  1A32 A;  4FZ1 A;  1IVS A;  5KAI Z;  1HP8 A;  1NKB A;  2QKQ A;  2KJ8 A;  2DN9 A;  3ZMV A;  1WB8 A;  4FVM A;  3DV9 A;  2EAM A;  3UMG A;  5DLF A;  1ZQL A;  1LR1 A;  1ZL8 B;  2WLL B;  1JRP A;  3UQ0 A;  1FEZ A;  4LC1 A;  2FJ6 A;  2ZDI A;  4ECT A;  1XNQ B;  3ZD9 A;  2EIL C;  3OT7 A;  4NVP A;  1OZ0 A;  5KL1 B;  3H0R B;  3FYI B;  2KIC A;  3IAY A;  2DYR B;  3N2G B;  1N5W A;  4KX3 A;  1AJN A;  4LF6 B;  3RH5 A;  4JI1 O;  4GKJ B;  4YR0 A;  4WJ3 B;  1M56 B;  1EM1 A;  4OX9 O;  5IYC O;  4RQ8 A;  2F4V B;  3WKA A;  1T3Q A;  1NOM A;  1YIJ V;  3FDS A;  4JGS A;  2J6U A;  2XTA A;  3ZRW B;  1XS9 D;  1MZF A;  2BSK A;  2HP8 A;  4NLC A;  2RDC A;  2KFN A;  2JRZ A;  3RYH B;  3N7P D;  4YCX A;  1F51 A;  5AM5 A;  4NV0 A;  1VQ4 V;  5F3X B;  1WWU A;  4K4I A;  3G80 A;  3ZRW A;  3STL C;  1Q86 W;  3SAH A;  3E89 A;  4M6W A;  3CP8 A;  2H94 A;  4UAZ A;  1HNZ O;  1XEQ A;  2JGA A;  3ZI4 A;  3RGB A;  3SR2 C;  3J81 N;  4FO6 A;  1NJZ A;  4ELV A;  2Y1J A;  4Y2P A;  4DFJ A;  3JAM N;  4GC6 A;  4FFB B;  3C29 A;  3H01 A;  1HNX B;  2RHF A;  2OM6 A;  9ICC A;  3PJS K;  1CUK A;  2VQE O;  2MK3 A;  2KD1 A;  4K8X A;  1BHA A;  4UAW A;  4DYL A;  3T1Y B;  1K8A W;  1AI6 A;  2B6G A;  3G67 A;  3ABK C;  1O08 A;  5KFQ A;  4J9Z B;  1LV5 A;  3C5F A;  3E86 A;  2CUG A;  8ICK A;  2ESE A;  2HOF A;  2EQY A;  4DR4 O;  3H4D A;  1TK5 A;  4MW8 A;  5J2D A;  3STZ C;  4YJ2 B;  3KKA A;  1HNW O;  2HSZ A;  2UVV A;  5J2B A;  2GO7 A;  1COO A;  2H3V A;  3OTO O;  9ICW A;  5AKJ A;  4CH3 A;  5KG4 A;  2GHY A;  5AK5 A;  2YML A;  8ICA A;  3OR6 C;  4J42 A;  1P7G A;  5L3E A;  4WFH A;  4RQ1 A;  3IFX A;  1BHB A;  4JI2 O;  1V38 A;  3BZK A;  5KFB A;  5KUM A;  4KTQ A;  3HPO A;  4OJL A;  5EBL C;  4DOC A;  2J6S A;  4O4H B;  1RFY A;  1RPO A;  2ES6 A;  4MTO A;  3MDS A;  4MEX A;  3CCU V;  4XQ8 A;  3CXH F;  2GH1 A;  4O4H A;  2ZDI C;  5G5H A;  4MF2 A;  3NR7 A;  4FLT A;  2EBO A;  4F2R A;  3CCM V;  1SL1 A;  3K9A A;  2Q8V A;  3SPI A;  3F5W C;  3ABL B;  4YXJ A;  4DK1 A;  5CJ7 A;  2JR5 A;  3HKZ C;  2JV3 A;  2KP7 A;  1P49 A;  5LMU B;  3CXC U;  1X2I A;  3BPZ A;  1FS0 G;  4QIW F;  4I50 B;  4QZ8 A;  4M9G A;  4USA A;  4P9O A;  5JU5 A;  3NRW A;  4GLX A;  3QO7 A;  1YI2 V;  1FXK B;  2YIB D;  2Y0I A;  5DN6 G;  1A76 A;  2OXO A;  8ICY A;  3F2C A;  2FPK A;  3SYQ A;  2GWS A;  1MG1 A;  2QWO B;  3AEV A;  3WG7 B;  2CN1 A;  4JI0 O;  5KLV H;  1NK8 A;  3D8C A;  3PST A;  2DMX A;  3A0H U;  2LKY A;  4ZHQ A;  1PZN A;  1JVM A;  1KFT A;  4UV8 A;  1L3U A;  1I94 O;  4KLH A;  1M9N A;  2LPE A;  1PNM A;  2NV3 A;  5HMM A;  3DSQ A;  1KW4 A;  2ETN A;  4DQS A;  3RBD A;  4MVQ A;  1BPD A;  5F2V O;  1PK3 A;  1Y76 A;  4RNM A;  3V7L A;  4PHE A;  3S3W A;  4PH5 A;  2GUZ A;  4B9V A;  3SEI A;  4JI5 B;  1X9W A;  3HT3 A;  5IJ9 B;  1SZP A;  1FXV A;  4I2D A;  4FMT A;  1OCC B;  4UAV A;  4R63 A;  4CH4 A;  1T94 A;  1Y76 B;  2FYU H;  3BQT A;  5AKH A;  2F2A B;  1TAU A;  3GWO A;  1MSD A;  5IYD O;  2QKA A;  3N28 A;  4J9P A;  4IRK A;  4M04 A;  3E35 A;  5BR8 B;  2KZZ A;  4NXZ A;  1KMI Z;  4I55 A;  3TAQ A;  4UCS A;  1G1X B;  2H3O A;  2ZUC A;  1V55 B;  2QR4 A;  1SGG A;  1AR5 A;  2RP5 A;  5ALE A;  3JAK B;  3I1Y A;  4U7N A;  1PD3 A;  3JPO A;  4U3J A;  2LM1 A;  1M56 C;  3RB0 A;  4X8A A;  3PR5 B;  2AHO B;  4X20 B;  1WPX A;  3AMZ A;  2W6J G;  2DBY A;  4QZB A;  4LF4 B;  3G6X A;  1K7D A;  3Q8R B;  1ZX3 A;  4QZI A;  5L9X A;  2LM4 A;  2R70 A;  5CA7 A;  5L1K A;  1JQ0 A;  1VF5 B;  3QZ8 A;  4RT2 A;  5KA5 A;  3BS5 B;  4OCZ A;  3OMA B;  2XGQ A;  4CF5 A;  3FX7 A;  8ICH A;  5JCO A;  2YC0 A;  3OPX A;  3LYS A;  3PW2 A;  4DOB A;  4PA6 A;  3T3F A;  4H13 B;  4LWS A;  5KT6 A;  4J9R A;  4P4M A;  5DBC A;  2P67 A;  3LK9 A;  1BVS A;  1K3E A;  5D49 A;  3K59 A;  2JEI A;  3H1L H;  2YMP A;  1K5O A;  4RAI A;  1U49 A;  4JI3 B;  4B3S B;  1ORQ C;  1GO3 F;  4J9M A;  3JD3 A;  4BXO B;  4FBU A;  1ZQ1 C;  1SC5 B;  2F95 B;  3FB8 C;  3CRC A;  3WG7 C;  4C8N A;  3AK3 A;  3CWB H;  5KG0 A;  2DUY A;  5EZY B;  1SKS A;  4UUJ C;  2PFP A;  2X6C A;  3ETR A;  4BXO A;  4IT5 A;  2HDO A;  2IH3 C;  2AU0 A;  1YZ6 A;  4ECZ A;  1NBM G;  3RYI B;  2F66 C;  2O6K A;  5CP2 A;  2GTA A;  4UB3 A;  4GZR B;  1WLE A;  4JAS A;  2P5O A;  3RVY A;  3C23 A;  1J5E O;  1XHZ A;  4ZOL B;  1FKA O;  4AYB C;  2LO1 A;  8ICV A;  3OGI B;  1ZL8 A;  1IBM B;  4IS7 A;  1NZ6 A;  4CBC A;  3T2M A;  4R8U A;  1HUZ A;  4KLM A;  3APO A;  2E5L B;  3TAD A;  3W7U A;  2UUA O;  4O3Q A;  4RO2 A;  5CRX A;  4X66 B;  4Y2R A;  2QM8 A;  4QE9 A;  3K08 A;  3WKE A;  1DF5 A;  2WA4 A;  2E1E A;  1YVW A;  2HHX A;  4Q43 A;  3ABM C;  5EK0 A;  1UJW B;  3OUS A;  2ZUD A;  4JV5 O;  2BSK B;  5ALV A;  3NVV A;  1ARO P;  3MFI A;  4DL4 A;  1SWV A;  1ZQR A;  2BCR A;  5IIK A;  1SIJ A;  4F5Q A;  1NTK H;  5JJN B;  4OPH A;  2AXT U;  5J0W A;  5J0O A;  1NK4 A;  1WWV A;  2PF4 E;  5DG8 A;  4IGG A;  2Q7H A;  3JD4 A;  4UAU A;  1B6Q A;  4YN4 A;  4O4J B;  3H8W A;  5GW7 A;  1PM9 A;  2W54 A;  4RZR A;  3N27 A;  3U10 A;  2ZXI A;  5BPC A;  2Q6A A;  3OMI B;  1IXB A;  5J0R A;  1ZSP A;  1FO4 A;  1W59 A;  4UBB A;  4LNU B;  4TQS A;  2OTL V;  3UMC A;  1XIL A;  3Q4H A;  2GDS A;  4UXN A;  3ABT A;  2G0A A;  4J7K A;  4DR5 B;  3T5J A;  1F23 A;  4RNO A;  1KQS U;  4F2S A;  4UB8 Z;  5ALW A;  2F1I A;  3WK8 A;  4O0I A;  1KLN A;  5KT7 A;  1ZJM A;  2AZ2 A;  2CTP A;  3CX5 F;  5AKL A;  2B9Z A;  3RWR D;  4J11 A;  9ICU A;  5DG9 A;  2IA6 A;  1FPO A;  3PX0 A;  4UV9 A;  1YTF D;  1N8R W;  5AM1 A;  3LUT B;  5J2T A;  4B9L A;  4FIP C;  1NNL A;  3E83 A;  8ICO A;  1HW7 A;  3HP6 A;  1IG6 A;  1NJW A;  1QH9 A;  2KQX A;  1Z5V A;  1Q8I A;  1A0P A;  2I1Q A;  2C2D A;  4GCZ A;  4F4Z A;  3I28 A;  5DB6 A;  3ZHQ A;  1GKF A;  3TCU A;  3J80 N;  5IIJ A;  1DK3 A;  1WCN A;  4NL9 C;  4CE6 A;  4BIU A;  5EYP A;  2I9G A;  2JZB B;  2HVH A;  1W0J G;  3JD2 A;  9ICN A;  3SDL A;  4BIZ A;  1S5J A;  2R9I A;  1YIT V;  1HNW B;  1PK1 A;  2HJD A;  3B9J A;  4BWJ A;  5J2C A;  1I7F A;  3EUB 2;  4KLT A;  2DQN B;  5KFO A;  4F4K A;  3AG3 C;  5JH7 B;  2VQF O;  4IQW A;  4O5E A;  2HG5 C;  5J2E A;  1MQ2 A;  7ICI A;  1COK A;  2K4P A;  3CCV V;  4Z2W A;  4KXR A;  3H0M B;  5JH7 A;  3BRC A;  1ZQC A;  2BDP A;  5EWG A;  1SV0 A;  2VIX A;  3H1J H;  4IYH A;  4LWS B;  2JGD A;  1LUW A;  1SES A;  4J9O A;  4O3S A;  4C80 A;  2LFS A;  2UUB O;  2W9C A;  1OCZ B;  1QHT A;  4UB4 A;  2OIE A;  1NZP A;  1N48 A;  1C7Y A;  2BPG A;  2RRD A;  4JB3 A;  4LJX A;  3BQ1 A;  1TAM A;  2LYB A;  5D5Q A;  2OCH A;  3B8M A;  5JVD B;  3PSF A;  1Q81 W;  4WFB V;  2NLJ C;  3IDW A;  9ICA A;  1CPY A;  3UXN A;  4ECR A;  2YXY A;  4PA3 A;  3TAD C;  1TV9 A;  5J0Q A;  1TE2 A;  2DYR C;  4RWU A;  1NR1 A;  4RPZ A;  2ATK C;  3H1K H;  1N36 O;  3H0L B;  5KFY A;  4DR2 B;  3T5K A;  1R3L C;  4Z6C A;  1H2K A;  4GX0 A;  1ZAU A;  2HVJ C;  4JWM A;  1OCR C;  5AKE A;  2ZIX B;  4JI7 B;  4JMU A;  3QO5 A;  4TV8 B;  1V85 A;  2H3I A;  7ICQ A;  1BPX A;  2C22 A;  2HCF A;  2EJ7 A;  1SS3 A;  3BAA A;  4DUY B;  5LOV B;  2E8O A;  2W9B B;  2V4D A;  2CTW A;  2F4V O;  3AQE A;  3SV3 A;  4KLG A;  1VQP V;  4B3M O;  3K1Z A;  4ED1 A;  4JZ2 A;  5KHJ A;  3JAW A;  1Q3U A;  3KG2 A;  3AM9 A;  1LKY A;  3PR4 A;  3CC7 V;  3OEH G;  1G8M A;  3RB6 A;  4O3O A;  2KK0 A;  3KFU F;  1DXS A;  1IX9 A;  2P6J A;  4QZF A;  1H2S B;  4YXW G;  3CEI A;  1AI5 A;  1PK1 B;  3CRA A;  3ABU A;  1VF7 A;  3PSI A;  2CK3 G;  5CB4 B;  5ALS A;  2KKW A;  4CDG A;  2UUB B;  1M93 A;  1ZQW A;  1P7B A;  4YJ3 A;  4TV9 B;  3OGC C;  1WYG A;  4B9U A;  1RPR A;  5DB8 A;  2R8K A;  4X1K A;  1SRY A;  5CWR A;  5JCO C;  3OW2 U;  2QLT A;  5H2F Z;  3SPJ A;  1KD1 W;  3BS5 A;  2ZM6 B;  1MA1 A;  4U7C A;  3JAL A;  4MVS A;  5CA1 B;  1BGX T;  2YXL A;  4Y2X A;  4UB5 A;  4F8R A;  4LCU C;  3WK4 A;  3GWK C;  1KTQ A;  3IJ4 A;  8ICX A;  3JYC A;  1GMG A;  2E8M A;  4YHH B;  1N33 B;  4E4E A;  1JOY A;  2W8K A;  2YTU A;  1I5Y A;  5GTI Z;  3WB0 A;  2RLT A;  2PI4 A;  4KLD A;  5GTI U;  3P3N A;  2BGW A;  2B1I A;  1R3K C;  4XRH A;  3H8S A;  4MTX A;  2Y48 A;  4QIW C;  4LF9 B;  2IOH A;  2BQU A;  3SYA A;  2QA4 V;  1XNS A;  4O2B A;  1OJH A;  2HBK A;  2R8J A;  1Q3V A;  3U26 A;  5AKG A;  1YT3 A;  3CHX A;  2UXB O;  2D2C B;  2Q5Z A;  1NQT A;  4DRX B;  4Y2J A;  4UVA A;  4O2B B;  2Z7J A;  3TKA A;  1NKE A;  2W8L A;  3UXP A;  1AR1 B;  2ZIM A;  2XND G;  4JV0 A;  1HDJ A;  5JTI A;  2WF8 A;  4PI2 A;  3KHH A;  1O03 A;  1Z19 A;  2WWW A;  4J7Z A;  2FMS A;  1MC8 A;  1TA8 A;  3OM3 B;  4IRC A;  2G38 A;  1GRJ A;  5IY5 C;  4HNA A;  2MSN A;  5B5E U;  5B1A B;  4K35 A;  3UPQ A;  3FAH A;  4UBC A;  4PV1 B;  1OUQ A;  4DUZ O;  1BCC H;  8ICQ A;  2FKX A;  4EX7 A;  3B40 A;  4P2H A;  1MZE A;  1KBH A;  1FIQ A;  2ADP A;  4YVZ A;  3QF7 A;  4P0Q B;  4MSW C;  1GAX A;  5JVD A;  1ZQK A;  9ICE A;  5CA3 A;  3GB7 C;  5AI9 A;  1S10 A;  3IC7 A;  5CBG A;  4NTY A;  4C8K A;  2L6L A;  2Q7G A;  3C2L A;  2WLM A;  3V6K A;  1EFR G;  3HKZ F;  1M1K W; 
#chains in the Genus database with same CATH homology
 2DYR B;  4KX3 A;  1AJN A;  2YX8 A;  3A0R A;  3CCR V;  4WJ3 B;  1M56 B;  4WFE A;  4X88 A;  3W7W A;  2VKQ A;  5IYC O;  2W03 A;  2BDU A;  3DTU B;  1YIJ V;  3K0D A;  4JGS A;  4KP4 A;  2AHY A;  3SPG A;  1K97 A;  3ZRW B;  5LHH A;  3SYO A;  5CMU A;  2JH7 A;  3D2S A;  2DYS C;  4NLC A;  1NKD A;  1W0K G;  1Y66 A;  5H6Q A;  1COW G;  4MTF A;  1QLN A;  3DEE A;  3N7P D;  2H3F A;  1F51 A;  4NV0 A;  1FFT B;  1P4R A;  2HVK C;  4X89 A;  3ZRW A;  4QNH B;  1NJI W;  3STL C;  3OAA G;  1VQ4 V;  3WFV A;  1Q86 W;  3SAH A;  2EZO A;  3E89 A;  2EIN B;  4P2Z A;  3CP8 A;  2H94 A;  3NUQ A;  3ZRV A;  2JGA A;  1R3I C;  5LGT A;  1EBO A;  3G71 V;  5L3F A;  1Y4M A;  3QO8 A;  3W7T A;  3C29 A;  3H01 A;  1M57 C;  1NH2 D;  2RHF A;  5IDJ A;  2G5H B;  2OM6 A;  3PJS K;  3RVZ A;  2IJH A;  4PL1 A;  4PDL A;  3CCQ V;  2M0N A;  2MK3 A;  2KD1 A;  1BHA A;  4H33 A;  4JAV A;  3ICX A;  1MAB G;  1AI6 A;  1K8A W;  4H37 A;  2DWD C;  2FTK A;  1JX9 A;  3ABK C;  5B1N A;  3BY6 A;  2DWE C;  4J9Z B;  3AG4 B;  2HBJ A;  1KP2 A;  3E86 A;  2HOF A;  3OE7 G;  4PDV A;  3NXS A;  1GTO A;  4MW8 A;  4DO2 A;  3STZ C;  3CCE V;  2HBM A;  4QPJ A;  1YJ9 V;  4BJQ A;  1VQL V;  2H3V A;  2EZP A;  4Q20 A;  3LVV A;  2GHY A;  1S0V A;  2WLJ A;  3K3W A;  3OR6 C;  5L3E A;  4P0P A;  4WFH A;  4RUE A;  3IFX A;  1BHB A;  4MVU A;  5KUM A;  5LHG A;  4AYB F;  3K04 A;  4OJL A;  1EZJ A;  3T79 A;  3AL0 B;  2P7T C;  3ASN B;  5EBL C;  1F44 A;  3SMV A;  3F53 A;  5CBH A;  2D3O W;  1RPO A;  3ABL C;  5LHI A;  3E2E A;  4MTO A;  5KA6 A;  2B5U A;  5B1O A;  2LHT A;  1AJQ A;  1GM9 A;  1NZB A;  3CCU V;  1E79 G;  2KKV A;  4TSF G;  3OUF A;  2GH1 A;  3E0F A;  3SJQ C;  2JHD A;  3RFA A;  3SAF A;  2ZDI C;  3R65 A;  2EBO A;  4I5S A;  3CCM V;  3K9A A;  2XAF A;  2W7P A;  3SPI A;  2F76 X;  1PVR A;  2JH1 A;  2CRX A;  3ABL B;  3F5W C;  1S3J A;  2R18 A;  1ENV A;  3HKZ C;  1FXK A;  3MHH C;  4FJC C;  1YJW V;  3HPL C;  4BUG A;  3CXC U;  2G06 A;  1FS0 G;  4QIW F;  1ROP A;  4QPK A;  3VBB A;  1S77 D;  4P9O A;  5HFM A;  3UM7 A;  1YTF B;  1R6K A;  4FE3 A;  3NRW A;  3PSP A;  2DW4 A;  3QO7 A;  4CZZ A;  1FXK B;  1YI2 V;  5DN6 G;  1OHH G;  2OXO A;  3W7S A;  3F2C A;  2KNJ A;  3F2D A;  1MOF A;  3ABM B;  1K4D C;  3SYQ A;  1MG1 A;  3ZMS A;  1QVG U;  2B1G A;  3WG7 B;  2CN1 A;  3UKM A;  3IG8 A;  2EIJ C;  2ITC C;  3PST A;  1DTO A;  4JYC A;  4F4L A;  4R8C A;  2LKY A;  1JVM A;  3ABK B;  2W7O A;  4UV8 A;  2KJ9 A;  1NVP B;  5IYB O;  1K92 A;  3CP1 A;  1R3J C;  1M9N A;  5KUK A;  1VQ7 V;  1PNM A;  3M6Z A;  1KP3 A;  2NV3 A;  1V54 C;  3ASO B;  2HR3 A;  2ZR3 A;  1IXM A;  1ED1 A;  4MVQ A;  1XL4 A;  3AEI A;  1PNL A;  1F4N A;  3M6K A;  4ZBM A;  5A0L A;  4J9Y B;  1FXV A;  4FMT A;  1OCC B;  3SPC A;  1T94 A;  2E5S A;  1QR9 A;  2HKO A;  3MGV A;  1Q7Y W;  2F2A B;  2W0F C;  3LDD A;  3C28 A;  3GWO A;  5IYD O;  2BOC C;  4FK5 C;  3L3F X;  1QCE A;  3E35 A;  4FPP A;  2DYS B;  1SER A;  4WCE V;  1ZWI C;  2W04 A;  2IJK A;  3E8F A;  4C0Z A;  2ZIW A;  3MHS C;  2GSM B;  1V55 B;  1NH2 B;  2IU0 A;  2KHV A;  2RP5 A;  4U7N A;  5E1A C;  1PD3 A;  3ETE A;  2K4H A;  5LGN A;  3B8N A;  1GM7 A;  4ASU G;  1M56 C;  4KUM A;  1VQ6 V;  3K03 A;  1PNK A;  2KB1 A;  5CBF A;  3FB6 C;  4X8A A;  1KEC A;  4R50 A;  4OO1 J;  1L6N A;  4JPR A;  4PDM A;  2LYA A;  1WPX A;  2K89 A;  4NLB A;  3AG1 B;  2X6A A;  5J9P C;  2W6J G;  2WLN A;  2G08 A;  1K7D A;  1OCZ C;  4I9W A;  2ZR2 A;  4L87 A;  4QJF B;  1JQ0 A;  1THZ A;  3F7V C;  4RQE A;  4PA9 A;  3T1C A;  2Y0S C;  3DGE A;  5KA5 A;  4KMO B;  1H8E G;  3LDC A;  2WSS G;  3E8H A;  3OMA B;  4ZKI A;  2ITD C;  3LSQ A;  5B3S B;  3T4D A;  1QLE B;  3P30 A;  2K8B B;  4KX5 A;  3OPX A;  2JIZ G;  4HYO A;  3ZRS A;  2F8L A;  3LYS A;  2UXX A;  3D3I A;  2D6F C;  4MVM A;  4PA6 A;  1MA7 A;  2AHZ A;  4WFF A;  3CYO A;  3K79 A;  5B1A C;  2QKS A;  2XAJ A;  1YHQ V;  2P67 A;  1FXH A;  2UXN A;  3ZJZ A;  1K3E A;  2R9R B;  4P30 A;  4O3M A;  1QVF U;  2JDI G;  1I5X A;  4JTD B;  2JMG A;  2MRL A;  2X7R B;  4RAI A;  2QE7 G;  1DRG A;  2JEX A;  1ORQ C;  3SYP A;  1GO3 F;  3JD3 A;  1K73 W;  1SZT A;  3T4Z A;  5H6R A;  1ZQ1 C;  1V55 C;  2N1R A;  3FB8 C;  4P0P B;  1SZH A;  3EFF K;  3CCJ V;  3WG7 C;  2Q68 A;  3ALR A;  2WB1 F;  4UVB A;  3N7R C;  2DF4 B;  4UUJ C;  1PVP A;  2X6C A;  3LDE A;  5EBM C;  5EBW C;  4XBF A;  1VQ9 V;  2Y69 B;  2IH3 C;  2K4I A;  1NBM G;  2KVC A;  2WLH A;  4MS2 A;  1WLE A;  4XDL A;  2E1F A;  1F4M A;  3EHB B;  1OCC C;  3FB7 C;  4JAS A;  3CMA V;  3RVY A;  2GOL A;  2XAS A;  3M7D A;  4BX9 C;  2JJ2 G;  2ZIU B;  4AYB C;  2VJ5 A;  1NVP D;  2A3V A;  1HEK A;  2Q67 A;  1V54 B;  3ASO C;  3D36 A;  4KFM A;  3PZP A;  3BEH A;  4CBC A;  2OT5 A;  1KKD A;  3T2M A;  2IJI A;  3ETG A;  2ZIU A;  1S72 V;  3W7U A;  2HMX A;  4RO2 A;  5CRX A;  3I56 V;  2WB1 C;  2OCC B;  2QM8 A;  2XAH A;  4QE9 A;  3ZN0 A;  3K08 A;  1XO0 A;  3ASN C;  1DF5 A;  3SYC A;  2E1E A;  3CME V;  2HBL A;  4PEL A;  3ABM C;  5EK0 A;  5KL8 B;  1UJW B;  3OUS A;  5HFL A;  3RF9 A;  5C0Y A;  1H8H G;  4QE7 A;  1ARO P;  3ZCC A;  3VCB A;  5HR7 A;  2PMZ C;  2YSU B;  4GFJ A;  2YB4 A;  4JYB A;  1DF4 A;  1CP9 A;  3N7S C;  1VQ5 V;  4R6Z A;  4XDK A;  2V7Q G;  4PDR A;  1OCO B;  2IJJ A;  2HFE C;  1VQK V;  3F5A A;  2K4E A;  2YEV A;  1HIW A;  2K8A A;  1B6Q A;  3JD0 A;  3JD4 A;  4PA7 A;  2WLI A;  4OJ6 A;  3SPH A;  5GW7 A;  2KEY A;  2OCC C;  5CN0 A;  2MA1 A;  2LBO A;  1KBU A;  2ZXI A;  1UPH A;  2Q6A A;  3OMI B;  2H3Q A;  4MW3 A;  3ZN1 A;  1HWY A;  5FL7 G;  4QNL A;  2WAM A;  2ZQM A;  3VC8 A;  5L3G A;  4RQF A;  2OTL V;  4GX1 A;  2WLI B;  4UXN A;  3JD1 A;  5EC2 C;  1L1F A;  1JJ2 U;  3ABT A;  2G0A A;  2WAQ C;  3CPW U;  1F23 A;  3SAG A;  1KQS U;  3TK1 A;  2ZXH A;  3FB5 C;  3CC4 V;  4MVR A;  2F77 X;  3GZF A;  2OTJ V;  4TT3 G;  4HAM A;  1VQO V;  4UV9 A;  1YTF D;  1N8R W;  3LUT B;  1G4Y B;  4FIP C;  2Y69 C;  3OR7 C;  3E83 A;  3CCS V;  4OJO A;  1JCH A;  3HB3 B;  2PI5 A;  3LVW A;  1A0P A;  2KHQ A;  4GCZ A;  1GKF A;  3TCU A;  4BIU A;  2JK5 C;  1K4C C;  1W0J G;  3JD2 A;  4A8E A;  4BIZ A;  1QBZ A;  4WFG A;  2R9I A;  4EKW A;  1NR7 A;  3K06 A;  1YIT V;  2QEX V;  2C2A A;  3AG3 C;  1RM1 B;  2DQN B;  2EIL B;  1A6S A;  3E8G A;  2HG5 C;  2IH1 C;  3X2Q B;  2NNU A;  1AI4 A;  1QLE C;  1TUE B;  3CCV V;  2LFR A;  3H0M B;  1DLB A;  3LSS A;  2XIC A;  1KC8 W;  3RW0 A;  3VOU A;  2EIN C;  2VIX A;  3CD6 V;  2KOB A;  2Z5U A;  2KJ5 A;  2WPD G;  2IW5 A;  3ZMT A;  1SES A;  3O0F A;  2LFS A;  2ZXW B;  1OCZ B;  1GM8 A;  2RRD A;  3CRX A;  2XOK G;  3AG1 C;  1TAM A;  3KZX A;  2LYB A;  5C93 A;  4FZM A;  1VQM V;  2WLK A;  3AG3 B;  1RM1 C;  3B8M A;  1Q81 W;  3PSF A;  1BMF G;  5IY5 B;  1W2B U;  4WFB V;  2NLJ C;  4GX5 A;  1CPY A;  1YSC A;  4PA3 A;  4JTA B;  3SQI A;  2ZIV B;  2ZIX A;  2DYR C;  2H3Z A;  1S76 D;  1NR1 A;  3ZRX A;  5HR6 A;  2ATK C;  2EJR A;  3H0L B;  1SET A;  1R3L C;  4GX0 A;  4E2L A;  4GT1 A;  5T14 A;  3OMN B;  2HOQ A;  2HVJ C;  1D8B A;  1OCR C;  2ZIX B;  1R6N A;  4JMU A;  4UVC A;  4Z1M G;  3QO5 A;  3F7Y C;  5EC1 C;  3RBZ A;  2H3I A;  2WAQ F;  2CPR A;  5H9C A;  3G6E V;  4JAU A;  1K34 A;  3MD0 A;  4N23 A;  3E8B A;  4CRX A;  2EIM C;  2KKP A;  1K9M W;  3AQE A;  2Q4T A;  1VQP V;  3K1Z A;  3ONN A;  1Q3U A;  3KG2 A;  1XL6 A;  3D2N A;  3FKS G;  2Q69 A;  3CC7 V;  3OEH G;  4MVZ A;  1YJN V;  1G8M A;  1WUD A;  2A79 B;  3KFU F;  1VQ8 V;  4OXS A;  4TWK A;  1JPX A;  1PKX A;  3ZMU A;  4BW5 A;  2VJ4 A;  2Y0S F;  2P6J A;  2KIW A;  2OYY A;  1LNQ A;  2ZG6 A;  1BL8 A;  1K5S A;  2EIK C;  4JTC B;  1AI5 A;  4YXW G;  2EIJ B;  3ABU A;  1QR8 A;  3OFN G;  1M90 W;  3F2B A;  3PSI A;  2CK3 G;  2QM7 A;  3IN5 A;  4FZN A;  1OCO C;  3QNE A;  4G2K A;  4CDG A;  2QTO A;  1P7B A;  5B1B B;  3CC2 V;  3B77 A;  1URJ A;  3OGC C;  3IG5 A;  2DQ0 A;  2YB1 A;  1RPR A;  3P32 A;  3IGA C;  3JCZ A;  2G09 A;  1SRY A;  1FXK C;  4R7C A;  4XDJ A;  4BAY A;  2WLL A;  4OJ5 A;  5L3D A;  2ZIW B;  3AG2 B;  3OW2 U;  3FYI B;  4U6P A;  3K0G A;  3SPJ A;  1KD1 W;  4HZ3 A;  3I55 V;  4U7C A;  2G5I B;  2HJF C;  3M99 B;  4MVS A;  3LNM B;  3OEE G;  3ML0 A;  3IP4 B;  4MT8 A;  3D2Q A;  3CCL V;  4ICA A;  4LCU C;  3AQF A;  1J95 A;  4LP8 A;  2Z3Y A;  2ZD9 A;  3JYC A;  1GMG A;  2X6B A;  4N21 A;  2IU3 A;  2P90 A;  4PL2 A;  4DXW A;  1JOY A;  2WLM A;  1I5Y A;  1S5H C;  3ETD A;  2PI4 A;  1K5Q A;  2B1I A;  1R3K C;  1M1K W;  4MTX A;  2Y48 A;  2ZIV A;  4QIW C;  2XVT A;  4P9P A;  3SYA A;  4NWI A;  5L3B A;  2QA4 V;  1VQN V;  1XNS A;  3FYE B;  1Q82 W;  2HBK A;  3AG2 C;  4JF3 A;  4RUF A;  3ZIA G;  2V1D A;  1Q3V A;  4MTG A;  3ZMZ A;  4WFA V;  1E1R G;  1YT3 A;  2XID A;  2HLD G;  3GU3 A;  5LBQ A;  1NQT A;  4UVA A;  2XAQ A;  2Z7J A;  1AR1 B;  1H38 A;  5DM6 V;  2XND G;  5B1B C;  5L3C A;  2K8C B;  4LBE C;  4FZL A;  4IC9 A;  4OJP A;  1Z1B A;  1PL0 A;  2A9H A;  2F43 G;  4G27 B;  3AG4 C;  2BOB C;  2EIK B;  3W7X A;  4G28 B;  2XAG A;  2DGZ A;  2X0L A;  1Z19 A;  2WWW A;  1R73 A;  4WF9 V;  1AJP A;  3OM3 B;  5BZB A;  5IY5 C;  3TET A;  2HOI A;  1MSW D;  1E1Q G;  2G07 A;  5B1A B;  1K33 A;  4CGZ A;  1M57 B;  2PMZ F;  1ECW A;  3F5E A;  2OH2 A;  2H8P C;  2XI9 A;  2K1E A;  2ZXW C;  4P0Q A;  4ACO A;  4U7O A;  2DQ3 A;  2EIM B;  2W6I G;  1OUQ A;  5LGU A;  1PVQ A;  5B3S C;  2A0L A;  1H2G A;  1CRX A;  1P7D A;  4PA4 A;  1CEZ A;  2KJ8 A;  4P0Q B;  3ZMV A;  2JJ1 G;  4MSW C;  2LP7 A;  3G4S V;  4MVO A;  1OCR B;  2KV2 A;  2WLL B;  3GB7 C;  5CA3 A;  2M7W A;  4LC1 A;  3X2Q C;  3CYM A;  1IIP A;  2JEU A;  3IC7 A;  5CBG A;  4GX2 A;  2ZDI A;  2EIL C;  1OZ0 A;  1AI7 A;  5KL1 B;  3H0R B;  1GK9 A;  2KIC A;  1EFR G;  3HKZ F;  2YEV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...