4QJFB

X-ray crystal structure of thermocuccus kodakarensis rna polymerase rpp4/rpo7 (rpof/rpoe) complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
122
structure length
122
Chain Sequence
MIGRKKLEEHYITIAEAKELLERRHAEGLAENPEEPMFYEARVSLEHAERFAKLKPEQARELKEKLMGLFDWINERIAAKLVDILPEDYLDIRVIFAKEEYMPTPEEAEEIIKVIDEYRPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase, subunit E'
publication title Crystal structure of euryarchaeal RNA polymerase and insight into the evolution of RNA polymerase II structure
rcsb
source organism Thermococcus kodakarensis
molecule tags Transcription
total genus 39
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4qjfB02
1.10.287.420 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4qjfB01
2DGZA 2HBMA 4CDGA 3SAGA 2RRDA 1GO3F 4NLBA 1D8BA 2MA1A 2HBJA 3CYMA 1WUDA 1YT3A 2E1FA 2HBLA 4OO1J 4CGZA 2KV2A 2RHFA 3SAHA 2E1EA 3SAFA 4O3MA 4NLCA 4QJFB 4QIWF 2CPRA 5C0YA 2HBKA
chains in the Genus database with same CATH superfamily
5HR6A 2DGZA 5IYBO 3OR7C 2V4DA 4JI5B 2KJ9A 4OPHA 4ECTA 4YMNA 5EE1A 4ECSA 1AJQA 4DL5A 2BOBC 3OJSA 1Q3UA 5EE9A 2BHNA 2XCPA 4FM2A 2IH1C 1YEWA 2ZE5A 1XSPA 3DSQA 4ICGA 4BGDA 3BEHA 4YY3B 1QLEC 4ECXA 1F23A 3I28A 5KFLA 1I5YA 2QM8A 3ABKB 4H37A 5KFPA 4QZGA 3LSQA 7ICMA 4F4YA 4JI5O 2I6XA 2CDYA 4NXNB 1Y66A 1VQ7V 4DO2A 4O3NA 4DFMA 4EBCA 3Q4HB 3AMZA 1EBOA 4O4JB 2PMZF 4OJ6A 1C7YA 5EWEA 5J2FA 4EYIB 2VA2A 4YY3O 4RPYA 4EZ6A 1I5XA 2QKAA 9ICQA 4FZ1A 4Q45A 3AG2C 2ISPA 3FC4A 7ICUA 4LF5O 1HNWO 4FLVA 4RQ2A 2JHDA 9ICCA 4X1IB 3D6JA 4PH5A 4NXNO 1NK6A 1KDHA 5ITZB 2FDRA 4O4IA 2FE9A 1S0VA 4K0KB 2DFLA 2MUTA 1Z1BA 3HRDD 1ZSPA 4J9ZB 3K9SA 1NH2B 4DEZA 3ZHTA 2EIKC 5AKIA 5HP4A 1SRYA 1V38A 3F5EA 3QU9A 4UB8U 1YJWV 1AI7A 4UB3A 1GN2A 4X20A 2PKEA 4XQ8A 2FLLA 5B5EZ 1MA7A 1KD1W 4K0KO 2DOSA 5BMVA 1JOYA 2YIDA 4FFDA 4P0QB 1DGSA 4DL2A 8ICVA 1S0OA 2F3NA 1QSLA 2WLHA 4DQSA 2YDEA 3RYCA 3OUFA 4KN7A 4B7EA 2JRZA 5C5JA 5ALPA 4DV6B 2DQ3A 4TV9B 1X9MA 3K4GA 4YMMA 5LOVB 3I1YA 4FLXA 8ICUA 5AHXA 2F76X 4RWUA 1ZJMA 3GWOA 2VIXA 3PW7A 4JYCA 3S6JA 2UUBO 1ENVA 3SPHA 5AKKA 1R3LC 4GKKO 1OCRC 3HKCB 2CPRA 4CH6A 2DE0X 5AM2A 3K5LA 1WP7A 2IOHA 3PW0A 4DV6O 4DLGA 1RQLA 4KLDA 4M0AA 2FL4A 3BA8A 1Y74B 4KLJA 4KMUA 2IA6A 5LXTA 1PKXA 4J9YB 1S5LU 3JPRA 2C2AA 2UXXA 4CGZA 4RNNA 2W11A 1S9FA 3L3FX 3EUB2 3ISCA 5DDYA 2DUYA 4DF4A 4UVBA 2N1RA 2B1IA 3TKAA 4F6RA 2F2AB 1ZQCA 2Q8VA 4JI0B 2BPGA 1O9HA 5ALFA 2JS5A 2K1EA 1PL4A 4X1YB 4WFAV 4XRHA 1ZL8B 1L3VA 4DV2O 3QF7A 1N36B 1B06A 1YITV 2K8CB 3IP4B 3IFXA 2CAZC 4JZ2A 3ZCCA 3SQIA 1VP7A 3SAGA 3FB7C 2RRDA 1IM4A 4X5VA 5J0QA 4OJ5A 5IINA 3PVXA 8ICJA 4J41A 3K5OA 4D6TH 5BR8B 3MHSC 4JI0O 2KOBA 1YT3A 3SMVA 5LMUB 1L7NA 5KFAA 5L1IA 3Q8RB 4I2CA 2HHWA 2XAGA 3PX4A 3RBEA 5CBHA 8ICMA 1QCEA 4KTQA 4RUEA 5KHJA 2R18A 2YIAA 3RAXA 2W7OA 5DEDA 2OTJV 5DB6A 3HKDA 1UPGA 4PDMA 1BPDA 4PZNA 4QZEA 3WU2Z 5KHHA 4NYKA 3ZRSA 3IAYA 1Q3EA 5IYDO 2EIMB 2JEGA 4RUAA 3ZN1A 4ECYA 2DPJA 5LMUO 1AI5A 7ICRA 9ICRA 3IGAC 3C2KA 4X20B 5ALMA 5JRTA 1G8MA 4KLFA 1TUBB 3N7SC 1FS0G 2AH5A 2F95B 2G5HB 1WAZA 2G09A 4H33A 2YX8A 2HVIA 2GH1A 2QKSA 3ZMVA 3RYIB 1ZQKA 4UQGA 1Z00B 3VQVA 3C3SA 2MW2B 3T5LA 2G07A 4QW9A 5J29A 1Q6IA 4IRKA 4M2YA 1AP6A 3E0FA 3AG1C 4Y2PA 1QBZA 2DMXA 2PUSA 1IV8A 4B9SA 4UASA 1PK1A 1UT5A 3H7IA 4NJ8A 9ICNA 2E75B 1DK3A 2MSNA 2QWOB 4YVZA 4YJ2A 4M6WA 1MOFA 3SYAA 8ICNA 1X59A 2ODMA 5AI9A 4ED0A 1GN6A 3QG5A 4CC5A 1SWVA 3UMCA 4FVMA 5LHIA 3OGUA 1XMOO 4JYYA 2QA4V 5L1MA 1RM1C 2JH1A 2ZG6A 2IOFA 3JYCA 2UXCB 4Y2YA 4YFKA 5J2KA 5ALGA 2FLPA 2ITDC 5KMGA 2X0LA 1Q82W 3TACB 3M8RA 1OW5A 4C4SA 5CA0A 1MQ3A 1Q43A 1SZXA 2ZTCA 3H4BA 4ED6A 1ZQPA 1JX9A 1V55B 1LV5A 4MVMA 1GKFA 4FZLA 1JALA 3M99B 3HX0A 2UXCO 1OHHG 7ICFA 1SETA 1U48A 3I5DA 2DKXA 4DV7B 4JF3A 1JXEA 1NS1A 4CE6A 4KLOA 1AR4A 1MZEA 3G71V 1YTFD 4LWSA 4UARA 3WK4A 5GTIU 5CR0A 2H8PC 5H5NA 5CBGA 5IIIA 4PA6A 5IE9A 4B08A 1JMSA 4J9KA 4O2AB 9ICJA 2KN7A 2ZJ5A 4I2JA 1N62A 4JI3B 4O3RA 5D5PA 4O4HB 4DV7O 3PR4A 4DQQA 1NTZH 3NR7A 5LYJA 1VQOV 5KG2A 3FAVA 3B40A 4MW8A 2KVCA 1E1QG 1OV9A 2R8KA 4RNMA 2AU0A 5JJJB 8ICTA 2VA8A 1Q7YW 1TKDA 4P9OA 4NTXA 3JAWB 3NRZA 1KYOF 2GOLA 4AYBF 2W9CB 2OCHA 4EB6B 4F50A 4KLEA 2GSMB 3E8GA 3LYSA 2EANA 4BWMA 2UXBB 2KHQA 3ALRA 1ZQBA 9ICHA 1BNPA 5JJNB 4X62B 1I0HA 1BVSA 4I29A 3RFAA 3V6KA 3ABKC 4GKJB 5IIKA 4J42A 3GQCA 1B4FA 1NK0A 2KG5A 1VQKV 3CC2V 4DV3B 3JPPA 4IL6U 3ETDA 5IYZB 2W04A 3LWLA 5H6QA 3ZRWA 2FTKA 1PK3A 3K75D 3N97B 4R63A 2UXBO 3JATA 4BR6A 2CRXA 4FPPA 2EIJB 3O0FA 1R6TA 3APOA 4X62O 5DLGA 3E58A 4RPXA 1GN3A 3THOA 4GKJO 4US9A 4FK5C 8ICOA 4O5KA 5H2FU 3HILA 2ISOA 2VRZA 2ZXWB 3N2GA 4Q6GA 3SYPA 4DV3O 3HWTA 3H1LH 3N2KA 3GIMA 1CPYA 3EFFK 3VOUA 1VF5B 4Y2XA 1AVMA 4UBBA 2XGPA 3BRCA 2YI8A 3JALB 1SESA 2X6AA 4U7NA 1WLEA 3O65A 8ICYA 2JZBA 3ZRXA 5LP6B 5H6RA 2LQTA 2YTUA 4QIWF 5KNIA 5BPCA 1OUQA 2W6IG 3KZIU 4LNUB 1RSOA 4O5EA 2UUAB 3ZMSA 4IQTA 3ZD9A 2XNDG 3H9VA 2AHZA 2YICA 5AG2A 5KA5A 3QZ7A 4IR9A 5G5GA 2BPCA 3QTCA 4C8OA 3NVVA 3SI8A 2Y0IA 4GXJA 1S5JA 1JIHA 1KKDA 3R66A 4DW1A 2RDIA 1ZTEA 4JI2B 5AKYA 4DS5A 4FBTA 2VQFB 1QSYA 5KTQA 3C5GA 3HKZF 3RVZA 1TAMA 1VEWA 4LF6O 1SXEA 3RN4A 3CC7V 5DG8A 4B9LA 1UJWB 4EZ9A 3L4PA 3GV7B 3CRXA 4DUYB 1FPOA 3CYMA 4JI2O 4OJPA 2DL0A 4TUPA 3TXQA 4P9PA 2VQFO 2NRWA 1JVMA 3WKAA 5AM0A 3L71H 3HKBB 2BQ3A 3GU3A 4DQIA 3DXRB 1Q46A 1NI8A 2K60A 1ZWIC 4LP8A 3SAHA 4UCVA 4X89A 1TVKB 2Q73A 5AKJA 1NJIW 4DUYO 4ZH4A 1L3UA 3WFVA 1IURA 2BDUA 1KLNA 5EIBD 5J2UB 1BPXA 3HT3A 3EPIA 4NL9C 1SGGA 1URJA 4PJ0Z 4HNAA 2YQEA 2WA4A 2A06H 4ED2A 3G67A 4DR2O 4LC1A 1AB3A 2FI1A 5F3XB 2E3CA 2IM9A 4YCXA 4UB6U 2I5HA 1XU4A 3WK7A 1R6NA 1WG8A 1NNLA 4PA9A 3A2FA 3ZJZA 3OEEG 4XA5A 1RQNA 2DW4A 1CXZB 3TJTA 1BQ0A 4YN4A 1R3KC 3BHPA 4BWAA 5LA6B 1NZBA 1SC5B 2PF4E 2LHTA 2D3OW 4K8ZA 5LL6Y 5LBQA 2QM4A 3RYHB 1CP9A 2EIMC 5ALUA 2OHFA 5DB8A 4YR2A 1FFXB 2H94A 3QNEA 5J2TB 1EM1A 2ZIVB 4BAYA 5DECA 3CNHA 4EENA 2XAFA 4JB3A 4IQWA 1EN5A 1K7DA 4QE7A 2BSKA 1WUDA 4O2BA 2W8KA 1WA8A 3FYIB 2P66A 4TUYB 5EOZA 2FMSA 3K0GA 2DF4B 4EBEA 2LW7A 3UO2A 2R8HA 1XDCA 3HKEB 2HHSA 3UKMA 3E22B 1AJNA 4F91B 2E8NA 2P35A 4I2IA 5CA7A 4P0PB 1IBLB 3QUTA 3C1ZA 4BX9C 1AR1B 3ABMB 1DRGA 5JH7A 4LVSA 3ZDDA 1HNXB 2XVTA 1YF2A 4QZ9A 5J2CA 4UUJC 5KFIA 3ZDBA 4MFCA 1ZQLA 2ASLA 3RGBA 4X88A 4DUZB 5HNKA 1U96A 5KG0A 2YMQA 4XDLA 7ICNA 3GFKB 3WKBA 5AIBA 1IBLO 1OXJA 4MF2A 4WFBV 1X40A 3MC1A 2FJ6A 4PDLA 4DR7B 1ZQNA 2Y0PA 3EXAA 4LF9B 3MR3A 2RCVA 3PSIA 4DSLA 4K4GA 1QVFU 3AQEA 3KZXA 2KV2A 4GT1A 3H8SA 4CRXA 3BQ2A 2CGNA 1RPRA 4DUZO 1TK0A 3SENA 4EEYA 1FAFA 3IJ4A 4BXOB 1J97A 3BQ1A 4R65A 1N48A 4M9HA 1HWYA 4BIOA 4RQ7A 1V55C 4AHCA 1B3QA 3QEAZ 3FB6C 4DXWA 4GC6A 4DR7O 2AJQA 2YXHA 4ZIBA 2JJ2G 2O6KA 2AGPA 4QZ8A 5KFQA 1OJHA 4CS4A 3CCJV 3BDPA 3RB4A 9ICGA 4DFDA 3E2EA 2Y9UA 4E4EA 3Q4HA 4O4JA 2PZSA 3UM7A 1GMGA 1SQBH 1XNQB 1GH6A 1PVRA 4B3RB 3RH4A 1TAUA 3P30A 3AQFA 3Q8KA 2F8KA 2XT9A 4UCRA 2WTFA 4X1IA 4KLGA 2GUZB 3ZS8C 3N28A 2VWJA 1W0KG 4NTWA 5ITZA 1BT8A 1SQQH 3SZ2A 1ZX3A 1WCNA 1BQZA 4R8UB 2NN4A 4LFCO 5CWRA 5IJ0B 4DR4O 4JWNA 2WF9A 4B3RO 1A76A 4F5NA 4NY8A 2BCCH 5F9LA 1UA1A 1BPEA 2IBKA 3J81j 1Q8IA 2JGUA 2UVWA 4PL2A 5DBCA 2FPKA 1ZQYA 4O3PA 4ECZA 3H01A 2ATLA 4X66B 3LUTB 4P0QA 4KMOB 5HHIA 5KT3A 2K8BB 5DQIA 3JPNA 4AILC 5KT4A 5TZVA 3K5MA 4IGGA 3SYQA 7ICTA 4TV9A 1Y4MA 5J2HA 2Q7HA 2XASA 5LOVA 1T8EA 4J7ZA 3CMEV 1IBMB 4UCOA 4X66O 1X9SA 3V7JA 4AI8A 2EIJC 5IJ9B 2JJ1G 4ACOA 1W59A 2P4VA 5B3SB 2JEJA 1C20A 3TXSA 4BIZA 3HKCA 2KE7A 1VLBA 2WF8A 3CP8A 3UMGA 1WPXA 2EZZA 1JXLA 1JCHA 2ZXWC 4QGPA 1N8RW 4I28A 1N0NA 2PFQA 3H1IH 3ETQA 2KK0A 8ICIA 1Y74A 3EWAA 4TUSA 3UQ2A 7ICOA 4GFJA 8ICBA 2WLNA 2AHOB 1H2KA 3WG7B 2KNJA 1ZQFA 4YMOA 8ICXA 4RQNA 2PFOA 3RJHA 2LPEA 3K0DA 2PYJA 3M9OB 1TVAA 5CB1A 1TFRA 3CHXA 1ZD4A 5KFFA 1NJZA 4LBEC 1AQ6A 2LM4A 5DGBA 3BJYA 2C28A 3LDEA 4WFEA 1SA0B 3UM9A 4DQRA 9ICSA 5AI4A 1M9NA 1VIBA 4K4HA 4X1YA 2A19A 4I2EA 1ZL8A 1US6A 4MT8A 4NXMO 1HEKA 4NL9A 1SKVA 8ICSA 2N05A 2H5XA 1VQ5V 1NJXA 1Q6HA 1ZQTA 4OJOA 2CK3G 1B0XA 2M9NA 2IJJA 4U7OA 1K1QA 1UQVA 1KU9A 1SKWA 5T14A 2EILB 2ARHA 2P90A 3E8HA 1NZPA 4H44B 3KBBA 3WKEA 4K35A 1L6NA 3NXSA 3RR8A 4TQFA 5AM3A 4YIPA 2K4HA 3ABLB 1N61A 1KB9F 3LDAA 3G6BA 2W8LA 2LI6A 1FXKB 2FKXA 2NV3A 1M1KW 4TUQA 5KFYA 2F1IA 5CA1B 2FMLA 5JVDB 4I9WA 2Q0ZX 9ICFA 3EHBB 2HSZA 2I1QA 2F4VB 5ALHA 1Y67A 2Y0SC 2JDIG 7ICEA 3JD3A 4J9RA 4F2RA 2Q4PA 2Y4UA 2XTAA 1HW7A 3JARB 4I9QA 1TUBA 1N63A 1NK4A 5D46A 3QUBA 3O9OA 4B9TA 3JPOA 2XCAA 5DDMA 2KSOB 4K3AA 3SJQC 3RVYA 3RYIA 4NLCA 2LFSA 1Z00A 1K34A 5BOLA 3OE7G 1ZQJA 5KFXA 4PHDA 7ICPA 1XS9D 2LP7A 2F4VO 2UUCB 2A9HA 4I2AA 9ICIA 3B77A 3H1KH 3DV9A 1KRPA 1ZUQA 4DK0A 4EELA 1L8DA 4PGXA 5L1KA 4RQ1A 2AGQA 5J0XA 1RXWA 2ZIUB 2J6UA 1YCIA 5EC1C 5KL1B 3ZMZA 4MHVA 2UUCO 4PHAA 2ZJAA 1JR9A 2Y4TA 3RBDA 5J2BA 3ZDCA 2QARB 5KHGA 1S72V 4RUCA 4CBCA 4OJLA 3QU2A 3CRCA 4IHJB 1VARA 4NLZA 4E2LA 4Z2WA 3QEBZ 5IWAB 1XC9A 4FMTA 3SR2C 1NVPB 4NXZA 4C8MA 4F4KA 3OTFA 5AK6A 1RYRA 2XOKG 1ZQZA 2IHNA 2JH7A 1D8BA 2RNBA 3G6VA 5ALYA 4JAVA 4XDKA 2JIZG 1ZQ1C 4UB2A 5KFEA 3BA9A 3VQXA 1QR9A 3SPJA 5IWAO 1FFUA 2BCUA 1UT8A 5D49A 4YHHO 4J80A 4LZDA 4DFJA 1Z4OA 4KN4A 9ICOA 2KFNA 1BMFG 3AG4B 2IMWP 3MHHC 1ZOLA 2Q6AA 5LGTA 2MRLA 3RJFA 1MNGA 2B9ZA 4LF5B 1HNWB 1ZQUA 1L0LH 3ABMC 5FLXN 2HHQA 2QWRB 4KLQA 2Z0AA 4O2AA 5HFLA 4JYAB 4IRDA 2E74B 5KFSA 1XO0A 4WFFA 5KHKA 2N04A 4O4HA 4D7SA 2K9PA 2IU3A 1SS3A 3N27A 3ORYA 3DGEA 3P3NA 2DPIA 4LR3A 5ALKA 4WBNB 4KLIA 1NR7A 1THZA 1S3JA 1QH9A 1FFTB 1B22A 3KHLA 4JYAO 3JAWA 4KITB 3C28A 2KKWA 2ZTEA 1IDSA 2W9CA 4EB6A 3DC6A 2Q0OC 4FFBB 1XNRB 3BAAA 5AICA 4DRXB 3NASA 1DGJA 2WB1F 2ZE7A 3ABTA 2XO7A 1B04A 3FAHA 5C0YA 3SYCA 4R66A 4DFKA 1UHUA 2HHUA 4ECQA 4L8JA 2CH7B 3QUCA 4Z6FA 3BZCA 3X2QB 3OPXA 2FLNA 4I0XB 5JJEB 4ZI7B 1XNRO 5KX5B 2UUBB 5IYZA 1OCZC 2HVKC 4GKKB 1COKA 3CJHB 2VQEO 3V72A 3W7TA 1ZJNA 2ZT9B 4FLWA 3RAQA 8ICGA 5EE0A 3SJAC 2LJ2A 2IJKA 4GZRB 1F5SA 4ABMA 4DV0B 2C2EA 2D8CA 3NUQA 5LGUA 3B8MA 5B66U 3FYHA 1XUQA 2RJZA 3JCUZ 1ZXIA 4QZIA 5EBLC 2YS8A 4Z1VA 2QTSA 3OTQA 4IC9A 2OT5A 3JALA 5TISZ 2R9RB 5CRXA 4M04A 3KZIZ 4FM1A 5LP6A 2EAOA 4DV0O 4I27A 1PPJH 1HNZB 2MU2A 4LNUA 2WPDG 2ODGA 5IY5C 2HCFA 4DV2B 2KB1A 3KHGA 3AM9A 5B1BC 1SZPA 2HVJC 5JWPA 1CRXA 3PZPA 1A0PA 3V7LA 3WK8A 3RTVA 3WB1A 3CCEV 3UQ8A 2BE3A 2WLKA 1NJYA 4U3JB 5L3GA 1ZAUA 1WB8A 1HNZO 3SPCA 2EQYA 5AKXA 5J2GA 3VBBA 5E79U 5KLVH 2JV3A 3PO5A 2DYSB 4DOBA 3RW0A 2Y1IA 4IYHA 2BCVA 2ALZA 5J0OA 5B3SC 1RDFA 2ZTDA 1AJPA 2LBOA 5KAIZ 5DN6G 3ZMTA 4J9MA 2YIBD 3SYOA 1J5EB 3B2EE 5AI8A 4QZCA 4Y2RA 1MSDA 4DS4A 2JRIA 1Q86W 2Q7GA 4CZZA 2FPLA 3SPGA 4WCEV 4JV1A 3T5JA 2VA3A 1D9DA 2C2DA 1BCCH 3QU7A 4O3MA 3IC9A 1NOMA 4MTXA 5BZBA 4QE9A 2DWQA 3HKBA 3S3WA 4Y2TA 3H4DA 2IHMA 1ZQHA 1QQCA 4MEXA 2B5UA 3DXRA 4C8KA 3GILA 1J5EO 3ML0A 3TFRA 1TVKA 4C7ZA 3L70H 1RPLA 1ZQMA 3PSTA 3H1HH 5J2UA 1N34B 4G2KA 2NRXA 1G6UA 3CCSV 2AXTU 3PMLA 3K57A 4ZBMA 1X9XA 4JAAA 1YZBA 4CF4A 2HOQA 3PSPA 4GIBA 2EILC 5GW7A 3W7WA 4O0IA 5A2QN 3FFQA 2ZDIC 4B9VA 3TAQA 2A7WA 3CRQA 4JTAB 2ZXHA 1RFYA 1N34O 4GYCB 5DB7A 4DOAA 1HJPA 3QUQA 2JEFA 3ABLC 3TGUH 5KFBA 4U7CA 2QWPB 1YDXA 7ICJA 2XAQA 5LA6A 1L1FA 4MEYA 1FXKC 4XDJA 1L8OA 3AK1A 1TA8A 3E35A 7ICSA 4JTDB 4MVUA 4JI1B 3KG2A 4N21A 1NK9A 3RYHA 3D2NA 1L5UA 4EFEA 4UAWA 3RJGA 2A79B 5J2TA 4F2SA 1FFXA 4USAA 2ZIVA 3A0HU 2PGGA 3KCYA 1ZQWA 1K33A 2ZUBA 3F2CA 4UB1A 5AIAA 1I08A 3D3QA 3RT3C 1G1XB 3ZDAA 1E1RG 5GONB 4UBCA 3C29A 5EZYB 4TUYA 1D8YA 1JA8A 3OEHG 4TSFG 5D5QA 3F7YC 1PV0A 4NWIA 4JI1O 4F4LA 3HKEA 2ZR2A 1EFRG 3M1YA 3E22A 4RPZA 4P0PA 1IXMA 2PY5A 3C5FA 2JXJA 4JZGA 2GTAA 2X6CA 5CB4B 2P6UA 1EXNA 1NKEA 4LCUC 2HBJA 3PW5A 3WK9A 3JPQA 2LM1A 1H38A 3RR7A 2NRVA 4O9MA 8ICAA 2V1DA 2ILMA 5ALJA 1DK2A 2OIGA 2XHBA 5B1OA 2XUMA 4ECVA 4TT3G 2EDUA 1U97A 2VS0A 2KTQA 4CH4A 1BPBA 2RN9A 3OMIB 1S77D 1XSNA 4RZRA 1PL0A 4WF9V 1N32B 2NRTA 3MR6A 3JD0A 8ICFA 2EH9A 3OFNG 4PV1B 2XI9A 1KKCA 3K3WA 2B0CA 4IIJB 4PHEA 4BXOA 4R7CA 1A6SA 3HPOA 3RYFB 1G4YB 4B3MB 2YB1A 2QWNB 4H0LB 1VDVA 4DV1B 1P7GA 5B1AB 3PMNA 2YC0A 1N32O 1SL2A 3ASNB 4C4TA 5LGNA 4QZDA 1N5XA 2R70A 2P7TC 3AG4C 4FE3A 1LNQA 3TI0A 1JPXA 4TWKA 3QXGA 2C22A 2BZFA 2P6RA 2ZD9A 4TQSA 2IJHA 3SAFA 3SR6A 3I55V 4JYBA 4B3MO 2XGQA 4DCCA 4DV1O 1WWUA 3G80A 3U26A 2R8JA 3ISDA 2GUZA 3F53A 1RZTA 4FZMA 2DN9A 2JEXA 3J81N 5DQHA 4MTOA 4CF3A 2EZXA 4RO2A 4EEQA 4R8UA 2BPFA 5L3CA 2AW9A 1GK9A 2M6YA 5IJ0A 1KFTA 4N23A 4UB5A 3B09A 4MVOA 4B9NA 4MTGA 3KKAC 3IN5A 5H9CA 2L35A 3K1ZA 1UCVA 2ZIWB 5B5EU 3DC5A 2CE4A 4KLUA 2XAJA 3MFHA 3FB5C 2D3DA 1KECA 4ZKIA 3PJSK 5FP0A 7ICGA 2RQ5A 2Q4TA 1ZD3A 1P49A 2KD1A 4I55B 2JGDB 1UA0A 3CYOA 1YTFB 3X2QC 3F2BA 3T4ZA 2WF6A 4ASUG 1IXRA 4ECUA 4YXWG 5HHHA 1O03A 2WHEA 3WK6A 5J0UA 3NVWA 2JR5A 2QM7A 2Y48A 4LF6B 4CF5A 2K4PA 2JMGA 3ONNA 5AM5A 3PX0A 9ICVA 1KBHA 5IJ9A 2QKQA 4BW9A 1YZ7A 2A1JB 1Z3EB 3C21A 3PR5B 5L3EA 2KVSA 4TV8B 2WLIB 4O4LB 1JFFB 1KFDA 1S97A 2KZMA 3CWBH 4YJ3B 1AROP 2BTQB 1H2LA 4K8XA 2QJ1A 3RB3A 1VJ5A 5IT9N 9ICTA 3AK2A 2UVUA 3OTOO 4UW9A 3LDCA 4KL1A 1MABG 4NB5A 5DLFA 3WB2A 5L3FA 1SA0A 3L9DA 4Y2QA 4JAUA 3SV3A 2W0FC 4DR2B 1K9MW 1KFSA 1R3JC 4BW5A 2ES6A 1AR5A 5JQGB 4OPAA 4Z6CA 1WB7A 1JJOA 3GVMA 4ZOLB 5FL7G 1N33B 1KKXA 3UXOA 1WYGA 2ZXIA 2QSAA 2K8AA 1TAQA 2HHTA 4QZFA 3OSNA 2DYSC 4I7ZB 2UXNA 3PW4A 3F7VC 1XQ8A 5ALSA 5ALLA 4UCTA 1IZ3A 3T4DA 1XHXA 3EZ5A 1KP2A 2ZDIA 4TQDA 2HVHA 5GTHU 3F5TA 1H8HG 1YZ6A 3T1YB 4RQ3A 4M47A 1J2NA 2ZINA 2B6GA 3ZBHA 1N33O 2Q67A 3RRHA 3MDAA 3BS5B 1FXKA 2A0LA 2R9AA 3LVVA 2HOIA 2HHHB 4KX3A 5CA1A 3WU2U 4LH7A 5JVDA 4NLGA 2Y0SF 4GLXA 2NNUA 3H0LB 1BGYH 3D8CA 3TANA 1F0MA 1K3EA 4BJQA 3T1YO 3S3XA 4Y2UA 3KD3A 2OYYA 1YXBA 3JARA 4CNQA 3RH6A 4IYIA 5C93A 4MF8A 5L1JA 2KSOA 3UXNA 1VQ9V 4ICAA 2ZCEA 3N4MB 2HHHO 1LR1A 4ED1A 4HYKA 2KJ8A 7ICIA 4IR1A 1P7BA 2V7QG 4WFHA 3T3FA 4DQPA 2G06A 5IIOA 2OCCB 2F8LA 5J0WA 1MA1A 4KLLA 4YXMA 3HP6A 1KW4A 3QO7A 1XREA 2DWEC 1N56A 2BQUA 3ZX6A 3H8MA 3BABA 1WJZA 1KTQA 2YEVB 5J0PA 2ZIUA 5KUKA 5L1LA 4I4TB 9ICXA 3Q8MA 4UCUA 4L87A 2P4KA 4J9PA 1XNSA 1D8LA 2ZIMA 4PGYA 3QE9Y 4K4IA 3ASOB 3C2MA 2A1AA 5ALDA 3BCCH 2QARA 3CB2A 4PELA 3B9JA 4UVCA 4DWIA 1LUVA 5J2DA 4IHJA 1XMQB 3SPIA 1U4BA 3RWRD 1D2DA 2E1FA 3BPZA 4U3FH 3FKSG 3V6JA 1YI2V 2EJ7A 1X2IA 1AI6A 1N60A 1T7PA 4OXSA 3M6ZA 3ZDEA 2HHXA 2HI0A 1LVHA 3F2DA 1KL9A 1XMQO 4HAIA 1B43A 4G28B 2CGOA 2WSSG 2E3TA 3M9NB 4FS2A 2KSDA 3OUSA 1QHTA 1NK5A 2HHVA 4J9SA 4JV5O 3UO3A 3STZC 4QNHB 1SZTA 4KLMA 3V6HA 3B0YA 3DEEA 3CCVV 4R6ZA 4UV9A 1XHZA 1MQ2A 1LKYB 4P2HA 2W3SA 1PM9A 3SGIA 2M7WA 4FFKA 2XY5A 4LFCB 1VF6C 2RMKB 5JU5A 3WB0A 4DR4B 5KFCA 8ICHA 2H3OA 2WLLB 3K58A 5AI5A 3OD4A 2KZ3A 4AQYB 4GXKA 2H3VA 2Q9LA 7ICKA 3UQ0A 3OMNB 4LF8O 4WBNA 4O3SA 4B7KA 1TK8A 4W4KA 3KKAA 3AN1A 4AYBC 4DL6A 2UU9B 3LVWA 4Z1MG 3D2SA 4M9LA 4C0ZA 2F23A 4UB8Z 3ETRA 2ASJA 4FFBA 5CP2A 4QWAA 5ALVA 1PNMA 4J7JA 4DRXA 3KTQA 1XL4A 2W6JG 4AQYO 4J9NA 4C8LA 4I2HA 1Q81W 3E89A 4LJXA 4X9QA 2PI4A 1OCCB 5K1XA 2M0NA 1L3TA 4BDPA 3L73H 5B1AC 1MZFA 3C90A 2CH7A 1JN3A 1L7PA 1TK5A 3ASNC 2UU9O 1T4GA 2AHYA 4UXNA 4I0XA 1ZD5A 9ICLA 1P84F 2OYQA 2H3QA 4ZI7A 1DK1A 2B1GA 5KX5A 1KMIZ 4DV5B 2CTQA 3CJHA 1JI7A 4RQ0A 5J2IA 1WN7A 3CRAA 4NV0A 4UFZA 1WNSA 2HEPA 1Z5WA 1YIJV 5AI6A 5B66Z 4JV2A 2JEUA 5L3BA 2YXLA 3PV8A 5CEHA 3LDDA 4DR5B 4TQRA 2IJIA 5K1PA 2ZR3A 1ZQOA 4DV5O 3NVYA 1DF4A 1HP8A 4HZ3A 3HPLC 1T3QA 1ZLZA 5CN0A 2YMPA 5HR7A 4JK1A 2KQXA 4G3IA 4QIWC 1S5LZ 4ZHQB 2W55A 2W9BB 2EX3A 3F5WC 1KQSU 4X65B 2Z3YA 4DR5O 3AU2A 5DB9A 2AQ0A 4NXMB 3UMBA 3RJKA 3ZIAG 2HDOA 3MGVA 3TCUA 5LP6C 1MN8A 1SB3C 3IV6A 3RF9A 4RU9A 3RH5A 1K1SA 1NQTA 2GBOA 2Q69A 3OGCC 3QYPA 2IH3C 3MBYA 5E79Z 4I5SA 4MVRA 2QKCA 5HMLA 4RUFA 1TGOA 3CW2C 5KG4A 4U3JA 2D6FC 1NKBA 1ZQQA 3K04A 4PI0A 4X65O 1PZNA 4FLTA 1QR8A 4GX1A 3ETGA 5KFOA 3NRWA 2Y1JA 3W7UA 1YHQV 2KG7B 2QB1A 1Y76B 5KFJA 4PL1A 5ALRA 1Z2GA 1BL8A 3AEIA 4JI4B 3TQ1A 3P32A 2WAQC 4OX9B 5ALOA 4RQ4A 2ZJ8A 3ETEA 4GX2A 4YIOA 1KBUA 3CMAV 3T1HB 1HUOA 2ZIXB 3IHQB 3THVA 5CMUA 3ZI4A 3J80N 4NLKA 4F5OA 3QU5A 4YD1A 1I7FA 3AU6A 1ZQVA 1SL1A 1UFIA 2YB4A 2GHYA 4BUGA 4FBUA 1F4NA 1S8OA 5KG7A 1ZQSA 4JI4O 2CTPA 3ZHSA 4OX9O 4DL4A 3T1HO 8ICRA 3TARA 3PNCA 1HUZA 4QWCA 3B0XA 1YVWA 4EBDA 2F1MA 2HJDA 2Q7EA 4ZOHC 4B6JA 4OD0A 2EINB 3U11A 1V85A 3TADC 3D3IA 2EAPA 3N7PD 5EYPB 1ZQRA 4M9GA 5DM6V 4DF8A 1VF7A 3M9MB 1SERA 4NLBA 3NGDA 5KT2A 5J0TA 4YR0A 2CUGA 4FZNA 2CXYA 2ZQMA 4F92B 2D2CB 5LHHA 2GDSA 3CRRA 4JWMA 2P22C 1EZJA 1U47A 1RXVA 3RFRA 4LF4B 3A0HZ 2N74A 1S5HC 5KAFU 1NH2D 1FJGB 4Z6EA 3JSLA 5ALQA 4PA4A 1B6QA 1VQMV 3UXPA 4EX6A 4RAIA 1EN4A 2W9AA 1M5IA 2JK5C 4J9LA 4Y2VA 2GO7A 3K9AA 3G6XA 4F8RA 1ED1A 4YHHB 4F5RA 3RJJA 4RQFA 1ZQDA 5GONA 3ZHUA 1PUZA 1K4CC 1R1BA 5EZYA 2YY6A 2J6TA 3JSNA 5KT6A 2CN1A 4KXRA 4LF4O 2A3QA 1FJGO 1F4MA 8ICCA 3A0BU 2MAXA 1Q8KA 2XC9A 2OCCC 1U45A 1PVPA 1KUQA 3LSUA 5CB4A 3MR5A 5GTIZ 3EVKA 3TK1A 3M8SA 2OH2A 1GTOA 4I2FA 1K5QA 1VF6A 3JCZA 2ITCC 3L5KA 1QCKA 3LSSA 4R64A 4I50B 4F72A 2H3FA 5AKLA 4X1KB 5LMNO 3ASOC 4I2GA 3AK3A 2OTLV 1GO3F 1K5SA 3ZHQA 4CH3A 4LFBB 2QTOA 3WK5A 3LK9A 2V4QA 4IIJA 4IRCA 1W2BU 1JMKC 1S0NA 3RYFA 1VQ8V 3CEIA 1CEZA 2JS3A 3ZMUA 3CS5A 4MS2A 1PD3A 2VQEB 3MR2A 1OCOB 2ZE6A 3CRMA 4LFBO 1D5NA 3GZFA 4FIPC 1H2NA 5DBBA 1AI4A 2OM6A 2KIWA 4IL6Z 3FDSA 5HMMA 2J6SA 2ZNIA 8ICPA 1XILA 2ATKC 4DR1B 3UT5B 5AI0A 1V54B 5DQGA 5F9NA 2R8GA 3NTUA 2VANA 4I2BA 4R50A 3D36C 1QQ6A 2NO4A 3F5AA 9ICUA 1BPYA 5H2FZ 1Z5VA 3ABUA 2LO1A 5AKGA 1M56B 2BCSA 2F1JA 3EPGA 1NKDA 1QQ7A 2QGNA 1L8LA 1SV0C 3ICXA 2W43A 1OZ0A 1K73W 3CX5F 4DR1O 2XIDA 3ZD8A 3KKYA 4J03A 2ZIWA 2WFAA 1QLNA 3MDCA 4CDGA 5CJ7A 3K5NA 2ESEA 1Q5OA 3OJUA 3GV5B 2BDPA 1OCCC 4I55A 2LYAA 2JGDA 1NTMH 3IDWA 5A9GA 4EFBA 2VJ5A 5L3DA 3KOOA 4NVPA 3OHBA 2JVDA 1I94B 3Q8QB 4RQ6A 1JROA 2GTSA 5AKZA 2EAMA 3C3TA 4I2DA 3Q8LA 2BOCC 8ICEA 3H8JA 4QW8A 1M4UA 3ZHRA 4EX7A 3NS1A 5KUMA 2WLMA 4XBFA 3JD2A 2A1JA 3RJIA 2VWKA 1NK7A 1R6KA 4TV8A 5EWGA 1I94O 4QWBA 2WLIA 3R65A 1O08A 4ELVA 1JFFA 4O4LA 3C1YA 2HBLA 3PSFA 1NKCA 4YJ3A 2BTQA 1XEQA 5DG9A 5KA6A 1Q90D 3MGHA 3CCMV 2LMRA 2KKPA 5AM4A 3KCXA 2QB0B 3WG7C 4DSEA 2WA3A 4GUNA 3NVZA 5KFUA 1NTKH 5B1NA 2KKVA 5AKEA 2ZM6B 1EN6A 2F66C 4LZGA 4B3TB 4P30A 5JQGA 4QPJA 2GWSA 1X4TA 2LGQA 3JASB 3U0ZA 4Q8EA 2K89A 3MABA 4ZOLA 1N2XA 3TFSA 2LGWA 1ZQXA 3TADA 4QZHA 1XSLA 5E1AC 3T2MA 1MG1A 5GTHZ 1PP9H 1BE3H 2F44A 3CXCU 2ZM6O 3MD0A 4MW3A 1NR1A 1N36O 4UB6Z 1ZD2P 4B3TO 3JAKB 4OCZA 3D2QA 3CE2A 4UCSA 1VQPV 4J9OA 1LUWA 2W9MA 4PA7A 2W3RA 9ICPA 8ICKA 5BR8O 3QO5A 1QVGU 1M57B 2OIEA 3BS5A 4U6PA 3EW9A 3G6EV 2JEIA 4UAYA 4OGQB 5AM1A 4DSIA 4EYHB 1X6IA 1V9PA 1N5WA 5EK0A 1JX4A 4JI6B 3JD1A 5FPOA 2AZ0A 2F43G 2G38A 2QWQB 2E8OA 5C8YB 2DJVA 4KX5A 4JI7B 2G08A 4G9BA 5ALZA 4YD2A 2HKOA 3MGIA 4BIUA 1KN5A 4DSFA 8ICZA 1QSSA 2ETNA 5KFDA 4JMUA 1FYJA 2NLJC 9ICKA 2G0AA 2HLDG 4JI6O 2ZNJA 4PGQA 2CTWA 3E8FA 3HR0A 4J11A 2AGOA 3V7KA 1IIPA 4JI7O 3M7DA 2Q5ZA 4MTFA 3B4SA 2YN4A 2IBZH 2EINC 3VC8A 5AKHA 1ZQAA 4ED3A 2FMQA 3C2LA 1M90W 2YEVA 4RT3A 2DBYA 5D4BA 4DK1A 4I4TA 4JI8B 4P4MA 1IG6A 4XUSA 5JTIA 3L74H 2KIVA 2E8MA 5ALWA 5G5HA 3JPTA 4OO1J 2P06A 3L72H 5AK3A 5FNVB 2HG5C 2C2RA 4PZOA 3VCBA 1K4DC 2HFEC 1ZQIA 2R9IA 1QQ5A 3QNMA 1SQVH 2RDJA 5EIBC 3FD9A 4JI8O 4PDRA 3EYZA 4P2ZA 2Y69B 2Z7JA 4RQMA 5ALTA 5KFRA 4R8CA 4DSJA 4F3OA 2DYRB 1GAXA 2BGWA 4DSKA 1MC8A 5JCOC 5DBAA 4QWDA 4DL3A 1VMGA 3CCRV 2X6BA 1FXVA 1HR0B 3OT7A 1SWWA 2ADQB 5KT7A 3APQA 1IXBA 4IQVA 3SEIA 2PFNA 1BS3A 2PMZC 3BQ7A 2BTOA 5F2VO 1LKYA 2UVVA 4MVQA 2PYLA 1X42A 3IG5A 4F93B 3D36A 3T5KA 3C23A 2WLLA 2HMXA 1HR0O 1FKAO 2JGAA 2X7RB 4O4IB 1S76D 4YXJA 2MUTB 4F4ZA 1HDJA 2KP7A 1SV0A 1JQ0A 1ROPA 1RG6A 2RDCA 4JI3O 1SV4A 4QNLA 3U10A 1AILA 1URFA 3FX7A 4Q43A 3RB0A 3T79A 3K03A 1WWVA 2VKQA 2WB1C 2QLTA 1F44A 1IX9A 1BGXT 1L7OA 2AZ2A 2V9WA 3WKCA 1K5OA 4GC7A 2RP5A 5KFNA 4AP9A 1KSPA 1V97A 1A32A 5BMVB 1SXDA 3KHRA 2BR0A 4Q8FA 9ICBA 4X8AA 1GRJA 3SD7A 1SQPH 1OCOC 2E5LB 3RYCB 2PI5A 3A8TA 5IIMA 3LNNA 9ICEA 2WAMA 3OGIB 2ZUCA 3IM1A 1JUDA 3N7RC 4KP4A 3H0MB 1FEZA 2L5YA 5DG7A 3OM3B 4NKGB 2QR4A 1ZQGA 2FYUH 3RRGA 1SKRA 1HIWA 1V54C 3RJEA 4Y2JA 3IRUA 2E5LO 5J2EA 1PVQA 1SF9A 2FPMA 1SQFA 4JUZA 3AG3B 2ZUDA 3LNMB 1M56C 3OTOB 5TISU 5KFGA 3MAQA 1T94A 5LXTB 4LFAB 4NTYA 2EZYA 4ZHQA 2W9BA 4MSWC 3PY8A 5CHGA 2WF7A 2XY7A 4Z6DA 2Z5UA 1NU1H 1T5EA 2V4RA 4C80A 4KFMA 4F6RB 4M9NA 3OR6C 1S10A 1LB2B 5ALEA 5EC2C 1WP8A 4LFAO 2H3IA 1X6JA 2R72A 2NRZA 3K1RB 4Y2SA 5DGAA 1SQXH 4CCHA 2UUAO 4PHZA 2AQ4A 4GX0A 1VQNV 4MVZA 5IYCO 2YUAA 2L6LA 2KHVA 3MFIA 2HJFC 2E76B 3P3PA 1RM6C 2KG7A 1H8EG 1Y76A 2BCQA 1KP3A 4KHPB 4QZBA 3BQTA 3ETLA 2BCRA 3SYZA 3SJCC 4CH5A 2WAQF 5KAIU 1ORQC 2PTMA 3FM9A 4NLNA 2FB5A 3SDLA 4A8EA 4DL7A 1GM7A 2O57A 3HB3B 3HKDB 1UPHA 2ZIXA 1K92A 1ZYQA 1T3NA 4GXIA 3BVOA 1DXSA 3PW2A 4DR3B 4FO6A 3T5HA 8ICQA 2RLTA 5DKWA 5L9XA 3HW8A 4KHPO 4PA3A 1ECWA 1YSCA 5BOMA 4JASA 1W0JG 1PNKA 1K97A 4QJFB 2R8IA 1BNOA 2P67A 4C8NA 4TOIA 3CCQV 3BQ0A 1NK8A 5KG3A 2DQ0A 1VQLV 1Z1VA 4DR3O 1JRPA 1Z19A 3W7SA 2Y9TA 2F77X 1ZQEA 1RPOA 1GM9A 4UB4A 2EULA 4NR1A 3UPQA 4PDVA 3H0RB 1PK1B 4FJCC 4F6EA 1BSMA 3T1CA 2UXDB 5EYPA 1XWLA 4BWJA 1NI3A 3ISBA 4YJ2B 4M6WB 1GM8A 1D9FA 1IVSA 5CA3A 3RB6A 3K06A 5KFWA 1BHAA 2YXYA 1X9WA 2LFRA 3E83A 3FYEB 1Q3VA 3IC7A 1M57C 2IOFK 1COWG 5KAFZ 1FFVA 1JJ2U 4UAZA 1L7MA 3GIKA 1NT2B 5J8YC 2UXDO 2LYHA 1FIQA 1QTMA 2KJ5A 3Q8SB 2OWOA 1H2GA 2HBMA 1U49A 5KMGB 5KFVA 3DTUB 1YJNV 4F4XA 3M8AA 3BZKA 4LF7B 4IS7A 5CA0B 2PFPA 5AK5A 3TAPA 3STLC 3W7XA 4DLEA 3B8NA 4FLZA 4M9JA 4RQ8A 5KFMA 1FXHA 5ALNA 1L3SA 4ECRA 1QLEB 3A0BZ 4JV0A 4JV5B 3GDXA 4W4LA 5JCOA 2WLJA 2HW3A 1SIJA 1RYUA 1RYSA 4JPRA 4CS3A 4LF7O 4TURA 8ICWA 1XBLA 2CTRA 1WPBA 4LWSB 4FLUA 3SJBC 4B9UA 5LHGA 2NYVA 2RQ6A 2WWWA 9ICMA 2I9GA 1S0MA 3AG2B 5KG5A 4EKWA 4LF8B 4DYLA 3AL0B 5HFMA 4I50A 2HR3A 2LW1A 1Y88A 2YMMA 5IILA 1RP3B 4FM0A 1HNXO 4X1KA 1L0NH 5EBMC 5LYJB 5EWFA 3FAVB 2MK3A 4C4RA 3SV4A 2P6JA 2K4EA 2E5SA 5BXZA 2EIKB 3H8WA 1J95A 4MVSA 4LF9O 1TUEB 4GCZA 2W0XA 3JAMN 2Y69C 3GIIA 3KFUF 4D7TA 3I76A 4CC6A 3K59A 4DR6B 3UCSC 1AP5A 3ZEDA 2IW5A 2F93B 2DYRC 4X64B 1OCZB 4RQEA 5J0RA 1R73A 3ZRVA 4RQ5A 4WJ3B 2B21A 2K4IA 2VJ4A 2KMDA 3G6YA 1R3IC 2NO5A 1P4RA 3ZRWB 4DR6O 2RHFA 3OHAA 5KFTA 2OXOA 3JATB 3VQWA 3WKDA 1M93A 5A0LA 3ZHVA 4UV8A 3UT5A 2NR5A 4X64O 4ECWA 2W03A 4J7KA 3BS7A 4WFGA 3AUOA 3CD6V 1OCRB 2WF5A 5KT5A 1BHBA 4YR3A 1XNQO 2DWDC 1YJ9V 2W7PA 3N2GB 4P4OA 1GN4A 3N2KB 3GB7C 5K4LA 2AGAA 5CBFA 4YG2A 4DW0A 1QU7A 5IDJA 1N0JA 5IY5B 1BZKA 3CCUV 4UATA 4P4PA 2BQRA 3GV8B 1F51A 1KC8W 2JZBB 3ED5A 1H2MA 5B1BB 3RBZA 4C7UA 2ADPA 4YQWA 1CI4A 3A0RA 5EBWC 1RSOB 2YSUB 3MDSA 1TV9A 4KUMA 2ZIOA 4DFPA 4ED8A 3JD4A 2Q0AA 2YMLA 1KQQA 7ICQA 3VQYA 3CSXA 2ASDA 2ZKOA 1DF5A 2DQNB 3H40A 2HBKA 1NJWA 4KLHA 4KLSA 4B3SB 1COOA 1XO1A 4MFAA 3QO8A 1WCLA 1TE2A 5KHIA 3M7MX 2EZOA 7ICHA 2MA1A 4UAUA 4FZ0A 4J9QA 1Q6UA 1D5AA 4JGSA 4IQUA 3QZ8A 1NBMG 4G27B 4DV4B 2KFZA 1A77A 5KG1A 1FD9A 2EZPA 4HBNA 4LH6A 4UAVA 3QU4A 3PX6A 3E8BA 1IBMO 3AEVA 3BFRA 7ICLA 4B3SO 9ICWA 3HKZC 4ELUA 2HP8A 4FS1A 1H2SB 1SZHA 3AG3C 4IT5A 4NM2A 1KEJA 1MSWD 4US8A 4QPKA 3ZN0A 5AK4A 1DTOA 3CC4V 4DV4O 2OEHA 2DKZA 3OSPA 3BY6A 3CXHF 7ICVA 5FPRA 3OW2U 1J2MA 4FLYA 4DO9A 2ZE8A 5J9PC 2QB0A 1ZRNA 1NVPD 1M6YA 4O3QA 5KL8B 5KFKA 5J2JA 2FMPA 1N4CA 3M6KA 2BKEA 1SKSA 4ELTA 1XL6A 3L75H 2W54A 2GV9A 5ALXA 4EEKA 4PD4F 5J0SA 4C7YA 2HOFA 2P5OA 4YP3A 1O9GA 4QZAA 3FB8C 2KICA 3JASA 3GIJA 3AG1B 5KG6A 4F71A 1F7YA 5EE3A 4GX5A 3H1JH 4PHPA 2AXTZ 4KLTA 4HNAB 2E1EA 1K8AW 3TETA 2EJRA 3JPSA 2YI9A 3E86A 1VQ4V 1IBKB 4PJ0U 2QE7G 4A5UB 2KZZA 1TAEA 3PO4A 3JAKA 2IU0A 1XMOB 2QEXV 2E8PA 2XICA 4RNOA 3PN1A 3J7AU 5KFZA 1CUKA 3R9KA 2PXIA 5KFHA 4CS2A 2A3VA 1RM1B 3CPWU 3AG7A 2Q68A 1VQ6V 2H3ZA 5J8YA 2EBOA 4F5QA 2XAHA 3OAAG 1IBKO 1Y6XA 3CCLV 5J0YA 2XY6A 5C8YA 2KEYA 4NM1A 4H13B 3KHHA 3I56V 1EZVH 3CP1A 2F1HA 5BY1A 1ZETA 4QWEA 3IG8A 1U9LA 1BPZA 4MFFA 4Q20A 5JUMA 3QVNA 3G4SV 2G5IB 2BSKB 8ICLA 3K79A 2LKYA 4O2BB 1WA8B 4RT2A 3HJEA 1P7DA 5J2AA 3DDHA 2OCEA 3OMAB 4PI2A 4HAMA 3QX7A 3LWMA 9ICAA 4ED7A 2UVRA 1SQGA 2QDOA 1FO4A 1PNLA 1Z4NA 5IIJA 4E0DA 4Q44A 1ZRMA 4HYOA 3K08A 5JH7B 2GLEA 2LYBA 1DLBA 4PPXA 4DOCA 1QNMA 5LMNB 4F5PA 4B9MA 4J10A 3Q8PB 1X66A 2YIBA 1DOQA 3GWKC 4UVAA 5ALIA 5FNVA 1XI1A 1SL0A 1NZ6A 4JTCB 4O3OA 1E79G 4F4WA 4O5CA 1XOUA 1MMMA
chains in the Genus database with same CATH topology
5HR6A 1AROP 2DGZA 3JD1A 2F43G 5IYBO 3OR7C 2KJ9A 1AJQA 4KX5A 2BOBC 2G08A 1Q3UA 2HKOA 4BIUA 3LDCA 4PL2A 1MABG 5L3FA 4JMUA 2IH1C 2NLJC 3H01A 3BEHA 3LUTB 1QLEC 4P0QA 2G0AA 1F23A 2W0FC 4JAUA 1I5YA 4KMOB 2HLDG 2QM8A 1R3JC 3ABKB 4BW5A 4H37A 1K9MW 2K8BB 3E8FA 3LSQA 1IIPA 5FL7G 1Y66A 3M7DA 4DO2A 1VQ7V 4MTFA 3SYQA 1EBOA 1Y4MA 2ZXIA 3VC8A 2PMZF 2K8AA 4OJ6A 2EINC 2XASA 3CMEV 2DYSC 1Q7YW 2UXNA 3F7VC 3T4DA 1I5XA 1M90W 2YEVA 1KP2A 2EIJC 2JJ1G 4ACOA 2ZDIA 3AG2C 5B3SB 1H8HG 4BIZA 2JHDA 3CP8A 2Q67A 1WPXA 4OO1J 2ZXWC 1JCHA 1S0VA 2HG5C 1N8RW 1FXKA 2A0LA 1Z1BA 3LVVA 2HOIA 3VCBA 4J9ZB 4KX3A 1K4DC 2HFEC 1NH2B 2R9IA 4GFJA 2WLNA 2EIKC 3WG7B 2KNJA 2Y0SF 1SRYA 3F5EA 3H0LB 2NNUA 1YJWV 3K0DA 1AI7A 1K3EA 4BJQA 4PDRA 4P2ZA 2Y69B 2Z7JA 2OYYA 1MA7A 1KD1W 4R8CA 4LBEC 5C93A 3LDEA 4WFEA 1JOYA 1VQ9V 4ICAA 4P0QB 1M9NA 2DYRB 2KJ8A 1P7BA 2V7QG 4WFHA 2WLHA 3CCRV 2X6BA 2G06A 1HEKA 4MT8A 1VQ5V 2OCCB 3OUFA 2F8LA 1FXVA 4OJOA 3QO7A 2CK3G 2DQ3A 2DWEC 2IJJA 4U7OA 2F76X 2PMZC 5T14A 2EILB 3GWOA 2VIXA 2P90A 2YEVB 4MVQA 3E8HA 4JYCA 2ZIUA 5KUKA 1ENVA 3SPHA 1L6NA 1R3LC 3NXSA 3IG5A 3D36A 1OCRC 2CPRA 2K4HA 2WLLA 2HMXA 3ABLB 1XNSA 4L87A 2JGAA 2X7RB 3ASOB 1S76D 1FXKB 4PELA 2NV3A 1M1KW 4UVCA 1JQ0A 1ROPA 4I9WA 3SPIA 4QNLA 1PKXA 4J9YB 2E1FA 2C2AA 3EHBB 2UXXA 4CGZA 3T79A 3K03A 2Y0SC 2WB1C 2VKQA 2JDIG 3L3FX 3FKSG 3JD3A 1YI2V 1F44A 1AI6A 2RP5A 3M6ZA 4OXSA 2N1RA 4UVBA 2B1IA 3SJQC 2F2AB 3RVYA 4NLCA 3F2DA 2K1EA 4X8AA 2LFSA 4WFAV 4G28B 1K34A 1OCOC 2WSSG 3OE7G 2LP7A 2PI5A 2A9HA 1YITV 3OUSA 2K8CB 3IP4B 2WAMA 3IFXA 3B77A 3N7RC 4KP4A 3ZCCA 3SQIA 3H0MB 3SAGA 3FB7C 2RRDA 3STZC 4QNHB 1SZTA 4OJ5A 3CCVV 3DEEA 3MHSC 4R6ZA 3OM3B 4UV9A 2KOBA 1YT3A 2M7WA 2ZIUB 3SMVA 1HIWA 1V54C 5EC1C 2XAGA 5KL1B 3ZMZA 2WLLB 1PVQA 5CBHA 1QCEA 4RUEA 2R18A 2W7OA 2H3VA 3OMNB 3AG3B 2OTJV 3LNMB 1M56C 1S72V 4CBCA 4OJLA 4E2LA 4PDMA 1T94A 4FMTA 3ZRSA 4AYBC 5IYDO 2EIMB 3LVWA 3ZN1A 4Z1MG 3D2SA 1AI5A 4MSWC 4C0ZA 1NVPB 3IGAC 1PNMA 2XOKG 1G8MA 1XL4A 3N7SC 1FS0G 2W6JG 2JH7A 1D8BA 2Z5UA 2G5HB 1Q81W 3E89A 4JAVA 2G09A 2JIZG 4H33A 1ZQ1C 4KFMA 4XDKA 1OCCB 3OR6C 2YX8A 2M0NA 2PI4A 2GH1A 1QR9A 2QKSA 5B1AC 3SPJA 3ZMVA 5EC2C 1BMFG 3ASNC 3AG4B 2H3IA 2AHYA 4UXNA 2G07A 3AG1C 3MHHC 3E0FA 2H3QA 1QBZA 2MRLA 2Q6AA 5LGTA 4GX0A 2B1GA 1VQNV 4MVZA 5IYCO 2KHVA 3ABMC 2HJFC 4NV0A 1MOFA 1YIJV 5HFLA 3SYAA 2JEUA 1H8EG 5L3BA 1KP3A 5LHIA 3LDDA 1XO0A 2IJIA 2WAQF 4WFFA 1ORQC 2IU3A 2ZR3A 2QA4V 3DGEA 1RM1C 2JH1A 2ZG6A 3JYCA 4A8EA 1DF4A 1GM7A 3HB3B 1NR7A 4HZ3A 1THZA 1UPHA 2ZIXA 1K92A 1S3JA 3HPLC 1FFTB 5CN0A 5HR7A 2ITDC 2X0LA 1Q82W 4QIWC 3C28A 3F5WC 4PA3A 1ECWA 1KQSU 1YSCA 2Z3YA 4JASA 2WB1F 1JX9A 1V55B 1W0JG 1PNKA 1K97A 4QJFB 3ABTA 4MVMA 3ZIAG 3MGVA 1GKFA 3TCUA 4FZLA 3M99B 2P67A 3CCQV 3RF9A 5C0YA 3OGCC 1NQTA 3SYCA 2Q69A 1OHHG 2IH3C 1VQLV 2DQ0A 1SETA 3X2QB 3OPXA 1Z19A 4I5SA 2F77X 1RPOA 4MVRA 1GM9A 4RUFA 3W7SA 4JF3A 2D6FC 3G71V 3K04A 1YTFD 1OCZC 3H0RB 1QR8A 2HVKC 3ETGA 4FJCC 4GX1A 4PDVA 3T1CA 5CBGA 2H8PC 3W7TA 3NRWA 4PA6A 3W7UA 1YHQV 1GM8A 2IJKA 5CA3A 3NUQA 5LGUA 3K06A 4PL1A 3B8MA 1BL8A 3AEIA 1BHAA 2LFRA 3E83A 3FYEB 1Q3VA 3IC7A 1M57C 1COWG 3P32A 2WAQC 5EBLC 1VQOV 1JJ2U 4MW8A 2KVCA 3ETEA 1E1QG 1KBUA 4GX2A 3CMAV 4IC9A 2ZIXB 2OT5A 2R9RB 2KJ5A 5CMUA 5CRXA 1H2GA 2HBMA 4P9OA 3DTUB 1YJNV 2GOLA 4AYBF 2GSMB 2YB4A 2GHYA 4BUGA 1F4NA 3STLC 2WPDG 5IY5C 3W7XA 3E8GA 3B8NA 3LYSA 1FXHA 2KHQA 3ALRA 1QLEB 2KB1A 5B1BC 2HVJC 1CRXA 3ABKC 3RFAA 3PZPA 1A0PA 2WLJA 3CCEV 4JPRA 2WLKA 5L3GA 1VQKV 3CC2V 3SPCA 2EINB 3ETDA 3D3IA 3VBBA 2W04A 3N7PD 5H6QA 2FTKA 2DYSB 2WWWA 3ZRWA 5LHGA 5DM6V 2CRXA 4FPPA 3RW0A 1SERA 2EIJB 3AG2B 3O0FA 4EKWA 4NLBA 3AL0B 4FK5C 5B3SC 4FZNA 1AJPA 2ZQMA 5HFMA 2HR3A 2LBOA 5LHHA 5DN6G 3SYPA 2ZXWB 3ZMTA 5EBMC 3SYOA 2MK3A 1CPYA 1EZJA 3EFFK 3VOUA 1Q86W 2P6JA 2K4EA 4CZZA 2E5SA 3SPGA 1SESA 2EIKB 2X6AA 4U7NA 4WCEV 1S5HC 1NH2D 1WLEA 4PA4A 4O3MA 1B6QA 3ZRXA 1VQMV 4RAIA 4MTXA 1J95A 2JK5C 4MVSA 5H6RA 5BZBA 4QE9A 1TUEB 4QIWF 3K9AA 4GCZA 1ED1A 2Y69C 4RQFA 2W6IG 3KFUF 1OUQA 2B5UA 1K4CC 3ZMSA 2XNDG 3ML0A 2AHZA 2IW5A 5KA5A 2CN1A 2DYRC 3PSTA 1OCZB 4RQEA 1R73A 3ZRVA 1F4MA 4G2KA 2OCCC 3CCSV 1PVPA 4WJ3B 2K4IA 2VJ4A 1KKDA 4ZBMA 1R3IC 1P4RA 3ZRWB 2RHFA 2OXOA 3TK1A 2HOQA 3PSPA 2EILC 5A0LA 5GW7A 4UV8A 3W7WA 2OH2A 1GTOA 1K5QA 2ZDIC 3JCZA 2W03A 2ITCC 3LSSA 4WFGA 3CD6V 4JTAB 1OCRB 2ZXHA 2H3FA 3HKZF 1TAMA 3RVZA 1BHBA 2DWDC 1YJ9V 3ABLC 2W7PA 3CC7V 4U7CA 2XAQA 3ASOC 1L1FA 1UJWB 1FXKC 2OTLV 1GO3F 1K5SA 3CRXA 3GB7C 4XDJA 3E35A 5CBFA 4JTDB 4MVUA 3CYMA 4OJPA 5IDJA 3KG2A 5IY5B 4N21A 3CCUV 3D2NA 1F51A 2QTOA 4P9PA 1KC8W 2A79B 1JVMA 5B1BB 2ZIVA 3RBZA 1K33A 3F2CA 1W2BU 3A0RA 5EBWC 3GU3A 1E1RG 1VQ8V 3C29A 1ZWIC 2YSUB 4LP8A 4KUMA 3SAHA 4X89A 1CEZA 1NJIW 3JD4A 3OEHG 3ZMUA 4TSFG 3WFVA 4MS2A 3F7YC 4NWIA 1PD3A 4F4LA 2BDUA 1OCOB 2ZR2A 1EFRG 3GZFA 4FIPC 1DF5A 2DQNB 2HBKA 1URJA 1AI4A 2OM6A 2KIWA 4P0PA 1IXMA 3QO8A 4LC1A 2X6CA 2EZOA 2MA1A 4LCUC 2HBJA 4JGSA 1H38A 4G27B 1NBMG 2ATKC 1R6NA 2V1DA 4PA9A 1V54B 3ZJZA 5B1OA 3OEEG 2EZPA 2DW4A 3E8BA 4R50A 4TT3G 3F5AA 3ABUA 3HKZC 1R3KC 1M56B 1SZHA 3AG3C 1NZBA 3OMIB 1S77D 1MSWD 1NKDA 4QPKA 2LHTA 1PL0A 3ZN0A 4WF9V 2D3OW 3ICXA 1DTOA 1OZ0A 3JD0A 5LBQA 3CC4V 1CP9A 1K73W 2EIMC 2XIDA 3BY6A 3OFNG 2H94A 2ZIWA 3QNEA 2ZIVB 4BAYA 3OW2U 2XI9A 3K3WA 1QLNA 4CDGA 2XAFA 5J9PC 1NVPD 5KL8B 1K7DA 1A6SA 4QE7A 4R7CA 1G4YB 2YB1A 1WUDA 3M6KA 1XL6A 3FYIB 5B1AB 1OCCC 3K0GA 2HOFA 2DF4B 2LYAA 3ASNB 3FB8C 5LGNA 2KICA 2P7TC 3AG4C 4FE3A 2VJ5A 3AG1B 1LNQA 5L3DA 1AJNA 1JPXA 4TWKA 3UKMA 2ZD9A 4GX5A 2IJHA 4P0PB 2E1EA 3SAFA 1K8AW 4BX9C 1AR1B 3TETA 2EJRA 3ABMB 1DRGA 3E86A 4JYBA 3I55V 1VQ4V 2XVTA 2BOCC 2QE7G 4UUJC 2IU0A 4X88A 5KUMA 2WLMA 4XBFA 2QEXV 2XICA 3JD2A 4XDLA 3F53A 2JEXA 4FZMA 2A3VA 1RM1B 1R6KA 4MTOA 3CPWU 4RO2A 2Q68A 1VQ6V 2H3ZA 4WFBV 2WLIA 2EBOA 3R65A 4PDLA 5L3CA 2XAHA 1GK9A 2HBLA 3PSFA 3OAAG 4N23A 3CCLV 3PSIA 5KA6A 1QVFU 4MVOA 3AQEA 3KZXA 2KV2A 4MTGA 2KEYA 3CCMV 3IN5A 4GT1A 5H9CA 3I56V 4CRXA 3CP1A 2KKPA 3K1ZA 1RPRA 2ZIWB 3IG8A 4Q20A 3G4SV 3WG7C 2XAJA 1HWYA 1V55C 2G5IB 2KKVA 3FB5C 5B1NA 3K79A 2LKYA 3FB6C 1KECA 4DXWA 4ZKIA 3PJSK 2Q4TA 1P7DA 2KD1A 2JJ2G 3OMAB 4P30A 4QPJA 4HAMA 3CYOA 3CCJV 3X2QC 3F2BA 2K89A 3T4ZA 4ASUG 1YTFB 3E2EA 4YXWG 1PNLA 3UM7A 5E1AC 1GMGA 3T2MA 1MG1A 2QM7A 2Y48A 4HYOA 3K08A 3CXCU 2LYBA 1DLBA 2JMGA 3ONNA 1PVRA 3MD0A 1NR1A 3P30A 4MW3A 3AQFA 3D2QA 1VQPV 4UVAA 4PA7A 3QO5A 1W0KG 5L3EA 1QVGU 1M57B 4JTCB 4U6PA 3G6EV 1E79G 2WLIB 5EK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DGZ A;  2HBM A;  4CDG A;  3SAG A;  2RRD A;  1GO3 F;  4NLB A;  1D8B A;  2MA1 A;  2HBJ A;  3CYM A;  1WUD A;  1YT3 A;  2E1F A;  2HBL A;  4OO1 J;  4CGZ A;  2KV2 A;  2RHF A;  3SAH A;  2E1E A;  3SAF A;  4O3M A;  4NLC A;  4QJF B;  4QIW F;  2CPR A;  5C0Y A;  2HBK A; 
#chains in the Genus database with same CATH topology
 5HR6 A;  2DGZ A;  5IYB O;  3OR7 C;  2V4D A;  4JI5 B;  2KJ9 A;  4OPH A;  4ECT A;  4YMN A;  5EE1 A;  4ECS A;  1AJQ A;  4DL5 A;  2BOB C;  3OJS A;  1Q3U A;  5EE9 A;  2BHN A;  2XCP A;  4FM2 A;  2IH1 C;  1YEW A;  2ZE5 A;  1XSP A;  3DSQ A;  4ICG A;  4BGD A;  3BEH A;  4YY3 B;  1QLE C;  4ECX A;  1F23 A;  3I28 A;  5KFL A;  1I5Y A;  2QM8 A;  3ABK B;  4H37 A;  5KFP A;  4QZG A;  3LSQ A;  7ICM A;  4F4Y A;  4JI5 O;  2I6X A;  2CDY A;  4NXN B;  1Y66 A;  1VQ7 V;  4DO2 A;  4O3N A;  4DFM A;  4EBC A;  3Q4H B;  3AMZ A;  1EBO A;  4O4J B;  2PMZ F;  4OJ6 A;  1C7Y A;  5EWE A;  5J2F A;  4EYI B;  2VA2 A;  4YY3 O;  4RPY A;  4EZ6 A;  1I5X A;  2QKA A;  9ICQ A;  4FZ1 A;  4Q45 A;  3AG2 C;  2ISP A;  3FC4 A;  7ICU A;  4LF5 O;  1HNW O;  4FLV A;  4RQ2 A;  2JHD A;  9ICC A;  4X1I B;  3D6J A;  4PH5 A;  4NXN O;  1NK6 A;  1KDH A;  5ITZ B;  2FDR A;  4O4I A;  2FE9 A;  1S0V A;  4K0K B;  2DFL A;  2MUT A;  1Z1B A;  3HRD D;  1ZSP A;  4J9Z B;  3K9S A;  1NH2 B;  4DEZ A;  3ZHT A;  2EIK C;  5AKI A;  5HP4 A;  1SRY A;  1V38 A;  3F5E A;  3QU9 A;  4UB8 U;  1YJW V;  1AI7 A;  4UB3 A;  1GN2 A;  4X20 A;  2PKE A;  4XQ8 A;  2FLL A;  5B5E Z;  1MA7 A;  1KD1 W;  4K0K O;  2DOS A;  5BMV A;  1JOY A;  2YID A;  4FFD A;  4P0Q B;  1DGS A;  4DL2 A;  8ICV A;  1S0O A;  2F3N A;  1QSL A;  2WLH A;  4DQS A;  2YDE A;  3RYC A;  3OUF A;  4KN7 A;  4B7E A;  2JRZ A;  5C5J A;  5ALP A;  4DV6 B;  2DQ3 A;  4TV9 B;  1X9M A;  3K4G A;  4YMM A;  5LOV B;  3I1Y A;  4FLX A;  8ICU A;  5AHX A;  2F76 X;  4RWU A;  1ZJM A;  3GWO A;  2VIX A;  3PW7 A;  4JYC A;  3S6J A;  2UUB O;  1ENV A;  3SPH A;  5AKK A;  1R3L C;  4GKK O;  1OCR C;  3HKC B;  2CPR A;  4CH6 A;  2DE0 X;  5AM2 A;  3K5L A;  1WP7 A;  2IOH A;  3PW0 A;  4DV6 O;  4DLG A;  1RQL A;  4KLD A;  4M0A A;  2FL4 A;  3BA8 A;  1Y74 B;  4KLJ A;  4KMU A;  2IA6 A;  5LXT A;  1PKX A;  4J9Y B;  1S5L U;  3JPR A;  2C2A A;  2UXX A;  4CGZ A;  4RNN A;  2W11 A;  1S9F A;  3L3F X;  3EUB 2;  3ISC A;  5DDY A;  2DUY A;  4DF4 A;  4UVB A;  2N1R A;  2B1I A;  3TKA A;  4F6R A;  2F2A B;  1ZQC A;  2Q8V A;  4JI0 B;  2BPG A;  1O9H A;  5ALF A;  2JS5 A;  2K1E A;  1PL4 A;  4X1Y B;  4WFA V;  4XRH A;  1ZL8 B;  1L3V A;  4DV2 O;  3QF7 A;  1N36 B;  1B06 A;  1YIT V;  2K8C B;  3IP4 B;  3IFX A;  2CAZ C;  4JZ2 A;  3ZCC A;  3SQI A;  1VP7 A;  3SAG A;  3FB7 C;  2RRD A;  1IM4 A;  4X5V A;  5J0Q A;  4OJ5 A;  5IIN A;  3PVX A;  8ICJ A;  4J41 A;  3K5O A;  4D6T H;  5BR8 B;  3MHS C;  4JI0 O;  2KOB A;  1YT3 A;  3SMV A;  5LMU B;  1L7N A;  5KFA A;  5L1I A;  3Q8R B;  4I2C A;  2HHW A;  2XAG A;  3PX4 A;  3RBE A;  5CBH A;  8ICM A;  1QCE A;  4KTQ A;  4RUE A;  5KHJ A;  2R18 A;  2YIA A;  3RAX A;  2W7O A;  5DED A;  2OTJ V;  5DB6 A;  3HKD A;  1UPG A;  4PDM A;  1BPD A;  4PZN A;  4QZE A;  3WU2 Z;  5KHH A;  4NYK A;  3ZRS A;  3IAY A;  1Q3E A;  5IYD O;  2EIM B;  2JEG A;  4RUA A;  3ZN1 A;  4ECY A;  2DPJ A;  5LMU O;  1AI5 A;  7ICR A;  9ICR A;  3IGA C;  3C2K A;  4X20 B;  5ALM A;  5JRT A;  1G8M A;  4KLF A;  1TUB B;  3N7S C;  1FS0 G;  2AH5 A;  2F95 B;  2G5H B;  1WAZ A;  2G09 A;  4H33 A;  2YX8 A;  2HVI A;  2GH1 A;  2QKS A;  3ZMV A;  3RYI B;  1ZQK A;  4UQG A;  1Z00 B;  3VQV A;  3C3S A;  2MW2 B;  3T5L A;  2G07 A;  4QW9 A;  5J29 A;  1Q6I A;  4IRK A;  4M2Y A;  1AP6 A;  3E0F A;  3AG1 C;  4Y2P A;  1QBZ A;  2DMX A;  2PUS A;  1IV8 A;  4B9S A;  4UAS A;  1PK1 A;  1UT5 A;  3H7I A;  4NJ8 A;  9ICN A;  2E75 B;  1DK3 A;  2MSN A;  2QWO B;  4YVZ A;  4YJ2 A;  4M6W A;  1MOF A;  3SYA A;  8ICN A;  1X59 A;  2ODM A;  5AI9 A;  4ED0 A;  1GN6 A;  3QG5 A;  4CC5 A;  1SWV A;  3UMC A;  4FVM A;  5LHI A;  3OGU A;  1XMO O;  4JYY A;  2QA4 V;  5L1M A;  1RM1 C;  2JH1 A;  2ZG6 A;  2IOF A;  3JYC A;  2UXC B;  4Y2Y A;  4YFK A;  5J2K A;  5ALG A;  2FLP A;  2ITD C;  5KMG A;  2X0L A;  1Q82 W;  3TAC B;  3M8R A;  1OW5 A;  4C4S A;  5CA0 A;  1MQ3 A;  1Q43 A;  1SZX A;  2ZTC A;  3H4B A;  4ED6 A;  1ZQP A;  1JX9 A;  1V55 B;  1LV5 A;  4MVM A;  1GKF A;  4FZL A;  1JAL A;  3M99 B;  3HX0 A;  2UXC O;  1OHH G;  7ICF A;  1SET A;  1U48 A;  3I5D A;  2DKX A;  4DV7 B;  4JF3 A;  1JXE A;  1NS1 A;  4CE6 A;  4KLO A;  1AR4 A;  1MZE A;  3G71 V;  1YTF D;  4LWS A;  4UAR A;  3WK4 A;  5GTI U;  5CR0 A;  2H8P C;  5H5N A;  5CBG A;  5III A;  4PA6 A;  5IE9 A;  4B08 A;  1JMS A;  4J9K A;  4O2A B;  9ICJ A;  2KN7 A;  2ZJ5 A;  4I2J A;  1N62 A;  4JI3 B;  4O3R A;  5D5P A;  4O4H B;  4DV7 O;  3PR4 A;  4DQQ A;  1NTZ H;  3NR7 A;  5LYJ A;  1VQO V;  5KG2 A;  3FAV A;  3B40 A;  4MW8 A;  2KVC A;  1E1Q G;  1OV9 A;  2R8K A;  4RNM A;  2AU0 A;  5JJJ B;  8ICT A;  2VA8 A;  1Q7Y W;  1TKD A;  4P9O A;  4NTX A;  3JAW B;  3NRZ A;  1KYO F;  2GOL A;  4AYB F;  2W9C B;  2OCH A;  4EB6 B;  4F50 A;  4KLE A;  2GSM B;  3E8G A;  3LYS A;  2EAN A;  4BWM A;  2UXB B;  2KHQ A;  3ALR A;  1ZQB A;  9ICH A;  1BNP A;  5JJN B;  4X62 B;  1I0H A;  1BVS A;  4I29 A;  3RFA A;  3V6K A;  3ABK C;  4GKJ B;  5IIK A;  4J42 A;  3GQC A;  1B4F A;  1NK0 A;  2KG5 A;  1VQK V;  3CC2 V;  4DV3 B;  3JPP A;  4IL6 U;  3ETD A;  5IYZ B;  2W04 A;  3LWL A;  5H6Q A;  3ZRW A;  2FTK A;  1PK3 A;  3K75 D;  3N97 B;  4R63 A;  2UXB O;  3JAT A;  4BR6 A;  2CRX A;  4FPP A;  2EIJ B;  3O0F A;  1R6T A;  3APO A;  4X62 O;  5DLG A;  3E58 A;  4RPX A;  1GN3 A;  3THO A;  4GKJ O;  4US9 A;  4FK5 C;  8ICO A;  4O5K A;  5H2F U;  3HIL A;  2ISO A;  2VRZ A;  2ZXW B;  3N2G A;  4Q6G A;  3SYP A;  4DV3 O;  3HWT A;  3H1L H;  3N2K A;  3GIM A;  1CPY A;  3EFF K;  3VOU A;  1VF5 B;  4Y2X A;  1AVM A;  4UBB A;  2XGP A;  3BRC A;  2YI8 A;  3JAL B;  1SES A;  2X6A A;  4U7N A;  1WLE A;  3O65 A;  8ICY A;  2JZB A;  3ZRX A;  5LP6 B;  5H6R A;  2LQT A;  2YTU A;  4QIW F;  5KNI A;  5BPC A;  1OUQ A;  2W6I G;  3KZI U;  4LNU B;  1RSO A;  4O5E A;  2UUA B;  3ZMS A;  4IQT A;  3ZD9 A;  2XND G;  3H9V A;  2AHZ A;  2YIC A;  5AG2 A;  5KA5 A;  3QZ7 A;  4IR9 A;  5G5G A;  2BPC A;  3QTC A;  4C8O A;  3NVV A;  3SI8 A;  2Y0I A;  4GXJ A;  1S5J A;  1JIH A;  1KKD A;  3R66 A;  4DW1 A;  2RDI A;  1ZTE A;  4JI2 B;  5AKY A;  4DS5 A;  4FBT A;  2VQF B;  1QSY A;  5KTQ A;  3C5G A;  3HKZ F;  3RVZ A;  1TAM A;  1VEW A;  4LF6 O;  1SXE A;  3RN4 A;  3CC7 V;  5DG8 A;  4B9L A;  1UJW B;  4EZ9 A;  3L4P A;  3GV7 B;  3CRX A;  4DUY B;  1FPO A;  3CYM A;  4JI2 O;  4OJP A;  2DL0 A;  4TUP A;  3TXQ A;  4P9P A;  2VQF O;  2NRW A;  1JVM A;  3WKA A;  5AM0 A;  3L71 H;  3HKB B;  2BQ3 A;  3GU3 A;  4DQI A;  3DXR B;  1Q46 A;  1NI8 A;  2K60 A;  1ZWI C;  4LP8 A;  3SAH A;  4UCV A;  4X89 A;  1TVK B;  2Q73 A;  5AKJ A;  1NJI W;  4DUY O;  4ZH4 A;  1L3U A;  3WFV A;  1IUR A;  2BDU A;  1KLN A;  5EIB D;  5J2U B;  1BPX A;  3HT3 A;  3EPI A;  4NL9 C;  1SGG A;  1URJ A;  4PJ0 Z;  4HNA A;  2YQE A;  2WA4 A;  2A06 H;  4ED2 A;  3G67 A;  4DR2 O;  4LC1 A;  1AB3 A;  2FI1 A;  5F3X B;  2E3C A;  2IM9 A;  4YCX A;  4UB6 U;  2I5H A;  1XU4 A;  3WK7 A;  1R6N A;  1WG8 A;  1NNL A;  4PA9 A;  3A2F A;  3ZJZ A;  3OEE G;  4XA5 A;  1RQN A;  2DW4 A;  1CXZ B;  3TJT A;  1BQ0 A;  4YN4 A;  1R3K C;  3BHP A;  4BWA A;  5LA6 B;  1NZB A;  1SC5 B;  2PF4 E;  2LHT A;  2D3O W;  4K8Z A;  5LL6 Y;  5LBQ A;  2QM4 A;  3RYH B;  1CP9 A;  2EIM C;  5ALU A;  2OHF A;  5DB8 A;  4YR2 A;  1FFX B;  2H94 A;  3QNE A;  5J2T B;  1EM1 A;  2ZIV B;  4BAY A;  5DEC A;  3CNH A;  4EEN A;  2XAF A;  4JB3 A;  4IQW A;  1EN5 A;  1K7D A;  4QE7 A;  2BSK A;  1WUD A;  4O2B A;  2W8K A;  1WA8 A;  3FYI B;  2P66 A;  4TUY B;  5EOZ A;  2FMS A;  3K0G A;  2DF4 B;  4EBE A;  2LW7 A;  3UO2 A;  2R8H A;  1XDC A;  3HKE B;  2HHS A;  3UKM A;  3E22 B;  1AJN A;  4F91 B;  2E8N A;  2P35 A;  4I2I A;  5CA7 A;  4P0P B;  1IBL B;  3QUT A;  3C1Z A;  4BX9 C;  1AR1 B;  3ABM B;  1DRG A;  5JH7 A;  4LVS A;  3ZDD A;  1HNX B;  2XVT A;  1YF2 A;  4QZ9 A;  5J2C A;  4UUJ C;  5KFI A;  3ZDB A;  4MFC A;  1ZQL A;  2ASL A;  3RGB A;  4X88 A;  4DUZ B;  5HNK A;  1U96 A;  5KG0 A;  2YMQ A;  4XDL A;  7ICN A;  3GFK B;  3WKB A;  5AIB A;  1IBL O;  1OXJ A;  4MF2 A;  4WFB V;  1X40 A;  3MC1 A;  2FJ6 A;  4PDL A;  4DR7 B;  1ZQN A;  2Y0P A;  3EXA A;  4LF9 B;  3MR3 A;  2RCV A;  3PSI A;  4DSL A;  4K4G A;  1QVF U;  3AQE A;  3KZX A;  2KV2 A;  4GT1 A;  3H8S A;  4CRX A;  3BQ2 A;  2CGN A;  1RPR A;  4DUZ O;  1TK0 A;  3SEN A;  4EEY A;  1FAF A;  3IJ4 A;  4BXO B;  1J97 A;  3BQ1 A;  4R65 A;  1N48 A;  4M9H A;  1HWY A;  4BIO A;  4RQ7 A;  1V55 C;  4AHC A;  1B3Q A;  3QEA Z;  3FB6 C;  4DXW A;  4GC6 A;  4DR7 O;  2AJQ A;  2YXH A;  4ZIB A;  2JJ2 G;  2O6K A;  2AGP A;  4QZ8 A;  5KFQ A;  1OJH A;  4CS4 A;  3CCJ V;  3BDP A;  3RB4 A;  9ICG A;  4DFD A;  3E2E A;  2Y9U A;  4E4E A;  3Q4H A;  4O4J A;  2PZS A;  3UM7 A;  1GMG A;  1SQB H;  1XNQ B;  1GH6 A;  1PVR A;  4B3R B;  3RH4 A;  1TAU A;  3P30 A;  3AQF A;  3Q8K A;  2F8K A;  2XT9 A;  4UCR A;  2WTF A;  4X1I A;  4KLG A;  2GUZ B;  3ZS8 C;  3N28 A;  2VWJ A;  1W0K G;  4NTW A;  5ITZ A;  1BT8 A;  1SQQ H;  3SZ2 A;  1ZX3 A;  1WCN A;  1BQZ A;  4R8U B;  2NN4 A;  4LFC O;  5CWR A;  5IJ0 B;  4DR4 O;  4JWN A;  2WF9 A;  4B3R O;  1A76 A;  4F5N A;  4NY8 A;  2BCC H;  5F9L A;  1UA1 A;  1BPE A;  2IBK A;  3J81 j;  1Q8I A;  2JGU A;  2UVW A;  4PL2 A;  5DBC A;  2FPK A;  1ZQY A;  4O3P A;  4ECZ A;  3H01 A;  2ATL A;  4X66 B;  3LUT B;  4P0Q A;  4KMO B;  5HHI A;  5KT3 A;  2K8B B;  5DQI A;  3JPN A;  4AIL C;  5KT4 A;  5TZV A;  3K5M A;  4IGG A;  3SYQ A;  7ICT A;  4TV9 A;  1Y4M A;  5J2H A;  2Q7H A;  2XAS A;  5LOV A;  1T8E A;  4J7Z A;  3CME V;  1IBM B;  4UCO A;  4X66 O;  1X9S A;  3V7J A;  4AI8 A;  2EIJ C;  5IJ9 B;  2JJ1 G;  4ACO A;  1W59 A;  2P4V A;  5B3S B;  2JEJ A;  1C20 A;  3TXS A;  4BIZ A;  3HKC A;  2KE7 A;  1VLB A;  2WF8 A;  3CP8 A;  3UMG A;  1WPX A;  2EZZ A;  1JXL A;  1JCH A;  2ZXW C;  4QGP A;  1N8R W;  4I28 A;  1N0N A;  2PFQ A;  3H1I H;  3ETQ A;  2KK0 A;  8ICI A;  1Y74 A;  3EWA A;  4TUS A;  3UQ2 A;  7ICO A;  4GFJ A;  8ICB A;  2WLN A;  2AHO B;  1H2K A;  3WG7 B;  2KNJ A;  1ZQF A;  4YMO A;  8ICX A;  4RQN A;  2PFO A;  3RJH A;  2LPE A;  3K0D A;  2PYJ A;  3M9O B;  1TVA A;  5CB1 A;  1TFR A;  3CHX A;  1ZD4 A;  5KFF A;  1NJZ A;  4LBE C;  1AQ6 A;  2LM4 A;  5DGB A;  3BJY A;  2C28 A;  3LDE A;  4WFE A;  1SA0 B;  3UM9 A;  4DQR A;  9ICS A;  5AI4 A;  1M9N A;  1VIB A;  4K4H A;  4X1Y A;  2A19 A;  4I2E A;  1ZL8 A;  1US6 A;  4MT8 A;  4NXM O;  1HEK A;  4NL9 A;  1SKV A;  8ICS A;  2N05 A;  2H5X A;  1VQ5 V;  1NJX A;  1Q6H A;  1ZQT A;  4OJO A;  2CK3 G;  1B0X A;  2M9N A;  2IJJ A;  4U7O A;  1K1Q A;  1UQV A;  1KU9 A;  1SKW A;  5T14 A;  2EIL B;  2ARH A;  2P90 A;  3E8H A;  1NZP A;  4H44 B;  3KBB A;  3WKE A;  4K35 A;  1L6N A;  3NXS A;  3RR8 A;  4TQF A;  5AM3 A;  4YIP A;  2K4H A;  3ABL B;  1N61 A;  1KB9 F;  3LDA A;  3G6B A;  2W8L A;  2LI6 A;  1FXK B;  2FKX A;  2NV3 A;  1M1K W;  4TUQ A;  5KFY A;  2F1I A;  5CA1 B;  2FML A;  5JVD B;  4I9W A;  2Q0Z X;  9ICF A;  3EHB B;  2HSZ A;  2I1Q A;  2F4V B;  5ALH A;  1Y67 A;  2Y0S C;  2JDI G;  7ICE A;  3JD3 A;  4J9R A;  4F2R A;  2Q4P A;  2Y4U A;  2XTA A;  1HW7 A;  3JAR B;  4I9Q A;  1TUB A;  1N63 A;  1NK4 A;  5D46 A;  3QUB A;  3O9O A;  4B9T A;  3JPO A;  2XCA A;  5DDM A;  2KSO B;  4K3A A;  3SJQ C;  3RVY A;  3RYI A;  4NLC A;  2LFS A;  1Z00 A;  1K34 A;  5BOL A;  3OE7 G;  1ZQJ A;  5KFX A;  4PHD A;  7ICP A;  1XS9 D;  2LP7 A;  2F4V O;  2UUC B;  2A9H A;  4I2A A;  9ICI A;  3B77 A;  3H1K H;  3DV9 A;  1KRP A;  1ZUQ A;  4DK0 A;  4EEL A;  1L8D A;  4PGX A;  5L1K A;  4RQ1 A;  2AGQ A;  5J0X A;  1RXW A;  2ZIU B;  2J6U A;  1YCI A;  5EC1 C;  5KL1 B;  3ZMZ A;  4MHV A;  2UUC O;  4PHA A;  2ZJA A;  1JR9 A;  2Y4T A;  3RBD A;  5J2B A;  3ZDC A;  2QAR B;  5KHG A;  1S72 V;  4RUC A;  4CBC A;  4OJL A;  3QU2 A;  3CRC A;  4IHJ B;  1VAR A;  4NLZ A;  4E2L A;  4Z2W A;  3QEB Z;  5IWA B;  1XC9 A;  4FMT A;  3SR2 C;  1NVP B;  4NXZ A;  4C8M A;  4F4K A;  3OTF A;  5AK6 A;  1RYR A;  2XOK G;  1ZQZ A;  2IHN A;  2JH7 A;  1D8B A;  2RNB A;  3G6V A;  5ALY A;  4JAV A;  4XDK A;  2JIZ G;  1ZQ1 C;  4UB2 A;  5KFE A;  3BA9 A;  3VQX A;  1QR9 A;  3SPJ A;  5IWA O;  1FFU A;  2BCU A;  1UT8 A;  5D49 A;  4YHH O;  4J80 A;  4LZD A;  4DFJ A;  1Z4O A;  4KN4 A;  9ICO A;  2KFN A;  1BMF G;  3AG4 B;  2IMW P;  3MHH C;  1ZOL A;  2Q6A A;  5LGT A;  2MRL A;  3RJF A;  1MNG A;  2B9Z A;  4LF5 B;  1HNW B;  1ZQU A;  1L0L H;  3ABM C;  5FLX N;  2HHQ A;  2QWR B;  4KLQ A;  2Z0A A;  4O2A A;  5HFL A;  4JYA B;  4IRD A;  2E74 B;  5KFS A;  1XO0 A;  4WFF A;  5KHK A;  2N04 A;  4O4H A;  4D7S A;  2K9P A;  2IU3 A;  1SS3 A;  3N27 A;  3ORY A;  3DGE A;  3P3N A;  2DPI A;  4LR3 A;  5ALK A;  4WBN B;  4KLI A;  1NR7 A;  1THZ A;  1S3J A;  1QH9 A;  1FFT B;  1B22 A;  3KHL A;  4JYA O;  3JAW A;  4KIT B;  3C28 A;  2KKW A;  2ZTE A;  1IDS A;  2W9C A;  4EB6 A;  3DC6 A;  2Q0O C;  4FFB B;  1XNR B;  3BAA A;  5AIC A;  4DRX B;  3NAS A;  1DGJ A;  2WB1 F;  2ZE7 A;  3ABT A;  2XO7 A;  1B04 A;  3FAH A;  5C0Y A;  3SYC A;  4R66 A;  4DFK A;  1UHU A;  2HHU A;  4ECQ A;  4L8J A;  2CH7 B;  3QUC A;  4Z6F A;  3BZC A;  3X2Q B;  3OPX A;  2FLN A;  4I0X B;  5JJE B;  4ZI7 B;  1XNR O;  5KX5 B;  2UUB B;  5IYZ A;  1OCZ C;  2HVK C;  4GKK B;  1COK A;  3CJH B;  2VQE O;  3V72 A;  3W7T A;  1ZJN A;  2ZT9 B;  4FLW A;  3RAQ A;  8ICG A;  5EE0 A;  3SJA C;  2LJ2 A;  2IJK A;  4GZR B;  1F5S A;  4ABM A;  4DV0 B;  2C2E A;  2D8C A;  3NUQ A;  5LGU A;  3B8M A;  5B66 U;  3FYH A;  1XUQ A;  2RJZ A;  3JCU Z;  1ZXI A;  4QZI A;  5EBL C;  2YS8 A;  4Z1V A;  2QTS A;  3OTQ A;  4IC9 A;  2OT5 A;  3JAL A;  5TIS Z;  2R9R B;  5CRX A;  4M04 A;  3KZI Z;  4FM1 A;  5LP6 A;  2EAO A;  4DV0 O;  4I27 A;  1PPJ H;  1HNZ B;  2MU2 A;  4LNU A;  2WPD G;  2ODG A;  5IY5 C;  2HCF A;  4DV2 B;  2KB1 A;  3KHG A;  3AM9 A;  5B1B C;  1SZP A;  2HVJ C;  5JWP A;  1CRX A;  3PZP A;  1A0P A;  3V7L A;  3WK8 A;  3RTV A;  3WB1 A;  3CCE V;  3UQ8 A;  2BE3 A;  2WLK A;  1NJY A;  4U3J B;  5L3G A;  1ZAU A;  1WB8 A;  1HNZ O;  3SPC A;  2EQY A;  5AKX A;  5J2G A;  3VBB A;  5E79 U;  5KLV H;  2JV3 A;  3PO5 A;  2DYS B;  4DOB A;  3RW0 A;  2Y1I A;  4IYH A;  2BCV A;  2ALZ A;  5J0O A;  5B3S C;  1RDF A;  2ZTD A;  1AJP A;  2LBO A;  5KAI Z;  5DN6 G;  3ZMT A;  4J9M A;  2YIB D;  3SYO A;  1J5E B;  3B2E E;  5AI8 A;  4QZC A;  4Y2R A;  1MSD A;  4DS4 A;  2JRI A;  1Q86 W;  2Q7G A;  4CZZ A;  2FPL A;  3SPG A;  4WCE V;  4JV1 A;  3T5J A;  2VA3 A;  1D9D A;  2C2D A;  1BCC H;  3QU7 A;  4O3M A;  3IC9 A;  1NOM A;  4MTX A;  5BZB A;  4QE9 A;  2DWQ A;  3HKB A;  3S3W A;  4Y2T A;  3H4D A;  2IHM A;  1ZQH A;  1QQC A;  4MEX A;  2B5U A;  3DXR A;  4C8K A;  3GIL A;  1J5E O;  3ML0 A;  3TFR A;  1TVK A;  4C7Z A;  3L70 H;  1RPL A;  1ZQM A;  3PST A;  3H1H H;  5J2U A;  1N34 B;  4G2K A;  2NRX A;  1G6U A;  3CCS V;  2AXT U;  3PML A;  3K57 A;  4ZBM A;  1X9X A;  4JAA A;  1YZB A;  4CF4 A;  2HOQ A;  3PSP A;  4GIB A;  2EIL C;  5GW7 A;  3W7W A;  4O0I A;  5A2Q N;  3FFQ A;  2ZDI C;  4B9V A;  3TAQ A;  2A7W A;  3CRQ A;  4JTA B;  2ZXH A;  1RFY A;  1N34 O;  4GYC B;  5DB7 A;  4DOA A;  1HJP A;  3QUQ A;  2JEF A;  3ABL C;  3TGU H;  5KFB A;  4U7C A;  2QWP B;  1YDX A;  7ICJ A;  2XAQ A;  5LA6 A;  1L1F A;  4MEY A;  1FXK C;  4XDJ A;  1L8O A;  3AK1 A;  1TA8 A;  3E35 A;  7ICS A;  4JTD B;  4MVU A;  4JI1 B;  3KG2 A;  4N21 A;  1NK9 A;  3RYH A;  3D2N A;  1L5U A;  4EFE A;  4UAW A;  3RJG A;  2A79 B;  5J2T A;  4F2S A;  1FFX A;  4USA A;  2ZIV A;  3A0H U;  2PGG A;  3KCY A;  1ZQW A;  1K33 A;  2ZUB A;  3F2C A;  4UB1 A;  5AIA A;  1I08 A;  3D3Q A;  3RT3 C;  1G1X B;  3ZDA A;  1E1R G;  5GON B;  4UBC A;  3C29 A;  5EZY B;  4TUY A;  1D8Y A;  1JA8 A;  3OEH G;  4TSF G;  5D5Q A;  3F7Y C;  1PV0 A;  4NWI A;  4JI1 O;  4F4L A;  3HKE A;  2ZR2 A;  1EFR G;  3M1Y A;  3E22 A;  4RPZ A;  4P0P A;  1IXM A;  2PY5 A;  3C5F A;  2JXJ A;  4JZG A;  2GTA A;  2X6C A;  5CB4 B;  2P6U A;  1EXN A;  1NKE A;  4LCU C;  2HBJ A;  3PW5 A;  3WK9 A;  3JPQ A;  2LM1 A;  1H38 A;  3RR7 A;  2NRV A;  4O9M A;  8ICA A;  2V1D A;  2ILM A;  5ALJ A;  1DK2 A;  2OIG A;  2XHB A;  5B1O A;  2XUM A;  4ECV A;  4TT3 G;  2EDU A;  1U97 A;  2VS0 A;  2KTQ A;  4CH4 A;  1BPB A;  2RN9 A;  3OMI B;  1S77 D;  1XSN A;  4RZR A;  1PL0 A;  4WF9 V;  1N32 B;  2NRT A;  3MR6 A;  3JD0 A;  8ICF A;  2EH9 A;  3OFN G;  4PV1 B;  2XI9 A;  1KKC A;  3K3W A;  2B0C A;  4IIJ B;  4PHE A;  4BXO A;  4R7C A;  1A6S A;  3HPO A;  3RYF B;  1G4Y B;  4B3M B;  2YB1 A;  2QWN B;  4H0L B;  1VDV A;  4DV1 B;  1P7G A;  5B1A B;  3PMN A;  2YC0 A;  1N32 O;  1SL2 A;  3ASN B;  4C4T A;  5LGN A;  4QZD A;  1N5X A;  2R70 A;  2P7T C;  3AG4 C;  4FE3 A;  1LNQ A;  3TI0 A;  1JPX A;  4TWK A;  3QXG A;  2C22 A;  2BZF A;  2P6R A;  2ZD9 A;  4TQS A;  2IJH A;  3SAF A;  3SR6 A;  3I55 V;  4JYB A;  4B3M O;  2XGQ A;  4DCC A;  4DV1 O;  1WWU A;  3G80 A;  3U26 A;  2R8J A;  3ISD A;  2GUZ A;  3F53 A;  1RZT A;  4FZM A;  2DN9 A;  2JEX A;  3J81 N;  5DQH A;  4MTO A;  4CF3 A;  2EZX A;  4RO2 A;  4EEQ A;  4R8U A;  2BPF A;  5L3C A;  2AW9 A;  1GK9 A;  2M6Y A;  5IJ0 A;  1KFT A;  4N23 A;  4UB5 A;  3B09 A;  4MVO A;  4B9N A;  4MTG A;  3KKA C;  3IN5 A;  5H9C A;  2L35 A;  3K1Z A;  1UCV A;  2ZIW B;  5B5E U;  3DC5 A;  2CE4 A;  4KLU A;  2XAJ A;  3MFH A;  3FB5 C;  2D3D A;  1KEC A;  4ZKI A;  3PJS K;  5FP0 A;  7ICG A;  2RQ5 A;  2Q4T A;  1ZD3 A;  1P49 A;  2KD1 A;  4I55 B;  2JGD B;  1UA0 A;  3CYO A;  1YTF B;  3X2Q C;  3F2B A;  3T4Z A;  2WF6 A;  4ASU G;  1IXR A;  4ECU A;  4YXW G;  5HHH A;  1O03 A;  2WHE A;  3WK6 A;  5J0U A;  3NVW A;  2JR5 A;  2QM7 A;  2Y48 A;  4LF6 B;  4CF5 A;  2K4P A;  2JMG A;  3ONN A;  5AM5 A;  3PX0 A;  9ICV A;  1KBH A;  5IJ9 A;  2QKQ A;  4BW9 A;  1YZ7 A;  2A1J B;  1Z3E B;  3C21 A;  3PR5 B;  5L3E A;  2KVS A;  4TV8 B;  2WLI B;  4O4L B;  1JFF B;  1KFD A;  1S97 A;  2KZM A;  3CWB H;  4YJ3 B;  1ARO P;  2BTQ B;  1H2L A;  4K8X A;  2QJ1 A;  3RB3 A;  1VJ5 A;  5IT9 N;  9ICT A;  3AK2 A;  2UVU A;  3OTO O;  4UW9 A;  3LDC A;  4KL1 A;  1MAB G;  4NB5 A;  5DLF A;  3WB2 A;  5L3F A;  1SA0 A;  3L9D A;  4Y2Q A;  4JAU A;  3SV3 A;  2W0F C;  4DR2 B;  1K9M W;  1KFS A;  1R3J C;  4BW5 A;  2ES6 A;  1AR5 A;  5JQG B;  4OPA A;  4Z6C A;  1WB7 A;  1JJO A;  3GVM A;  4ZOL B;  5FL7 G;  1N33 B;  1KKX A;  3UXO A;  1WYG A;  2ZXI A;  2QSA A;  2K8A A;  1TAQ A;  2HHT A;  4QZF A;  3OSN A;  2DYS C;  4I7Z B;  2UXN A;  3PW4 A;  3F7V C;  1XQ8 A;  5ALS A;  5ALL A;  4UCT A;  1IZ3 A;  3T4D A;  1XHX A;  3EZ5 A;  1KP2 A;  2ZDI A;  4TQD A;  2HVH A;  5GTH U;  3F5T A;  1H8H G;  1YZ6 A;  3T1Y B;  4RQ3 A;  4M47 A;  1J2N A;  2ZIN A;  2B6G A;  3ZBH A;  1N33 O;  2Q67 A;  3RRH A;  3MDA A;  3BS5 B;  1FXK A;  2A0L A;  2R9A A;  3LVV A;  2HOI A;  2HHH B;  4KX3 A;  5CA1 A;  3WU2 U;  4LH7 A;  5JVD A;  4NLG A;  2Y0S F;  4GLX A;  2NNU A;  3H0L B;  1BGY H;  3D8C A;  3TAN A;  1F0M A;  1K3E A;  4BJQ A;  3T1Y O;  3S3X A;  4Y2U A;  3KD3 A;  2OYY A;  1YXB A;  3JAR A;  4CNQ A;  3RH6 A;  4IYI A;  5C93 A;  4MF8 A;  5L1J A;  2KSO A;  3UXN A;  1VQ9 V;  4ICA A;  2ZCE A;  3N4M B;  2HHH O;  1LR1 A;  4ED1 A;  4HYK A;  2KJ8 A;  7ICI A;  4IR1 A;  1P7B A;  2V7Q G;  4WFH A;  3T3F A;  4DQP A;  2G06 A;  5IIO A;  2OCC B;  2F8L A;  5J0W A;  1MA1 A;  4KLL A;  4YXM A;  3HP6 A;  1KW4 A;  3QO7 A;  1XRE A;  2DWE C;  1N56 A;  2BQU A;  3ZX6 A;  3H8M A;  3BAB A;  1WJZ A;  1KTQ A;  2YEV B;  5J0P A;  2ZIU A;  5KUK A;  5L1L A;  4I4T B;  9ICX A;  3Q8M A;  4UCU A;  4L87 A;  2P4K A;  4J9P A;  1XNS A;  1D8L A;  2ZIM A;  4PGY A;  3QE9 Y;  4K4I A;  3ASO B;  3C2M A;  2A1A A;  5ALD A;  3BCC H;  2QAR A;  3CB2 A;  4PEL A;  3B9J A;  4UVC A;  4DWI A;  1LUV A;  5J2D A;  4IHJ A;  1XMQ B;  3SPI A;  1U4B A;  3RWR D;  1D2D A;  2E1F A;  3BPZ A;  4U3F H;  3FKS G;  3V6J A;  1YI2 V;  2EJ7 A;  1X2I A;  1AI6 A;  1N60 A;  1T7P A;  4OXS A;  3M6Z A;  3ZDE A;  2HHX A;  2HI0 A;  1LVH A;  3F2D A;  1KL9 A;  1XMQ O;  4HAI A;  1B43 A;  4G28 B;  2CGO A;  2WSS G;  2E3T A;  3M9N B;  4FS2 A;  2KSD A;  3OUS A;  1QHT A;  1NK5 A;  2HHV A;  4J9S A;  4JV5 O;  3UO3 A;  3STZ C;  4QNH B;  1SZT A;  4KLM A;  3V6H A;  3B0Y A;  3DEE A;  3CCV V;  4R6Z A;  4UV9 A;  1XHZ A;  1MQ2 A;  1LKY B;  4P2H A;  2W3S A;  1PM9 A;  3SGI A;  2M7W A;  4FFK A;  2XY5 A;  4LFC B;  1VF6 C;  2RMK B;  5JU5 A;  3WB0 A;  4DR4 B;  5KFC A;  8ICH A;  2H3O A;  2WLL B;  3K58 A;  5AI5 A;  3OD4 A;  2KZ3 A;  4AQY B;  4GXK A;  2H3V A;  2Q9L A;  7ICK A;  3UQ0 A;  3OMN B;  4LF8 O;  4WBN A;  4O3S A;  4B7K A;  1TK8 A;  4W4K A;  3KKA A;  3AN1 A;  4AYB C;  4DL6 A;  2UU9 B;  3LVW A;  4Z1M G;  3D2S A;  4M9L A;  4C0Z A;  2F23 A;  4UB8 Z;  3ETR A;  2ASJ A;  4FFB A;  5CP2 A;  4QWA A;  5ALV A;  1PNM A;  4J7J A;  4DRX A;  3KTQ A;  1XL4 A;  2W6J G;  4AQY O;  4J9N A;  4C8L A;  4I2H A;  1Q81 W;  3E89 A;  4LJX A;  4X9Q A;  2PI4 A;  1OCC B;  5K1X A;  2M0N A;  1L3T A;  4BDP A;  3L73 H;  5B1A C;  1MZF A;  3C90 A;  2CH7 A;  1JN3 A;  1L7P A;  1TK5 A;  3ASN C;  2UU9 O;  1T4G A;  2AHY A;  4UXN A;  4I0X A;  1ZD5 A;  9ICL A;  1P84 F;  2OYQ A;  2H3Q A;  4ZI7 A;  1DK1 A;  2B1G A;  5KX5 A;  1KMI Z;  4DV5 B;  2CTQ A;  3CJH A;  1JI7 A;  4RQ0 A;  5J2I A;  1WN7 A;  3CRA A;  4NV0 A;  4UFZ A;  1WNS A;  2HEP A;  1Z5W A;  1YIJ V;  5AI6 A;  5B66 Z;  4JV2 A;  2JEU A;  5L3B A;  2YXL A;  3PV8 A;  5CEH A;  3LDD A;  4DR5 B;  4TQR A;  2IJI A;  5K1P A;  2ZR3 A;  1ZQO A;  4DV5 O;  3NVY A;  1DF4 A;  1HP8 A;  4HZ3 A;  3HPL C;  1T3Q A;  1ZLZ A;  5CN0 A;  2YMP A;  5HR7 A;  4JK1 A;  2KQX A;  4G3I A;  4QIW C;  1S5L Z;  4ZHQ B;  2W55 A;  2W9B B;  2EX3 A;  3F5W C;  1KQS U;  4X65 B;  2Z3Y A;  4DR5 O;  3AU2 A;  5DB9 A;  2AQ0 A;  4NXM B;  3UMB A;  3RJK A;  3ZIA G;  2HDO A;  3MGV A;  3TCU A;  5LP6 C;  1MN8 A;  1SB3 C;  3IV6 A;  3RF9 A;  4RU9 A;  3RH5 A;  1K1S A;  1NQT A;  2GBO A;  2Q69 A;  3OGC C;  3QYP A;  2IH3 C;  3MBY A;  5E79 Z;  4I5S A;  4MVR A;  2QKC A;  5HML A;  4RUF A;  1TGO A;  3CW2 C;  5KG4 A;  4U3J A;  2D6F C;  1NKB A;  1ZQQ A;  3K04 A;  4PI0 A;  4X65 O;  1PZN A;  4FLT A;  1QR8 A;  4GX1 A;  3ETG A;  5KFO A;  3NRW A;  2Y1J A;  3W7U A;  1YHQ V;  2KG7 B;  2QB1 A;  1Y76 B;  5KFJ A;  4PL1 A;  5ALR A;  1Z2G A;  1BL8 A;  3AEI A;  4JI4 B;  3TQ1 A;  3P32 A;  2WAQ C;  4OX9 B;  5ALO A;  4RQ4 A;  2ZJ8 A;  3ETE A;  4GX2 A;  4YIO A;  1KBU A;  3CMA V;  3T1H B;  1HUO A;  2ZIX B;  3IHQ B;  3THV A;  5CMU A;  3ZI4 A;  3J80 N;  4NLK A;  4F5O A;  3QU5 A;  4YD1 A;  1I7F A;  3AU6 A;  1ZQV A;  1SL1 A;  1UFI A;  2YB4 A;  2GHY A;  4BUG A;  4FBU A;  1F4N A;  1S8O A;  5KG7 A;  1ZQS A;  4JI4 O;  2CTP A;  3ZHS A;  4OX9 O;  4DL4 A;  3T1H O;  8ICR A;  3TAR A;  3PNC A;  1HUZ A;  4QWC A;  3B0X A;  1YVW A;  4EBD A;  2F1M A;  2HJD A;  2Q7E A;  4ZOH C;  4B6J A;  4OD0 A;  2EIN B;  3U11 A;  1V85 A;  3TAD C;  3D3I A;  2EAP A;  3N7P D;  5EYP B;  1ZQR A;  4M9G A;  5DM6 V;  4DF8 A;  1VF7 A;  3M9M B;  1SER A;  4NLB A;  3NGD A;  5KT2 A;  5J0T A;  4YR0 A;  2CUG A;  4FZN A;  2CXY A;  2ZQM A;  4F92 B;  2D2C B;  5LHH A;  2GDS A;  3CRR A;  4JWM A;  2P22 C;  1EZJ A;  1U47 A;  1RXV A;  3RFR A;  4LF4 B;  3A0H Z;  2N74 A;  1S5H C;  5KAF U;  1NH2 D;  1FJG B;  4Z6E A;  3JSL A;  5ALQ A;  4PA4 A;  1B6Q A;  1VQM V;  3UXP A;  4EX6 A;  4RAI A;  1EN4 A;  2W9A A;  1M5I A;  2JK5 C;  4J9L A;  4Y2V A;  2GO7 A;  3K9A A;  3G6X A;  4F8R A;  1ED1 A;  4YHH B;  4F5R A;  3RJJ A;  4RQF A;  1ZQD A;  5GON A;  3ZHU A;  1PUZ A;  1K4C C;  1R1B A;  5EZY A;  2YY6 A;  2J6T A;  3JSN A;  5KT6 A;  2CN1 A;  4KXR A;  4LF4 O;  2A3Q A;  1FJG O;  1F4M A;  8ICC A;  3A0B U;  2MAX A;  1Q8K A;  2XC9 A;  2OCC C;  1U45 A;  1PVP A;  1KUQ A;  3LSU A;  5CB4 A;  3MR5 A;  5GTI Z;  3EVK A;  3TK1 A;  3M8S A;  2OH2 A;  1GTO A;  4I2F A;  1K5Q A;  1VF6 A;  3JCZ A;  2ITC C;  3L5K A;  1QCK A;  3LSS A;  4R64 A;  4I50 B;  4F72 A;  2H3F A;  5AKL A;  4X1K B;  5LMN O;  3ASO C;  4I2G A;  3AK3 A;  2OTL V;  1GO3 F;  1K5S A;  3ZHQ A;  4CH3 A;  4LFB B;  2QTO A;  3WK5 A;  3LK9 A;  2V4Q A;  4IIJ A;  4IRC A;  1W2B U;  1JMK C;  1S0N A;  3RYF A;  1VQ8 V;  3CEI A;  1CEZ A;  2JS3 A;  3ZMU A;  3CS5 A;  4MS2 A;  1PD3 A;  2VQE B;  3MR2 A;  1OCO B;  2ZE6 A;  3CRM A;  4LFB O;  1D5N A;  3GZF A;  4FIP C;  1H2N A;  5DBB A;  1AI4 A;  2OM6 A;  2KIW A;  4IL6 Z;  3FDS A;  5HMM A;  2J6S A;  2ZNI A;  8ICP A;  1XIL A;  2ATK C;  4DR1 B;  3UT5 B;  5AI0 A;  1V54 B;  5DQG A;  5F9N A;  2R8G A;  3NTU A;  2VAN A;  4I2B A;  4R50 A;  3D36 C;  1QQ6 A;  2NO4 A;  3F5A A;  9ICU A;  1BPY A;  5H2F Z;  1Z5V A;  3ABU A;  2LO1 A;  5AKG A;  1M56 B;  2BCS A;  2F1J A;  3EPG A;  1NKD A;  1QQ7 A;  2QGN A;  1L8L A;  1SV0 C;  3ICX A;  2W43 A;  1OZ0 A;  1K73 W;  3CX5 F;  4DR1 O;  2XID A;  3ZD8 A;  3KKY A;  4J03 A;  2ZIW A;  2WFA A;  1QLN A;  3MDC A;  4CDG A;  5CJ7 A;  3K5N A;  2ESE A;  1Q5O A;  3OJU A;  3GV5 B;  2BDP A;  1OCC C;  4I55 A;  2LYA A;  2JGD A;  1NTM H;  3IDW A;  5A9G A;  4EFB A;  2VJ5 A;  5L3D A;  3KOO A;  4NVP A;  3OHB A;  2JVD A;  1I94 B;  3Q8Q B;  4RQ6 A;  1JRO A;  2GTS A;  5AKZ A;  2EAM A;  3C3T A;  4I2D A;  3Q8L A;  2BOC C;  8ICE A;  3H8J A;  4QW8 A;  1M4U A;  3ZHR A;  4EX7 A;  3NS1 A;  5KUM A;  2WLM A;  4XBF A;  3JD2 A;  2A1J A;  3RJI A;  2VWK A;  1NK7 A;  1R6K A;  4TV8 A;  5EWG A;  1I94 O;  4QWB A;  2WLI A;  3R65 A;  1O08 A;  4ELV A;  1JFF A;  4O4L A;  3C1Y A;  2HBL A;  3PSF A;  1NKC A;  4YJ3 A;  2BTQ A;  1XEQ A;  5DG9 A;  5KA6 A;  1Q90 D;  3MGH A;  3CCM V;  2LMR A;  2KKP A;  5AM4 A;  3KCX A;  2QB0 B;  3WG7 C;  4DSE A;  2WA3 A;  4GUN A;  3NVZ A;  5KFU A;  1NTK H;  5B1N A;  2KKV A;  5AKE A;  2ZM6 B;  1EN6 A;  2F66 C;  4LZG A;  4B3T B;  4P30 A;  5JQG A;  4QPJ A;  2GWS A;  1X4T A;  2LGQ A;  3JAS B;  3U0Z A;  4Q8E A;  2K89 A;  3MAB A;  4ZOL A;  1N2X A;  3TFS A;  2LGW A;  1ZQX A;  3TAD A;  4QZH A;  1XSL A;  5E1A C;  3T2M A;  1MG1 A;  5GTH Z;  1PP9 H;  1BE3 H;  2F44 A;  3CXC U;  2ZM6 O;  3MD0 A;  4MW3 A;  1NR1 A;  1N36 O;  4UB6 Z;  1ZD2 P;  4B3T O;  3JAK B;  4OCZ A;  3D2Q A;  3CE2 A;  4UCS A;  1VQP V;  4J9O A;  1LUW A;  2W9M A;  4PA7 A;  2W3R A;  9ICP A;  8ICK A;  5BR8 O;  3QO5 A;  1QVG U;  1M57 B;  2OIE A;  3BS5 A;  4U6P A;  3EW9 A;  3G6E V;  2JEI A;  4UAY A;  4OGQ B;  5AM1 A;  4DSI A;  4EYH B;  1X6I A;  1V9P A;  1N5W A;  5EK0 A;  1JX4 A;  4JI6 B;  3JD1 A;  5FPO A;  2AZ0 A;  2F43 G;  2G38 A;  2QWQ B;  2E8O A;  5C8Y B;  2DJV A;  4KX5 A;  4JI7 B;  2G08 A;  4G9B A;  5ALZ A;  4YD2 A;  2HKO A;  3MGI A;  4BIU A;  1KN5 A;  4DSF A;  8ICZ A;  1QSS A;  2ETN A;  5KFD A;  4JMU A;  1FYJ A;  2NLJ C;  9ICK A;  2G0A A;  2HLD G;  4JI6 O;  2ZNJ A;  4PGQ A;  2CTW A;  3E8F A;  3HR0 A;  4J11 A;  2AGO A;  3V7K A;  1IIP A;  4JI7 O;  3M7D A;  2Q5Z A;  4MTF A;  3B4S A;  2YN4 A;  2IBZ H;  2EIN C;  3VC8 A;  5AKH A;  1ZQA A;  4ED3 A;  2FMQ A;  3C2L A;  1M90 W;  2YEV A;  4RT3 A;  2DBY A;  5D4B A;  4DK1 A;  4I4T A;  4JI8 B;  4P4M A;  1IG6 A;  4XUS A;  5JTI A;  3L74 H;  2KIV A;  2E8M A;  5ALW A;  5G5H A;  3JPT A;  4OO1 J;  2P06 A;  3L72 H;  5AK3 A;  5FNV B;  2HG5 C;  2C2R A;  4PZO A;  3VCB A;  1K4D C;  2HFE C;  1ZQI A;  2R9I A;  1QQ5 A;  3QNM A;  1SQV H;  2RDJ A;  5EIB C;  3FD9 A;  4JI8 O;  4PDR A;  3EYZ A;  4P2Z A;  2Y69 B;  2Z7J A;  4RQM A;  5ALT A;  5KFR A;  4R8C A;  4DSJ A;  4F3O A;  2DYR B;  1GAX A;  2BGW A;  4DSK A;  1MC8 A;  5JCO C;  5DBA A;  4QWD A;  4DL3 A;  1VMG A;  3CCR V;  2X6B A;  1FXV A;  1HR0 B;  3OT7 A;  1SWW A;  2ADQ B;  5KT7 A;  3APQ A;  1IXB A;  4IQV A;  3SEI A;  2PFN A;  1BS3 A;  2PMZ C;  3BQ7 A;  2BTO A;  5F2V O;  1LKY A;  2UVV A;  4MVQ A;  2PYL A;  1X42 A;  3IG5 A;  4F93 B;  3D36 A;  3T5K A;  3C23 A;  2WLL A;  2HMX A;  1HR0 O;  1FKA O;  2JGA A;  2X7R B;  4O4I B;  1S76 D;  4YXJ A;  2MUT B;  4F4Z A;  1HDJ A;  2KP7 A;  1SV0 A;  1JQ0 A;  1ROP A;  1RG6 A;  2RDC A;  4JI3 O;  1SV4 A;  4QNL A;  3U10 A;  1AIL A;  1URF A;  3FX7 A;  4Q43 A;  3RB0 A;  3T79 A;  3K03 A;  1WWV A;  2VKQ A;  2WB1 C;  2QLT A;  1F44 A;  1IX9 A;  1BGX T;  1L7O A;  2AZ2 A;  2V9W A;  3WKC A;  1K5O A;  4GC7 A;  2RP5 A;  5KFN A;  4AP9 A;  1KSP A;  1V97 A;  1A32 A;  5BMV B;  1SXD A;  3KHR A;  2BR0 A;  4Q8F A;  9ICB A;  4X8A A;  1GRJ A;  3SD7 A;  1SQP H;  1OCO C;  2E5L B;  3RYC B;  2PI5 A;  3A8T A;  5IIM A;  3LNN A;  9ICE A;  2WAM A;  3OGI B;  2ZUC A;  3IM1 A;  1JUD A;  3N7R C;  4KP4 A;  3H0M B;  1FEZ A;  2L5Y A;  5DG7 A;  3OM3 B;  4NKG B;  2QR4 A;  1ZQG A;  2FYU H;  3RRG A;  1SKR A;  1HIW A;  1V54 C;  3RJE A;  4Y2J A;  3IRU A;  2E5L O;  5J2E A;  1PVQ A;  1SF9 A;  2FPM A;  1SQF A;  4JUZ A;  3AG3 B;  2ZUD A;  3LNM B;  1M56 C;  3OTO B;  5TIS U;  5KFG A;  3MAQ A;  1T94 A;  5LXT B;  4LFA B;  4NTY A;  2EZY A;  4ZHQ A;  2W9B A;  4MSW C;  3PY8 A;  5CHG A;  2WF7 A;  2XY7 A;  4Z6D A;  2Z5U A;  1NU1 H;  1T5E A;  2V4R A;  4C80 A;  4KFM A;  4F6R B;  4M9N A;  3OR6 C;  1S10 A;  1LB2 B;  5ALE A;  5EC2 C;  1WP8 A;  4LFA O;  2H3I A;  1X6J A;  2R72 A;  2NRZ A;  3K1R B;  4Y2S A;  5DGA A;  1SQX H;  4CCH A;  2UUA O;  4PHZ A;  2AQ4 A;  4GX0 A;  1VQN V;  4MVZ A;  5IYC O;  2YUA A;  2L6L A;  2KHV A;  3MFI A;  2HJF C;  2E76 B;  3P3P A;  1RM6 C;  2KG7 A;  1H8E G;  1Y76 A;  2BCQ A;  1KP3 A;  4KHP B;  4QZB A;  3BQT A;  3ETL A;  2BCR A;  3SYZ A;  3SJC C;  4CH5 A;  2WAQ F;  5KAI U;  1ORQ C;  2PTM A;  3FM9 A;  4NLN A;  2FB5 A;  3SDL A;  4A8E A;  4DL7 A;  1GM7 A;  2O57 A;  3HB3 B;  3HKD B;  1UPH A;  2ZIX A;  1K92 A;  1ZYQ A;  1T3N A;  4GXI A;  3BVO A;  1DXS A;  3PW2 A;  4DR3 B;  4FO6 A;  3T5H A;  8ICQ A;  2RLT A;  5DKW A;  5L9X A;  3HW8 A;  4KHP O;  4PA3 A;  1ECW A;  1YSC A;  5BOM A;  4JAS A;  1W0J G;  1PNK A;  1K97 A;  4QJF B;  2R8I A;  1BNO A;  2P67 A;  4C8N A;  4TOI A;  3CCQ V;  3BQ0 A;  1NK8 A;  5KG3 A;  2DQ0 A;  1VQL V;  1Z1V A;  4DR3 O;  1JRP A;  1Z19 A;  3W7S A;  2Y9T A;  2F77 X;  1ZQE A;  1RPO A;  1GM9 A;  4UB4 A;  2EUL A;  4NR1 A;  3UPQ A;  4PDV A;  3H0R B;  1PK1 B;  4FJC C;  4F6E A;  1BSM A;  3T1C A;  2UXD B;  5EYP A;  1XWL A;  4BWJ A;  1NI3 A;  3ISB A;  4YJ2 B;  4M6W B;  1GM8 A;  1D9F A;  1IVS A;  5CA3 A;  3RB6 A;  3K06 A;  5KFW A;  1BHA A;  2YXY A;  1X9W A;  2LFR A;  3E83 A;  3FYE B;  1Q3V A;  3IC7 A;  1M57 C;  2IOF K;  1COW G;  5KAF Z;  1FFV A;  1JJ2 U;  4UAZ A;  1L7M A;  3GIK A;  1NT2 B;  5J8Y C;  2UXD O;  2LYH A;  1FIQ A;  1QTM A;  2KJ5 A;  3Q8S B;  2OWO A;  1H2G A;  2HBM A;  1U49 A;  5KMG B;  5KFV A;  3DTU B;  1YJN V;  4F4X A;  3M8A A;  3BZK A;  4LF7 B;  4IS7 A;  5CA0 B;  2PFP A;  5AK5 A;  3TAP A;  3STL C;  3W7X A;  4DLE A;  3B8N A;  4FLZ A;  4M9J A;  4RQ8 A;  5KFM A;  1FXH A;  5ALN A;  1L3S A;  4ECR A;  1QLE B;  3A0B Z;  4JV0 A;  4JV5 B;  3GDX A;  4W4L A;  5JCO A;  2WLJ A;  2HW3 A;  1SIJ A;  1RYU A;  1RYS A;  4JPR A;  4CS3 A;  4LF7 O;  4TUR A;  8ICW A;  1XBL A;  2CTR A;  1WPB A;  4LWS B;  4FLU A;  3SJB C;  4B9U A;  5LHG A;  2NYV A;  2RQ6 A;  2WWW A;  9ICM A;  2I9G A;  1S0M A;  3AG2 B;  5KG5 A;  4EKW A;  4LF8 B;  4DYL A;  3AL0 B;  5HFM A;  4I50 A;  2HR3 A;  2LW1 A;  1Y88 A;  2YMM A;  5IIL A;  1RP3 B;  4FM0 A;  1HNX O;  4X1K A;  1L0N H;  5EBM C;  5LYJ B;  5EWF A;  3FAV B;  2MK3 A;  4C4R A;  3SV4 A;  2P6J A;  2K4E A;  2E5S A;  5BXZ A;  2EIK B;  3H8W A;  1J95 A;  4MVS A;  4LF9 O;  1TUE B;  4GCZ A;  2W0X A;  3JAM N;  2Y69 C;  3GII A;  3KFU F;  4D7T A;  3I76 A;  4CC6 A;  3K59 A;  4DR6 B;  3UCS C;  1AP5 A;  3ZED A;  2IW5 A;  2F93 B;  2DYR C;  4X64 B;  1OCZ B;  4RQE A;  5J0R A;  1R73 A;  3ZRV A;  4RQ5 A;  4WJ3 B;  2B21 A;  2K4I A;  2VJ4 A;  2KMD A;  3G6Y A;  1R3I C;  2NO5 A;  1P4R A;  3ZRW B;  4DR6 O;  2RHF A;  3OHA A;  5KFT A;  2OXO A;  3JAT B;  3VQW A;  3WKD A;  1M93 A;  5A0L A;  3ZHV A;  4UV8 A;  3UT5 A;  2NR5 A;  4X64 O;  4ECW A;  2W03 A;  4J7K A;  3BS7 A;  4WFG A;  3AUO A;  3CD6 V;  1OCR B;  2WF5 A;  5KT5 A;  1BHB A;  4YR3 A;  1XNQ O;  2DWD C;  1YJ9 V;  2W7P A;  3N2G B;  4P4O A;  1GN4 A;  3N2K B;  3GB7 C;  5K4L A;  2AGA A;  5CBF A;  4YG2 A;  4DW0 A;  1QU7 A;  5IDJ A;  1N0J A;  5IY5 B;  1BZK A;  3CCU V;  4UAT A;  4P4P A;  2BQR A;  3GV8 B;  1F51 A;  1KC8 W;  2JZB B;  3ED5 A;  1H2M A;  5B1B B;  3RBZ A;  4C7U A;  2ADP A;  4YQW A;  1CI4 A;  3A0R A;  5EBW C;  1RSO B;  2YSU B;  3MDS A;  1TV9 A;  4KUM A;  2ZIO A;  4DFP A;  4ED8 A;  3JD4 A;  2Q0A A;  2YML A;  1KQQ A;  7ICQ A;  3VQY A;  3CSX A;  2ASD A;  2ZKO A;  1DF5 A;  2DQN B;  3H40 A;  2HBK A;  1NJW A;  4KLH A;  4KLS A;  4B3S B;  1COO A;  1XO1 A;  4MFA A;  3QO8 A;  1WCL A;  1TE2 A;  5KHI A;  3M7M X;  2EZO A;  7ICH A;  2MA1 A;  4UAU A;  4FZ0 A;  4J9Q A;  1Q6U A;  1D5A A;  4JGS A;  4IQU A;  3QZ8 A;  1NBM G;  4G27 B;  4DV4 B;  2KFZ A;  1A77 A;  5KG1 A;  1FD9 A;  2EZP A;  4HBN A;  4LH6 A;  4UAV A;  3QU4 A;  3PX6 A;  3E8B A;  1IBM O;  3AEV A;  3BFR A;  7ICL A;  4B3S O;  9ICW A;  3HKZ C;  4ELU A;  2HP8 A;  4FS1 A;  1H2S B;  1SZH A;  3AG3 C;  4IT5 A;  4NM2 A;  1KEJ A;  1MSW D;  4US8 A;  4QPK A;  3ZN0 A;  5AK4 A;  1DTO A;  3CC4 V;  4DV4 O;  2OEH A;  2DKZ A;  3OSP A;  3BY6 A;  3CXH F;  7ICV A;  5FPR A;  3OW2 U;  1J2M A;  4FLY A;  4DO9 A;  2ZE8 A;  5J9P C;  2QB0 A;  1ZRN A;  1NVP D;  1M6Y A;  4O3Q A;  5KL8 B;  5KFK A;  5J2J A;  2FMP A;  1N4C A;  3M6K A;  2BKE A;  1SKS A;  4ELT A;  1XL6 A;  3L75 H;  2W54 A;  2GV9 A;  5ALX A;  4EEK A;  4PD4 F;  5J0S A;  4C7Y A;  2HOF A;  2P5O A;  4YP3 A;  1O9G A;  4QZA A;  3FB8 C;  2KIC A;  3JAS A;  3GIJ A;  3AG1 B;  5KG6 A;  4F71 A;  1F7Y A;  5EE3 A;  4GX5 A;  3H1J H;  4PHP A;  2AXT Z;  4KLT A;  4HNA B;  2E1E A;  1K8A W;  3TET A;  2EJR A;  3JPS A;  2YI9 A;  3E86 A;  1VQ4 V;  1IBK B;  4PJ0 U;  2QE7 G;  4A5U B;  2KZZ A;  1TAE A;  3PO4 A;  3JAK A;  2IU0 A;  1XMO B;  2QEX V;  2E8P A;  2XIC A;  4RNO A;  3PN1 A;  3J7A U;  5KFZ A;  1CUK A;  3R9K A;  2PXI A;  5KFH A;  4CS2 A;  2A3V A;  1RM1 B;  3CPW U;  3AG7 A;  2Q68 A;  1VQ6 V;  2H3Z A;  5J8Y A;  2EBO A;  4F5Q A;  2XAH A;  3OAA G;  1IBK O;  1Y6X A;  3CCL V;  5J0Y A;  2XY6 A;  5C8Y A;  2KEY A;  4NM1 A;  4H13 B;  3KHH A;  3I56 V;  1EZV H;  3CP1 A;  2F1H A;  5BY1 A;  1ZET A;  4QWE A;  3IG8 A;  1U9L A;  1BPZ A;  4MFF A;  4Q20 A;  5JUM A;  3QVN A;  3G4S V;  2G5I B;  2BSK B;  8ICL A;  3K79 A;  2LKY A;  4O2B B;  1WA8 B;  4RT2 A;  3HJE A;  1P7D A;  5J2A A;  3DDH A;  2OCE A;  3OMA B;  4PI2 A;  4HAM A;  3QX7 A;  3LWM A;  9ICA A;  4ED7 A;  2UVR A;  1SQG A;  2QDO A;  1FO4 A;  1PNL A;  1Z4N A;  5IIJ A;  4E0D A;  4Q44 A;  1ZRM A;  4HYO A;  3K08 A;  5JH7 B;  2GLE A;  2LYB A;  1DLB A;  4PPX A;  4DOC A;  1QNM A;  5LMN B;  4F5P A;  4B9M A;  4J10 A;  3Q8P B;  1X66 A;  2YIB A;  1DOQ A;  3GWK C;  4UVA A;  5ALI A;  5FNV A;  1XI1 A;  1SL0 A;  1NZ6 A;  4JTC B;  4O3O A;  1E79 G;  4F4W A;  4O5C A;  1XOU A;  1MMM A; 
#chains in the Genus database with same CATH homology
 5HR6 A;  1ARO P;  2DGZ A;  3JD1 A;  2F43 G;  5IYB O;  3OR7 C;  2KJ9 A;  1AJQ A;  4KX5 A;  2BOB C;  2G08 A;  1Q3U A;  2HKO A;  4BIU A;  3LDC A;  4PL2 A;  1MAB G;  5L3F A;  4JMU A;  2IH1 C;  2NLJ C;  3H01 A;  3BEH A;  3LUT B;  1QLE C;  4P0Q A;  2G0A A;  1F23 A;  2W0F C;  4JAU A;  1I5Y A;  4KMO B;  2HLD G;  2QM8 A;  1R3J C;  3ABK B;  4BW5 A;  4H37 A;  1K9M W;  2K8B B;  3E8F A;  3LSQ A;  1IIP A;  5FL7 G;  1Y66 A;  3M7D A;  4DO2 A;  1VQ7 V;  4MTF A;  3SYQ A;  1EBO A;  1Y4M A;  2ZXI A;  3VC8 A;  2PMZ F;  2K8A A;  4OJ6 A;  2EIN C;  2XAS A;  3CME V;  2DYS C;  1Q7Y W;  2UXN A;  3F7V C;  3T4D A;  1I5X A;  1M90 W;  2YEV A;  1KP2 A;  2EIJ C;  2JJ1 G;  4ACO A;  2ZDI A;  3AG2 C;  5B3S B;  1H8H G;  4BIZ A;  2JHD A;  3CP8 A;  2Q67 A;  1WPX A;  4OO1 J;  2ZXW C;  1JCH A;  1S0V A;  2HG5 C;  1N8R W;  1FXK A;  2A0L A;  1Z1B A;  3LVV A;  2HOI A;  3VCB A;  4J9Z B;  4KX3 A;  1K4D C;  2HFE C;  1NH2 B;  2R9I A;  4GFJ A;  2WLN A;  2EIK C;  3WG7 B;  2KNJ A;  2Y0S F;  1SRY A;  3F5E A;  3H0L B;  2NNU A;  1YJW V;  3K0D A;  1AI7 A;  1K3E A;  4BJQ A;  4PDR A;  4P2Z A;  2Y69 B;  2Z7J A;  2OYY A;  1MA7 A;  1KD1 W;  4R8C A;  4LBE C;  5C93 A;  3LDE A;  4WFE A;  1JOY A;  1VQ9 V;  4ICA A;  4P0Q B;  1M9N A;  2DYR B;  2KJ8 A;  1P7B A;  2V7Q G;  4WFH A;  2WLH A;  3CCR V;  2X6B A;  2G06 A;  1HEK A;  4MT8 A;  1VQ5 V;  2OCC B;  3OUF A;  2F8L A;  1FXV A;  4OJO A;  3QO7 A;  2CK3 G;  2DQ3 A;  2DWE C;  2IJJ A;  4U7O A;  2F76 X;  2PMZ C;  5T14 A;  2EIL B;  3GWO A;  2VIX A;  2P90 A;  2YEV B;  4MVQ A;  3E8H A;  4JYC A;  2ZIU A;  5KUK A;  1ENV A;  3SPH A;  1L6N A;  1R3L C;  3NXS A;  3IG5 A;  3D36 A;  1OCR C;  2CPR A;  2K4H A;  2WLL A;  2HMX A;  3ABL B;  1XNS A;  4L87 A;  2JGA A;  2X7R B;  3ASO B;  1S76 D;  1FXK B;  4PEL A;  2NV3 A;  1M1K W;  4UVC A;  1JQ0 A;  1ROP A;  4I9W A;  3SPI A;  4QNL A;  1PKX A;  4J9Y B;  2E1F A;  2C2A A;  3EHB B;  2UXX A;  4CGZ A;  3T79 A;  3K03 A;  2Y0S C;  2WB1 C;  2VKQ A;  2JDI G;  3L3F X;  3FKS G;  3JD3 A;  1YI2 V;  1F44 A;  1AI6 A;  2RP5 A;  3M6Z A;  4OXS A;  2N1R A;  4UVB A;  2B1I A;  3SJQ C;  2F2A B;  3RVY A;  4NLC A;  3F2D A;  2K1E A;  4X8A A;  2LFS A;  4WFA V;  4G28 B;  1K34 A;  1OCO C;  2WSS G;  3OE7 G;  2LP7 A;  2PI5 A;  2A9H A;  1YIT V;  3OUS A;  2K8C B;  3IP4 B;  2WAM A;  3IFX A;  3B77 A;  3N7R C;  4KP4 A;  3ZCC A;  3SQI A;  3H0M B;  3SAG A;  3FB7 C;  2RRD A;  3STZ C;  4QNH B;  1SZT A;  4OJ5 A;  3CCV V;  3DEE A;  3MHS C;  4R6Z A;  3OM3 B;  4UV9 A;  2KOB A;  1YT3 A;  2M7W A;  2ZIU B;  3SMV A;  1HIW A;  1V54 C;  5EC1 C;  2XAG A;  5KL1 B;  3ZMZ A;  2WLL B;  1PVQ A;  5CBH A;  1QCE A;  4RUE A;  2R18 A;  2W7O A;  2H3V A;  3OMN B;  3AG3 B;  2OTJ V;  3LNM B;  1M56 C;  1S72 V;  4CBC A;  4OJL A;  4E2L A;  4PDM A;  1T94 A;  4FMT A;  3ZRS A;  4AYB C;  5IYD O;  2EIM B;  3LVW A;  3ZN1 A;  4Z1M G;  3D2S A;  1AI5 A;  4MSW C;  4C0Z A;  1NVP B;  3IGA C;  1PNM A;  2XOK G;  1G8M A;  1XL4 A;  3N7S C;  1FS0 G;  2W6J G;  2JH7 A;  1D8B A;  2Z5U A;  2G5H B;  1Q81 W;  3E89 A;  4JAV A;  2G09 A;  2JIZ G;  4H33 A;  1ZQ1 C;  4KFM A;  4XDK A;  1OCC B;  3OR6 C;  2YX8 A;  2M0N A;  2PI4 A;  2GH1 A;  1QR9 A;  2QKS A;  5B1A C;  3SPJ A;  3ZMV A;  5EC2 C;  1BMF G;  3ASN C;  3AG4 B;  2H3I A;  2AHY A;  4UXN A;  2G07 A;  3AG1 C;  3MHH C;  3E0F A;  2H3Q A;  1QBZ A;  2MRL A;  2Q6A A;  5LGT A;  4GX0 A;  2B1G A;  1VQN V;  4MVZ A;  5IYC O;  2KHV A;  3ABM C;  2HJF C;  4NV0 A;  1MOF A;  1YIJ V;  5HFL A;  3SYA A;  2JEU A;  1H8E G;  5L3B A;  1KP3 A;  5LHI A;  3LDD A;  1XO0 A;  2IJI A;  2WAQ F;  4WFF A;  1ORQ C;  2IU3 A;  2ZR3 A;  2QA4 V;  3DGE A;  1RM1 C;  2JH1 A;  2ZG6 A;  3JYC A;  4A8E A;  1DF4 A;  1GM7 A;  3HB3 B;  1NR7 A;  4HZ3 A;  1THZ A;  1UPH A;  2ZIX A;  1K92 A;  1S3J A;  3HPL C;  1FFT B;  5CN0 A;  5HR7 A;  2ITD C;  2X0L A;  1Q82 W;  4QIW C;  3C28 A;  3F5W C;  4PA3 A;  1ECW A;  1KQS U;  1YSC A;  2Z3Y A;  4JAS A;  2WB1 F;  1JX9 A;  1V55 B;  1W0J G;  1PNK A;  1K97 A;  4QJF B;  3ABT A;  4MVM A;  3ZIA G;  3MGV A;  1GKF A;  3TCU A;  4FZL A;  3M99 B;  2P67 A;  3CCQ V;  3RF9 A;  5C0Y A;  3OGC C;  1NQT A;  3SYC A;  2Q69 A;  1OHH G;  2IH3 C;  1VQL V;  2DQ0 A;  1SET A;  3X2Q B;  3OPX A;  1Z19 A;  4I5S A;  2F77 X;  1RPO A;  4MVR A;  1GM9 A;  4RUF A;  3W7S A;  4JF3 A;  2D6F C;  3G71 V;  3K04 A;  1YTF D;  1OCZ C;  3H0R B;  1QR8 A;  2HVK C;  3ETG A;  4FJC C;  4GX1 A;  4PDV A;  3T1C A;  5CBG A;  2H8P C;  3W7T A;  3NRW A;  4PA6 A;  3W7U A;  1YHQ V;  1GM8 A;  2IJK A;  5CA3 A;  3NUQ A;  5LGU A;  3K06 A;  4PL1 A;  3B8M A;  1BL8 A;  3AEI A;  1BHA A;  2LFR A;  3E83 A;  3FYE B;  1Q3V A;  3IC7 A;  1M57 C;  1COW G;  3P32 A;  2WAQ C;  5EBL C;  1VQO V;  1JJ2 U;  4MW8 A;  2KVC A;  3ETE A;  1E1Q G;  1KBU A;  4GX2 A;  3CMA V;  4IC9 A;  2ZIX B;  2OT5 A;  2R9R B;  2KJ5 A;  5CMU A;  5CRX A;  1H2G A;  2HBM A;  4P9O A;  3DTU B;  1YJN V;  2GOL A;  4AYB F;  2GSM B;  2YB4 A;  2GHY A;  4BUG A;  1F4N A;  3STL C;  2WPD G;  5IY5 C;  3W7X A;  3E8G A;  3B8N A;  3LYS A;  1FXH A;  2KHQ A;  3ALR A;  1QLE B;  2KB1 A;  5B1B C;  2HVJ C;  1CRX A;  3ABK C;  3RFA A;  3PZP A;  1A0P A;  2WLJ A;  3CCE V;  4JPR A;  2WLK A;  5L3G A;  1VQK V;  3CC2 V;  3SPC A;  2EIN B;  3ETD A;  3D3I A;  3VBB A;  2W04 A;  3N7P D;  5H6Q A;  2FTK A;  2DYS B;  2WWW A;  3ZRW A;  5LHG A;  5DM6 V;  2CRX A;  4FPP A;  3RW0 A;  1SER A;  2EIJ B;  3AG2 B;  3O0F A;  4EKW A;  4NLB A;  3AL0 B;  4FK5 C;  5B3S C;  4FZN A;  1AJP A;  2ZQM A;  5HFM A;  2HR3 A;  2LBO A;  5LHH A;  5DN6 G;  3SYP A;  2ZXW B;  3ZMT A;  5EBM C;  3SYO A;  2MK3 A;  1CPY A;  1EZJ A;  3EFF K;  3VOU A;  1Q86 W;  2P6J A;  2K4E A;  4CZZ A;  2E5S A;  3SPG A;  1SES A;  2EIK B;  2X6A A;  4U7N A;  4WCE V;  1S5H C;  1NH2 D;  1WLE A;  4PA4 A;  4O3M A;  1B6Q A;  3ZRX A;  1VQM V;  4RAI A;  4MTX A;  1J95 A;  2JK5 C;  4MVS A;  5H6R A;  5BZB A;  4QE9 A;  1TUE B;  4QIW F;  3K9A A;  4GCZ A;  1ED1 A;  2Y69 C;  4RQF A;  2W6I G;  3KFU F;  1OUQ A;  2B5U A;  1K4C C;  3ZMS A;  2XND G;  3ML0 A;  2AHZ A;  2IW5 A;  5KA5 A;  2CN1 A;  2DYR C;  3PST A;  1OCZ B;  4RQE A;  1R73 A;  3ZRV A;  1F4M A;  4G2K A;  2OCC C;  3CCS V;  1PVP A;  4WJ3 B;  2K4I A;  2VJ4 A;  1KKD A;  4ZBM A;  1R3I C;  1P4R A;  3ZRW B;  2RHF A;  2OXO A;  3TK1 A;  2HOQ A;  3PSP A;  2EIL C;  5A0L A;  5GW7 A;  4UV8 A;  3W7W A;  2OH2 A;  1GTO A;  1K5Q A;  2ZDI C;  3JCZ A;  2W03 A;  2ITC C;  3LSS A;  4WFG A;  3CD6 V;  4JTA B;  1OCR B;  2ZXH A;  2H3F A;  3HKZ F;  1TAM A;  3RVZ A;  1BHB A;  2DWD C;  1YJ9 V;  3ABL C;  2W7P A;  3CC7 V;  4U7C A;  2XAQ A;  3ASO C;  1L1F A;  1UJW B;  1FXK C;  2OTL V;  1GO3 F;  1K5S A;  3CRX A;  3GB7 C;  4XDJ A;  3E35 A;  5CBF A;  4JTD B;  4MVU A;  3CYM A;  4OJP A;  5IDJ A;  3KG2 A;  5IY5 B;  4N21 A;  3CCU V;  3D2N A;  1F51 A;  2QTO A;  4P9P A;  1KC8 W;  2A79 B;  1JVM A;  5B1B B;  2ZIV A;  3RBZ A;  1K33 A;  3F2C A;  1W2B U;  3A0R A;  5EBW C;  3GU3 A;  1E1R G;  1VQ8 V;  3C29 A;  1ZWI C;  2YSU B;  4LP8 A;  4KUM A;  3SAH A;  4X89 A;  1CEZ A;  1NJI W;  3JD4 A;  3OEH G;  3ZMU A;  4TSF G;  3WFV A;  4MS2 A;  3F7Y C;  4NWI A;  1PD3 A;  4F4L A;  2BDU A;  1OCO B;  2ZR2 A;  1EFR G;  3GZF A;  4FIP C;  1DF5 A;  2DQN B;  2HBK A;  1URJ A;  1AI4 A;  2OM6 A;  2KIW A;  4P0P A;  1IXM A;  3QO8 A;  4LC1 A;  2X6C A;  2EZO A;  2MA1 A;  4LCU C;  2HBJ A;  4JGS A;  1H38 A;  4G27 B;  1NBM G;  2ATK C;  1R6N A;  2V1D A;  4PA9 A;  1V54 B;  3ZJZ A;  5B1O A;  3OEE G;  2EZP A;  2DW4 A;  3E8B A;  4R50 A;  4TT3 G;  3F5A A;  3ABU A;  3HKZ C;  1R3K C;  1M56 B;  1SZH A;  3AG3 C;  1NZB A;  3OMI B;  1S77 D;  1MSW D;  1NKD A;  4QPK A;  2LHT A;  1PL0 A;  3ZN0 A;  4WF9 V;  2D3O W;  3ICX A;  1DTO A;  1OZ0 A;  3JD0 A;  5LBQ A;  3CC4 V;  1CP9 A;  1K73 W;  2EIM C;  2XID A;  3BY6 A;  3OFN G;  2H94 A;  2ZIW A;  3QNE A;  2ZIV B;  4BAY A;  3OW2 U;  2XI9 A;  3K3W A;  1QLN A;  4CDG A;  2XAF A;  5J9P C;  1NVP D;  5KL8 B;  1K7D A;  1A6S A;  4QE7 A;  4R7C A;  1G4Y B;  2YB1 A;  1WUD A;  3M6K A;  1XL6 A;  3FYI B;  5B1A B;  1OCC C;  3K0G A;  2HOF A;  2DF4 B;  2LYA A;  3ASN B;  3FB8 C;  5LGN A;  2KIC A;  2P7T C;  3AG4 C;  4FE3 A;  2VJ5 A;  3AG1 B;  1LNQ A;  5L3D A;  1AJN A;  1JPX A;  4TWK A;  3UKM A;  2ZD9 A;  4GX5 A;  2IJH A;  4P0P B;  2E1E A;  3SAF A;  1K8A W;  4BX9 C;  1AR1 B;  3TET A;  2EJR A;  3ABM B;  1DRG A;  3E86 A;  4JYB A;  3I55 V;  1VQ4 V;  2XVT A;  2BOC C;  2QE7 G;  4UUJ C;  2IU0 A;  4X88 A;  5KUM A;  2WLM A;  4XBF A;  2QEX V;  2XIC A;  3JD2 A;  4XDL A;  3F53 A;  2JEX A;  4FZM A;  2A3V A;  1RM1 B;  1R6K A;  4MTO A;  3CPW U;  4RO2 A;  2Q68 A;  1VQ6 V;  2H3Z A;  4WFB V;  2WLI A;  2EBO A;  3R65 A;  4PDL A;  5L3C A;  2XAH A;  1GK9 A;  2HBL A;  3PSF A;  3OAA G;  4N23 A;  3CCL V;  3PSI A;  5KA6 A;  1QVF U;  4MVO A;  3AQE A;  3KZX A;  2KV2 A;  4MTG A;  2KEY A;  3CCM V;  3IN5 A;  4GT1 A;  5H9C A;  3I56 V;  4CRX A;  3CP1 A;  2KKP A;  3K1Z A;  1RPR A;  2ZIW B;  3IG8 A;  4Q20 A;  3G4S V;  3WG7 C;  2XAJ A;  1HWY A;  1V55 C;  2G5I B;  2KKV A;  3FB5 C;  5B1N A;  3K79 A;  2LKY A;  3FB6 C;  1KEC A;  4DXW A;  4ZKI A;  3PJS K;  2Q4T A;  1P7D A;  2KD1 A;  2JJ2 G;  3OMA B;  4P30 A;  4QPJ A;  4HAM A;  3CYO A;  3CCJ V;  3X2Q C;  3F2B A;  2K89 A;  3T4Z A;  4ASU G;  1YTF B;  3E2E A;  4YXW G;  1PNL A;  3UM7 A;  5E1A C;  1GMG A;  3T2M A;  1MG1 A;  2QM7 A;  2Y48 A;  4HYO A;  3K08 A;  3CXC U;  2LYB A;  1DLB A;  2JMG A;  3ONN A;  1PVR A;  3MD0 A;  1NR1 A;  3P30 A;  4MW3 A;  3AQF A;  3D2Q A;  1VQP V;  4UVA A;  4PA7 A;  3QO5 A;  1W0K G;  5L3E A;  1QVG U;  1M57 B;  4JTC B;  4U6P A;  3G6E V;  1E79 G;  2WLI B;  5EK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...