4QJFB

X-ray crystal structure of thermocuccus kodakarensis rna polymerase rpp4/rpo7 (rpof/rpoe) complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
122
structure length
122
Chain Sequence
MIGRKKLEEHYITIAEAKELLERRHAEGLAENPEEPMFYEARVSLEHAERFAKLKPEQARELKEKLMGLFDWINERIAAKLVDILPEDYLDIRVIFAKEEYMPTPEEAEEIIKVIDEYRPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase, subunit E'
publication title Crystal structure of euryarchaeal RNA polymerase and insight into the evolution of RNA polymerase II structure
rcsb
source organism Thermococcus kodakarensis
molecule tags Transcription
total genus 39
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4qjfB02
1.10.287.420 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4qjfB01
4NLBA 4CGZA 2HBKA 3SAHA 2MA1A 2HBLA 2E1FA 2HBMA 2RHFA 2KV2A 4O3MA 3SAGA 5C0YA 4CDGA 4QJFB 2CPRA 4QIWF 1WUDA 4OO1J 2DGZA 2RRDA 3CYMA 4NLCA 1GO3F 3SAFA 1YT3A 2E1EA 1D8BA 2HBJA
chains in the Genus database with same CATH superfamily
1TVKA 1Y74B 2D8CA 3V6KA 1NI3A 5KHIA 4ZKIA 1L1FA 1YZBA 4UAZA 1B6QA 3N7PD 3P32A 4EELA 3F53A 5CB4A 2BDPA 2A3VA 2HCFA 1KMIZ 1L8DA 2WLIA 4O3MA 5DEDA 3N7SC 8ICJA 3OMIB 5KUKA 4YJ2A 2WFAA 4KXRA 4J9LA 2PFQA 4JI6O 1Z1VA 2K9PA 2M0NA 2LFSA 3D6JA 3ZHSA 5H2FZ 2L5YA 4WJ3B 4Q20A 3TXQA 2KIVA 3T1CA 3AN1A 4KLLA 4TOIA 4GT1A 1F51A 5JJNB 4AP9A 4R64A 2HHXA 4EENA 3SJCC 4BIZA 5KFBA 3CC4V 4IQVA 4YIOA 2W9CB 1SZPA 1ZOLA 4I2BA 2N74A 1UFIA 2W9BB 4YJ3A 2XIDA 3CS5A 1SESA 2UXBO 3L73H 1ZWIC 5F3XB 2P6RA 1FFXB 3MGVA 1JXEA 3MR5A 3LVVA 4ED2A 4TUQA 1IG6A 8ICXA 4PA7A 4QW8A 3QYPA 3G71V 2ZXWC 3FFQA 4LBEC 4EB6B 3OGUA 3CC7V 4U3JA 1WCLA 2WF9A 2ZJ8A 1JQ0A 2KP7A 4BAYA 4B3TO 2ZIWB 1RPLA 3SQIA 1N33B 2QB0B 5J2TA 4EEQA 3DDHA 2UUCB 1KU9A 1UT8A 4OCZA 1KL9A 3JASB 1BHAA 1JN3A 4F91B 3MFIA 3HKZC 1DK3A 2A0LA 1WB8A 3I56V 4LZGA 2XAQA 5H6RA 2F1HA 3BHPA 2W6IG 2VIXA 1NR1A 5HP4A 2E8MA 3SGIA 4JV5B 1T4GA 1FXKB 1QQCA 7ICKA 2H3ZA 2DPJA 2HDOA 3BS7A 1MMMA 2M6YA 2B9ZA 9ICEA 2OCCC 3ZIAG 4CBCA 2E76B 2BCUA 3NR7A 2DWEC 5IYBO 2WLLB 5IIOA 1D8BA 4I7ZB 3VQXA 2UXDB 9ICIA 1PK3A 4OJPA 1PL0A 4M9HA 3M8AA 2Q7HA 4H0LB 4YXJA 2HHSA 2P5OA 2R8HA 3QE9Y 1ZQNA 2E74B 4QZ8A 3I55V 2UVRA 2M9NA 3C5FA 2OXOA 4BUGA 3ABLC 1A77A 3F7YC 3BS5B 4B9LA 3HPLC 1ZQLA 5JRTA 4DLEA 2ZTEA 2FPKA 3JAWB 2NRZA 3A2FA 4ZH4A 4O4JA 2HHHB 3C3SA 4QPKA 4NTYA 4NL9A 1D8LA 3E8HA 4UVBA 4LF4O 4Y2TA 4GXIA 5AI6A 5LP6C 3ZDBA 3ML0A 5H2FU 3UMGA 2JJ1G 2Y4UA 4J42A 4YN4A 4RQ8A 1UT5A 3JPQA 1M1KW 1Y74A 3X2QB 4F5OA 2ZDIC 4OGQB 4RQ6A 3ZMUA 1S0NA 2QA4V 5KG1A 4PDVA 4I9WA 3EPIA 1NJYA 1Q3EA 2QARB 1KBUA 1WWUA 2C2EA 4ZBMA 1KFTA 3ISCA 1L0NH 3BQ7A 4TQSA 4B3MO 2H3VA 1ZD2P 3QNEA 4MT8A 1X9SA 3P3NA 2FPMA 5KFWA 3E22B 1YIJV 2YI8A 2JHDA 1MABG 5JQGA 4BXOA 3N28A 3IM1A 4BWJA 4DR1O 5KFCA 3GV8B 1R3IC 3PNCA 5KFFA 1IM4A 3KHRA 4MFFA 1FD9A 4FO6A 5EIBC 1Q82W 1ZQVA 1H2SB 2RN9A 1Y88A 1SETA 5J29A 1H8EG 3K3WA 1FFXA 4YY3O 3ZRVA 5IIIA 2ZCEA 3DSQA 4NXZA 1YDXA 2MRLA 1NQTA 2UUAB 4EB6A 2NO4A 3FB8C 4JI8O 4DV6B 3WB2A 3KD3A 4R63A 2F1IA 1KEJA 5KMGB 2QB0A 4I2EA 1SZTA 4FVMA 2B1GA 1V85A 4Z6CA 3ABKC 3KKYA 4OPAA 1XL6A 1CXZB 4LF7O 3OUFA 3S3XA 1Q5OA 5D46A 4UAVA 2GV9A 2JEIA 3ZJZA 1IXMA 1XQ8A 2PMZC 4HZ3A 5KA5A 4WFHA 4F71A 1RFYA 2VA2A 3OTFA 4Y2YA 3RWRD 4KLTA 9ICWA 1FXKA 2VQEB 3ZHRA 1FEZA 2H3QA 2DYSB 2K89A 1BPBA 1KB9F 2KOBA 1HR0B 1YHQV 4JTDB 2EX3A 4DQSA 2YS8A 2KIWA 2GDSA 4GKKO 4I5SA 2WLLA 4X1KB 1SWWA 1S5LZ 1KDHA 2YSUB 4QPJA 1JR9A 1B43A 3DC5A 1HNWB 3JPSA 2C2RA 1JX4A 1LKYB 1NS1A 5AK3A 1XS9D 1O08A 2I6XA 1XMQO 3G6YA 4NWIA 4DFDA 1ZQXA 2E8NA 4GLXA 2YIAA 4J9YB 4LC1A 4WFAV 4DV1B 5J2IA 1XNRB 1V55B 3ETEA 4O5CA 1L7MA 9ICQA 3AG2B 2RQ5A 3BJYA 9ICFA 4NJ8A 2R9AA 5HFLA 4LF8O 3LSSA 5DG8A 4LF9O 1KW4A 5TISZ 2BE3A 3CW2C 1ECWA 3HJEA 5AI9A 5B5EU 1C7YA 2GWSA 8ICHA 3STZC 5K1XA 1IBMO 5J2KA 4WFBV 3QU9A 7ICPA 4Z6DA 4DR2O 1NTZH 1NVPB 3V72A 4C4RA 2ASLA 1I08A 4JUZA 2IOHA 3EYZA 3K5OA 4CS3A 3RYHA 1WN7A 3LVWA 2NRXA 4NM2A 1ZRNA 7ICGA 4O4LB 2AZ2A 1ZQSA 2IM9A 2YC0A 3MBYA 4RNNA 5GW7A 3SYQA 1L7NA 7ICTA 3HKEA 4UXNA 1M90W 2QARA 4FLXA 5BOMA 4DR6B 4TURA 2IMWP 1XMQB 3WKDA 5ALYA 3H8WA 2FKXA 1KFSA 3H0LB 2QKSA 5J9PC 3JPOA 1YTFD 5J0UA 1RSOA 3HKBA 2D2CB 1J95A 5EWEA 3F2CA 3E22A 3ASNC 3C29A 1Q8KA 4ED6A 3OTOB 4DWIA 1SV4A 2A06H 4DQRA 1V54C 5DB8A 2JGDB 2Y69C 5CN0A 3WKEA 3K03A 4UQGA 4JYAO 1RG6A 2VWKA 2ZE7A 1RYRA 4X1IA 4WBNB 3PW2A 3C90A 3B4SA 1BPEA 1PK1A 3SPHA 4DW0A 2NLJC 3JCUZ 5LMNO 4UBCA 1I94B 4ASUG 1COKA 2Y0PA 2KSOA 3ETLA 5CRXA 4NXMO 5AK5A 2HKOA 3K4GA 4KHPB 4YD2A 4FIPC 4D7SA 3G6XA 5KFTA 2VS0A 4EBEA 4JZGA 2LI6A 4HAIA 1NKEA 3UQ0A 3NVZA 3IC7A 5D5QA 2A3QA 4W4KA 3B8NA 5AI5A 4DV7B 4DR7O 2UXCB 1X66A 3IP4B 4ECZA 3OE7G 4P2HA 2PMZF 5DBAA 5KMGA 2P4KA 3BA9A 1B22A 3CB2A 1J2NA 2HVHA 4Y2JA 3T3FA 3LK9A 3CC2V 2P06A 1BVSA 4LF5B 2LYBA 8ICPA 8ICSA 1GK9A 1Q7YW 2HMXA 3AG3B 4KLEA 2GUZA 2R8JA 2H3FA 4F2RA 3SJQC 4F4XA 2N1RA 3BA8A 4KFMA 2BCQA 2HHVA 4JB3A 2ODMA 4OJLA 3OJUA 2XCPA 3ALRA 5AKGA 1MZEA 2F1MA 2PF4E 3JAKB 3QO7A 5ALEA 1BE3H 3ZN0A 4FM1A 5DKWA 2QWRB 2JH7A 3WK4A 5B1AB 3SZ2A 1SV0A 2F4VB 1G6UA 1NR7A 4UCOA 4X1KA 5KFPA 1Z00A 5KG0A 3PR5B 4CH5A 4K4HA 5BPCA 4DR7B 4AYBF 5DGBA 2HHQA 1KQQA 4PDRA 1LKYA 1TAEA 4ZOLA 2HBKA 1O9GA 3ZMZA 1NZ6A 3ZRWA 5AKIA 1QSLA 9ICCA 3BAAA 1NNLA 3M99B 2LP7A 3L71H 4O5EA 4QZBA 2BQUA 2CH7B 3MDCA 2WLKA 4YMOA 1SL2A 1JMKC 2Q73A 2XOKG 1YSCA 4X9QA 3WU2Z 4Q8EA 1B0XA 4F92B 5E79Z 4DUYB 5J8YC 4ECTA 4JI0O 5BMVB 3SV3A 1SKVA 4JI5O 2FJ6A 3PW0A 4F4KA 2BOCC 5LXTA 1P84F 5DB6A 3JALB 2OIEA 4UB6Z 2EILB 3CRQA 1K5QA 2KHVA 4ECUA 1ZQPA 1E79G 4EFBA 3FB6C 4JTCB 3TADC 1L0LH 4O4LA 4RQ5A 1DF4A 3H8JA 4D7TA 1SZHA 4NV0A 2BZFA 5L9XA 1Q6HA 2YMMA 3SENA 4XDJA 3SYPA 1WPXA 1FJGB 2EZXA 1AR5A 5FP0A 5AKLA 3F5WC 2YUAA 4TV9A 3OEHG 4EBDA 8ICVA 1T7PA 1Y67A 3AK3A 2HJFC 4N23A 1BQ0A 5L3DA 2ISOA 4B3RO 4JI0B 1NKDA 4ZI7B 5JCOA 1XBLA 3OGIB 1D5AA 1L3VA 4B9TA 3PMLA 4BWMA 4WBNA 5EYPB 4OJOA 1TVAA 1ZQFA 4YMNA 4O3PA 2PI5A 2OWOA 4RQMA 3UPQA 2ZT9B 3NXSA 1ZETA 1FFVA 1ZQHA 3U10A 4DV3O 2E3TA 8ICAA 1VQMV 1SB3C 3L9DA 4MS2A 1IZ3A 5CEHA 2ZIMA 1LB2B 4UV8A 4G2KA 4PJ0Z 1D9DA 1O9HA 1N4CA 1G4YB 5JWPA 3ZDDA 1YXBA 2VA8A 3TI0A 4JAUA 1U9LA 2H3IA 8ICFA 3HKCB 2YB4A 1G8MA 4B3RB 4LFCO 8ICNA 2ZIVB 4J9NA 5KAIU 4DSLA 1IXBA 4ECXA 5ALFA 4PA3A 2E5LO 3LYSA 2V7QG 2LYAA 3M6ZA 1M57C 4J7KA 5J2DA 4F6RB 1J97A 5KHKA 3WG7B 4MVRA 4EKWA 5HHHA 1ZYQA 2WA4A 4QZ9A 3JAKA 1AVMA 5CMUA 4DV3B 1TFRA 3AL0B 3CWBH 4OJ6A 5KFIA 5IIKA 4ECRA 3SPCA 5E79U 1K3EA 2CTPA 4I2HA 3WB0A 4Q44A 2AQ0A 4KLHA 3N2KA 1QU7A 4X20B 3D2SA 1TA8A 3SMVA 5J0TA 2EIJC 3D2QA 2XAGA 3H1HH 4YR0A 1HIWA 2K8AA 2O57A 3ZD8A 4O4IB 3WB1A 1KN5A 2EIMB 3TKAA 2DN9A 4KUMA 1ZQDA 1SL1A 3M1YA 5J2JA 2L35A 2QM8A 4XA5A 3BEHA 3OAAG 3C5GA 4MHVA 1FFUA 2AQ4A 5HMLA 3RYFA 1N34B 5F2VO 4QGPA 3QO8A 2KKWA 5CJ7A 3QU2A 3QG5A 3M9NB 5BMVA 2HVIA 3RJEA 2AZ0A 3ZMVA 3AK1A 4IL6U 3M7DA 3UMCA 4UCUA 2ZM6O 1BNOA 3RT3C 3PW7A 5LYJA 7ICEA 3SYCA 1IBKB 4J9KA 3HKDA 3H8SA 1KSPA 2LKYA 5ALPA 2EINB 1SQGA 2FMLA 5H5NA 3VBBA 4R65A 3QZ7A 4LJXA 4FK5C 2NV3A 2F2AB 2LW7A 4QE9A 3IGAC 5J0PA 4X1YB 2NYVA 2F23A 4DL5A 2IH1C 4M2YA 5CA1A 2BDUA 2DW4A 4C8LA 1L6NA 1BPXA 3CEIA 3R65A 1NK4A 1EM1A 3IG5A 3C1ZA 5CBHA 2Q6AA 3QXGA 4UAYA 4O5KA 2ILMA 5KL1B 2GTSA 2PUSA 2EZPA 5J2EA 9ICUA 4QIWC 4ZI7A 7ICSA 1IV8A 2DF4B 4F93B 4JF3A 2XUMA 3CJHA 4RQ4A 4M9JA 2CGNA 5DECA 1ZQBA 2QWPB 2WAMA 1ZTEA 3JARB 1SWVA 1R73A 2LJ2A 3MDSA 3AU6A 4I55A 3O9OA 4KN4A 4EYIB 1EN4A 4MVSA 1XMOO 1RM6C 4K8XA 2Y9TA 2R8KA 1ZD5A 3CRMA 4DQIA 3I76A 1N60A 3CE2A 2IBKA 3QU7A 3M8RA 3ABMC 1VQNV 5KHHA 3HKCA 1VQOV 9ICNA 4O3RA 3RB0A 4YXMA 2HBJA 4IR1A 3TJTA 2F8LA 5AHXA 4ICGA 2V4DA 1H2KA 4IYHA 4UB8U 1T8EA 3BQ2A 2WLMA 5FL7G 1HEKA 5KFGA 4GKJB 3GQCA 1WPBA 3A0BU 3ZN1A 3IN5A 2A7WA 3T5KA 3C28A 5ITZB 1VQ4V 1FKAO 1AI6A 2ZUDA 3G80A 1Z3EB 4RUFA 3CHXA 3ZHTA 3RH5A 1Y4MA 1AQ6A 4J9SA 1WJZA 3ABTA 2D3DA 4U7CA 4TUPA 3AG1B 3VQYA 4X64O 4DUZB 4DOAA 1Q8IA 2QWQB 4OX9O 9ICVA 2DFLA 4LF6B 1YJ9V 2IOFA 3V7JA 4X20A 1QCEA 2JEJA 3FX7A 2IHNA 4F4LA 2I5HA 4DQPA 4FZ0A 4O4IA 4C7ZA 5B3SB 2Y4TA 3ZDCA 1JI7A 5BR8O 3HR0A 2MU2A 5EC1C 1X59A 4DV5B 3DEEA 3BABA 4NL9C 2F95B 3K59A 2O6KA 2EIKC 4X8AA 1QVGU 1WLEA 3K0DA 3KKAA 4W4LA 1JIHA 2AH5A 1I0HA 3CD6V 3E0FA 4EZ6A 2R8GA 4GX1A 5KFLA 2KG7B 2JH1A 5KT5A 3M9OB 3CP1A 3GV7B 4JWNA 4NLCA 1X9XA 2F77X 2F43G 1F5SA 3PSIA 3PX4A 3UO2A 1S72V 2UU9B 3ZEDA 2XI9A 3LDEA 2W7PA 1GH6A 3RYCB 2ARHA 3CCQV 3QUTA 4UCVA 2A79B 1O03A 1FXVA 3NVYA 4O2AB 1NVPD 2Q67A 1JFFA 1XNQB 3OW2U 5JTIA 1VQPV 4ZHQB 4PHDA 3H40A 4H33A 4AQYB 4KLIA 3THVA 1TUBB 2Q5ZA 3TQ1A 1VIBA 4IIJB 4IYIA 5BR8B 4WCEV 4PGYA 5ALNA 1YF2A 4Z2WA 2BCRA 2R9IA 2OCEA 4FZNA 2YMLA 3Q8PB 3DGEA 5KFOA 5KT3A 1E1QG 4PDMA 3EFFK 3Q8KA 4HNAB 4RQ1A 4TUYB 1AB3A 4A5UB 4KLJA 1Z4OA 2AW9A 4CC5A 4PH5A 2RJZA 5JU5A 2ZE5A 2VA3A 4ECQA 2Y48A 2WF6A 4DW1A 3T5JA 1V38A 1S3JA 3H8MA 1D9FA 4RUEA 3KG2A 4Y2SA 1BSMA 3JARA 4G28B 1BPDA 5AKHA 3WKCA 2A1JA 2IW5A 2Q7GA 3RBDA 3T4DA 3OSPA 2HHUA 2JMGA 4KLUA 1KYOF 2CN1A 3IHQB 1ZLZA 3APOA 4C8NA 3CSXA 4F8RA 2DGZA 4NXNB 2X6AA 2PFOA 1LUVA 2ETNA 5ALQA 5EZYB 5L3FA 5KFNA 2JEXA 2AXTZ 4JYBA 4NYKA 2Z7JA 1ZQJA 1ZQTA 4DOCA 4ED7A 2P22C 1N33O 2UUCO 2ODGA 4R7CA 1QQ6A 4K8ZA 1KUQA 1U96A 3BZKA 2MSNA 5A9GA 2XY5A 3SR2C 4ED1A 2DQ0A 1FXKC 3ONNA 2DWQA 3HW8A 5KG6A 1OCCB 1VQ8V 3G6BA 4U6PA 3U11A 3QUCA 5AKYA 3JSLA 4UASA 3MR3A 2R72A 2ZE6A 2YXYA 1WWVA 4JV5O 4P2ZA 1XI1A 1VF6A 4DL2A 5KG3A 2CK3G 4RQEA 3GVMA 1GN6A 1ZQQA 5J2BA 1SGGA 1VQ5V 2RDCA 2RRDA 1OXJA 3CYMA 2B6GA 2VJ5A 4DFKA 5LGNA 3N7RC 4TQDA 2WPDG 3CCVV 1TAQA 1WG8A 3H0MB 3B77A 5GTIU 2UXDO 5DGAA 4PI0A 1AI5A 3T5LA 2BTQB 5J2HA 1XL4A 4JAVA 4JI1B 1L8OA 1QCKA 2XHBA 3H4DA 4F5QA 3H0RB 4FM0A 4J41A 3WKAA 4R66A 3APQA 3S6JA 2FMPA 4FZ1A 1N0NA 4DK1A 5AG2A 4ZIBA 2P67A 2YX8A 4BR6A 2XY6A 2QR4A 2HHHO 1GMGA 1SZXA 3V7LA 2IH3C 3CRRA 3X2QC 4IRDA 5KFVA 3TAPA 2F44A 3STLC 2WHEA 3RB4A 3ZHUA 5KHJA 5H9CA 5DLGA 2QKAA 3RYCA 4KITB 4RQ0A 1SS3A 2MW2B 1TK8A 3S3WA 2HEPA 3AM9A 2W03A 2P4VA 4O3OA 5KFSA 3RAQA 1PNMA 1N0JA 1PNKA 4ZHQA 4ECYA 3B9JA 5KFKA 1US6A 1CPYA 1PVPA 4K35A 1TUBA 1RQLA 3SAGA 5KHGA 3TCUA 2Y0SF 2CTWA 1VQ6V 5DDYA 2AU0A 1TK0A 1BCCH 4GXJA 4FBUA 2QM7A 1AJPA 2MUTA 1OJHA 3E35A 1PL4A 2X0LA 2R9RB 3AQFA 3EZ5A 2AGPA 4HNAA 5KNIA 4NR1A 3PN1A 1UQVA 2DQNB 1RYUA 1JVMA 4LNUB 2AXTU 4FLZA 4DFMA 4Y2RA 2EAOA 2JS3A 1MG1A 2ZXWB 4UV9A 2KICA 4FZMA 4EZ9A 4FLUA 4Z6FA 5DB9A 1GM7A 2PZSA 3FB5C 1XNSA 2IOFK 2NRWA 5DQIA 4QWAA 2QDOA 2W54A 1QH9A 1X6JA 5AI0A 5IILA 7ICVA 1HWYA 2Q4PA 2YXHA 1NZBA 4K4GA 2X7RB 4E0DA 2UUAO 3H1LH 2JZBB 5B5EZ 4DV6O 2P6JA 9ICRA 4UBBA 1MZFA 5EZYA 4DXWA 4X89A 1WP8A 4GYCB 1S76D 8ICRA 2PFPA 1L5UA 1MQ3A 3PY8A 4NVPA 3BVOA 3LDDA 1R6TA 4AI8A 2LW1A 4LH7A 5ALTA 4X66B 1VQ9V 4F6EA 1BZKA 1K5SA 2OCCB 2W9CA 1SXDA 2WF7A 4QW9A 1OCRB 3CYOA 4UB5A 1K1SA 4K4IA 1SXEA 2W9BA 3E2EA 4LH6A 4QZHA 2ZR3A 4KP4A 1ZQOA 2JR5A 5L1KA 2VQEO 4PI2A 1NK8A 1SV0C 3HPOA 3LSQA 2Q9LA 4J9ZB 5KAFZ 4XQ8A 4RPXA 3LWLA 1W0KG 2ZG6A 3J81j 1HR0O 3RB6A 4GIBA 4PZNA 4HYKA 3ZCCA 3EVKA 5IJ0B 4C4TA 1GM8A 1TK5A 5AI8A 2HVJC 3UXNA 2YQEA 2QGNA 1U45A 1HNWO 4IQWA 2LPEA 2ZIWA 1HUOA 3AG2C 1N48A 3PX6A 8ICIA 1K33A 4WFFA 1H2GA 3FB7C 1OV9A 3JASA 3G4SV 4DV1O 1AR4A 5KFYA 1XNRO 4DL6A 2VANA 2KN7A 1H2LA 2NRVA 4RT2A 4JYYA 4DFJA 5DB7A 4QJFB 2HJDA 3H4BA 1JALA 2KMDA 3FDSA 2W11A 4B9UA 2KNJA 4UCSA 8ICGA 2ZXHA 3MHSC 4PDLA 4D6TH 3A0RA 1N61A 2VWJA 1DXSA 3VC8A 5DBBA 5KL8B 1XDCA 2BR0A 4R8UB 4IR9A 4DR6O 4J9OA 3K1ZA 2HOIA 1HNXB 3MDAA 1ZXIA 1SL0A 5JJJB 3UXPA 2YN4A 4PPXA 4CH3A 3BS5A 4AYBC 1AI7A 1KBHA 1SQBH 3HT3A 4TQRA 1RPRA 2J6SA 2BSKB 2JGUA 5JCOC 9ICSA 3JAWA 8ICCA 3CXCU 2V1DA 1WP7A 9ICHA 1Z4NA 2RP5A 4I50B 3OTOO 3SDLA 4UB4A 5FLXN 2ZTCA 4DR4B 5C8YB 3SD7A 2PFNA 1HP8A 1J2MA 5DQGA 3K04A 2ZUCA 1XC9A 2B1IA 1QLEB 1R6KA 1PZNA 2GH1A 3E8BA 1I94O 2ADPA 2Z3YA 4OPHA 2B0CA 3W7SA 5CWRA 4Q6GA 4KHPO 1IDSA 2ZNJA 3RFAA 4R50A 4X65B 5CA7A 3IJ4A 4NLZA 3OGCC 4RNMA 4XDLA 1PNLA 3NGDA 4J9RA 2JZBA 4B9SA 3K5NA 3Q8RB 4DV4B 3E58A 5KAFU 1XSLA 4MFCA 4B3SO 2UXCO 4ED3A 1AROP 3CCRV 2ZIXB 1EFRG 4DV7O 1NH2D 2LM4A 2EANA 3M6KA 3AG3C 1X9WA 4CE6A 1KP2A 2HOQA 4QZAA 2JDIG 4LF5O 5D49A 2HR3A 4NB5A 5J2UB 5LGTA 2ASDA 3F7VC 4MVUA 1CEZA 1N36B 2ZIUB 3FAVB 4O4HB 2OYQA 1J5EB 3CPWU 3LSUA 3QNMA 2H3OA 2KK0A 2XY7A 3C2KA 4UB2A 1H2NA 2KEYA 3TETA 1OZ0A 5CBFA 5LA6B 5CP2A 1Y6XA 1K9MW 2F4VO 2HP8A 3TGUH 2WF8A 3UQ2A 1MA1A 2E5SA 4B3SB 1K7DA 3D2NA 5LMUB 5ALSA 4GX5A 1XU4A 1G1XB 1RXVA 1RPOA 1JXLA 3J7AU 3ZDEA 3NRWA 2XVTA 2N05A 1MN8A 4BX9C 4US8A 3PVXA 2RHFA 2KV2A 2ZJAA 5J0RA 4UUJC 1L3SA 4KMOB 4CF5A 2BGWA 1GN3A 2CE4A 4DUYO 1PUZA 5B1BC 1SQXH 3C23A 8ICYA 2ZIOA 5EBMC 4X62B 1GO3F 4J03A 1JCHA 4DSIA 1A76A 2BPGA 2KTQA 2R8IA 2W7OA 3TANA 7ICOA 1Q6UA 2BHNA 1QQ7A 4J9MA 1NZPA 3WK9A 2AJQA 5KAIZ 1T3NA 2VQFB 3ASNB 2ITDC 1NJXA 1S0VA 4PD4F 4PA6A 1FJGO 4JV0A 2Y69B 4RT3A 2G09A 3NRZA 5EWFA 2R70A 5HFMA 1KP3A 2JGAA 3B40A 2LMRA 2UVUA 3BZCA 1DK2A 2FMSA 4I50A 4MTFA 3SAFA 4PELA 3UKMA 4ABMA 2XGPA 3T5HA 1M56B 2B5UA 5DN6G 5J0SA 2K1EA 3TK1A 5DG7A 2RDIA 2DYRB 3GIIA 3QEBZ 2G07A 4F5PA 5D5PA 3HP6A 5GONB 5LOVB 1QR9A 2YTUA 2GLEA 2FPLA 3O0FA 4LFBB 2EDUA 4B08A 4UATA 1S77D 1KC8W 1WNSA 2NR5A 1QVFU 1N56A 1D2DA 5KFHA 2ZQMA 4K0KB 4P0PB 4NY8A 1BPZA 3B0XA 3D3QA 5A0LA 1HNZB 1Q3VA 3EPGA 4IL6Z 2ZKOA 2C22A 1S9FA 5AM2A 1VF5B 2W55A 2Q0ZX 1PKXA 1MNGA 3LDCA 2BPFA 3AUOA 4G27B 4DV0B 1R1BA 2JGDA 1S97A 1HDJA 4JMUA 3WG7C 3W7TA 3JYCA 1OCZB 4EFEA 3ASOB 5HR6A 4RUCA 2IU0A 3HRDD 2CGOA 2H8PC 3QF7A 1ZQEA 2XGQA 2YEVB 2FI1A 3CXHF 4XBFA 1YJWV 4IHJB 3M9MB 3DXRB 4EX7A 2KD1A 2BCSA 4YR3A 2ASJA 4MF2A 4F4WA 5LA6A 4E4EA 5H6QA 3AEVA 2EIMC 3OR6C 4DRXB 3T79A 3BPZA 2KHQA 3V7KA 1JPXA 1X6IA 4DL7A 3CRXA 4YMMA 1KKCA 2PKEA 2EQYA 3KKAC 1FO4A 7ICUA 5DQHA 5DG9A 3WK8A 3N27A 1P4RA 5L3EA 4HYOA 3M8SA 1EN5A 3CRCA 2AGAA 1N34O 2QSAA 1W59A 2A9HA 4ECSA 4DEZA 2G38A 4YFKA 1S5HC 1AILA 5IIJA 4OO1J 4TV8B 1B04A 5ALWA 2XC9A 5KX5B 5J2AA 1M9NA 1QSYA 3OT7A 3ZMTA 5JH7B 1IBKO 1L3UA 4GX0A 2LO1A 3NS1A 4UW9A 2KVCA 4JASA 4CGZA 5CA3A 1RXWA 4UB8Z 4JI7O 3ZDAA 2QE7G 3LUTB 4B9MA 1LV5A 3K08A 2MA1A 3QX7A 7ICMA 2ISPA 1NK5A 3A0BZ 4GZRB 3ISDA 3ETDA 1URJA 3UMBA 1V9PA 3QUBA 3C1YA 1D5NA 4JI3B 3SPJA 1YI2V 3CNHA 4CCHA 2CH7A 2UVWA 4N21A 2DPIA 1NTKH 3ZRXA 4I2JA 3D36A 3QVNA 2GTAA 3Q4HB 2Y9UA 2IU3A 4QNLA 1RM1C 4E2LA 3JALA 4QZEA 2PY5A 3F5AA 4QWBA 2E1EA 4C8OA 1NTMH 3H9VA 2OH2A 3BRCA 2Q0OC 1B06A 5ALLA 4NTWA 4WFEA 3RF9A 1YCIA 3UM7A 2HSZA 3K75D 2Y0IA 4I2IA 2CRXA 3OTQA 5LOVA 3ZMSA 4JI7B 3UM9A 3LDAA 1TE2A 3QUQA 2E8OA 2WLJA 3GWKC 2W0FC 3UQ8A 4PA4A 4GX2A 4DYLA 4FLYA 1H2MA 1N8RW 4P0PA 3ETQA 3TAQA 5DBCA 1F44A 5KFAA 1OCOC 2CTQA 2EH9A 4ECVA 2E75B 3RBEA 3SEIA 1ZQAA 2I9GA 3RW0A 1VJ5A 4MTOA 1N62A 3RR8A 4O9MA 3RJKA 2Q68A 3RYIB 4DQQA 2W3RA 1SKSA 3WK6A 4I2CA 1DOQA 4NLBA 1VF6C 3D3IA 8ICBA 4GKJO 2KZMA 5AICA 2EJRA 5IWAB 1BNPA 4RWUA 5EYPA 1IURA 1Y76B 2FB5A 2JEUA 3ZS8C 1R3LC 4MVZA 4RQ2A 1GAXA 4DO9A 2RLTA 1NBMG 2EIJB 1QLNA 3AG1C 2YEVA 2LGQA 3L70H 4GCZA 5K1PA 3A0HU 3DXRA 4X88A 1PD3A 3AG7A 4FS1A 1LVHA 1NH2B 1K73W 1F7YA 2JRZA 1M93A 1ZD4A 4DUZO 1U97A 4UB3A 2X6CA 4JI4B 3U26A 4US9A 5B3SC 4LF6O 5LHGA 4EBCA 1P7DA 2QJ1A 2FE9A 2W9MA 4JV2A 4U7OA 3K5MA 2W43A 4PL1A 4JK1A 3GZFA 4DV5O 2ZIVA 1SKWA 5CB4B 3GU3A 1Z5WA 4MW8A 2IJHA 2WLIB 4YJ2B 2JK5C 2ZD9A 4F6RA 3J81N 1FS0G 2CUGA 5KFXA 2YIBD 1K1QA 2F76X 1GKFA 1VDVA 5B1NA 2WLNA 3N2GB 1QTMA 2K4IA 2JV3A 1IIPA 3VOUA 1K92A 4JTAB 2UU9O 4MEYA 4MFAA 2UXXA 2JJ2G 5JH7A 5EOZA 1CI4A 3V6HA 1BT8A 1NU1H 3MR2A 1BGXT 3K79A 3T2MA 4F3OA 1ROPA 1XNQO 2ZTDA 5IDJA 4B7EA 3NASA 4ZOHC 4CF4A 1FPOA 2KG5A 4PGXA 3LNNA 4KTQA 3RRGA 4AQYO 1IBLB 4CH6A 3F5EA 5K4LA 5F9NA 1KD1W 5HNKA 2Q4TA 4YJ3B 4O0IA 3OSNA 1NJZA 1ZRMA 3OUSA 5IJ9B 2OYYA 7ICRA 4IGGA 2CPRA 3GIKA 2EBOA 3VCBA 1N32B 4IT5A 2R18A 7ICQA 2ZE8A 4F2SA 3K0GA 4R6ZA 1N63A 1ZQ1C 2KJ8A 1XO0A 5IY5B 3C21A 1U4BA 5EIBD 1PP9H 1FIQA 1OW5A 5GTIZ 2OCHA 2WWWA 3ZRSA 5AKEA 1SKRA 4C7YA 5B66U 3M7MX 3L74H 1UA1A 5GTHZ 5J2TB 3EHBB 4FE3A 2PXIA 3FKSG 4CF3A 4UB1A 3BQ1A 2OM6A 2RDJA 3ABMB 2QM4A 3D8CA 2J6UA 3WKBA 8ICEA 1THZA 4DLGA 2OT5A 4X1YA 4AHCA 5JJEB 2W6JG 3RFRA 5LHHA 1DK1A 2IHMA 2EZYA 2BQRA 3H1IH 5J2FA 5HHIA 2YDEA 1IXRA 3MR6A 3LNMB 3CMAV 4NXNO 3GIMA 4YD1A 5AM4A 1LNQA 4XRHA 4DR5B 1OCCC 3PSPA 3BY6A 1T94A 3AG4B 2OHFA 2Y0SC 2HG5C 2XASA 1ZAUA 4JPRA 2JIZG 3C2MA 4DSFA 4M0AA 1AP5A 3RAXA 1Z5VA 3GB7C 4XDKA 1P7BA 1Q81W 2RQ6A 4UARA 3PR4A 3IC9A 2UUBO 1NK7A 2E1FA 3JPPA 1NKCA 2QTOA 2IJJA 5ALIA 2W8LA 3NTUA 1T5EA 2G5HB 3ISBA 5L3BA 4LFAB 3CCEV 4O4JB 3BFRA 4FLWA 2HVKC 2DJVA 4B9NA 4RU9A 2P7TC 4RNOA 1S10A 2JEGA 1W0JG 4U7NA 5FNVB 4JI1O 1MOFA 2K60A 5KFRA 7ICLA 2E3CA 4QZIA 2P6UA 4QZDA 5G5GA 1AR1B 1F4MA 3H1JH 9ICXA 1F4NA 4DS4A 4FFKA 4MSWC 4BW5A 3AQEA 5AKXA 1XO1A 2F3NA 3KZXA 4Q45A 8ICKA 4KL1A 1U48A 1VMGA 4DSJA 2QKCA 3G67A 1H8HG 2P66A 2UUBB 1VLBA 2IJKA 5ITZA 1EBOA 4IC9A 3N2GA 2F8KA 1A32A 3RR7A 4JV1A 3KZIU 4ED8A 3JD0A 1XREA 4P4PA 2DOSA 1DRGA 2HHWA 1YEWA 1SC5B 4F4YA 3Q8SB 2LYHA 4QWEA 3KFUF 2XAHA 4YHHB 4I29A 5JQGB 3ETRA 1B3QA 4BXOB 1L3TA 4KLFA 3QTCA 4C80A 4ECWA 4GC7A 2YMQA 5GTHU 1EZJA 1RYSA 5ALMA 1XUQA 2HFEC 1GN2A 3RN4A 2LM1A 3J80N 1FYJA 5EWGA 4G3IA 3JPNA 5IJ9A 3JD1A 2XO7A 4RQFA 4KN7A 5LGUA 3KCYA 2F93B 3RRHA 2A19A 4QZCA 2UVVA 1UPHA 5L1LA 4M9LA 2KG7A 5IIMA 4JI6B 2EAPA 5EE1A 3UT5B 4QWCA 1VQLV 4GC6A 4J7JA 2AGQA 2XNDG 4F5NA 2YMPA 1MSWD 1NKBA 4ELUA 5IYDO 4DCCA 1WCNA 2W9AA 1M6YA 2WF5A 3OPXA 1LR1A 4MTXA 9ICGA 3JSNA 4O2AA 1SF9A 2DQ3A 3JD3A 2ITCC 4YVZA 5DDMA 9ICAA 3OM3B 4P9PA 3BQTA 3W7XA 2HBMA 5KG5A 1TKDA 3ZBHA 1V97A 4IIJA 3OHBA 1Y66A 4C8KA 1TGOA 3OFNG 2UXBB 2XAFA 1XOUA 3E86A 4P30A 1YITV 1Q3UA 4YXWG 2ESEA 3KBBA 1OCRC 4IRCA 4EEKA 1NK6A 4TUYA 2C2AA 2EZOA 5BOLA 1ZQCA 1NJWA 1COOA 2DWDC 4X66O 5IT9N 2DKZA 2HHTA 4R8CA 4B3TB 1MSDA 1VEWA 4BDPA 2ZJ5A 2V9WA 3PW5A 4PHZA 3SJAC 4NLNA 1KQSU 3SYAA 1K34A 5KG2A 2OTLV 4H13B 2Y1IA 5DLFA 1IVSA 1BGYH 3EUB2 8ICUA 3CX5F 3TFRA 2H94A 2WAQC 4GUNA 3JD2A 1PVQA 1MA7A 1KECA 1Z19A 4FLVA 1PVRA 5FNVA 4KLSA 4YIPA 3MC1A 4DK0A 3V6JA 3RJGA 3RYHB 4J7ZA 2LBOA 4KLMA 3JPRA 7ICHA 4ELVA 2KB1A 3FD9A 5FPOA 2OTJV 3HX0A 1F23A 3I1YA 2DYSC 1X2IA 2M7WA 4EYHB 4KMUA 1Q86W 3HKEB 3L72H 2G0AA 5AM0A 2QLTA 8ICWA 4O2BB 1XHXA 2ZR2A 1VQKV 1DTOA 3N97B 3DTUB 3IRUA 9ICKA 4UFZA 4UVAA 4LVSA 4NLKA 2OEHA 4QE7A 4RPZA 1ZQMA 4IQUA 5CA0B 1RSOB 3HKBB 5EBWC 2W04A 3ABLB 4J9QA 1HUZA 1R3JC 4I4TB 9ICBA 3OMNB 5IYZB 1WB7A 4NM1A 2Z5UA 2K4HA 3VQWA 3JPTA 4LF4B 4I2AA 1QQ5A 2ZUBA 1V55C 2ATKC 3JCZA 2BTQA 1ZQGA 5ALVA 1HNXO 1PV0A 4TSFG 4X1IB 4RQ7A 4M04A 5HMMA 3L75H 2XTAA 5LP6B 1PK1B 2XICA 3IDWA 3QU4A 3KCXA 5KG7A 1WAZA 1SQPH 3TFSA 2D3OW 5EBLC 4CDGA 2KSOB 3EXAA 4AILC 2ATLA 3PV8A 1ZQZA 4J10A 1YJNV 2XAJA 5J0WA 4QWDA 2LGWA 3SPGA 3UT5A 5LL6Y 4LR3A 4B3MB 1QLEC 2EULA 3PJSK 4P0QB 3HKZF 4LWSB 4DR4O 1B4FA 1VF7A 5LBQA 2KSDA 1N2XA 5IINA 2W8KA 1L8LA 2MK3A 4FZLA 2Q7EA 3KTQA 4LZDA 2JRIA 1Q46A 3H01A 4Z6EA 1PPJH 4CRXA 4DR1B 8ICLA 1UPGA 1U47A 5ALJA 3GV5B 3SPIA 4X65O 2GUZB 1L7PA 3NUQA 3C2LA 3OD4A 3B0YA 4DV4O 1UJWB 3F2DA 1ENVA 1OUQA 5EK0A 1D8YA 3KHHA 3FAHA 4YY3B 5J0YA 3THOA 2X6BA 4PZOA 7ICNA 1AJQA 4J80A 3OJSA 1VP7A 4JI8B 4F50A 2H5XA 1Z00B 3GFKB 1DLBA 4TQFA 2K8CB 4LNUA 5CHGA 4I0XB 1A0PA 5A2QN 1OHHG 1ZQRA 2NN4A 3GILA 4ZOLB 1JA8A 1N36O 3SAHA 2RCVA 3ZRWB 1J5EO 4IRKA 4LF7B 2K4PA 2WAQF 2J6TA 3KHGA 4P9OA 4DL3A 3RJIA 3OEEG 2V4RA 4F5RA 3ABKB 2L6LA 5L1IA 1ZX3A 4Z1MG 2DKXA 3T1YO 1HJPA 5ALDA 2FMQA 3NVVA 1BMFG 2FLNA 4QZGA 1NK9A 1I5XA 5BZBA 5LMUO 5LXTB 3SI8A 4P4OA 1A6SA 1H38A 4OJ5A 2FDRA 4GKKB 5FPRA 3RJJA 3K57A 2AGOA 1R6NA 4H37A 3CCLV 1NOMA 1W2BU 3CRAA 4O2BA 3WFVA 1TAMA 3A8TA 4CS2A 3G6VA 5B1AC 1I5YA 1QNMA 3SV4A 1TAUA 1R3KC 4TV9B 4IS7A 5AI4A 4FBTA 1Q6IA 5CA0A 4X62O 4LF8B 4L87A 5DM6V 4FLTA 3B8MA 3T1YB 4LF9B 3RGBA 3ICXA 4I4TA 5IJ0A 3O65A 3MHHC 5IYZA 2BCVA 2ES6A 2G08A 1IBMB 1ZQWA 2FLPA 3I28A 5ALOA 4DR2B 1C20A 2VQFO 1XSPA 3AU2A 1UA0A 3UO3A 1NJIW 3JAMN 3AMZA 3RVZA 5CR0A 4TT3G 5LP6A 2Q0AA 4KLOA 1JOYA 4M47A 2YIBA 3D36C 1X4TA 2KKVA 2HLDG 3JATB 4C0ZA 4MW3A 5KFJA 1AI4A 1M56C 2NRTA 1K4CC 2UXNA 2ZDIA 2PGGA 2KJ5A 3T1HO 3IG8A 4USAA 2EILC 3KOOA 5ALKA 2DYRC 1COWG 4P0QA 1M5IA 4LWSA 1ZD3A 2VJ4A 1TUEB 1E1RG 4O3NA 2GHYA 2YIDA 5T14A 4FFBB 1JX9A 3DC6A 3GIJA 1S5LU 4NLGA 3PW4A 4R8UA 3GWOA 4LFBO 4JYAB 5ALXA 4YG2A 3RVYA 1CRXA 2IJIA 4FM2A 1V54B 3SJBC 5LMNB 1BPYA 4C4SA 4K0KO 1KRPA 1HNZO 5ALHA 1WUDA 1XSNA 2BSKA 2Y1JA 2CDYA 4NXMB 4ACOA 2HOFA 3PZPA 5JVDB 2QEXV 5AKJA 1OCZC 5KA6A 5TISU 3T1HB 2NNUA 3KHLA 2KFNA 1EZVH 4OD0A 3ASOC 4DV0O 4F4ZA 3E8FA 1ZJNA 3N2KB 3PSTA 1K8AW 1QR8A 5C8YA 1YT3A 4I0XA 2QTSA 1K4DC 5L3CA 3CP8A 4Y2VA 4NTXA 2LFRA 1Z2GA 4MTGA 2F1JA 4BJQA 4PV1B 4I2GA 2BPCA 4J9PA 1P7GA 4O3SA 1X42A 4BGDA 3RYFB 4JYCA 2EAMA 3HB3B 2ADQB 1U49A 3OMAB 4YP3A 1FFTB 5JUMA 3MD0A 3QO5A 3CCJV 2PTMA 4M9NA 3ED5A 2ZNIA 1L7OA 3ZHQA 2ZIXA 5C93A 1CP9A 3RH6A 3SYZA 4JAAA 1SERA 1TV9A 3Q8MA 4KLQA 5KT4A 5EC2C 5LYJB 1JROA 3QU5A 4PL2A 5KG4A 3VQVA 3R9KA 3ZI4A 5B1BB 5AM3A 2LQTA 3HKDB 3PO4A 5J2UA 4TWKA 2Q8VA 3K06A 3G6EV 1PM9A 5KFUA 3FYIB 4B6JA 2ZIUA 4YCXA 3FAVA 4O4HA 3N4MB 5AIAA 2KKPA 3ZX6A 5CA1B 3OHAA 4CH4A 2Z0AA 1RQNA 4FFDA 4MF8A 2ALZA 4DFPA 1XILA 2EJ7A 2YICA 2G5IB 2AHOB 4CC6A 4BIUA 3PX0A 3ORYA 4MVMA 2DE0X 3GDXA 3MGIA 2DL0A 4J11A 2XT9A 3RH4A 3H1KH 3QEAZ 2B21A 2P35A 1JRPA 1DF5A 4JI5B 3Q8QB 4DV2O 2IBZH 4UAWA 4RQNA 5BXZA 2DBYA 3ZD9A 5B1OA 5LHIA 2K4EA 1K97A 2WA3A 1ZQIA 5KTQA 3CJHB 3F2BA 2BOBC 4QZFA 4DR3O 2HBLA 3RJFA 4WFGA 3JATA 4JI3O 3MABA 3Q8LA 3A0HZ 3BQ0A 1SRYA 1URFA 4I55B 1X40A 2XCAA 2BTOA 5KFQA 3OR7C 2KJ9A 2C2DA 4UAUA 2HW3A 1F0MA 2QB1A 5TZVA 4RO2A 4P4MA 4NKGB 4Y2XA 1WA8B 2EINC 1ZUQA 3K1RB 4RZRA 5EE9A 2JXJA 1QSSA 1UHUA 4FFBA 3I5DA 4B7KA 1MQ2A 3UXOA 5D4BA 5AKZA 7ICFA 2V4QA 4DV2B 5F9LA 1Z1BA 1ZL8B 3EW9A 5KT7A 4Y2PA 3QZ8A 4L8JA 3DV9A 3SR6A 1VQ7V 2JVDA 2WB1C 2BCCH 4JGSA 4DR3B 1DGSA 4DO2A 1P49A 3U0ZA 9ICPA 1RP3B 3TACB 1M4UA 3RBZA 5JVDA 4Q8FA 3WU2U 2CTRA 3IV6A 4IQTA 5ALZA 3K9AA 4KX3A 1HW7A 3B2EE 3CCMV 2YXLA 2GSMB 2OIGA 4PGQA 4I28A 3WK5A 2RNBA 1XEQA 3RB3A 3L5KA 5AKKA 3MFHA 4UB6U 4JWMA 5IWAO 4HAMA 2C28A 4LFCB 4RUAA 2CAZC 1N5WA 4ICAA 4BWAA 9ICOA 3W7UA 4DSEA 3MGHA 3FC4A 4Y2QA 4YQWA 1AP6A 1XWLA 5GONA 2E5LB 3P3PA 3ABUA 5IYCO 5CB1A 5KFZA 1SA0B 4JI4O 2NO5A 3PMNA 4C8MA 4WF9V 2ZXIA 2FL4A 5AIBA 2QWNB 3TXSA 2VRZA 1M57B 5KT2A 1T3QA 3F5TA 5B66Z 3IFXA 3RJHA 1SQFA 1SQQH 1KKDA 2MAXA 2I1QA 1CUKA 1K5OA 4YR2A 1ZQYA 5ALUA 1NI8A 2FYUH 3PSFA 5KFMA 3L4PA 5J0XA 2GBOA 1JFFB 3CCSV 3HWTA 5AM5A 3PO5A 1GN4A 5AK6A 3K9SA 3MAQA 4M6WB 4JI2O 2KZZA 4UVCA 1ZJMA 3SYOA 5BY1A 4I2DA 4B9VA 5HR7A 4JZ2A 2ZINA 7ICJA 4M9GA 4IHJA 1KKXA 1I7FA 1VARA 1RZTA 2EZZA 2G06A 8ICTA 2WSSG 3CMEV 4HBNA 4DRXA 1AJNA 4PJ0U 1JMSA 5J0OA 2QWOB 1Q90D 1NK0A 1ZQKA 2ZM6B 4PA9A 1TVKB 5J8YA 1KFDA 1IBLO 4DS5A 2PI4A 1LUWA 4K3AA 5KLVH 1RM1B 4DOBA 3WK7A 4CNQA 5IY5C 1NT2B 2YB1A 1JJOA 2A1JB 3K58A 1DGJA 1YTFB 1N32O 2DUYA 2GO7A 3T4ZA 4F72A 3TADA 2BQ3A 9ICLA 3AK2A 3JD4A 4JI2B 2K8BB 9ICTA 2LHTA 8ICMA 4FJCC 1GTOA 4TV8A 4MVQA 4UCTA 1QBZA 5J0QA 1WA8A 2WLHA 5KX5A 4PHPA 4KLDA 3HILA 4FS2A 2W0XA 1ED1A 5KT6A 2WB1F 2F66C 1OCOB 3R66A 1SQVH 1ZL8A 2IA6A 4RAIA 2Q69A 4DF8A 2JS5A 2W3SA 5J2CA 1ORQC 4XUSA 2N04A 3AEIA 5J2GA 1JJ2U 4QNHB 1RDFA 2WTFA 1FXHA 3TARA 1S5JA 5AM1A 1ZSPA 1EXNA 3AG4C 4H44B 4Q43A 2YY6A 4OXSA 3KZIZ 1FAFA 4RQ3A 4DSKA 1GRJA 1XMOB 3H7IA 3ZHVA 4DR5O 1X9MA 2AHYA 3FM9A 5KFDA 5IE9A 3BDPA 3Q4HA 9ICJA 2DMXA 2KQXA 1WYGA 3LWMA 4U3JB 1N5XA 1JUDA 4Z1VA 1UCVA 3C3TA 2FTKA 3BCCH 4BIOA 1BL8A 3L3FX 4FMTA 4GFJA 4PHEA 4UCRA 4DL4A 1S0MA 3B09A 2KFZA 1MC8A 4RPYA 4G9BA 4O3QA 2A1AA 5EE0A 2P90A 5E1AC 3NVWA 4KLGA 4ED0A 2KE7A 4Y2UA 4LFAO 5AK4A 1SA0A 1BQZA 4MVOA 4I9QA 1KLNA 4PHAA 1SIJA 3UCSC 8ICOA 4LP8A 1BHBA 5EE3A 2AHZA 4KX5A 2E8PA 5L1JA 3E8GA 2D6FC 1YZ6A 1EN6A 4X64B 3W7WA 1QHTA 2VKQA 4GXKA 4FPPA 5G5HA 2PYLA 4EEYA 1Q43A 3IAYA 4OX9B 4LCUC 2RMKB 3RYIA 3P30A 4TUSA 5ALRA 8ICQA 1S0OA 4I2FA 2CXYA 5L3GA 2HI0A 8ICZA 3E89A 1S8OA 3E83A 1Y76A 4U3FH 4M6WA 3FYHA 3RTVA 4CZZA 9ICMA 5C0YA 2YI9A 2GOLA 5ALGA 7ICIA 3K5LA 4BW9A 4QIWF 4I27A 3EWAA 4DF4A 4CS4A 2FLLA 3ETGA 2MUTB 4A8EA 3FYEB 5KUMA 4EX6A 5L1MA 5C5JA 2BKEA 4ELTA 5CBGA 1YZ7A 1ZQUA 1BS3A 2KVSA 1GM9A 1YVWA 2EIKB 4X5VA 4YHHO 1XHZA 2QKQA 3CCUV 1KTQA 2JEFA 1IX9A 2KZ3A 4MEXA 5KFEA 4C7UA 2PYJA
chains in the Genus database with same CATH topology
3JCZA 2LKYA 4ZKIA 2EINB 4TSFG 3ASNB 3VBBA 1L1FA 4FK5C 1B6QA 3N7PD 2ITDC 3P32A 2XICA 1S0VA 3F53A 2NV3A 2F2AB 4PA6A 4QE9A 3IGAC 2A3VA 2WLIA 2Y69B 5KUKA 4O3MA 2D3OW 3N7SC 3OMIB 4CDGA 2G09A 2IH1C 5EBLC 2BDUA 2DW4A 1L6NA 1YJNV 5HFMA 1KP3A 3R65A 2JGAA 2XAJA 3IG5A 3SPGA 2M0NA 2LFSA 5CBHA 1QLEC 2Q6AA 3PJSK 4P0QB 3HKZF 4MTFA 3SAFA 4PELA 3UKMA 5KL1B 4WJ3B 5LBQA 1M56B 2B5UA 4Q20A 3T1CA 2EZPA 4QIWC 4GT1A 1F51A 5DN6G 2K1EA 2MK3A 4FZLA 3TK1A 2DF4B 4BIZA 3CC4V 2DYRB 3H01A 4JF3A 2G07A 4CRXA 2WAMA 3SPIA 1QR9A 3NUQA 3O0FA 1R73A 2XIDA 1SESA 1ZWIC 1S77D 1KC8W 1QVFU 3MGVA 1UJWB 4MVSA 3LVVA 3F2DA 1ENVA 1OUQA 5EK0A 2ZQMA 4P0PB 4PA7A 5A0LA 1Q3VA 2X6BA 3G71V 1AJQA 2ZXWC 4LBEC 3CC7V 1JQ0A 1PKXA 3ABMC 3LDCA 4BAYA 1VQNV 1DLBA 2ZIWB 4G27B 2K8CB 1VQOV 3SQIA 1A0PA 2HBJA 1OHHG 2F8LA 4JMUA 3WG7C 3W7TA 1BHAA 3JYCA 3SAHA 1OCZB 3ZRWB 3HKZC 2WLMA 5FL7G 2WAQF 1HEKA 5HR6A 2A0LA 3ASOB 3I56V 2IU0A 2XAQA 5H6RA 4P9OA 2H8PC 4XBFA 1YJWV 2W6IG 3ZN1A 2YEVB 2VIXA 3IN5A 1NR1A 3C28A 3OEEG 1VQ4V 3ABKB 1AI6A 4RUFA 2KD1A 4Z1MG 1FXKB 1Y4MA 2H3ZA 1BMFG 5H6QA 3ABTA 2EIMC 3OR6C 4U7CA 3AG1B 1I5XA 3T79A 2OCCC 3ZIAG 4CBCA 5BZBA 2KHQA 1A6SA 1JPXA 2DWEC 5IYBO 1YJ9V 1H38A 1QCEA 4OJ5A 2WLLB 3CRXA 1D8BA 4F4LA 4OJPA 1PL0A 5B3SB 1R6NA 4H37A 3CCLV 3I55V 5EC1C 1W2BU 1P4RA 3WFVA 3DEEA 5L3EA 2OXOA 4HYOA 1TAMA 4BUGA 3ABLC 2EIKC 3F7YC 4X8AA 5B1AC 1WLEA 1I5YA 3K0DA 3HPLC 1QVGU 2A9HA 1R3KC 3CD6V 3E0FA 1S5HC 4GX1A 4OO1J 2JH1A 3CP1A 4QPKA 4L87A 4UVBA 4NLCA 3B8MA 3E8HA 5DM6V 2F77X 1M9NA 2F43G 3ICXA 3MHHC 3PSIA 3ZMTA 2G08A 3ML0A 1S72V 2JJ1G 2XI9A 4GX0A 3LDEA 2W7PA 2KVCA 4JASA 3CCQV 1M1KW 4CGZA 3X2QB 5CA3A 2A79B 1FXVA 2QE7G 3LUTB 2ZDIC 3K08A 2Q67A 3ZMUA 2MA1A 1NVPD 2QA4V 1NJIW 3RVZA 4TT3G 1JOYA 4PDVA 3OW2U 1VQPV 4I9WA 4H33A 2KKVA 2HLDG 1KBUA 4C0ZA 3ETDA 4MW3A 1URJA 4ZBMA 3SPJA 1YI2V 1AI4A 1M56C 4WCEV 1K4CC 2UXNA 2ZDIA 2KJ5A 2R9IA 2H3VA 3IG8A 3QNEA 4N21A 4MT8A 2EILC 4FZNA 3ZRXA 3D36A 3DGEA 1E1QG 4PDMA 2DYRC 3EFFK 1COWG 4P0QA 2VJ4A 2IU3A 1TUEB 1E1RG 2GHYA 4QNLA 1RM1C 4E2LA 1YIJV 5T14A 3F5AA 2E1EA 2JHDA 1MABG 2OH2A 1JX9A 1R3IC 2Y48A 4WFEA 3RF9A 1S3JA 3UM7A 3GWOA 4RUEA 1Q82W 3KG2A 2CRXA 4G28B 1SETA 3ZMSA 3RVYA 1CRXA 2IW5A 2IJIA 2WLJA 3T4DA 1H8EG 1V54B 3K3WA 2W0FC 2JMGA 4PA4A 2CN1A 4GX2A 3ZRVA 1N8RW 1WUDA 4P0PA 4ACOA 2DGZA 1F44A 2MRLA 3PZPA 2HOFA 1NQTA 1OCOC 3FB8C 2X6AA 5KA6A 1OCZC 5L3FA 2QEXV 2NNUA 2JEXA 4JYBA 3ASOC 2Z7JA 3E8FA 3RW0A 3PSTA 4MTOA 1K8AW 1QR8A 1YT3A 4R7CA 1K4DC 1SZTA 2Q68A 5L3CA 3CP8A 2B1GA 4NLBA 3ABKC 3D3IA 1XL6A 2LFRA 4MTGA 2DQ0A 3OUFA 1FXKC 2EJRA 4BJQA 3ONNA 1OCCB 1VQ8V 3ZJZA 4U6PA 1IXMA 2JEUA 1R3LC 4MVZA 2PMZC 4HZ3A 5KA5A 1NBMG 2EIJB 3AG1C 4GCZA 2YEVA 4WFHA 4P2ZA 1QLNA 4X88A 2CK3G 1PD3A 4RQEA 1FXKA 4JYCA 3HB3B 2DYSB 2H3QA 1NH2B 1K73W 3OMAB 1FFTB 2K89A 1VQ5V 2RRDA 3CYMA 2X6CA 3MD0A 2KOBA 2VJ5A 3QO5A 5B3SC 5LGNA 3N7RC 5LHGA 4JTDB 1YHQV 2ZIXA 5C93A 1CP9A 2KIWA 2WPDG 3CCVV 4I5SA 1P7DA 3CCJV 3H0MB 3B77A 1SERA 2WLLA 5EC2C 4PL2A 4U7OA 4QPJA 2YSUB 5B1BB 1AI5A 1XL4A 4PL1A 4JAVA 4TWKA 3H0RB 3GZFA 2ZIVA 3K06A 3G6EV 4NWIA 3FYIB 2ZIUA 3GU3A 4LC1A 4J9YB 4MW8A 2IJHA 2WLIB 4WFAV 1V55B 2KKPA 2JK5C 2ZD9A 3ETEA 3AG2B 1FS0G 2P67A 2F76X 2YX8A 1GKFA 2G5IB 1GMGA 5HFLA 5B1NA 2WLNA 3LSSA 2IH3C 2K4IA 3X2QC 4BIUA 1IIPA 1ECWA 3STZC 1K92A 4MVMA 3VOUA 3STLC 4JTAB 2UXXA 4WFBV 2JJ2G 5H9CA 1DF5A 1NVPB 3K79A 3T2MA 1ROPA 5B1OA 5IDJA 3LVWA 5LHIA 2K4EA 2W03A 1K97A 3F2BA 1PNMA 2BOBC 1PNKA 2HBLA 5GW7A 3F5EA 1CPYA 4UXNA 4WFGA 3SYQA 1PVPA 1M90W 1KD1W 2Q4TA 3SAGA 3OUSA 1SRYA 2OYYA 3TCUA 2Y0SF 2CPRA 1VQ6V 2EBOA 3VCBA 3OR7C 2KJ9A 2R18A 3H0LB 1AJPA 2QM7A 2QKSA 4RO2A 5J9PC 1YTFD 3E35A 3K0GA 4R6ZA 1ZQ1C 2KJ8A 1XO0A 5IY5B 2X0LA 2R9RB 3AQFA 1J95A 3F2CA 2EINC 3ASNC 3C29A 2WWWA 3ZRSA 2DQNB 1JVMA 5CN0A 1V54C 2Y69C 3EHBB 3K03A 4FE3A 1MG1A 3FKSG 1Z1BA 2ZXWB 4UV9A 2KICA 4FZMA 2OM6A 1GM7A 3ABMB 3FB5C 1XNSA 3SPHA 2NLJC 1VQ7V 1THZA 2OT5A 2WB1C 4JGSA 4ASUG 5LHHA 2W6JG 1HWYA 1NZBA 5CRXA 2HKOA 2X7RB 4DO2A 3LNMB 4FIPC 3RBZA 3CMAV 2P6JA 1LNQA 3K9AA 4KX3A 4DXWA 1OCCC 3PSPA 3BY6A 3IC7A 2GSMB 3B8NA 1T94A 4X89A 3CCMV 3AG4B 3IP4B 2Y0SC 2HG5C 2XASA 2PMZF 3OE7G 1S76D 4JPRA 2JIZG 3LDDA 1VQ9V 1K5SA 3GB7C 4HAMA 4XDKA 3CC2V 2LYBA 1P7BA 2OCCB 1Q81W 3CYOA 4ICAA 1OCRB 1GK9A 1Q7YW 3W7UA 2HMXA 3AG3B 2E1FA 2QTOA 2IJJA 2ZR3A 3E2EA 4KP4A 2H3FA 3SJQC 3LSQA 2N1RA 3ABUA 4J9ZB 4KFMA 5IYCO 2G5HB 1W0KG 2ZG6A 4OJLA 3ALRA 5L3BA 3QO7A 3CCEV 4WF9V 2ZXIA 3ZN0A 3ZCCA 2JH7A 2HVKC 1M57B 5B1AB 1GM8A 2P7TC 3IFXA 1NR7A 2HVJC 1KKDA 1W0JG 4U7NA 1MOFA 2ZIWA 4AYBF 3AG2C 3PSFA 1K33A 4PDRA 4WFFA 1AR1B 2HBKA 1H2GA 3FB7C 1F4MA 3ZMZA 3G4SV 1F4NA 3ZRWA 3CCSV 4MSWC 4BW5A 3AQEA 3KZXA 3M99B 2LP7A 4UVCA 1H8HG 3SYOA 5HR7A 2IJKA 4QJFB 2WLKA 1EBOA 4IC9A 1YSCA 2XOKG 2G06A 2WSSG 3JD0A 2KNJA 3CMEV 2ZXHA 1DRGA 1AJNA 3MHSC 4PDLA 3KFUF 2BOCC 3A0RA 2XAHA 2EILB 1K5QA 2KHVA 3VC8A 1E79G 4PA9A 3FB6C 4JTCB 5KL8B 2PI4A 1DF4A 1EZJA 2HFEC 1RM1B 1SZHA 3K1ZA 4NV0A 2HOIA 5IY5C 2YB1A 3JD1A 1YTFB 4XDJA 3SYPA 1WPXA 4RQFA 4AYBC 1AI7A 3T4ZA 5LGUA 3JD4A 2K8BB 1RPRA 3F5WC 2LHTA 3OEHG 1UPHA 1GTOA 4FJCC 3CXCU 4N23A 2HJFC 2V1DA 4MVQA 1QBZA 1VQLV 2WLHA 5L3DA 2RP5A 2XNDG 1MSWD 5IYDO 1ED1A 1NKDA 2WB1F 1OCOB 3K04A 3OPXA 4MTXA 2B1IA 4RAIA 1QLEB 1R6KA 2GH1A 2Q69A 2DQ3A 1ORQC 3E8BA 4OJOA 2ITCC 3JD3A 3OM3B 3AEIA 4P9PA 2Z3YA 3W7XA 2HBMA 3W7SA 1JJ2U 4QNHB 2PI5A 1FXHA 4R50A 3RFAA 1Y66A 3NXSA 3OGCC 3OFNG 4XDLA 3AG4C 1PNLA 1VQMV 2XAFA 4OXSA 3E86A 4MS2A 4P30A 1YITV 4UV8A 1Q3UA 4YXWG 4G2KA 2AHYA 1NH2D 1AROP 3CCRV 2ZIXB 1EFRG 1OCRC 1G4YB 3M6KA 2C2AA 2EZOA 3AG3C 4JAUA 2H3IA 1KP2A 2DWDC 2YB4A 1G8MA 2FTKA 2HOQA 2JDIG 4R8CA 1BL8A 2HR3A 3L3FX 4FMTA 5LGTA 3F7VC 2ZIVB 4GFJA 4MVUA 1CEZA 2ZIUB 1KQSU 4PA3A 3SYAA 3LYSA 3CPWU 2V7QG 2LYAA 3M6ZA 1M57C 1K34A 2OTLV 2P90A 5E1AC 2KEYA 3WG7B 4MVRA 4MVOA 3TETA 4EKWA 1OZ0A 5CBFA 2H94A 2WAQC 5CMUA 1K9MW 3AL0B 4LP8A 3JD2A 1BHBA 1PVQA 1MA7A 2AHZA 4OJ6A 4KX5A 1Z19A 1KECA 3E8GA 3SPCA 2E5SA 2D6FC 1K3EA 1PVRA 3W7WA 1K7DA 2VKQA 3D2NA 4FPPA 3D2SA 2EIJC 3SMVA 4GX5A 3D2QA 2XAGA 4LCUC 2K8AA 1HIWA 3P30A 2LBOA 1RPOA 2EIMB 2KB1A 4KUMA 5L3GA 3E89A 3NRWA 1F23A 2OTJV 2DYSC 2XVTA 2M7WA 1Q86W 2QM8A 2G0AA 4BX9C 3BEHA 3E83A 2RHFA 2KV2A 2ZR2A 3OAAG 4UUJC 1DTOA 3DTUB 4CZZA 1VQKV 5C0YA 4KMOB 2GOLA 4UVAA 4QIWF 5KUMA 3ETGA 4QE7A 4A8EA 3FYEB 3QO8A 5B1BC 5EBWC 2W04A 5CBGA 5EBMC 1GO3F 3ABLB 3ZMVA 1GM9A 1R3JC 2EIKB 1JCHA 3M7DA 3CCUV 3OMNB 2Z5UA 2K4HA 2ATKC 1V55C 3SYCA 2W7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NLB A;  4CGZ A;  2HBK A;  3SAH A;  2MA1 A;  2HBL A;  2E1F A;  2HBM A;  2RHF A;  2KV2 A;  4O3M A;  3SAG A;  5C0Y A;  4CDG A;  4QJF B;  2CPR A;  4QIW F;  1WUD A;  4OO1 J;  2DGZ A;  2RRD A;  3CYM A;  4NLC A;  1GO3 F;  3SAF A;  1YT3 A;  2E1E A;  1D8B A;  2HBJ A; 
#chains in the Genus database with same CATH topology
 1TVK A;  1Y74 B;  2D8C A;  3V6K A;  1NI3 A;  5KHI A;  4ZKI A;  1L1F A;  1YZB A;  4UAZ A;  1B6Q A;  3N7P D;  3P32 A;  4EEL A;  3F53 A;  5CB4 A;  2BDP A;  2A3V A;  2HCF A;  1KMI Z;  1L8D A;  2WLI A;  4O3M A;  5DED A;  3N7S C;  8ICJ A;  3OMI B;  5KUK A;  4YJ2 A;  2WFA A;  4KXR A;  4J9L A;  2PFQ A;  4JI6 O;  1Z1V A;  2K9P A;  2M0N A;  2LFS A;  3D6J A;  3ZHS A;  5H2F Z;  2L5Y A;  4WJ3 B;  4Q20 A;  3TXQ A;  2KIV A;  3T1C A;  3AN1 A;  4KLL A;  4TOI A;  4GT1 A;  1F51 A;  5JJN B;  4AP9 A;  4R64 A;  2HHX A;  4EEN A;  3SJC C;  4BIZ A;  5KFB A;  3CC4 V;  4IQV A;  4YIO A;  2W9C B;  1SZP A;  1ZOL A;  4I2B A;  2N74 A;  1UFI A;  2W9B B;  4YJ3 A;  2XID A;  3CS5 A;  1SES A;  2UXB O;  3L73 H;  1ZWI C;  5F3X B;  2P6R A;  1FFX B;  3MGV A;  1JXE A;  3MR5 A;  3LVV A;  4ED2 A;  4TUQ A;  1IG6 A;  8ICX A;  4PA7 A;  4QW8 A;  3QYP A;  3G71 V;  2ZXW C;  3FFQ A;  4LBE C;  4EB6 B;  3OGU A;  3CC7 V;  4U3J A;  1WCL A;  2WF9 A;  2ZJ8 A;  1JQ0 A;  2KP7 A;  4BAY A;  4B3T O;  2ZIW B;  1RPL A;  3SQI A;  1N33 B;  2QB0 B;  5J2T A;  4EEQ A;  3DDH A;  2UUC B;  1KU9 A;  1UT8 A;  4OCZ A;  1KL9 A;  3JAS B;  1BHA A;  1JN3 A;  4F91 B;  3MFI A;  3HKZ C;  1DK3 A;  2A0L A;  1WB8 A;  3I56 V;  4LZG A;  2XAQ A;  5H6R A;  2F1H A;  3BHP A;  2W6I G;  2VIX A;  1NR1 A;  5HP4 A;  2E8M A;  3SGI A;  4JV5 B;  1T4G A;  1FXK B;  1QQC A;  7ICK A;  2H3Z A;  2DPJ A;  2HDO A;  3BS7 A;  1MMM A;  2M6Y A;  2B9Z A;  9ICE A;  2OCC C;  3ZIA G;  4CBC A;  2E76 B;  2BCU A;  3NR7 A;  2DWE C;  5IYB O;  2WLL B;  5IIO A;  1D8B A;  4I7Z B;  3VQX A;  2UXD B;  9ICI A;  1PK3 A;  4OJP A;  1PL0 A;  4M9H A;  3M8A A;  2Q7H A;  4H0L B;  4YXJ A;  2HHS A;  2P5O A;  2R8H A;  3QE9 Y;  1ZQN A;  2E74 B;  4QZ8 A;  3I55 V;  2UVR A;  2M9N A;  3C5F A;  2OXO A;  4BUG A;  3ABL C;  1A77 A;  3F7Y C;  3BS5 B;  4B9L A;  3HPL C;  1ZQL A;  5JRT A;  4DLE A;  2ZTE A;  2FPK A;  3JAW B;  2NRZ A;  3A2F A;  4ZH4 A;  4O4J A;  2HHH B;  3C3S A;  4QPK A;  4NTY A;  4NL9 A;  1D8L A;  3E8H A;  4UVB A;  4LF4 O;  4Y2T A;  4GXI A;  5AI6 A;  5LP6 C;  3ZDB A;  3ML0 A;  5H2F U;  3UMG A;  2JJ1 G;  2Y4U A;  4J42 A;  4YN4 A;  4RQ8 A;  1UT5 A;  3JPQ A;  1M1K W;  1Y74 A;  3X2Q B;  4F5O A;  2ZDI C;  4OGQ B;  4RQ6 A;  3ZMU A;  1S0N A;  2QA4 V;  5KG1 A;  4PDV A;  4I9W A;  3EPI A;  1NJY A;  1Q3E A;  2QAR B;  1KBU A;  1WWU A;  2C2E A;  4ZBM A;  1KFT A;  3ISC A;  1L0N H;  3BQ7 A;  4TQS A;  4B3M O;  2H3V A;  1ZD2 P;  3QNE A;  4MT8 A;  1X9S A;  3P3N A;  2FPM A;  5KFW A;  3E22 B;  1YIJ V;  2YI8 A;  2JHD A;  1MAB G;  5JQG A;  4BXO A;  3N28 A;  3IM1 A;  4BWJ A;  4DR1 O;  5KFC A;  3GV8 B;  1R3I C;  3PNC A;  5KFF A;  1IM4 A;  3KHR A;  4MFF A;  1FD9 A;  4FO6 A;  5EIB C;  1Q82 W;  1ZQV A;  1H2S B;  2RN9 A;  1Y88 A;  1SET A;  5J29 A;  1H8E G;  3K3W A;  1FFX A;  4YY3 O;  3ZRV A;  5III A;  2ZCE A;  3DSQ A;  4NXZ A;  1YDX A;  2MRL A;  1NQT A;  2UUA B;  4EB6 A;  2NO4 A;  3FB8 C;  4JI8 O;  4DV6 B;  3WB2 A;  3KD3 A;  4R63 A;  2F1I A;  1KEJ A;  5KMG B;  2QB0 A;  4I2E A;  1SZT A;  4FVM A;  2B1G A;  1V85 A;  4Z6C A;  3ABK C;  3KKY A;  4OPA A;  1XL6 A;  1CXZ B;  4LF7 O;  3OUF A;  3S3X A;  1Q5O A;  5D46 A;  4UAV A;  2GV9 A;  2JEI A;  3ZJZ A;  1IXM A;  1XQ8 A;  2PMZ C;  4HZ3 A;  5KA5 A;  4WFH A;  4F71 A;  1RFY A;  2VA2 A;  3OTF A;  4Y2Y A;  3RWR D;  4KLT A;  9ICW A;  1FXK A;  2VQE B;  3ZHR A;  1FEZ A;  2H3Q A;  2DYS B;  2K89 A;  1BPB A;  1KB9 F;  2KOB A;  1HR0 B;  1YHQ V;  4JTD B;  2EX3 A;  4DQS A;  2YS8 A;  2KIW A;  2GDS A;  4GKK O;  4I5S A;  2WLL A;  4X1K B;  1SWW A;  1S5L Z;  1KDH A;  2YSU B;  4QPJ A;  1JR9 A;  1B43 A;  3DC5 A;  1HNW B;  3JPS A;  2C2R A;  1JX4 A;  1LKY B;  1NS1 A;  5AK3 A;  1XS9 D;  1O08 A;  2I6X A;  1XMQ O;  3G6Y A;  4NWI A;  4DFD A;  1ZQX A;  2E8N A;  4GLX A;  2YIA A;  4J9Y B;  4LC1 A;  4WFA V;  4DV1 B;  5J2I A;  1XNR B;  1V55 B;  3ETE A;  4O5C A;  1L7M A;  9ICQ A;  3AG2 B;  2RQ5 A;  3BJY A;  9ICF A;  4NJ8 A;  2R9A A;  5HFL A;  4LF8 O;  3LSS A;  5DG8 A;  4LF9 O;  1KW4 A;  5TIS Z;  2BE3 A;  3CW2 C;  1ECW A;  3HJE A;  5AI9 A;  5B5E U;  1C7Y A;  2GWS A;  8ICH A;  3STZ C;  5K1X A;  1IBM O;  5J2K A;  4WFB V;  3QU9 A;  7ICP A;  4Z6D A;  4DR2 O;  1NTZ H;  1NVP B;  3V72 A;  4C4R A;  2ASL A;  1I08 A;  4JUZ A;  2IOH A;  3EYZ A;  3K5O A;  4CS3 A;  3RYH A;  1WN7 A;  3LVW A;  2NRX A;  4NM2 A;  1ZRN A;  7ICG A;  4O4L B;  2AZ2 A;  1ZQS A;  2IM9 A;  2YC0 A;  3MBY A;  4RNN A;  5GW7 A;  3SYQ A;  1L7N A;  7ICT A;  3HKE A;  4UXN A;  1M90 W;  2QAR A;  4FLX A;  5BOM A;  4DR6 B;  4TUR A;  2IMW P;  1XMQ B;  3WKD A;  5ALY A;  3H8W A;  2FKX A;  1KFS A;  3H0L B;  2QKS A;  5J9P C;  3JPO A;  1YTF D;  5J0U A;  1RSO A;  3HKB A;  2D2C B;  1J95 A;  5EWE A;  3F2C A;  3E22 A;  3ASN C;  3C29 A;  1Q8K A;  4ED6 A;  3OTO B;  4DWI A;  1SV4 A;  2A06 H;  4DQR A;  1V54 C;  5DB8 A;  2JGD B;  2Y69 C;  5CN0 A;  3WKE A;  3K03 A;  4UQG A;  4JYA O;  1RG6 A;  2VWK A;  2ZE7 A;  1RYR A;  4X1I A;  4WBN B;  3PW2 A;  3C90 A;  3B4S A;  1BPE A;  1PK1 A;  3SPH A;  4DW0 A;  2NLJ C;  3JCU Z;  5LMN O;  4UBC A;  1I94 B;  4ASU G;  1COK A;  2Y0P A;  2KSO A;  3ETL A;  5CRX A;  4NXM O;  5AK5 A;  2HKO A;  3K4G A;  4KHP B;  4YD2 A;  4FIP C;  4D7S A;  3G6X A;  5KFT A;  2VS0 A;  4EBE A;  4JZG A;  2LI6 A;  4HAI A;  1NKE A;  3UQ0 A;  3NVZ A;  3IC7 A;  5D5Q A;  2A3Q A;  4W4K A;  3B8N A;  5AI5 A;  4DV7 B;  4DR7 O;  2UXC B;  1X66 A;  3IP4 B;  4ECZ A;  3OE7 G;  4P2H A;  2PMZ F;  5DBA A;  5KMG A;  2P4K A;  3BA9 A;  1B22 A;  3CB2 A;  1J2N A;  2HVH A;  4Y2J A;  3T3F A;  3LK9 A;  3CC2 V;  2P06 A;  1BVS A;  4LF5 B;  2LYB A;  8ICP A;  8ICS A;  1GK9 A;  1Q7Y W;  2HMX A;  3AG3 B;  4KLE A;  2GUZ A;  2R8J A;  2H3F A;  4F2R A;  3SJQ C;  4F4X A;  2N1R A;  3BA8 A;  4KFM A;  2BCQ A;  2HHV A;  4JB3 A;  2ODM A;  4OJL A;  3OJU A;  2XCP A;  3ALR A;  5AKG A;  1MZE A;  2F1M A;  2PF4 E;  3JAK B;  3QO7 A;  5ALE A;  1BE3 H;  3ZN0 A;  4FM1 A;  5DKW A;  2QWR B;  2JH7 A;  3WK4 A;  5B1A B;  3SZ2 A;  1SV0 A;  2F4V B;  1G6U A;  1NR7 A;  4UCO A;  4X1K A;  5KFP A;  1Z00 A;  5KG0 A;  3PR5 B;  4CH5 A;  4K4H A;  5BPC A;  4DR7 B;  4AYB F;  5DGB A;  2HHQ A;  1KQQ A;  4PDR A;  1LKY A;  1TAE A;  4ZOL A;  2HBK A;  1O9G A;  3ZMZ A;  1NZ6 A;  3ZRW A;  5AKI A;  1QSL A;  9ICC A;  3BAA A;  1NNL A;  3M99 B;  2LP7 A;  3L71 H;  4O5E A;  4QZB A;  2BQU A;  2CH7 B;  3MDC A;  2WLK A;  4YMO A;  1SL2 A;  1JMK C;  2Q73 A;  2XOK G;  1YSC A;  4X9Q A;  3WU2 Z;  4Q8E A;  1B0X A;  4F92 B;  5E79 Z;  4DUY B;  5J8Y C;  4ECT A;  4JI0 O;  5BMV B;  3SV3 A;  1SKV A;  4JI5 O;  2FJ6 A;  3PW0 A;  4F4K A;  2BOC C;  5LXT A;  1P84 F;  5DB6 A;  3JAL B;  2OIE A;  4UB6 Z;  2EIL B;  3CRQ A;  1K5Q A;  2KHV A;  4ECU A;  1ZQP A;  1E79 G;  4EFB A;  3FB6 C;  4JTC B;  3TAD C;  1L0L H;  4O4L A;  4RQ5 A;  1DF4 A;  3H8J A;  4D7T A;  1SZH A;  4NV0 A;  2BZF A;  5L9X A;  1Q6H A;  2YMM A;  3SEN A;  4XDJ A;  3SYP A;  1WPX A;  1FJG B;  2EZX A;  1AR5 A;  5FP0 A;  5AKL A;  3F5W C;  2YUA A;  4TV9 A;  3OEH G;  4EBD A;  8ICV A;  1T7P A;  1Y67 A;  3AK3 A;  2HJF C;  4N23 A;  1BQ0 A;  5L3D A;  2ISO A;  4B3R O;  4JI0 B;  1NKD A;  4ZI7 B;  5JCO A;  1XBL A;  3OGI B;  1D5A A;  1L3V A;  4B9T A;  3PML A;  4BWM A;  4WBN A;  5EYP B;  4OJO A;  1TVA A;  1ZQF A;  4YMN A;  4O3P A;  2PI5 A;  2OWO A;  4RQM A;  3UPQ A;  2ZT9 B;  3NXS A;  1ZET A;  1FFV A;  1ZQH A;  3U10 A;  4DV3 O;  2E3T A;  8ICA A;  1VQM V;  1SB3 C;  3L9D A;  4MS2 A;  1IZ3 A;  5CEH A;  2ZIM A;  1LB2 B;  4UV8 A;  4G2K A;  4PJ0 Z;  1D9D A;  1O9H A;  1N4C A;  1G4Y B;  5JWP A;  3ZDD A;  1YXB A;  2VA8 A;  3TI0 A;  4JAU A;  1U9L A;  2H3I A;  8ICF A;  3HKC B;  2YB4 A;  1G8M A;  4B3R B;  4LFC O;  8ICN A;  2ZIV B;  4J9N A;  5KAI U;  4DSL A;  1IXB A;  4ECX A;  5ALF A;  4PA3 A;  2E5L O;  3LYS A;  2V7Q G;  2LYA A;  3M6Z A;  1M57 C;  4J7K A;  5J2D A;  4F6R B;  1J97 A;  5KHK A;  3WG7 B;  4MVR A;  4EKW A;  5HHH A;  1ZYQ A;  2WA4 A;  4QZ9 A;  3JAK A;  1AVM A;  5CMU A;  4DV3 B;  1TFR A;  3AL0 B;  3CWB H;  4OJ6 A;  5KFI A;  5IIK A;  4ECR A;  3SPC A;  5E79 U;  1K3E A;  2CTP A;  4I2H A;  3WB0 A;  4Q44 A;  2AQ0 A;  4KLH A;  3N2K A;  1QU7 A;  4X20 B;  3D2S A;  1TA8 A;  3SMV A;  5J0T A;  2EIJ C;  3D2Q A;  2XAG A;  3H1H H;  4YR0 A;  1HIW A;  2K8A A;  2O57 A;  3ZD8 A;  4O4I B;  3WB1 A;  1KN5 A;  2EIM B;  3TKA A;  2DN9 A;  4KUM A;  1ZQD A;  1SL1 A;  3M1Y A;  5J2J A;  2L35 A;  2QM8 A;  4XA5 A;  3BEH A;  3OAA G;  3C5G A;  4MHV A;  1FFU A;  2AQ4 A;  5HML A;  3RYF A;  1N34 B;  5F2V O;  4QGP A;  3QO8 A;  2KKW A;  5CJ7 A;  3QU2 A;  3QG5 A;  3M9N B;  5BMV A;  2HVI A;  3RJE A;  2AZ0 A;  3ZMV A;  3AK1 A;  4IL6 U;  3M7D A;  3UMC A;  4UCU A;  2ZM6 O;  1BNO A;  3RT3 C;  3PW7 A;  5LYJ A;  7ICE A;  3SYC A;  1IBK B;  4J9K A;  3HKD A;  3H8S A;  1KSP A;  2LKY A;  5ALP A;  2EIN B;  1SQG A;  2FML A;  5H5N A;  3VBB A;  4R65 A;  3QZ7 A;  4LJX A;  4FK5 C;  2NV3 A;  2F2A B;  2LW7 A;  4QE9 A;  3IGA C;  5J0P A;  4X1Y B;  2NYV A;  2F23 A;  4DL5 A;  2IH1 C;  4M2Y A;  5CA1 A;  2BDU A;  2DW4 A;  4C8L A;  1L6N A;  1BPX A;  3CEI A;  3R65 A;  1NK4 A;  1EM1 A;  3IG5 A;  3C1Z A;  5CBH A;  2Q6A A;  3QXG A;  4UAY A;  4O5K A;  2ILM A;  5KL1 B;  2GTS A;  2PUS A;  2EZP A;  5J2E A;  9ICU A;  4QIW C;  4ZI7 A;  7ICS A;  1IV8 A;  2DF4 B;  4F93 B;  4JF3 A;  2XUM A;  3CJH A;  4RQ4 A;  4M9J A;  2CGN A;  5DEC A;  1ZQB A;  2QWP B;  2WAM A;  1ZTE A;  3JAR B;  1SWV A;  1R73 A;  2LJ2 A;  3MDS A;  3AU6 A;  4I55 A;  3O9O A;  4KN4 A;  4EYI B;  1EN4 A;  4MVS A;  1XMO O;  1RM6 C;  4K8X A;  2Y9T A;  2R8K A;  1ZD5 A;  3CRM A;  4DQI A;  3I76 A;  1N60 A;  3CE2 A;  2IBK A;  3QU7 A;  3M8R A;  3ABM C;  1VQN V;  5KHH A;  3HKC A;  1VQO V;  9ICN A;  4O3R A;  3RB0 A;  4YXM A;  2HBJ A;  4IR1 A;  3TJT A;  2F8L A;  5AHX A;  4ICG A;  2V4D A;  1H2K A;  4IYH A;  4UB8 U;  1T8E A;  3BQ2 A;  2WLM A;  5FL7 G;  1HEK A;  5KFG A;  4GKJ B;  3GQC A;  1WPB A;  3A0B U;  3ZN1 A;  3IN5 A;  2A7W A;  3T5K A;  3C28 A;  5ITZ B;  1VQ4 V;  1FKA O;  1AI6 A;  2ZUD A;  3G80 A;  1Z3E B;  4RUF A;  3CHX A;  3ZHT A;  3RH5 A;  1Y4M A;  1AQ6 A;  4J9S A;  1WJZ A;  3ABT A;  2D3D A;  4U7C A;  4TUP A;  3AG1 B;  3VQY A;  4X64 O;  4DUZ B;  4DOA A;  1Q8I A;  2QWQ B;  4OX9 O;  9ICV A;  2DFL A;  4LF6 B;  1YJ9 V;  2IOF A;  3V7J A;  4X20 A;  1QCE A;  2JEJ A;  3FX7 A;  2IHN A;  4F4L A;  2I5H A;  4DQP A;  4FZ0 A;  4O4I A;  4C7Z A;  5B3S B;  2Y4T A;  3ZDC A;  1JI7 A;  5BR8 O;  3HR0 A;  2MU2 A;  5EC1 C;  1X59 A;  4DV5 B;  3DEE A;  3BAB A;  4NL9 C;  2F95 B;  3K59 A;  2O6K A;  2EIK C;  4X8A A;  1QVG U;  1WLE A;  3K0D A;  3KKA A;  4W4L A;  1JIH A;  2AH5 A;  1I0H A;  3CD6 V;  3E0F A;  4EZ6 A;  2R8G A;  4GX1 A;  5KFL A;  2KG7 B;  2JH1 A;  5KT5 A;  3M9O B;  3CP1 A;  3GV7 B;  4JWN A;  4NLC A;  1X9X A;  2F77 X;  2F43 G;  1F5S A;  3PSI A;  3PX4 A;  3UO2 A;  1S72 V;  2UU9 B;  3ZED A;  2XI9 A;  3LDE A;  2W7P A;  1GH6 A;  3RYC B;  2ARH A;  3CCQ V;  3QUT A;  4UCV A;  2A79 B;  1O03 A;  1FXV A;  3NVY A;  4O2A B;  1NVP D;  2Q67 A;  1JFF A;  1XNQ B;  3OW2 U;  5JTI A;  1VQP V;  4ZHQ B;  4PHD A;  3H40 A;  4H33 A;  4AQY B;  4KLI A;  3THV A;  1TUB B;  2Q5Z A;  3TQ1 A;  1VIB A;  4IIJ B;  4IYI A;  5BR8 B;  4WCE V;  4PGY A;  5ALN A;  1YF2 A;  4Z2W A;  2BCR A;  2R9I A;  2OCE A;  4FZN A;  2YML A;  3Q8P B;  3DGE A;  5KFO A;  5KT3 A;  1E1Q G;  4PDM A;  3EFF K;  3Q8K A;  4HNA B;  4RQ1 A;  4TUY B;  1AB3 A;  4A5U B;  4KLJ A;  1Z4O A;  2AW9 A;  4CC5 A;  4PH5 A;  2RJZ A;  5JU5 A;  2ZE5 A;  2VA3 A;  4ECQ A;  2Y48 A;  2WF6 A;  4DW1 A;  3T5J A;  1V38 A;  1S3J A;  3H8M A;  1D9F A;  4RUE A;  3KG2 A;  4Y2S A;  1BSM A;  3JAR A;  4G28 B;  1BPD A;  5AKH A;  3WKC A;  2A1J A;  2IW5 A;  2Q7G A;  3RBD A;  3T4D A;  3OSP A;  2HHU A;  2JMG A;  4KLU A;  1KYO F;  2CN1 A;  3IHQ B;  1ZLZ A;  3APO A;  4C8N A;  3CSX A;  4F8R A;  2DGZ A;  4NXN B;  2X6A A;  2PFO A;  1LUV A;  2ETN A;  5ALQ A;  5EZY B;  5L3F A;  5KFN A;  2JEX A;  2AXT Z;  4JYB A;  4NYK A;  2Z7J A;  1ZQJ A;  1ZQT A;  4DOC A;  4ED7 A;  2P22 C;  1N33 O;  2UUC O;  2ODG A;  4R7C A;  1QQ6 A;  4K8Z A;  1KUQ A;  1U96 A;  3BZK A;  2MSN A;  5A9G A;  2XY5 A;  3SR2 C;  4ED1 A;  2DQ0 A;  1FXK C;  3ONN A;  2DWQ A;  3HW8 A;  5KG6 A;  1OCC B;  1VQ8 V;  3G6B A;  4U6P A;  3U11 A;  3QUC A;  5AKY A;  3JSL A;  4UAS A;  3MR3 A;  2R72 A;  2ZE6 A;  2YXY A;  1WWV A;  4JV5 O;  4P2Z A;  1XI1 A;  1VF6 A;  4DL2 A;  5KG3 A;  2CK3 G;  4RQE A;  3GVM A;  1GN6 A;  1ZQQ A;  5J2B A;  1SGG A;  1VQ5 V;  2RDC A;  2RRD A;  1OXJ A;  3CYM A;  2B6G A;  2VJ5 A;  4DFK A;  5LGN A;  3N7R C;  4TQD A;  2WPD G;  3CCV V;  1TAQ A;  1WG8 A;  3H0M B;  3B77 A;  5GTI U;  2UXD O;  5DGA A;  4PI0 A;  1AI5 A;  3T5L A;  2BTQ B;  5J2H A;  1XL4 A;  4JAV A;  4JI1 B;  1L8O A;  1QCK A;  2XHB A;  3H4D A;  4F5Q A;  3H0R B;  4FM0 A;  4J41 A;  3WKA A;  4R66 A;  3APQ A;  3S6J A;  2FMP A;  4FZ1 A;  1N0N A;  4DK1 A;  5AG2 A;  4ZIB A;  2P67 A;  2YX8 A;  4BR6 A;  2XY6 A;  2QR4 A;  2HHH O;  1GMG A;  1SZX A;  3V7L A;  2IH3 C;  3CRR A;  3X2Q C;  4IRD A;  5KFV A;  3TAP A;  2F44 A;  3STL C;  2WHE A;  3RB4 A;  3ZHU A;  5KHJ A;  5H9C A;  5DLG A;  2QKA A;  3RYC A;  4KIT B;  4RQ0 A;  1SS3 A;  2MW2 B;  1TK8 A;  3S3W A;  2HEP A;  3AM9 A;  2W03 A;  2P4V A;  4O3O A;  5KFS A;  3RAQ A;  1PNM A;  1N0J A;  1PNK A;  4ZHQ A;  4ECY A;  3B9J A;  5KFK A;  1US6 A;  1CPY A;  1PVP A;  4K35 A;  1TUB A;  1RQL A;  3SAG A;  5KHG A;  3TCU A;  2Y0S F;  2CTW A;  1VQ6 V;  5DDY A;  2AU0 A;  1TK0 A;  1BCC H;  4GXJ A;  4FBU A;  2QM7 A;  1AJP A;  2MUT A;  1OJH A;  3E35 A;  1PL4 A;  2X0L A;  2R9R B;  3AQF A;  3EZ5 A;  2AGP A;  4HNA A;  5KNI A;  4NR1 A;  3PN1 A;  1UQV A;  2DQN B;  1RYU A;  1JVM A;  4LNU B;  2AXT U;  4FLZ A;  4DFM A;  4Y2R A;  2EAO A;  2JS3 A;  1MG1 A;  2ZXW B;  4UV9 A;  2KIC A;  4FZM A;  4EZ9 A;  4FLU A;  4Z6F A;  5DB9 A;  1GM7 A;  2PZS A;  3FB5 C;  1XNS A;  2IOF K;  2NRW A;  5DQI A;  4QWA A;  2QDO A;  2W54 A;  1QH9 A;  1X6J A;  5AI0 A;  5IIL A;  7ICV A;  1HWY A;  2Q4P A;  2YXH A;  1NZB A;  4K4G A;  2X7R B;  4E0D A;  2UUA O;  3H1L H;  2JZB B;  5B5E Z;  4DV6 O;  2P6J A;  9ICR A;  4UBB A;  1MZF A;  5EZY A;  4DXW A;  4X89 A;  1WP8 A;  4GYC B;  1S76 D;  8ICR A;  2PFP A;  1L5U A;  1MQ3 A;  3PY8 A;  4NVP A;  3BVO A;  3LDD A;  1R6T A;  4AI8 A;  2LW1 A;  4LH7 A;  5ALT A;  4X66 B;  1VQ9 V;  4F6E A;  1BZK A;  1K5S A;  2OCC B;  2W9C A;  1SXD A;  2WF7 A;  4QW9 A;  1OCR B;  3CYO A;  4UB5 A;  1K1S A;  4K4I A;  1SXE A;  2W9B A;  3E2E A;  4LH6 A;  4QZH A;  2ZR3 A;  4KP4 A;  1ZQO A;  2JR5 A;  5L1K A;  2VQE O;  4PI2 A;  1NK8 A;  1SV0 C;  3HPO A;  3LSQ A;  2Q9L A;  4J9Z B;  5KAF Z;  4XQ8 A;  4RPX A;  3LWL A;  1W0K G;  2ZG6 A;  3J81 j;  1HR0 O;  3RB6 A;  4GIB A;  4PZN A;  4HYK A;  3ZCC A;  3EVK A;  5IJ0 B;  4C4T A;  1GM8 A;  1TK5 A;  5AI8 A;  2HVJ C;  3UXN A;  2YQE A;  2QGN A;  1U45 A;  1HNW O;  4IQW A;  2LPE A;  2ZIW A;  1HUO A;  3AG2 C;  1N48 A;  3PX6 A;  8ICI A;  1K33 A;  4WFF A;  1H2G A;  3FB7 C;  1OV9 A;  3JAS A;  3G4S V;  4DV1 O;  1AR4 A;  5KFY A;  1XNR O;  4DL6 A;  2VAN A;  2KN7 A;  1H2L A;  2NRV A;  4RT2 A;  4JYY A;  4DFJ A;  5DB7 A;  4QJF B;  2HJD A;  3H4B A;  1JAL A;  2KMD A;  3FDS A;  2W11 A;  4B9U A;  2KNJ A;  4UCS A;  8ICG A;  2ZXH A;  3MHS C;  4PDL A;  4D6T H;  3A0R A;  1N61 A;  2VWJ A;  1DXS A;  3VC8 A;  5DBB A;  5KL8 B;  1XDC A;  2BR0 A;  4R8U B;  4IR9 A;  4DR6 O;  4J9O A;  3K1Z A;  2HOI A;  1HNX B;  3MDA A;  1ZXI A;  1SL0 A;  5JJJ B;  3UXP A;  2YN4 A;  4PPX A;  4CH3 A;  3BS5 A;  4AYB C;  1AI7 A;  1KBH A;  1SQB H;  3HT3 A;  4TQR A;  1RPR A;  2J6S A;  2BSK B;  2JGU A;  5JCO C;  9ICS A;  3JAW A;  8ICC A;  3CXC U;  2V1D A;  1WP7 A;  9ICH A;  1Z4N A;  2RP5 A;  4I50 B;  3OTO O;  3SDL A;  4UB4 A;  5FLX N;  2ZTC A;  4DR4 B;  5C8Y B;  3SD7 A;  2PFN A;  1HP8 A;  1J2M A;  5DQG A;  3K04 A;  2ZUC A;  1XC9 A;  2B1I A;  1QLE B;  1R6K A;  1PZN A;  2GH1 A;  3E8B A;  1I94 O;  2ADP A;  2Z3Y A;  4OPH A;  2B0C A;  3W7S A;  5CWR A;  4Q6G A;  4KHP O;  1IDS A;  2ZNJ A;  3RFA A;  4R50 A;  4X65 B;  5CA7 A;  3IJ4 A;  4NLZ A;  3OGC C;  4RNM A;  4XDL A;  1PNL A;  3NGD A;  4J9R A;  2JZB A;  4B9S A;  3K5N A;  3Q8R B;  4DV4 B;  3E58 A;  5KAF U;  1XSL A;  4MFC A;  4B3S O;  2UXC O;  4ED3 A;  1ARO P;  3CCR V;  2ZIX B;  1EFR G;  4DV7 O;  1NH2 D;  2LM4 A;  2EAN A;  3M6K A;  3AG3 C;  1X9W A;  4CE6 A;  1KP2 A;  2HOQ A;  4QZA A;  2JDI G;  4LF5 O;  5D49 A;  2HR3 A;  4NB5 A;  5J2U B;  5LGT A;  2ASD A;  3F7V C;  4MVU A;  1CEZ A;  1N36 B;  2ZIU B;  3FAV B;  4O4H B;  2OYQ A;  1J5E B;  3CPW U;  3LSU A;  3QNM A;  2H3O A;  2KK0 A;  2XY7 A;  3C2K A;  4UB2 A;  1H2N A;  2KEY A;  3TET A;  1OZ0 A;  5CBF A;  5LA6 B;  5CP2 A;  1Y6X A;  1K9M W;  2F4V O;  2HP8 A;  3TGU H;  2WF8 A;  3UQ2 A;  1MA1 A;  2E5S A;  4B3S B;  1K7D A;  3D2N A;  5LMU B;  5ALS A;  4GX5 A;  1XU4 A;  1G1X B;  1RXV A;  1RPO A;  1JXL A;  3J7A U;  3ZDE A;  3NRW A;  2XVT A;  2N05 A;  1MN8 A;  4BX9 C;  4US8 A;  3PVX A;  2RHF A;  2KV2 A;  2ZJA A;  5J0R A;  4UUJ C;  1L3S A;  4KMO B;  4CF5 A;  2BGW A;  1GN3 A;  2CE4 A;  4DUY O;  1PUZ A;  5B1B C;  1SQX H;  3C23 A;  8ICY A;  2ZIO A;  5EBM C;  4X62 B;  1GO3 F;  4J03 A;  1JCH A;  4DSI A;  1A76 A;  2BPG A;  2KTQ A;  2R8I A;  2W7O A;  3TAN A;  7ICO A;  1Q6U A;  2BHN A;  1QQ7 A;  4J9M A;  1NZP A;  3WK9 A;  2AJQ A;  5KAI Z;  1T3N A;  2VQF B;  3ASN B;  2ITD C;  1NJX A;  1S0V A;  4PD4 F;  4PA6 A;  1FJG O;  4JV0 A;  2Y69 B;  4RT3 A;  2G09 A;  3NRZ A;  5EWF A;  2R70 A;  5HFM A;  1KP3 A;  2JGA A;  3B40 A;  2LMR A;  2UVU A;  3BZC A;  1DK2 A;  2FMS A;  4I50 A;  4MTF A;  3SAF A;  4PEL A;  3UKM A;  4ABM A;  2XGP A;  3T5H A;  1M56 B;  2B5U A;  5DN6 G;  5J0S A;  2K1E A;  3TK1 A;  5DG7 A;  2RDI A;  2DYR B;  3GII A;  3QEB Z;  2G07 A;  4F5P A;  5D5P A;  3HP6 A;  5GON B;  5LOV B;  1QR9 A;  2YTU A;  2GLE A;  2FPL A;  3O0F A;  4LFB B;  2EDU A;  4B08 A;  4UAT A;  1S77 D;  1KC8 W;  1WNS A;  2NR5 A;  1QVF U;  1N56 A;  1D2D A;  5KFH A;  2ZQM A;  4K0K B;  4P0P B;  4NY8 A;  1BPZ A;  3B0X A;  3D3Q A;  5A0L A;  1HNZ B;  1Q3V A;  3EPG A;  4IL6 Z;  2ZKO A;  2C22 A;  1S9F A;  5AM2 A;  1VF5 B;  2W55 A;  2Q0Z X;  1PKX A;  1MNG A;  3LDC A;  2BPF A;  3AUO A;  4G27 B;  4DV0 B;  1R1B A;  2JGD A;  1S97 A;  1HDJ A;  4JMU A;  3WG7 C;  3W7T A;  3JYC A;  1OCZ B;  4EFE A;  3ASO B;  5HR6 A;  4RUC A;  2IU0 A;  3HRD D;  2CGO A;  2H8P C;  3QF7 A;  1ZQE A;  2XGQ A;  2YEV B;  2FI1 A;  3CXH F;  4XBF A;  1YJW V;  4IHJ B;  3M9M B;  3DXR B;  4EX7 A;  2KD1 A;  2BCS A;  4YR3 A;  2ASJ A;  4MF2 A;  4F4W A;  5LA6 A;  4E4E A;  5H6Q A;  3AEV A;  2EIM C;  3OR6 C;  4DRX B;  3T79 A;  3BPZ A;  2KHQ A;  3V7K A;  1JPX A;  1X6I A;  4DL7 A;  3CRX A;  4YMM A;  1KKC A;  2PKE A;  2EQY A;  3KKA C;  1FO4 A;  7ICU A;  5DQH A;  5DG9 A;  3WK8 A;  3N27 A;  1P4R A;  5L3E A;  4HYO A;  3M8S A;  1EN5 A;  3CRC A;  2AGA A;  1N34 O;  2QSA A;  1W59 A;  2A9H A;  4ECS A;  4DEZ A;  2G38 A;  4YFK A;  1S5H C;  1AIL A;  5IIJ A;  4OO1 J;  4TV8 B;  1B04 A;  5ALW A;  2XC9 A;  5KX5 B;  5J2A A;  1M9N A;  1QSY A;  3OT7 A;  3ZMT A;  5JH7 B;  1IBK O;  1L3U A;  4GX0 A;  2LO1 A;  3NS1 A;  4UW9 A;  2KVC A;  4JAS A;  4CGZ A;  5CA3 A;  1RXW A;  4UB8 Z;  4JI7 O;  3ZDA A;  2QE7 G;  3LUT B;  4B9M A;  1LV5 A;  3K08 A;  2MA1 A;  3QX7 A;  7ICM A;  2ISP A;  1NK5 A;  3A0B Z;  4GZR B;  3ISD A;  3ETD A;  1URJ A;  3UMB A;  1V9P A;  3QUB A;  3C1Y A;  1D5N A;  4JI3 B;  3SPJ A;  1YI2 V;  3CNH A;  4CCH A;  2CH7 A;  2UVW A;  4N21 A;  2DPI A;  1NTK H;  3ZRX A;  4I2J A;  3D36 A;  3QVN A;  2GTA A;  3Q4H B;  2Y9U A;  2IU3 A;  4QNL A;  1RM1 C;  4E2L A;  3JAL A;  4QZE A;  2PY5 A;  3F5A A;  4QWB A;  2E1E A;  4C8O A;  1NTM H;  3H9V A;  2OH2 A;  3BRC A;  2Q0O C;  1B06 A;  5ALL A;  4NTW A;  4WFE A;  3RF9 A;  1YCI A;  3UM7 A;  2HSZ A;  3K75 D;  2Y0I A;  4I2I A;  2CRX A;  3OTQ A;  5LOV A;  3ZMS A;  4JI7 B;  3UM9 A;  3LDA A;  1TE2 A;  3QUQ A;  2E8O A;  2WLJ A;  3GWK C;  2W0F C;  3UQ8 A;  4PA4 A;  4GX2 A;  4DYL A;  4FLY A;  1H2M A;  1N8R W;  4P0P A;  3ETQ A;  3TAQ A;  5DBC A;  1F44 A;  5KFA A;  1OCO C;  2CTQ A;  2EH9 A;  4ECV A;  2E75 B;  3RBE A;  3SEI A;  1ZQA A;  2I9G A;  3RW0 A;  1VJ5 A;  4MTO A;  1N62 A;  3RR8 A;  4O9M A;  3RJK A;  2Q68 A;  3RYI B;  4DQQ A;  2W3R A;  1SKS A;  3WK6 A;  4I2C A;  1DOQ A;  4NLB A;  1VF6 C;  3D3I A;  8ICB A;  4GKJ O;  2KZM A;  5AIC A;  2EJR A;  5IWA B;  1BNP A;  4RWU A;  5EYP A;  1IUR A;  1Y76 B;  2FB5 A;  2JEU A;  3ZS8 C;  1R3L C;  4MVZ A;  4RQ2 A;  1GAX A;  4DO9 A;  2RLT A;  1NBM G;  2EIJ B;  1QLN A;  3AG1 C;  2YEV A;  2LGQ A;  3L70 H;  4GCZ A;  5K1P A;  3A0H U;  3DXR A;  4X88 A;  1PD3 A;  3AG7 A;  4FS1 A;  1LVH A;  1NH2 B;  1K73 W;  1F7Y A;  2JRZ A;  1M93 A;  1ZD4 A;  4DUZ O;  1U97 A;  4UB3 A;  2X6C A;  4JI4 B;  3U26 A;  4US9 A;  5B3S C;  4LF6 O;  5LHG A;  4EBC A;  1P7D A;  2QJ1 A;  2FE9 A;  2W9M A;  4JV2 A;  4U7O A;  3K5M A;  2W43 A;  4PL1 A;  4JK1 A;  3GZF A;  4DV5 O;  2ZIV A;  1SKW A;  5CB4 B;  3GU3 A;  1Z5W A;  4MW8 A;  2IJH A;  2WLI B;  4YJ2 B;  2JK5 C;  2ZD9 A;  4F6R A;  3J81 N;  1FS0 G;  2CUG A;  5KFX A;  2YIB D;  1K1Q A;  2F76 X;  1GKF A;  1VDV A;  5B1N A;  2WLN A;  3N2G B;  1QTM A;  2K4I A;  2JV3 A;  1IIP A;  3VOU A;  1K92 A;  4JTA B;  2UU9 O;  4MEY A;  4MFA A;  2UXX A;  2JJ2 G;  5JH7 A;  5EOZ A;  1CI4 A;  3V6H A;  1BT8 A;  1NU1 H;  3MR2 A;  1BGX T;  3K79 A;  3T2M A;  4F3O A;  1ROP A;  1XNQ O;  2ZTD A;  5IDJ A;  4B7E A;  3NAS A;  4ZOH C;  4CF4 A;  1FPO A;  2KG5 A;  4PGX A;  3LNN A;  4KTQ A;  3RRG A;  4AQY O;  1IBL B;  4CH6 A;  3F5E A;  5K4L A;  5F9N A;  1KD1 W;  5HNK A;  2Q4T A;  4YJ3 B;  4O0I A;  3OSN A;  1NJZ A;  1ZRM A;  3OUS A;  5IJ9 B;  2OYY A;  7ICR A;  4IGG A;  2CPR A;  3GIK A;  2EBO A;  3VCB A;  1N32 B;  4IT5 A;  2R18 A;  7ICQ A;  2ZE8 A;  4F2S A;  3K0G A;  4R6Z A;  1N63 A;  1ZQ1 C;  2KJ8 A;  1XO0 A;  5IY5 B;  3C21 A;  1U4B A;  5EIB D;  1PP9 H;  1FIQ A;  1OW5 A;  5GTI Z;  2OCH A;  2WWW A;  3ZRS A;  5AKE A;  1SKR A;  4C7Y A;  5B66 U;  3M7M X;  3L74 H;  1UA1 A;  5GTH Z;  5J2T B;  3EHB B;  4FE3 A;  2PXI A;  3FKS G;  4CF3 A;  4UB1 A;  3BQ1 A;  2OM6 A;  2RDJ A;  3ABM B;  2QM4 A;  3D8C A;  2J6U A;  3WKB A;  8ICE A;  1THZ A;  4DLG A;  2OT5 A;  4X1Y A;  4AHC A;  5JJE B;  2W6J G;  3RFR A;  5LHH A;  1DK1 A;  2IHM A;  2EZY A;  2BQR A;  3H1I H;  5J2F A;  5HHI A;  2YDE A;  1IXR A;  3MR6 A;  3LNM B;  3CMA V;  4NXN O;  3GIM A;  4YD1 A;  5AM4 A;  1LNQ A;  4XRH A;  4DR5 B;  1OCC C;  3PSP A;  3BY6 A;  1T94 A;  3AG4 B;  2OHF A;  2Y0S C;  2HG5 C;  2XAS A;  1ZAU A;  4JPR A;  2JIZ G;  3C2M A;  4DSF A;  4M0A A;  1AP5 A;  3RAX A;  1Z5V A;  3GB7 C;  4XDK A;  1P7B A;  1Q81 W;  2RQ6 A;  4UAR A;  3PR4 A;  3IC9 A;  2UUB O;  1NK7 A;  2E1F A;  3JPP A;  1NKC A;  2QTO A;  2IJJ A;  5ALI A;  2W8L A;  3NTU A;  1T5E A;  2G5H B;  3ISB A;  5L3B A;  4LFA B;  3CCE V;  4O4J B;  3BFR A;  4FLW A;  2HVK C;  2DJV A;  4B9N A;  4RU9 A;  2P7T C;  4RNO A;  1S10 A;  2JEG A;  1W0J G;  4U7N A;  5FNV B;  4JI1 O;  1MOF A;  2K60 A;  5KFR A;  7ICL A;  2E3C A;  4QZI A;  2P6U A;  4QZD A;  5G5G A;  1AR1 B;  1F4M A;  3H1J H;  9ICX A;  1F4N A;  4DS4 A;  4FFK A;  4MSW C;  4BW5 A;  3AQE A;  5AKX A;  1XO1 A;  2F3N A;  3KZX A;  4Q45 A;  8ICK A;  4KL1 A;  1U48 A;  1VMG A;  4DSJ A;  2QKC A;  3G67 A;  1H8H G;  2P66 A;  2UUB B;  1VLB A;  2IJK A;  5ITZ A;  1EBO A;  4IC9 A;  3N2G A;  2F8K A;  1A32 A;  3RR7 A;  4JV1 A;  3KZI U;  4ED8 A;  3JD0 A;  1XRE A;  4P4P A;  2DOS A;  1DRG A;  2HHW A;  1YEW A;  1SC5 B;  4F4Y A;  3Q8S B;  2LYH A;  4QWE A;  3KFU F;  2XAH A;  4YHH B;  4I29 A;  5JQG B;  3ETR A;  1B3Q A;  4BXO B;  1L3T A;  4KLF A;  3QTC A;  4C80 A;  4ECW A;  4GC7 A;  2YMQ A;  5GTH U;  1EZJ A;  1RYS A;  5ALM A;  1XUQ A;  2HFE C;  1GN2 A;  3RN4 A;  2LM1 A;  3J80 N;  1FYJ A;  5EWG A;  4G3I A;  3JPN A;  5IJ9 A;  3JD1 A;  2XO7 A;  4RQF A;  4KN7 A;  5LGU A;  3KCY A;  2F93 B;  3RRH A;  2A19 A;  4QZC A;  2UVV A;  1UPH A;  5L1L A;  4M9L A;  2KG7 A;  5IIM A;  4JI6 B;  2EAP A;  5EE1 A;  3UT5 B;  4QWC A;  1VQL V;  4GC6 A;  4J7J A;  2AGQ A;  2XND G;  4F5N A;  2YMP A;  1MSW D;  1NKB A;  4ELU A;  5IYD O;  4DCC A;  1WCN A;  2W9A A;  1M6Y A;  2WF5 A;  3OPX A;  1LR1 A;  4MTX A;  9ICG A;  3JSN A;  4O2A A;  1SF9 A;  2DQ3 A;  3JD3 A;  2ITC C;  4YVZ A;  5DDM A;  9ICA A;  3OM3 B;  4P9P A;  3BQT A;  3W7X A;  2HBM A;  5KG5 A;  1TKD A;  3ZBH A;  1V97 A;  4IIJ A;  3OHB A;  1Y66 A;  4C8K A;  1TGO A;  3OFN G;  2UXB B;  2XAF A;  1XOU A;  3E86 A;  4P30 A;  1YIT V;  1Q3U A;  4YXW G;  2ESE A;  3KBB A;  1OCR C;  4IRC A;  4EEK A;  1NK6 A;  4TUY A;  2C2A A;  2EZO A;  5BOL A;  1ZQC A;  1NJW A;  1COO A;  2DWD C;  4X66 O;  5IT9 N;  2DKZ A;  2HHT A;  4R8C A;  4B3T B;  1MSD A;  1VEW A;  4BDP A;  2ZJ5 A;  2V9W A;  3PW5 A;  4PHZ A;  3SJA C;  4NLN A;  1KQS U;  3SYA A;  1K34 A;  5KG2 A;  2OTL V;  4H13 B;  2Y1I A;  5DLF A;  1IVS A;  1BGY H;  3EUB 2;  8ICU A;  3CX5 F;  3TFR A;  2H94 A;  2WAQ C;  4GUN A;  3JD2 A;  1PVQ A;  1MA7 A;  1KEC A;  1Z19 A;  4FLV A;  1PVR A;  5FNV A;  4KLS A;  4YIP A;  3MC1 A;  4DK0 A;  3V6J A;  3RJG A;  3RYH B;  4J7Z A;  2LBO A;  4KLM A;  3JPR A;  7ICH A;  4ELV A;  2KB1 A;  3FD9 A;  5FPO A;  2OTJ V;  3HX0 A;  1F23 A;  3I1Y A;  2DYS C;  1X2I A;  2M7W A;  4EYH B;  4KMU A;  1Q86 W;  3HKE B;  3L72 H;  2G0A A;  5AM0 A;  2QLT A;  8ICW A;  4O2B B;  1XHX A;  2ZR2 A;  1VQK V;  1DTO A;  3N97 B;  3DTU B;  3IRU A;  9ICK A;  4UFZ A;  4UVA A;  4LVS A;  4NLK A;  2OEH A;  4QE7 A;  4RPZ A;  1ZQM A;  4IQU A;  5CA0 B;  1RSO B;  3HKB B;  5EBW C;  2W04 A;  3ABL B;  4J9Q A;  1HUZ A;  1R3J C;  4I4T B;  9ICB A;  3OMN B;  5IYZ B;  1WB7 A;  4NM1 A;  2Z5U A;  2K4H A;  3VQW A;  3JPT A;  4LF4 B;  4I2A A;  1QQ5 A;  2ZUB A;  1V55 C;  2ATK C;  3JCZ A;  2BTQ A;  1ZQG A;  5ALV A;  1HNX O;  1PV0 A;  4TSF G;  4X1I B;  4RQ7 A;  4M04 A;  5HMM A;  3L75 H;  2XTA A;  5LP6 B;  1PK1 B;  2XIC A;  3IDW A;  3QU4 A;  3KCX A;  5KG7 A;  1WAZ A;  1SQP H;  3TFS A;  2D3O W;  5EBL C;  4CDG A;  2KSO B;  3EXA A;  4AIL C;  2ATL A;  3PV8 A;  1ZQZ A;  4J10 A;  1YJN V;  2XAJ A;  5J0W A;  4QWD A;  2LGW A;  3SPG A;  3UT5 A;  5LL6 Y;  4LR3 A;  4B3M B;  1QLE C;  2EUL A;  3PJS K;  4P0Q B;  3HKZ F;  4LWS B;  4DR4 O;  1B4F A;  1VF7 A;  5LBQ A;  2KSD A;  1N2X A;  5IIN A;  2W8K A;  1L8L A;  2MK3 A;  4FZL A;  2Q7E A;  3KTQ A;  4LZD A;  2JRI A;  1Q46 A;  3H01 A;  4Z6E A;  1PPJ H;  4CRX A;  4DR1 B;  8ICL A;  1UPG A;  1U47 A;  5ALJ A;  3GV5 B;  3SPI A;  4X65 O;  2GUZ B;  1L7P A;  3NUQ A;  3C2L A;  3OD4 A;  3B0Y A;  4DV4 O;  1UJW B;  3F2D A;  1ENV A;  1OUQ A;  5EK0 A;  1D8Y A;  3KHH A;  3FAH A;  4YY3 B;  5J0Y A;  3THO A;  2X6B A;  4PZO A;  7ICN A;  1AJQ A;  4J80 A;  3OJS A;  1VP7 A;  4JI8 B;  4F50 A;  2H5X A;  1Z00 B;  3GFK B;  1DLB A;  4TQF A;  2K8C B;  4LNU A;  5CHG A;  4I0X B;  1A0P A;  5A2Q N;  1OHH G;  1ZQR A;  2NN4 A;  3GIL A;  4ZOL B;  1JA8 A;  1N36 O;  3SAH A;  2RCV A;  3ZRW B;  1J5E O;  4IRK A;  4LF7 B;  2K4P A;  2WAQ F;  2J6T A;  3KHG A;  4P9O A;  4DL3 A;  3RJI A;  3OEE G;  2V4R A;  4F5R A;  3ABK B;  2L6L A;  5L1I A;  1ZX3 A;  4Z1M G;  2DKX A;  3T1Y O;  1HJP A;  5ALD A;  2FMQ A;  3NVV A;  1BMF G;  2FLN A;  4QZG A;  1NK9 A;  1I5X A;  5BZB A;  5LMU O;  5LXT B;  3SI8 A;  4P4O A;  1A6S A;  1H38 A;  4OJ5 A;  2FDR A;  4GKK B;  5FPR A;  3RJJ A;  3K57 A;  2AGO A;  1R6N A;  4H37 A;  3CCL V;  1NOM A;  1W2B U;  3CRA A;  4O2B A;  3WFV A;  1TAM A;  3A8T A;  4CS2 A;  3G6V A;  5B1A C;  1I5Y A;  1QNM A;  3SV4 A;  1TAU A;  1R3K C;  4TV9 B;  4IS7 A;  5AI4 A;  4FBT A;  1Q6I A;  5CA0 A;  4X62 O;  4LF8 B;  4L87 A;  5DM6 V;  4FLT A;  3B8M A;  3T1Y B;  4LF9 B;  3RGB A;  3ICX A;  4I4T A;  5IJ0 A;  3O65 A;  3MHH C;  5IYZ A;  2BCV A;  2ES6 A;  2G08 A;  1IBM B;  1ZQW A;  2FLP A;  3I28 A;  5ALO A;  4DR2 B;  1C20 A;  2VQF O;  1XSP A;  3AU2 A;  1UA0 A;  3UO3 A;  1NJI W;  3JAM N;  3AMZ A;  3RVZ A;  5CR0 A;  4TT3 G;  5LP6 A;  2Q0A A;  4KLO A;  1JOY A;  4M47 A;  2YIB A;  3D36 C;  1X4T A;  2KKV A;  2HLD G;  3JAT B;  4C0Z A;  4MW3 A;  5KFJ A;  1AI4 A;  1M56 C;  2NRT A;  1K4C C;  2UXN A;  2ZDI A;  2PGG A;  2KJ5 A;  3T1H O;  3IG8 A;  4USA A;  2EIL C;  3KOO A;  5ALK A;  2DYR C;  1COW G;  4P0Q A;  1M5I A;  4LWS A;  1ZD3 A;  2VJ4 A;  1TUE B;  1E1R G;  4O3N A;  2GHY A;  2YID A;  5T14 A;  4FFB B;  1JX9 A;  3DC6 A;  3GIJ A;  1S5L U;  4NLG A;  3PW4 A;  4R8U A;  3GWO A;  4LFB O;  4JYA B;  5ALX A;  4YG2 A;  3RVY A;  1CRX A;  2IJI A;  4FM2 A;  1V54 B;  3SJB C;  5LMN B;  1BPY A;  4C4S A;  4K0K O;  1KRP A;  1HNZ O;  5ALH A;  1WUD A;  1XSN A;  2BSK A;  2Y1J A;  2CDY A;  4NXM B;  4ACO A;  2HOF A;  3PZP A;  5JVD B;  2QEX V;  5AKJ A;  1OCZ C;  5KA6 A;  5TIS U;  3T1H B;  2NNU A;  3KHL A;  2KFN A;  1EZV H;  4OD0 A;  3ASO C;  4DV0 O;  4F4Z A;  3E8F A;  1ZJN A;  3N2K B;  3PST A;  1K8A W;  1QR8 A;  5C8Y A;  1YT3 A;  4I0X A;  2QTS A;  1K4D C;  5L3C A;  3CP8 A;  4Y2V A;  4NTX A;  2LFR A;  1Z2G A;  4MTG A;  2F1J A;  4BJQ A;  4PV1 B;  4I2G A;  2BPC A;  4J9P A;  1P7G A;  4O3S A;  1X42 A;  4BGD A;  3RYF B;  4JYC A;  2EAM A;  3HB3 B;  2ADQ B;  1U49 A;  3OMA B;  4YP3 A;  1FFT B;  5JUM A;  3MD0 A;  3QO5 A;  3CCJ V;  2PTM A;  4M9N A;  3ED5 A;  2ZNI A;  1L7O A;  3ZHQ A;  2ZIX A;  5C93 A;  1CP9 A;  3RH6 A;  3SYZ A;  4JAA A;  1SER A;  1TV9 A;  3Q8M A;  4KLQ A;  5KT4 A;  5EC2 C;  5LYJ B;  1JRO A;  3QU5 A;  4PL2 A;  5KG4 A;  3VQV A;  3R9K A;  3ZI4 A;  5B1B B;  5AM3 A;  2LQT A;  3HKD B;  3PO4 A;  5J2U A;  4TWK A;  2Q8V A;  3K06 A;  3G6E V;  1PM9 A;  5KFU A;  3FYI B;  4B6J A;  2ZIU A;  4YCX A;  3FAV A;  4O4H A;  3N4M B;  5AIA A;  2KKP A;  3ZX6 A;  5CA1 B;  3OHA A;  4CH4 A;  2Z0A A;  1RQN A;  4FFD A;  4MF8 A;  2ALZ A;  4DFP A;  1XIL A;  2EJ7 A;  2YIC A;  2G5I B;  2AHO B;  4CC6 A;  4BIU A;  3PX0 A;  3ORY A;  4MVM A;  2DE0 X;  3GDX A;  3MGI A;  2DL0 A;  4J11 A;  2XT9 A;  3RH4 A;  3H1K H;  3QEA Z;  2B21 A;  2P35 A;  1JRP A;  1DF5 A;  4JI5 B;  3Q8Q B;  4DV2 O;  2IBZ H;  4UAW A;  4RQN A;  5BXZ A;  2DBY A;  3ZD9 A;  5B1O A;  5LHI A;  2K4E A;  1K97 A;  2WA3 A;  1ZQI A;  5KTQ A;  3CJH B;  3F2B A;  2BOB C;  4QZF A;  4DR3 O;  2HBL A;  3RJF A;  4WFG A;  3JAT A;  4JI3 O;  3MAB A;  3Q8L A;  3A0H Z;  3BQ0 A;  1SRY A;  1URF A;  4I55 B;  1X40 A;  2XCA A;  2BTO A;  5KFQ A;  3OR7 C;  2KJ9 A;  2C2D A;  4UAU A;  2HW3 A;  1F0M A;  2QB1 A;  5TZV A;  4RO2 A;  4P4M A;  4NKG B;  4Y2X A;  1WA8 B;  2EIN C;  1ZUQ A;  3K1R B;  4RZR A;  5EE9 A;  2JXJ A;  1QSS A;  1UHU A;  4FFB A;  3I5D A;  4B7K A;  1MQ2 A;  3UXO A;  5D4B A;  5AKZ A;  7ICF A;  2V4Q A;  4DV2 B;  5F9L A;  1Z1B A;  1ZL8 B;  3EW9 A;  5KT7 A;  4Y2P A;  3QZ8 A;  4L8J A;  3DV9 A;  3SR6 A;  1VQ7 V;  2JVD A;  2WB1 C;  2BCC H;  4JGS A;  4DR3 B;  1DGS A;  4DO2 A;  1P49 A;  3U0Z A;  9ICP A;  1RP3 B;  3TAC B;  1M4U A;  3RBZ A;  5JVD A;  4Q8F A;  3WU2 U;  2CTR A;  3IV6 A;  4IQT A;  5ALZ A;  3K9A A;  4KX3 A;  1HW7 A;  3B2E E;  3CCM V;  2YXL A;  2GSM B;  2OIG A;  4PGQ A;  4I28 A;  3WK5 A;  2RNB A;  1XEQ A;  3RB3 A;  3L5K A;  5AKK A;  3MFH A;  4UB6 U;  4JWM A;  5IWA O;  4HAM A;  2C28 A;  4LFC B;  4RUA A;  2CAZ C;  1N5W A;  4ICA A;  4BWA A;  9ICO A;  3W7U A;  4DSE A;  3MGH A;  3FC4 A;  4Y2Q A;  4YQW A;  1AP6 A;  1XWL A;  5GON A;  2E5L B;  3P3P A;  3ABU A;  5IYC O;  5CB1 A;  5KFZ A;  1SA0 B;  4JI4 O;  2NO5 A;  3PMN A;  4C8M A;  4WF9 V;  2ZXI A;  2FL4 A;  5AIB A;  2QWN B;  3TXS A;  2VRZ A;  1M57 B;  5KT2 A;  1T3Q A;  3F5T A;  5B66 Z;  3IFX A;  3RJH A;  1SQF A;  1SQQ H;  1KKD A;  2MAX A;  2I1Q A;  1CUK A;  1K5O A;  4YR2 A;  1ZQY A;  5ALU A;  1NI8 A;  2FYU H;  3PSF A;  5KFM A;  3L4P A;  5J0X A;  2GBO A;  1JFF B;  3CCS V;  3HWT A;  5AM5 A;  3PO5 A;  1GN4 A;  5AK6 A;  3K9S A;  3MAQ A;  4M6W B;  4JI2 O;  2KZZ A;  4UVC A;  1ZJM A;  3SYO A;  5BY1 A;  4I2D A;  4B9V A;  5HR7 A;  4JZ2 A;  2ZIN A;  7ICJ A;  4M9G A;  4IHJ A;  1KKX A;  1I7F A;  1VAR A;  1RZT A;  2EZZ A;  2G06 A;  8ICT A;  2WSS G;  3CME V;  4HBN A;  4DRX A;  1AJN A;  4PJ0 U;  1JMS A;  5J0O A;  2QWO B;  1Q90 D;  1NK0 A;  1ZQK A;  2ZM6 B;  4PA9 A;  1TVK B;  5J8Y A;  1KFD A;  1IBL O;  4DS5 A;  2PI4 A;  1LUW A;  4K3A A;  5KLV H;  1RM1 B;  4DOB A;  3WK7 A;  4CNQ A;  5IY5 C;  1NT2 B;  2YB1 A;  1JJO A;  2A1J B;  3K58 A;  1DGJ A;  1YTF B;  1N32 O;  2DUY A;  2GO7 A;  3T4Z A;  4F72 A;  3TAD A;  2BQ3 A;  9ICL A;  3AK2 A;  3JD4 A;  4JI2 B;  2K8B B;  9ICT A;  2LHT A;  8ICM A;  4FJC C;  1GTO A;  4TV8 A;  4MVQ A;  4UCT A;  1QBZ A;  5J0Q A;  1WA8 A;  2WLH A;  5KX5 A;  4PHP A;  4KLD A;  3HIL A;  4FS2 A;  2W0X A;  1ED1 A;  5KT6 A;  2WB1 F;  2F66 C;  1OCO B;  3R66 A;  1SQV H;  1ZL8 A;  2IA6 A;  4RAI A;  2Q69 A;  4DF8 A;  2JS5 A;  2W3S A;  5J2C A;  1ORQ C;  4XUS A;  2N04 A;  3AEI A;  5J2G A;  1JJ2 U;  4QNH B;  1RDF A;  2WTF A;  1FXH A;  3TAR A;  1S5J A;  5AM1 A;  1ZSP A;  1EXN A;  3AG4 C;  4H44 B;  4Q43 A;  2YY6 A;  4OXS A;  3KZI Z;  1FAF A;  4RQ3 A;  4DSK A;  1GRJ A;  1XMO B;  3H7I A;  3ZHV A;  4DR5 O;  1X9M A;  2AHY A;  3FM9 A;  5KFD A;  5IE9 A;  3BDP A;  3Q4H A;  9ICJ A;  2DMX A;  2KQX A;  1WYG A;  3LWM A;  4U3J B;  1N5X A;  1JUD A;  4Z1V A;  1UCV A;  3C3T A;  2FTK A;  3BCC H;  4BIO A;  1BL8 A;  3L3F X;  4FMT A;  4GFJ A;  4PHE A;  4UCR A;  4DL4 A;  1S0M A;  3B09 A;  2KFZ A;  1MC8 A;  4RPY A;  4G9B A;  4O3Q A;  2A1A A;  5EE0 A;  2P90 A;  5E1A C;  3NVW A;  4KLG A;  4ED0 A;  2KE7 A;  4Y2U A;  4LFA O;  5AK4 A;  1SA0 A;  1BQZ A;  4MVO A;  4I9Q A;  1KLN A;  4PHA A;  1SIJ A;  3UCS C;  8ICO A;  4LP8 A;  1BHB A;  5EE3 A;  2AHZ A;  4KX5 A;  2E8P A;  5L1J A;  3E8G A;  2D6F C;  1YZ6 A;  1EN6 A;  4X64 B;  3W7W A;  1QHT A;  2VKQ A;  4GXK A;  4FPP A;  5G5H A;  2PYL A;  4EEY A;  1Q43 A;  3IAY A;  4OX9 B;  4LCU C;  2RMK B;  3RYI A;  3P30 A;  4TUS A;  5ALR A;  8ICQ A;  1S0O A;  4I2F A;  2CXY A;  5L3G A;  2HI0 A;  8ICZ A;  3E89 A;  1S8O A;  3E83 A;  1Y76 A;  4U3F H;  4M6W A;  3FYH A;  3RTV A;  4CZZ A;  9ICM A;  5C0Y A;  2YI9 A;  2GOL A;  5ALG A;  7ICI A;  3K5L A;  4BW9 A;  4QIW F;  4I27 A;  3EWA A;  4DF4 A;  4CS4 A;  2FLL A;  3ETG A;  2MUT B;  4A8E A;  3FYE B;  5KUM A;  4EX6 A;  5L1M A;  5C5J A;  2BKE A;  4ELT A;  5CBG A;  1YZ7 A;  1ZQU A;  1BS3 A;  2KVS A;  1GM9 A;  1YVW A;  2EIK B;  4X5V A;  4YHH O;  1XHZ A;  2QKQ A;  3CCU V;  1KTQ A;  2JEF A;  1IX9 A;  2KZ3 A;  4MEX A;  5KFE A;  4C7U A;  2PYJ A; 
#chains in the Genus database with same CATH homology
 3JCZ A;  2LKY A;  4ZKI A;  2EIN B;  4TSF G;  3ASN B;  3VBB A;  1L1F A;  4FK5 C;  1B6Q A;  3N7P D;  2ITD C;  3P32 A;  2XIC A;  1S0V A;  3F53 A;  2NV3 A;  2F2A B;  4PA6 A;  4QE9 A;  3IGA C;  2A3V A;  2WLI A;  2Y69 B;  5KUK A;  4O3M A;  2D3O W;  3N7S C;  3OMI B;  4CDG A;  2G09 A;  2IH1 C;  5EBL C;  2BDU A;  2DW4 A;  1L6N A;  1YJN V;  5HFM A;  1KP3 A;  3R65 A;  2JGA A;  2XAJ A;  3IG5 A;  3SPG A;  2M0N A;  2LFS A;  5CBH A;  1QLE C;  2Q6A A;  3PJS K;  4P0Q B;  3HKZ F;  4MTF A;  3SAF A;  4PEL A;  3UKM A;  5KL1 B;  4WJ3 B;  5LBQ A;  1M56 B;  2B5U A;  4Q20 A;  3T1C A;  2EZP A;  4QIW C;  4GT1 A;  1F51 A;  5DN6 G;  2K1E A;  2MK3 A;  4FZL A;  3TK1 A;  2DF4 B;  4BIZ A;  3CC4 V;  2DYR B;  3H01 A;  4JF3 A;  2G07 A;  4CRX A;  2WAM A;  3SPI A;  1QR9 A;  3NUQ A;  3O0F A;  1R73 A;  2XID A;  1SES A;  1ZWI C;  1S77 D;  1KC8 W;  1QVF U;  3MGV A;  1UJW B;  4MVS A;  3LVV A;  3F2D A;  1ENV A;  1OUQ A;  5EK0 A;  2ZQM A;  4P0P B;  4PA7 A;  5A0L A;  1Q3V A;  2X6B A;  3G71 V;  1AJQ A;  2ZXW C;  4LBE C;  3CC7 V;  1JQ0 A;  1PKX A;  3ABM C;  3LDC A;  4BAY A;  1VQN V;  1DLB A;  2ZIW B;  4G27 B;  2K8C B;  1VQO V;  3SQI A;  1A0P A;  2HBJ A;  1OHH G;  2F8L A;  4JMU A;  3WG7 C;  3W7T A;  1BHA A;  3JYC A;  3SAH A;  1OCZ B;  3ZRW B;  3HKZ C;  2WLM A;  5FL7 G;  2WAQ F;  1HEK A;  5HR6 A;  2A0L A;  3ASO B;  3I56 V;  2IU0 A;  2XAQ A;  5H6R A;  4P9O A;  2H8P C;  4XBF A;  1YJW V;  2W6I G;  3ZN1 A;  2YEV B;  2VIX A;  3IN5 A;  1NR1 A;  3C28 A;  3OEE G;  1VQ4 V;  3ABK B;  1AI6 A;  4RUF A;  2KD1 A;  4Z1M G;  1FXK B;  1Y4M A;  2H3Z A;  1BMF G;  5H6Q A;  3ABT A;  2EIM C;  3OR6 C;  4U7C A;  3AG1 B;  1I5X A;  3T79 A;  2OCC C;  3ZIA G;  4CBC A;  5BZB A;  2KHQ A;  1A6S A;  1JPX A;  2DWE C;  5IYB O;  1YJ9 V;  1H38 A;  1QCE A;  4OJ5 A;  2WLL B;  3CRX A;  1D8B A;  4F4L A;  4OJP A;  1PL0 A;  5B3S B;  1R6N A;  4H37 A;  3CCL V;  3I55 V;  5EC1 C;  1W2B U;  1P4R A;  3WFV A;  3DEE A;  5L3E A;  2OXO A;  4HYO A;  1TAM A;  4BUG A;  3ABL C;  2EIK C;  3F7Y C;  4X8A A;  5B1A C;  1WLE A;  1I5Y A;  3K0D A;  3HPL C;  1QVG U;  2A9H A;  1R3K C;  3CD6 V;  3E0F A;  1S5H C;  4GX1 A;  4OO1 J;  2JH1 A;  3CP1 A;  4QPK A;  4L87 A;  4UVB A;  4NLC A;  3B8M A;  3E8H A;  5DM6 V;  2F77 X;  1M9N A;  2F43 G;  3ICX A;  3MHH C;  3PSI A;  3ZMT A;  2G08 A;  3ML0 A;  1S72 V;  2JJ1 G;  2XI9 A;  4GX0 A;  3LDE A;  2W7P A;  2KVC A;  4JAS A;  3CCQ V;  1M1K W;  4CGZ A;  3X2Q B;  5CA3 A;  2A79 B;  1FXV A;  2QE7 G;  3LUT B;  2ZDI C;  3K08 A;  2Q67 A;  3ZMU A;  2MA1 A;  1NVP D;  2QA4 V;  1NJI W;  3RVZ A;  4TT3 G;  1JOY A;  4PDV A;  3OW2 U;  1VQP V;  4I9W A;  4H33 A;  2KKV A;  2HLD G;  1KBU A;  4C0Z A;  3ETD A;  4MW3 A;  1URJ A;  4ZBM A;  3SPJ A;  1YI2 V;  1AI4 A;  1M56 C;  4WCE V;  1K4C C;  2UXN A;  2ZDI A;  2KJ5 A;  2R9I A;  2H3V A;  3IG8 A;  3QNE A;  4N21 A;  4MT8 A;  2EIL C;  4FZN A;  3ZRX A;  3D36 A;  3DGE A;  1E1Q G;  4PDM A;  2DYR C;  3EFF K;  1COW G;  4P0Q A;  2VJ4 A;  2IU3 A;  1TUE B;  1E1R G;  2GHY A;  4QNL A;  1RM1 C;  4E2L A;  1YIJ V;  5T14 A;  3F5A A;  2E1E A;  2JHD A;  1MAB G;  2OH2 A;  1JX9 A;  1R3I C;  2Y48 A;  4WFE A;  3RF9 A;  1S3J A;  3UM7 A;  3GWO A;  4RUE A;  1Q82 W;  3KG2 A;  2CRX A;  4G28 B;  1SET A;  3ZMS A;  3RVY A;  1CRX A;  2IW5 A;  2IJI A;  2WLJ A;  3T4D A;  1H8E G;  1V54 B;  3K3W A;  2W0F C;  2JMG A;  4PA4 A;  2CN1 A;  4GX2 A;  3ZRV A;  1N8R W;  1WUD A;  4P0P A;  4ACO A;  2DGZ A;  1F44 A;  2MRL A;  3PZP A;  2HOF A;  1NQT A;  1OCO C;  3FB8 C;  2X6A A;  5KA6 A;  1OCZ C;  5L3F A;  2QEX V;  2NNU A;  2JEX A;  4JYB A;  3ASO C;  2Z7J A;  3E8F A;  3RW0 A;  3PST A;  4MTO A;  1K8A W;  1QR8 A;  1YT3 A;  4R7C A;  1K4D C;  1SZT A;  2Q68 A;  5L3C A;  3CP8 A;  2B1G A;  4NLB A;  3ABK C;  3D3I A;  1XL6 A;  2LFR A;  4MTG A;  2DQ0 A;  3OUF A;  1FXK C;  2EJR A;  4BJQ A;  3ONN A;  1OCC B;  1VQ8 V;  3ZJZ A;  4U6P A;  1IXM A;  2JEU A;  1R3L C;  4MVZ A;  2PMZ C;  4HZ3 A;  5KA5 A;  1NBM G;  2EIJ B;  3AG1 C;  4GCZ A;  2YEV A;  4WFH A;  4P2Z A;  1QLN A;  4X88 A;  2CK3 G;  1PD3 A;  4RQE A;  1FXK A;  4JYC A;  3HB3 B;  2DYS B;  2H3Q A;  1NH2 B;  1K73 W;  3OMA B;  1FFT B;  2K89 A;  1VQ5 V;  2RRD A;  3CYM A;  2X6C A;  3MD0 A;  2KOB A;  2VJ5 A;  3QO5 A;  5B3S C;  5LGN A;  3N7R C;  5LHG A;  4JTD B;  1YHQ V;  2ZIX A;  5C93 A;  1CP9 A;  2KIW A;  2WPD G;  3CCV V;  4I5S A;  1P7D A;  3CCJ V;  3H0M B;  3B77 A;  1SER A;  2WLL A;  5EC2 C;  4PL2 A;  4U7O A;  4QPJ A;  2YSU B;  5B1B B;  1AI5 A;  1XL4 A;  4PL1 A;  4JAV A;  4TWK A;  3H0R B;  3GZF A;  2ZIV A;  3K06 A;  3G6E V;  4NWI A;  3FYI B;  2ZIU A;  3GU3 A;  4LC1 A;  4J9Y B;  4MW8 A;  2IJH A;  2WLI B;  4WFA V;  1V55 B;  2KKP A;  2JK5 C;  2ZD9 A;  3ETE A;  3AG2 B;  1FS0 G;  2P67 A;  2F76 X;  2YX8 A;  1GKF A;  2G5I B;  1GMG A;  5HFL A;  5B1N A;  2WLN A;  3LSS A;  2IH3 C;  2K4I A;  3X2Q C;  4BIU A;  1IIP A;  1ECW A;  3STZ C;  1K92 A;  4MVM A;  3VOU A;  3STL C;  4JTA B;  2UXX A;  4WFB V;  2JJ2 G;  5H9C A;  1DF5 A;  1NVP B;  3K79 A;  3T2M A;  1ROP A;  5B1O A;  5IDJ A;  3LVW A;  5LHI A;  2K4E A;  2W03 A;  1K97 A;  3F2B A;  1PNM A;  2BOB C;  1PNK A;  2HBL A;  5GW7 A;  3F5E A;  1CPY A;  4UXN A;  4WFG A;  3SYQ A;  1PVP A;  1M90 W;  1KD1 W;  2Q4T A;  3SAG A;  3OUS A;  1SRY A;  2OYY A;  3TCU A;  2Y0S F;  2CPR A;  1VQ6 V;  2EBO A;  3VCB A;  3OR7 C;  2KJ9 A;  2R18 A;  3H0L B;  1AJP A;  2QM7 A;  2QKS A;  4RO2 A;  5J9P C;  1YTF D;  3E35 A;  3K0G A;  4R6Z A;  1ZQ1 C;  2KJ8 A;  1XO0 A;  5IY5 B;  2X0L A;  2R9R B;  3AQF A;  1J95 A;  3F2C A;  2EIN C;  3ASN C;  3C29 A;  2WWW A;  3ZRS A;  2DQN B;  1JVM A;  5CN0 A;  1V54 C;  2Y69 C;  3EHB B;  3K03 A;  4FE3 A;  1MG1 A;  3FKS G;  1Z1B A;  2ZXW B;  4UV9 A;  2KIC A;  4FZM A;  2OM6 A;  1GM7 A;  3ABM B;  3FB5 C;  1XNS A;  3SPH A;  2NLJ C;  1VQ7 V;  1THZ A;  2OT5 A;  2WB1 C;  4JGS A;  4ASU G;  5LHH A;  2W6J G;  1HWY A;  1NZB A;  5CRX A;  2HKO A;  2X7R B;  4DO2 A;  3LNM B;  4FIP C;  3RBZ A;  3CMA V;  2P6J A;  1LNQ A;  3K9A A;  4KX3 A;  4DXW A;  1OCC C;  3PSP A;  3BY6 A;  3IC7 A;  2GSM B;  3B8N A;  1T94 A;  4X89 A;  3CCM V;  3AG4 B;  3IP4 B;  2Y0S C;  2HG5 C;  2XAS A;  2PMZ F;  3OE7 G;  1S76 D;  4JPR A;  2JIZ G;  3LDD A;  1VQ9 V;  1K5S A;  3GB7 C;  4HAM A;  4XDK A;  3CC2 V;  2LYB A;  1P7B A;  2OCC B;  1Q81 W;  3CYO A;  4ICA A;  1OCR B;  1GK9 A;  1Q7Y W;  3W7U A;  2HMX A;  3AG3 B;  2E1F A;  2QTO A;  2IJJ A;  2ZR3 A;  3E2E A;  4KP4 A;  2H3F A;  3SJQ C;  3LSQ A;  2N1R A;  3ABU A;  4J9Z B;  4KFM A;  5IYC O;  2G5H B;  1W0K G;  2ZG6 A;  4OJL A;  3ALR A;  5L3B A;  3QO7 A;  3CCE V;  4WF9 V;  2ZXI A;  3ZN0 A;  3ZCC A;  2JH7 A;  2HVK C;  1M57 B;  5B1A B;  1GM8 A;  2P7T C;  3IFX A;  1NR7 A;  2HVJ C;  1KKD A;  1W0J G;  4U7N A;  1MOF A;  2ZIW A;  4AYB F;  3AG2 C;  3PSF A;  1K33 A;  4PDR A;  4WFF A;  1AR1 B;  2HBK A;  1H2G A;  3FB7 C;  1F4M A;  3ZMZ A;  3G4S V;  1F4N A;  3ZRW A;  3CCS V;  4MSW C;  4BW5 A;  3AQE A;  3KZX A;  3M99 B;  2LP7 A;  4UVC A;  1H8H G;  3SYO A;  5HR7 A;  2IJK A;  4QJF B;  2WLK A;  1EBO A;  4IC9 A;  1YSC A;  2XOK G;  2G06 A;  2WSS G;  3JD0 A;  2KNJ A;  3CME V;  2ZXH A;  1DRG A;  1AJN A;  3MHS C;  4PDL A;  3KFU F;  2BOC C;  3A0R A;  2XAH A;  2EIL B;  1K5Q A;  2KHV A;  3VC8 A;  1E79 G;  4PA9 A;  3FB6 C;  4JTC B;  5KL8 B;  2PI4 A;  1DF4 A;  1EZJ A;  2HFE C;  1RM1 B;  1SZH A;  3K1Z A;  4NV0 A;  2HOI A;  5IY5 C;  2YB1 A;  3JD1 A;  1YTF B;  4XDJ A;  3SYP A;  1WPX A;  4RQF A;  4AYB C;  1AI7 A;  3T4Z A;  5LGU A;  3JD4 A;  2K8B B;  1RPR A;  3F5W C;  2LHT A;  3OEH G;  1UPH A;  1GTO A;  4FJC C;  3CXC U;  4N23 A;  2HJF C;  2V1D A;  4MVQ A;  1QBZ A;  1VQL V;  2WLH A;  5L3D A;  2RP5 A;  2XND G;  1MSW D;  5IYD O;  1ED1 A;  1NKD A;  2WB1 F;  1OCO B;  3K04 A;  3OPX A;  4MTX A;  2B1I A;  4RAI A;  1QLE B;  1R6K A;  2GH1 A;  2Q69 A;  2DQ3 A;  1ORQ C;  3E8B A;  4OJO A;  2ITC C;  3JD3 A;  3OM3 B;  3AEI A;  4P9P A;  2Z3Y A;  3W7X A;  2HBM A;  3W7S A;  1JJ2 U;  4QNH B;  2PI5 A;  1FXH A;  4R50 A;  3RFA A;  1Y66 A;  3NXS A;  3OGC C;  3OFN G;  4XDL A;  3AG4 C;  1PNL A;  1VQM V;  2XAF A;  4OXS A;  3E86 A;  4MS2 A;  4P30 A;  1YIT V;  4UV8 A;  1Q3U A;  4YXW G;  4G2K A;  2AHY A;  1NH2 D;  1ARO P;  3CCR V;  2ZIX B;  1EFR G;  1OCR C;  1G4Y B;  3M6K A;  2C2A A;  2EZO A;  3AG3 C;  4JAU A;  2H3I A;  1KP2 A;  2DWD C;  2YB4 A;  1G8M A;  2FTK A;  2HOQ A;  2JDI G;  4R8C A;  1BL8 A;  2HR3 A;  3L3F X;  4FMT A;  5LGT A;  3F7V C;  2ZIV B;  4GFJ A;  4MVU A;  1CEZ A;  2ZIU B;  1KQS U;  4PA3 A;  3SYA A;  3LYS A;  3CPW U;  2V7Q G;  2LYA A;  3M6Z A;  1M57 C;  1K34 A;  2OTL V;  2P90 A;  5E1A C;  2KEY A;  3WG7 B;  4MVR A;  4MVO A;  3TET A;  4EKW A;  1OZ0 A;  5CBF A;  2H94 A;  2WAQ C;  5CMU A;  1K9M W;  3AL0 B;  4LP8 A;  3JD2 A;  1BHB A;  1PVQ A;  1MA7 A;  2AHZ A;  4OJ6 A;  4KX5 A;  1Z19 A;  1KEC A;  3E8G A;  3SPC A;  2E5S A;  2D6F C;  1K3E A;  1PVR A;  3W7W A;  1K7D A;  2VKQ A;  3D2N A;  4FPP A;  3D2S A;  2EIJ C;  3SMV A;  4GX5 A;  3D2Q A;  2XAG A;  4LCU C;  2K8A A;  1HIW A;  3P30 A;  2LBO A;  1RPO A;  2EIM B;  2KB1 A;  4KUM A;  5L3G A;  3E89 A;  3NRW A;  1F23 A;  2OTJ V;  2DYS C;  2XVT A;  2M7W A;  1Q86 W;  2QM8 A;  2G0A A;  4BX9 C;  3BEH A;  3E83 A;  2RHF A;  2KV2 A;  2ZR2 A;  3OAA G;  4UUJ C;  1DTO A;  3DTU B;  4CZZ A;  1VQK V;  5C0Y A;  4KMO B;  2GOL A;  4UVA A;  4QIW F;  5KUM A;  3ETG A;  4QE7 A;  4A8E A;  3FYE B;  3QO8 A;  5B1B C;  5EBW C;  2W04 A;  5CBG A;  5EBM C;  1GO3 F;  3ABL B;  3ZMV A;  1GM9 A;  1R3J C;  2EIK B;  1JCH A;  3M7D A;  3CCU V;  3OMN B;  2Z5U A;  2K4H A;  2ATK C;  1V55 C;  3SYC A;  2W7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...