4QJFB

X-ray crystal structure of thermocuccus kodakarensis rna polymerase rpp4/rpo7 (rpof/rpoe) complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
122
structure length
122
Chain Sequence
b'MIGRKKLEEHYITIAEAKELLERRHAEGLAENPEEPMFYEARVSLEHAERFAKLKPEQARELKEKLMGLFDWINERIAAKLVDILPEDYLDIRVIFAKEEYMPTPEEAEEIIKVIDEYRPLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase, subunit E'
publication title Crystal structure of euryarchaeal RNA polymerase and insight into the evolution of RNA polymerase II structure
rcsb
source organism Thermococcus kodakarensis
molecule tags Transcription
total genus 39
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4qjfB02
1.10.287.420 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4qjfB01
4NLBA 2E1EA 1D8BA 4QJFB 1GO3F 2CPRA 1YT3A 2HBKA 2MA1A 4O3MA 2DGZA 2HBJA 2KV2A 2HBMA 1WUDA 3SAGA 3SAFA 2HBLA 3SAHA 4CDGA 4CGZA 4OO1J 5C0YA 2E1FA 2RHFA 2RRDA 3CYMA 4NLCA 4QIWF
chains in the Genus database with same CATH superfamily
1BE3H 1W0JG 3GVMA 2I6XA 9ICKA 5J0RA 1O03A 4P4PA 4MEXA 3SJCC 4RQFA 3J7AU 1OCOB 1GO3F 4JAVA 2HP8A 4GXJA 4DS5A 3QUBA 1N34B 1JCHA 3G71V 1PNKA 4F4YA 1JROA 3GB7C 4G27B 2Q7EA 3QEAZ 2EAPA 3CRCA 8ICFA 1BT8A 1D8LA 1A6SA 3JPOA 2AJQA 1WLEA 1SV0A 4RNOA 1SGGA 4DFKA 4L87A 2Z0AA 1N56A 4KX3A 3OGUA 4CDGA 5DGAA 1XSLA 4EFEA 9ICMA 3RYIA 2JEFA 4UCSA 2RHFA 2YTUA 1C20A 5JTIA 2JEGA 4UCVA 1IDSA 5AM0A 3SEIA 4C80A 2MRLA 2F2AB 3F5EA 3ZHUA 3PV8A 5J0PA 3RR8A 3MR3A 1PD3A 4O3OA 1XILA 3JAMN 5ALWA 4KLTA 5KFWA 4JYCA 3VBBA 4EBCA 4GX1A 1L0NH 5L9XA 2NRVA 2R9AA 1XI1A 1AJPA 4KLLA 1EM1A 2F1IA 4MW3A 1ZRMA 3WKAA 4GLXA 1U4BA 1V85A 1KQSU 2QKAA 1Q90D 2LO1A 3WU2U 2LJ2A 4IR1A 4DSKA 3B4SA 3FB8C 3HT3A 9ICJA 1B0XA 4ZHQB 1VQNV 3BA9A 1I0HA 2JJ2G 4GX5A 5AK6A 4ZBMA 2Q4PA 3C2KA 1PUZA 4Q8EA 2WSSG 1N5WA 3ICXA 4DSEA 3GIJA 1M56B 1NJZA 3SYOA 3TACB 2ETNA 2YIAA 3RYFA 1BSMA 4FLWA 3LDAA 3N97B 1FFXA 2ZE8A 3H01A 5AKHA 4IQVA 3UMGA 4DLEA 2ILMA 2PFQA 4YY3O 4RT3A 1J95A 1JALA 3HP6A 1XHXA 3ASNB 2BTQB 1SZHA 4IT5A 1SA0A 1SA0B 3E8FA 4Y2UA 2FLLA 5AI9A 5CHGA 2DF4B 1H2NA 1TGOA 5FPOA 3DGEA 3CC2V 1WCLA 2LFSA 3PNCA 1ZL8B 1ZQWA 4B3SB 8ICIA 2ZTCA 4CZZA 4H37A 4LZGA 4H33A 4DK0A 1Z2GA 3L3FX 4YD2A 2WF5A 3V7KA 1HNZO 1YDXA 1FXHA 4NLNA 1HUOA 3C29A 4ZKIA 4CH3A 2VJ4A 4ABMA 1H8EG 5L3GA 2OYYA 1IBKO 1L8OA 5J0TA 1M9NA 5D49A 4L8JA 4MSWC 4CS3A 5DGBA 4FM2A 5HMLA 4PDMA 2QWRB 1R6NA 5IIMA 4FJCC 4NJ8A 4WFAV 5LMNB 1OHHG 1BCCH 8ICWA 3GV7B 3TAQA 1BNPA 4QWEA 2XAFA 3KOOA 4JTCB 4X89A 4F5PA 5CRXA 1BPYA 4IIJB 1XSNA 5KT2A 1I5YA 4YHHB 2BSKB 2YMLA 1EXNA 3K5LA 2W04A 5FP0A 8ICAA 4BXOA 2NRWA 2ZUCA 1IBMB 1L3TA 4R50A 1A32A 4I55A 5AI5A 1VF6C 2ZDIA 5EOZA 3KHGA 1O9GA 3ED5A 2JV3A 2DGZA 4FLXA 4UV9A 3LWMA 2LM4A 3RW0A 1NR7A 2LW7A 2PI4A 1I94O 3CP8A 3FC4A 2EZYA 3PR4A 3OMNB 3A0HU 4YR3A 2UUAB 4UXNA 3KCYA 1VQ5V 3CCUV 3BRCA 5F2VO 4KLJA 3QU4A 1KYOF 4JTDB 2XGQA 4BX9C 3AU6A 3LNNA 2G09A 4NL9A 2P7TC 2QLTA 1D9FA 3MHHC 5CBGA 4FFBB 3AG7A 4WF9V 1M4UA 4ZH4A 1M93A 2WLIB 4DL7A 4DL2A 1Y74A 1JX4A 2ZNJA 1SB3C 4DOCA 2BCRA 1XL6A 2E74B 5AKXA 5TZVA 5L1LA 2EJ7A 2LW1A 5LXTA 4C8OA 4DV0B 5J2AA 5J2CA 4DR6B 1NJYA 1TK8A 5CBFA 1V55C 3CCVV 2AU0A 1SKWA 4JTAB 4RQNA 2YI8A 3Q8PB 3PN1A 3M9NB 2PFPA 3IN5A 4I2FA 2B0CA 4QIWC 4KLDA 3RB3A 4LH7A 1NI8A 4B3MB 4ZOLB 3ZDEA 1ZQGA 8ICOA 3CC7V 3ZN0A 3R9KA 4DV4O 3G6VA 2KK0A 4I2HA 1XHZA 3L9DA 3ETGA 4F6EA 7ICHA 1PL4A 5IJ0B 5CMUA 5IJ0A 3J81j 3G4SV 1S8OA 5D4BA 3WG7B 2XNDG 2LYHA 5KFYA 1Z00B 4DRXB 3RVZA 2HBJA 4I2JA 2X6BA 2AZ0A 4G3IA 4JK1A 4FZLA 4RT2A 4O0IA 2CTPA 3FAVB 4OJLA 3CRAA 2NYVA 3UO2A 4DUYO 5CB4A 3CCLV 5JRTA 1T5EA 3SI8A 1BHBA 3KZIZ 1RYRA 3K4GA 1OCZB 3SENA 3SMVA 2MSNA 4O3NA 4MTXA 1GM7A 5KX5A 1URJA 4MF2A 4KMUA 3H8WA 1L8LA 3TARA 4KLEA 1GRJA 4I0XA 4NB5A 3T4ZA 4NTWA 2PXIA 5L1IA 2OIGA 4NKGB 4YCXA 3PX0A 1DGJA 2HCFA 3AG1B 5KG0A 1KUQA 4TT3G 3QVNA 1H8HG 4O2BB 1XEQA 2RDCA 4TOIA 1ZSPA 2VA8A 2R9RB 4UB6Z 4LF8B 1FXKB 2V9WA 4QZHA 4Z6DA 1HWYA 1IXBA 1AI7A 1QLEC 1RFYA 2H94A 3UQ2A 1N33B 2Z3YA 3ZHVA 3OSPA 1YEWA 3I5DA 4BWJA 4CC5A 2CDYA 3JARB 4X1YA 4F4XA 1FAFA 2M0NA 1Z1BA 9ICBA 2I5HA 3C23A 3S6JA 2VKQA 5HHIA 7ICTA 1KMIZ 2ZNIA 2FI1A 2ZXHA 3R65A 1SESA 3QZ7A 4O2AB 2HKOA 3ZX6A 2Y9TA 2V7QG 3OHAA 1ZQPA 2R18A 5DEDA 2K8AA 1J2MA 3V6JA 1HNXO 4FZNA 3T5KA 3JPSA 5IWAO 1HIWA 2G08A 3ETRA 2OCCB 4NLKA 1L6NA 2Y4UA 1KEJA 3H0MB 1QSSA 1X9XA 4ED6A 2HHVA 4QZDA 2C2EA 3Q4HA 3Q4HB 3WB0A 4R7CA 5JU5A 2R8GA 2EIJB 1CEZA 3HKCB 9ICEA 2VQFB 4F4KA 1D2DA 2OT5A 2R72A 2E8MA 2DOSA 3M8RA 1SQPH 3GIKA 4RAIA 2Q68A 1W0KG 4C4RA 3OR6C 4O4LB 3JD0A 2EIMB 5EYPA 5EYPB 2A1JA 4UAZA 3OD4A 4Y2JA 1HNZB 1BZKA 3M1YA 3OAAG 5KFBA 1Q43A 2F95B 3ETLA 2XHBA 3OW2U 1IBKB 2G0AA 4ECZA 1NS1A 3H9VA 3CXHF 1YZ7A 1XO0A 2ZR3A 4BIOA 3CC4V 2H3VA 4DXWA 1VF5B 3MDSA 4CE6A 2QEXV 3KBBA 2W9CA 4US9A 2JH1A 2W9CB 1K92A 2JRIA 1TK5A 2CTWA 1DOQA 3AG3B 4LF6B 3U10A 2HSZA 4PA7A 2QGNA 1AROP 9ICIA 2HHXA 4J9PA 3BAAA 1RPOA 3AG4B 4ASUG 3G6YA 4J7ZA 1TVAA 4C7YA 4Y2YA 4ICGA 5JVDA 4MFAA 4DQSA 4A5UB 5A2QN 2VA3A 2LPEA 4YQWA 1BVSA 1RYSA 4RQ6A 1SXDA 4PDVA 2VQFO 2F77X 5BPCA 1K97A 2GTSA 3WKDA 1I94B 2WAQC 2ARHA 2HOFA 2Q69A 3OR7C 3RYCB 5EC2C 2AXTU 1LKYA 1WCNA 1TV9A 9ICTA 4K3AA 4ED2A 3CRQA 4F4WA 1PPJH 4JB3A 1LUWA 1Z4OA 1K73W 4WCEV 1HJPA 3MR6A 3SV3A 5DG7A 1BPBA 3JCUZ 3KHRA 4TV9A 4TV9B 4LC1A 4JWMA 3JASA 4EB6A 1RSOA 3QG5A 4MS2A 8ICHA 3HKEA 5DBBA 1NH2B 2GLEA 2XY5A 3ETEA 1NU1H 4N21A 4OJ5A 3K0GA 5JH7B 2ZIUB 5KFOA 4UAVA 1ZTEA 2KN7A 2KZZA 4BW9A 5IIOA 3H0LB 4LWSA 4LWSB 2V4QA 3ALRA 2G38A 2XGPA 1NK7A 4P2HA 3CE2A 4RUEA 5DB9A 3D8CA 4DR7O 1X42A 3SAGA 2X7RB 3FYIB 3TJTA 4RPXA 2RDIA 3QUQA 1DK1A 1OCZC 4NVPA 4X65O 4IQUA 3SYAA 1VQ7V 3ABLB 1KKDA 2A7WA 3RF9A 5LGUA 2CAZC 4DV4B 2W7PA 8ICEA 1TKDA 1Y4MA 5B66Z 1YI2V 1UPHA 3ZDCA 5DB6A 4NXZA 2EANA 9ICSA 3EZ5A 2LGWA 1XOUA 2CN1A 2ZT9B 2BQRA 3CCMV 2E1EA 1QQ6A 2OWOA 1QBZA 1SQXH 2BOBC 4JAUA 1ZQRA 4DFDA 3KHLA 1SZXA 4I2GA 3AG1C 1GM8A 2C22A 1JI7A 4JI3O 3DDHA 5ALEA 5F3XB 4DUYB 2HOQA 2P6RA 4EZ9A 4EEKA 4U7CA 1C7YA 2QM4A 4MW8A 3EHBB 1FXKC 5AI8A 4DV6B 3SAFA 2HBLA 1Y76B 4JUZA 4PDLA 4CF4A 5A9GA 2E8NA 4J9YB 1QH9A 2X6CA 1Q82W 4GT1A 3QZ8A 1SWWA 2W9BA 2DPIA 5L3CA 4ED7A 4YJ3B 1NBMG 2ZUBA 3AL0B 2XAGA 4PDRA 1SWVA 4YVZA 1WP7A 1NZ6A 5BR8O 3QUTA 3G80A 1ZQVA 5ALLA 3T1HO 5H2FU 3VCBA 2Y9UA 1VIBA 2JDIG 1JOYA 3D3QA 4IRKA 2A19A 2UXBO 4R8UA 3ZEDA 5J2FA 1Q8KA 1ZQUA 2IBZH 7ICNA 4XBFA 4ECSA 4AP9A 3BQ1A 3NR7A 1KBUA 4PI0A 5KFLA 3WB1A 2UXNA 4TQRA 1WB8A 2A3VA 5KHHA 1NJIW 3NRZA 4GX0A 4KLIA 2QWNB 3ZRWB 2QKSA 3PY8A 4I4TB 4OD0A 4I4TA 2KVSA 4X64O 4NM1A 5ALKA 2LYBA 2PMZC 4R6ZA 4UAUA 1A76A 2F3NA 3ZN1A 1U9LA 2Y0IA 2DFLA 4DO2A 1JJOA 1BQZA 5KFEA 2XVTA 3L72H 5J2DA 1YHQV 2W6JG 5FLXN 4ECRA 1K7DA 2F8LA 3SJBC 4CH4A 3T1CA 3JSLA 2ZIWB 4C8NA 3Q8LA 4HNAA 1XNSA 4C4TA 2EX3A 3RFRA 5CA0A 2UU9O 2KG5A 5K4LA 1KU9A 5CN0A 1F0MA 2OCEA 3QF7A 5EK0A 4JV5O 1US6A 3PX6A 4TQDA 3UT5A 3FYHA 2JS3A 2JHDA 4LVSA 5LHGA 5DDYA 7ICRA 1JRPA 3ZHSA 4C8LA 3AG3C 1ZQSA 3W7UA 2YIBA 5IT9N 2C28A 5ALDA 4JI7O 2NRXA 1K34A 5KG2A 3T3FA 2ADQB 4UW9A 2BPGA 2AW9A 4IL6U 2QB1A 1KFTA 3DXRA 4G28B 2AHOB 5J2EA 4FM1A 3DEEA 1UA0A 1IM4A 3IJ4A 2AGOA 3CCRV 1S77D 3DV9A 2ZE6A 5LYJA 1OUQA 1D8YA 2IOHA 3PSTA 3K9SA 5LHHA 4KHPO 1COOA 3H0RB 1N61A 4QIWF 4UCUA 4LF4O 3SYZA 4O3PA 1GM9A 4DF8A 2JIZG 1EN4A 1ZQKA 3ISBA 1QCEA 4B9TA 5B1NA 3C3TA 4CF3A 4FM0A 3EVKA 4KN7A 5AKGA 3S3WA 4O9MA 3CCJV 1TVKA 4PHZA 3C5FA 4RUAA 3ZDAA 3RJFA 2VIXA 5DQIA 4B9MA 2N1RA 7ICPA 1AJQA 2K89A 7ICFA 5CBHA 1GTOA 5LOVA 3JATA 4I2BA 2KKPA 2Y69B 4JV1A 4XDJA 2HHHO 3NVWA 2MK3A 4NV0A 2P4KA 3T5HA 3ABLC 3H1HH 4YIPA 2CRXA 4WBNB 4FLYA 1NTKH 1NKCA 4DS4A 1M5IA 2F23A 2WWWA 3DTUB 3ZRSA 5J2TB 1MSWD 4BIUA 4JPRA 4RQEA 7ICIA 2F66C 4UFZA 3SAHA 2B5UA 4TUYB 5CEHA 1YJ9V 4ECVA 1VF7A 2I1QA 3E22B 5KFSA 5E79Z 3H7IA 3K58A 2IH3C 3SPCA 1VLBA 3ZRVA 8ICGA 3C3SA 5AG2A 5KG4A 4DR7B 4CS4A 1VDVA 2HLDG 4C0ZA 1MZFA 3Q8RB 4QZIA 3ETDA 1S0OA 2EDUA 3TQ1A 4X65B 3T4DA 1NZBA 1ZOLA 2B1GA 3T1YO 2YIDA 4QZEA 4MEYA 5KT6A 3Q8QB 4PJ0U 7ICUA 5J0OA 1KD1W 3VC8A 2AZ2A 1ZQLA 3T5JA 1ZQTA 2M7WA 1U49A 2OCHA 3IAYA 4NXMO 2XCPA 4Q6GA 4CH5A 1KW4A 3MR5A 3SJQC 2V1DA 3T5LA 1QVGU 1NJWA 4AILC 3JD4A 4JI3B 2K8BB 2QWQB 1D5NA 3M8SA 4LF7B 1K4DC 5GTHU 2BE3A 3NTUA 4GYCB 3QU9A 5L1MA 1WA8A 9ICUA 4NR1A 2C2RA 1SKSA 3LWLA 1HNWB 2X6AA 4QWBA 3LK9A 3TETA 2NO4A 1L7MA 9ICPA 2HBMA 5J8YA 5BR8B 3EPGA 4P4OA 3NS1A 1QQ5A 5AM1A 3WKCA 3JPTA 2CGOA 3T1HB 2E3TA 3B2EE 2H3QA 3V6KA 3B8NA 4NXNO 4PZOA 1OV9A 2DWDC 5B5EZ 5ALQA 1GH6A 1PVRA 4KITB 4UB1A 3BZKA 2UXBB 4RPYA 3A0RA 4G9BA 2CH7B 2BCVA 3HKDA 2YX8A 4UVCA 2M6YA 4BDPA 3BABA 4U7OA 2BZFA 5KL8B 3OJSA 4X20A 1UT8A 7ICKA 3I56V 4PZNA 4ECWA 5JCOC 4F2SA 2ZJAA 3PSPA 2XAHA 4HYKA 3CRXA 5CWRA 5ALPA 4X64B 1BHAA 4J41A 2F4VB 4F72A 4P4MA 2IJHA 4QZCA 2AGAA 5IIIA 5T14A 3D36C 3TFSA 3RAQA 5HP4A 2EILB 3E58A 1K5QA 1T3NA 2KHQA 2XIDA 1PL0A 4EX6A 2WA4A 3RYIB 3N2GA 4QWDA 1JX9A 3IC7A 3ABKC 5JWPA 2R70A 3HW8A 1Z4NA 2AH5A 4EYHB 3STZC 1Z3EB 3CCEV 1HDJA 3OMAB 2WAQF 2UU9B 2Y48A 3JAKA 1G4YB 3K79A 3QX7A 2NV3A 1ZD4A 2QA4V 1T4GA 4P0PA 1PP9H 4RQ5A 1SL2A 5AI6A 3QYPA 4NLGA 4KLOA 5J2GA 5L3EA 2X0LA 3RYHA 5AI4A 1SKVA 2CTRA 1KBHA 3IFXA 9ICNA 1A77A 3MD0A 2ASJA 4UB3A 4I28A 1ZUQA 4HAMA 4U3JA 3RBDA 1XS9D 1KECA 4U3JB 4Z1VA 4DV5B 1RM6C 2YS8A 1N0NA 4JI7B 5KG6A 2PI5A 4MFFA 3VQVA 4DQQA 4RQ0A 3WFVA 1LUVA 4NLCA 1IIPA 4QZ8A 2JS5A 1BL8A 5DN6G 3NVVA 2OM6A 4PA6A 1I5XA 3CS5A 2WTFA 3MBYA 4DV7B 3JPQA 1FPOA 4FLZA 3R66A 4UUJC 3IG5A 1ZQEA 4XRHA 1QNMA 4CC6A 2EZXA 3RYFB 2XY7A 5J2UA 4KLQA 1FFXB 4B3TO 1UHUA 4OGQB 5KHJA 4ED0A 4B9VA 2JGUA 1L1FA 4LF4B 5TISU 4B6JA 4UB4A 3TANA 1KFDA 4IRCA 5KFPA 1AR5A 4AHCA 4RWUA 2PF4E 5A0LA 3OEHG 3A0HZ 4GKKO 2JRZA 2BCSA 2Y69C 5DKWA 1FJGB 4PA9A 1M1KW 5DM6V 4DR4B 1X2IA 2JVDA 1QHTA 1ZQNA 2QB0A 3D3IA 1KKCA 4JYYA 2NLJC 1I7FA 2DW4A 3EW9A 4DSJA 1YT3A 2IHMA 8ICCA 1MN8A 5J2BA 3HKBA 4DLGA 1Z19A 3PSIA 2OIEA 3C2MA 4NLZA 3M6ZA 2UUCO 2EAMA 1XSPA 2KFZA 2F93B 3G67A 3ZMSA 1RPLA 2ZE5A 5IYZA 2Q8VA 2GUZA 1JQ0A 3F2BA 5J2JA 2ZG6A 4YP3A 2XAQA 5KHGA 1J5EB 1GMGA 1X9SA 2HHHB 4LZDA 2GO7A 2F1MA 3JD2A 2W8KA 3OEEG 2RJZA 5AHXA 2OHFA 4DW1A 4EZ6A 3L71H 4WFHA 3O0FA 2JZBA 1V9PA 5AKEA 1KDHA 2RN9A 5LP6A 5F9LA 4BXOB 1ZX3A 4J9OA 4NWIA 5KFIA 2ASLA 4I55B 1AQ6A 3C1YA 3GZFA 4ELVA 2Q6AA 1ZQCA 2IM9A 5DG9A 3ZBHA 4KL1A 5B1AC 4ECXA 2H8PC 1WG8A 3UM9A 2Q67A 4BJQA 1NH2D 1WUDA 2HR3A 3CCQV 3AK2A 3LSSA 4B3RO 2UUBO 4X66O 5J0UA 2N04A 4UASA 2JGAA 2LKYA 2Y4TA 4FIPC 1GN4A 4RNNA 4DR2O 3BHPA 2XICA 5KL1B 3CHXA 3K3WA 4W4LA 3QNMA 2PMZF 2AQ4A 2RMKB 2BPCA 4UBBA 1U96A 3T1YB 2RP5A 3AM9A 5DQGA 3RB6A 2W6IG 2F1HA 2LBOA 9ICHA 1KSPA 5L3BA 1F51A 2H3FA 2EULA 5KT7A 4JI0O 1Y74B 4NXMB 5BXZA 5J0WA 1N0JA 5GTIU 2P66A 2D8CA 2HBKA 3N7RC 1JVMA 5LXTB 4Z6CA 5HMMA 4Q8FA 4ZIBA 1ZQQA 2HHQA 1ZETA 3K5MA 2IH1C 2BR0A 3ZI4A 1VEWA 3K57A 2YICA 3UPQA 5KFAA 2FL4A 1DF4A 5KA6A 4EBEA 4G2KA 1OCOC 5LL6Y 4DEZA 2A9HA 4X8AA 4JF3A 3NVYA 4GX2A 1WP8A 3FAHA 2IW5A 2P35A 2UVWA 2ISPA 2YB4A 1PNMA 4O4HA 4O4HB 4XDKA 4O4IA 2VWJA 4WFBV 3M9OB 1SV0C 2EILC 4NXNB 3B77A 3UMBA 1CP9A 1NI3A 2N74A 2FPMA 3AG2B 1R3LC 4MVOA 2ZIXA 2J6TA 1VJ5A 7ICGA 2ZINA 3FKSG 4I2DA 5AKZA 3V6HA 1B6QA 2PFNA 2Y0SF 1X9WA 5CB4B 2KG7A 5KTQA 4FVMA 2KICA 8ICRA 2PKEA 2V4RA 3CRMA 3V7JA 3TI0A 2GWSA 1M90W 2CXYA 1IVSA 3QEBZ 4LF5O 5KX5B 8ICMA 8ICXA 4JAAA 2ZJ5A 5FPRA 4I0XB 5KUKA 4EBDA 3PZPA 4N23A 4O3QA 5ALUA 2OXOA 2WLNA 1L0LH 2ZM6O 3EYZA 3SYCA 1RXWA 2CUGA 4YXJA 5HFMA 1HW7A 2HI0A 1NTMH 1M56C 3BCCH 2QTOA 5HFLA 2GHYA 3MGVA 5LGTA 1M6YA 5GW7A 5B3SB 5JQGA 2WF9A 4M9NA 3UM7A 3L74H 1PZNA 2KEYA 4DFJA 3HKZF 1AI6A 4QJFB 2O57A 2Z5UA 2LQTA 4YJ2A 1YZBA 4AYBC 1IXMA 5KFUA 4X1YB 2FDRA 3ASNC 1NOMA 4O3MA 3TK1A 4BWMA 1T94A 1TA8A 5IY5B 2H3ZA 1NQTA 4U3FH 4FS2A 1S0NA 4H0LB 2WPDG 4JI1O 1TAMA 1AR4A 3CW2C 3E8HA 4RQ8A 1NJXA 2WLHA 2DPJA 3BZCA 1ZQ1C 3CPWU 4ELUA 1ZQXA 4F3OA 4Z2WA 4O4JA 4O4JB 1VQPV 2RLTA 5B1BB 2W9MA 4P9PA 4B3TB 3KCXA 2JK5C 4YY3B 2IBKA 1WN7A 3ZHRA 2CPRA 1TK0A 4IHJA 4IHJB 1H2SB 1N34O 2ZD9A 5EZYA 3SR2C 4GKKB 5ALYA 2AXTZ 1OZ0A 4Q44A 1XMOO 1Q81W 4R66A 2KZMA 1QQCA 1MOFA 3DSQA 3CSXA 2Y0PA 3N28A 4UB8Z 3E86A 3D2QA 1P84F 4JI8O 3PW4A 3JSNA 1QVFU 4ECQA 2DWQA 5AM4A 1F23A 4I2AA 5LA6A 4NM2A 2A1JB 3TADA 2FYUH 3D2SA 2KSOA 2KSOB 3H8SA 1JFFA 4BR6A 4HZ3A 4IQWA 2WLKA 5FNVA 2UXXA 1PVPA 3F7VC 1S72V 2ZDIC 4J03A 2Q0OC 3SZ2A 2UUCB 4B7KA 5GONA 2VQEO 1ECWA 2YUAA 2DQ0A 1ZD3A 4FK5C 3BFRA 2RDJA 1Q6IA 2ZIOA 4PL2A 2MA1A 2BPFA 4H44B 2W11A 4R64A 2QR4A 4F93B 4MVRA 1P4RA 1L5UA 4UAYA 4UB5A 4KLFA 4QZGA 4UVAA 2Q4TA 4NL9C 3RH5A 3LDEA 4OO1J 3JALA 3AMZA 2WB1C 3C5GA 1AILA 4FBUA 3HPLC 3KD3A 5JVDB 1ZJNA 2R8KA 2RQ5A 4TWKA 1SL1A 4ECUA 1Q3VA 4R63A 4C7UA 5KHIA 5LBQA 4DL3A 4RQ2A 4DK1A 3HPOA 9ICXA 3RBZA 2YMQA 4B3RB 4YMNA 1T7PA 2UUBB 4X66B 4ED1A 5ITZA 5ITZB 4DR2B 1KP3A 1LKYB 3PVXA 2OTJV 1G1XB 1CPYA 5BMVA 4US8A 1B43A 1NVPB 3OJUA 1ED1A 4KFMA 3RJJA 4B9UA 4JYAO 1GKFA 1UFIA 2BQ3A 1RQLA 3AEVA 5HR6A 2KHVA 3JASB 3IDWA 1RSOB 4EB6B 1DLBA 3AQEA 3OHBA 3HKEB 4JI0B 4K4GA 1CRXA 3E8BA 1K5OA 4TUPA 5KAIZ 3IG8A 4Z1MG 3X2QB 1U47A 5AM3A 3WG7C 5H2FZ 3A0BZ 5KFTA 2BOCC 3AG2C 1J97A 4GXIA 3GFKB 3N4MB 2K60A 1PM9A 4RU9A 3ZRXA 4B9NA 1H2MA 1OXJA 4TV8A 3CCSV 2VJ5A 3OTQA 1F5SA 1FKAO 2DJVA 3LNMB 5KA5A 3RB4A 4GC7A 1NKEA 2KTQA 4YFKA 3SV4A 2P67A 2ZIMA 1WAZA 1ZQAA 1XL4A 3BJYA 4ED3A 2W3RA 2DKXA 3K0DA 1W59A 4OX9O 4J9MA 4M0AA 1ENVA 4DSIA 1Y67A 4UV8A 2UXDO 3OTFA 4WJ3B 1NK9A 3CP1A 3THVA 1YVWA 3ZHTA 5EBMC 3TXSA 1XU4A 1KQQA 5EBLC 2BDUA 2UVVA 2WF8A 3CB2A 3JPPA 4TQSA 4CH6A 1ZQDA 2RQ6A 1Q5OA 2IMWP 2EIKB 4LFBO 3SD7A 3ASOB 5CB1A 2PY5A 4KLMA 1M57B 1ZXIA 4YN4A 4DQRA 1ZQHA 1IBLO 1IURA 3K75D 1QCKA 3LSUA 2WLLA 4H13B 2ASDA 3ONNA 2Q0AA 2FPLA 4J9RA 1ZYQA 1V38A 4EEQA 4JMUA 4LF5B 1TAQA 3WK7A 2ALZA 1EBOA 2PYJA 2W9BB 3NUQA 4CNQA 2OYQA 5KT3A 2YMMA 2HFEC 2OTLV 5B1OA 1K1QA 3RH4A 2C2DA 1N4CA 4ZOHC 2KKWA 1V54B 1VQOV 5IILA 3FB7C 3AU2A 4F2RA 4MTOA 1GAXA 4P0QA 2QM7A 1SQGA 1ZLZA 1N5XA 1KL9A 1FS0G 1WPBA 3LDDA 3L5KA 4R8UB 4FFDA 1B06A 4OXSA 2DN9A 2CGNA 2BHNA 4DSLA 1S10A 2OCCC 4OJ6A 1B04A 3MFHA 1COKA 2ZE7A 3FFQA 3IM1A 2IA6A 2UVRA 1WB7A 3L70H 5B1BC 4FLTA 3LSQA 1F4NA 1DF5A 2IU0A 2EIJC 5DBAA 4IYHA 3BQ2A 1YZ6A 1ZQYA 1GN2A 1N32O 4JASA 4PHDA 1ZAUA 4MTGA 2EAOA 8ICLA 1D8BA 5KHKA 3G6EV 2GV9A 2VANA 4JI1B 2DBYA 2MAXA 2L35A 9ICFA 5ALGA 1R3IC 3QUCA 2F76X 2IOFK 2ITCC 4QWAA 5KFDA 4J10A 2EIMC 3CX5F 5EE3A 3CJHA 3HJEA 1HNXB 1XNRO 4FE3A 4HNAB 1UCVA 3KKYA 5IWAB 3CD6V 3M8AA 2G5IB 5KFXA 1ZJMA 2FB5A 3EPIA 2FTKA 5LGNA 5JUMA 5CA0B 4QNHB 4FZ0A 3HB3B 3BQ0A 1ZQZA 4J9LA 2YEVA 4LCUC 3UT5B 4DR5O 1AI4A 1X6JA 1BNOA 4KX5A 4I27A 3DC6A 1OW5A 2A1AA 3Q8SB 3BDPA 3ML0A 3BQTA 3LVWA 8ICTA 4IC9A 2K1EA 2K4PA 5IINA 3KKAA 5ALTA 1JUDA 1F4MA 3ZMZA 4JI8B 2ES6A 1DGSA 2LGQA 1MC8A 5KG3A 1R73A 2QWOB 3OPXA 1S5HC 4TUSA 1YIJV 3PO4A 9ICAA 3AG4C 3DXRB 3RGBA 3ABTA 4Y2VA 2ZKOA 5E1AC 2GSMB 1SETA 3O65A 4PGXA 1JN3A 2JXJA 4C4SA 1NKBA 5LYJB 2VQEB 2ISOA 1S5LU 1NNLA 3FD9A 5KMGA 3GQCA 1KFSA 3L4PA 1RP3B 2K4HA 5AK5A 5G5HA 2L5YA 3ZD9A 5J0YA 1O9HA 4QPKA 2YXLA 2EH9A 3CMEV 2AGQA 5KG7A 3GDXA 3G6XA 4RNMA 3H8JA 4PHPA 1PKXA 1VQKV 3H8MA 1D5AA 5KFKA 2DMXA 2N05A 1VARA 2FLPA 1SC5B 3CYOA 1TVKB 3F7YC 2RCVA 1Q3EA 1S3JA 4IS7A 2HVIA 1J2NA 1XC9A 3FB5C 1I08A 1L7PA 3SYQA 3X2QC 1MQ3A 2A79B 2KOBA 3MDCA 4YXMA 5DB8A 4X1IA 3WKEA 1AI5A 2QKCA 4QGPA 3UMCA 4Y2PA 3K08A 2QE7G 1ORQC 4AQYO 3TGUH 5KAFZ 3M7DA 3RRGA 4M47A 1S5JA 4DV2O 5LOVB 3JATB 1X9MA 1X40A 3RH6A 3WK9A 4JYAB 1ZQOA 1SERA 2MUTA 3ZDDA 1LB2B 2WAMA 5AICA 1T8EA 2GTAA 3UKMA 4ECYA 2F8KA 5HR7A 2W0XA 1NTZH 1F7YA 1AP5A 3MC1A 3BA8A 4R65A 2R8JA 3AN1A 4EEYA 1KRPA 3B8MA 1KKXA 1RPRA 1HEKA 4J9KA 5DG8A 5EE1A 2EIKC 1K3EA 4LNUA 1BGXT 4YR2A 3ASOC 1RQNA 3APOA 3ISDA 3EFFK 5KFJA 4O5EA 4J9NA 1AP6A 5H6RA 5KT5A 5KUMA 1R3JC 1A0PA 4AYBF 4GIBA 1JJ2U 4DOAA 4DQIA 2ODGA 5KT4A 3I76A 3D6JA 1VP7A 2KSDA 4NTXA 4OX9B 1R3KC 3APQA 4EYIB 2UXDB 7ICMA 2VRZA 3WK6A 3C1ZA 4BW5A 1ZD5A 5AKYA 2HVKC 2YN4A 2XO7A 2BCCH 2JJ1G 3TAPA 3N2KA 4PI2A 5KFGA 4QNLA 5D5QA 1FYJA 2W9AA 4CCHA 3RWRD 2DE0X 4I7ZB 2NN4A 4UCOA 3CNHA 4ZI7A 1IBLB 4GUNA 3A8TA 5DB7A 3RJKA 2EZOA 2R8IA 4J80A 2K4EA 3I1YA 3LVVA 2KNJA 1MSDA 2D6FC 1WA8B 3ZD8A 4Y2QA 4QZFA 4ECTA 1QTMA 1GN3A 2C2AA 2HG5C 2PTMA 1YTFB 1VF6A 3IV6A 4XUSA 2E8OA 3RR7A 3PO5A 4MF8A 4C8KA 2V4DA 1AB3A 5JJJB 1NK5A 2D2CB 4J7JA 3RJGA 5CA7A 3GWOA 2AHYA 3WU2Z 2BQUA 3MGHA 5L3DA 2W43A 2YSUB 4KLHA 2FE9A 1H38A 4LR3A 4PL1A 2R9IA 8ICVA 2KE7A 4FO6A 2QWPB 5KFNA 4F8RA 2FKXA 2P6JA 3HKDB 4PHEA 5EC1C 3IGAC 3JAWA 4X20B 2GBOA 2FMSA 4B3MO 2WHEA 3SQIA 3P3PA 1UJWB 1RYUA 5DLGA 5AKKA 1K1SA 3LUTB 4PELA 5J2KA 1RXVA 3K5NA 1N32B 3IP4B 1QR9A 4OJPA 2UVUA 2LMRA 3OSNA 1DXSA 3E8GA 5J9PC 4F4LA 4EX7A 4DFMA 4KUMA 2P6UA 3HILA 3UQ0A 4K35A 1RM1B 5E79U 2BGWA 2QARA 2QARB 2XASA 3PW5A 1AVMA 3AK1A 3GILA 3ZJZA 2GDSA 3SR6A 3N2GB 2YC0A 3ZMVA 2PFOA 4Q43A 4M2YA 4F91B 3CXCU 2GH1A 1XNRB 5K1PA 1H2LA 2ZJ8A 1QSLA 5ALJA 1QU7A 1N2XA 2FMQA 3K04A 1VQ9V 1JA8A 1NKDA 3CMAV 3JAKB 1TAEA 2QJ1A 3BY6A 4JV5B 1FEZA 5C5JA 4QWCA 4K4HA 4P0PB 2HVJC 2ZUDA 4DCCA 4DR5B 2P22C 3SYPA 4QW9A 3RYHB 3JYCA 3ZHQA 1P49A 2IJJA 1L7OA 5CJ7A 3JPNA 1BQ0A 2KMDA 7ICOA 3U0ZA 1Q86W 1CI4A 3M9MB 4NLBA 2KIWA 3MDAA 1U97A 4JGSA 3W7WA 1ZRNA 3KG2A 4AI8A 3QTCA 5KFMA 4LF8O 5D5PA 2FMLA 2KP7A 4DOBA 4DL5A 1ZQMA 2IHNA 2LHTA 2ATLA 3AQFA 4F50A 1N33O 4NYKA 4GCZA 1XUQA 1YCIA 5J2UB 4KHPB 2KV2A 1Q46A 3C21A 2EINB 1G8MA 3IRUA 4ACOA 3LDCA 5JJNB 3CEIA 5B5EU 1S9FA 3RRHA 1QLNA 4I29A 5G5GA 4PA4A 5ALZA 3QXGA 4Q20A 4ZHQA 4HAIA 3NASA 4MVSA 4JV0A 2QB0B 1EZJA 4IYIA 1NK6A 2XT9A 1SZTA 2QM8A 4QW8A 8ICQA 4YXWG 1LR1A 3HRDD 4F5QA 4HBNA 4P9OA 1QLEB 1ZWIC 2ZXIA 2A06H 5CR0A 4UQGA 1VQLV 3P32A 3C2LA 3JCZA 3JD1A 4ICAA 3QU2A 5GTIZ 3HKBB 1FXVA 3C28A 1Q6UA 2BTQA 2QKQA 4X9QA 4AQYB 1RG6A 2WF7A 4FS1A 2YXHA 2WLMA 5IYZB 2GUZB 2P4VA 4DV2B 1SQVH 1XQ8A 3K03A 2GOLA 2E3CA 1ZL8A 4RUCA 3QU5A 4KN4A 1E1RG 3J80N 2QTSA 5DBCA 1CXZB 4F71A 4QPJA 3K1ZA 2JZBB 5LP6B 4W4KA 2IOFA 3ETQA 1NVPD 2ZQMA 2PZSA 1S76D 1PK3A 1X59A 1SL0A 1SIJA 1QQ7A 2JMGA 3KZXA 1CUKA 1BPZA 3F2CA 4F5OA 2NNUA 4LF9O 5BOLA 3D2NA 1GK9A 2BKEA 4LF6O 5K1XA 4FLUA 3PSFA 1JMKC 2K8CB 4IIJA 4YR0A 2E1FA 3ORYA 4KXRA 2BSKA 2CTQA 1UQVA 4DF4A 2KIVA 4XQ8A 2JEXA 3F2DA 4IGGA 3P3NA 1WPXA 1L3UA 4RZRA 1JIHA 3GU3A 8ICNA 4MVQA 4MFCA 3OUSA 1QSYA 5J8YC 2JR5A 1L3SA 5J29A 5LMUO 1MNGA 5ALMA 1E1QG 1FIQA 4UB2A 9ICWA 4GC6A 3PW7A 5AK4A 4UVBA 1L3VA 3WK8A 1UPGA 4JI5O 4RQ7A 2KFNA 2HJDA 3E83A 5ALIA 5IJ9A 5IJ9B 1KP2A 4PA3A 1FO4A 4QZ9A 1DRGA 3OTOO 4QZBA 1JXLA 2ATKC 2YXYA 3VOUA 4FFBA 1BMFG 2F44A 1RZTA 1MABG 1NZPA 1YSCA 5EIBD 2FLNA 2WLIA 1VQ4V 5ALHA 5L3FA 3KHHA 4J7KA 3ZCCA 1IXRA 2EJRA 4BIZA 1LNQA 2W8LA 4Y2TA 2R8HA 4O4IB 1VQMV 9ICVA 4UATA 1RM1C 2JGDA 2JGDB 3W7TA 1ZQBA 1XDCA 2WA3A 1HR0O 4YMMA 4CRXA 2MU2A 4IRDA 4DR3O 2ZIXB 5IIJA 4M9HA 3E2EA 3U26A 1ZQFA 3ZMTA 4DV1O 3UCSC 2DYSB 4OCZA 3F53A 4DO9A 3U11A 2ZTEA 2HJFC 2Q7GA 4ZOLA 2HMXA 2J6SA 1YF2A 4O5KA 2KG7B 2XTAA 8ICBA 3S3XA 2I9GA 4EENA 4EKWA 2O6KA 1VQ6V 4X5VA 1K8AW 2HEPA 7ICJA 1HP8A 2B6GA 4KLGA 3FX7A 4UAWA 2A0LA 7ICEA 1Z00A 4RPZA 4DRXA 3TFRA 3M6KA 5J0XA 2E5LO 1MA1A 3FAVA 1OCCB 1EZVH 3FDSA 5IIKA 4MT8A 1UT5A 4E4EA 5AKLA 3PW0A 4DV6O 1X6IA 7ICSA 4PPXA 3QU7A 4QE7A 3BEHA 5J2IA 5AKIA 4BUGA 4K4IA 2RNBA 5JQGB 4X62O 5KFRA 2VA2A 5KFQA 4C8MA 1DK3A 2EINC 2Q0ZX 2ZIVA 2ZIVB 2KZ3A 4TSFG 4YJ2B 2ZR2A 4DL6A 5ALSA 3H1LH 4RQMA 5AM5A 4FMTA 1XNQO 3BVOA 4LFAO 5ALFA 9ICLA 8ICPA 4DR1O 8ICZA 1IX9A 4O2BA 3RT3C 4UCTA 1EN5A 3OGCC 4JI2O 4GXKA 3JPRA 3H4DA 1FXKA 2YIBD 2BTOA 5EWEA 4QE9A 4WFEA 3HX0A 4PGYA 2HHTA 2LI6A 3PX4A 2EZPA 4P2ZA 1P7BA 2E8PA 1Z5WA 3PJSK 1XO1A 4KMOB 3Q8KA 4O5CA 4F5NA 3JARA 3MABA 4DQPA 1RDFA 2ODMA 2ZXWB 1THZA 4I2CA 4F5RA 4RQ1A 1H2GA 1BPDA 5EZYB 1PVQA 5F9NA 2MW2B 3WB2A 3ZMUA 4JI4O 3H40A 4J9ZB 1K33A 1O08A 2W03A 4M9LA 4O2AA 2E76B 3K59A 1K9MW 4M9JA 2JEUA 1ZQIA 1SKRA 3I55V 5LP6C 5D46A 5LA6B 3PMLA 1MQ2A 3NXSA 1SRYA 2JEJA 3KZIU 3CYMA 1JFFB 3STLC 2IJKA 1TUEB 3P30A 4LJXA 5KFZA 5KFVA 1MMMA 3KTQA 5FNVB 1FFTB 3HKCA 4KLSA 1S0MA 3EWAA 2XY6A 5GONB 4TQFA 1N36O 7ICVA 1X4TA 1IG6A 4HYOA 1XMQO 4OPHA 4D7TA 2P06A 5DQHA 1N60A 3KFUF 4O4LA 4B9SA 4JZ2A 1FD9A 2NO5A 5AM2A 3E0FA 4X1KA 4X1KB 1SQBH 1SZPA 3ZIAG 5KLVH 4UB6U 5IE9A 3BQ7A 4MVUA 2B21A 3N27A 4DFPA 2UXCO 1NK0A 2VWKA 1AJNA 1GN6A 2LFRA 3JALB 3RJHA 4Y2XA 3THOA 3PMNA 3SPGA 1YJWV 2DUYA 2EBOA 1R6KA 2KJ8A 4EFBA 3N7SC 4LF9B 1JPXA 5L1JA 4U7NA 2E75B 4J9QA 4RQ4A 2FPKA 4JZGA 1F44A 3TKAA 1JR9A 4B08A 4IR9A 2ITDC 1WWVA 5BMVB 3K9AA 4CBCA 5C93A 1KB9F 3B40A 4NTYA 4DWIA 4I50A 4I50B 3L75H 1G6UA 5EWFA 1JXEA 2ADPA 2Q7HA 3F5TA 2F1JA 1SF9A 4FFKA 4WFFA 4BWAA 4K8XA 5KFHA 2DL0A 3RAXA 1TFRA 5AK3A 1OCRB 1S0VA 4Y2SA 3UXPA 1Y66A 1YXBA 5LMUB 2DKZA 3CRRA 1D9DA 1LV5A 4Z6FA 3RYCA 2DQNB 1KTQA 3UXOA 1COWG 1TUBA 1TUBB 4JI5B 2KJ5A 3T79A 4DUZO 3UO3A 2B1IA 4J42A 4UB8U 3I28A 2DYSC 4TV8B 1Y6XA 3EUB2 3OTOB 2WLJA 4DV3O 4LH6A 3SGIA 2XI9A 4JYBA 2FMPA 4JWNA 4GFJA 1KLNA 4A8EA 2JH7A 2DYRB 2P90A 3ABUA 3ABMB 2CE4A 2LYAA 4B7EA 3BS7A 9ICOA 3MGIA 3OMIB 2Y1JA 3LYSA 2HHSA 5JH7A 4FBTA 3AK3A 2ZIUA 1EN6A 2YQEA 1YTFD 2NRZA 1N62A 5KG1A 3HWTA 1HR0B 2QDOA 4DR3B 1OCCC 2CK3G 4E0DA 1SQFA 4DV1B 2KB1A 4LFCO 2D3DA 2HOIA 7ICLA 5HHHA 3GV8B 4QZAA 4DW0A 1H2KA 1WNSA 1YITV 4K0KO 1FFUA 1EFRG 4F4ZA 1BPEA 5KFCA 2KJ9A 4UBCA 2WLLB 2IJIA 5B3SC 4D7SA 1XREA 2A3QA 3OE7G 2FJ6A 3FYEB 5IYDO 1QR8A 4P30A 3F5AA 2IU3A 4JI6O 3K1RB 4I2EA 3JD3A 2E5LB 2G06A 4LBEC 1JMSA 2KD1A 3RBEA 3K5OA 5IY5C 4P0QB 4M04A 1K4CC 2XUMA 8ICSA 2ZM6B 2W55A 4I9QA 4LF7O 4IL6Z 3NVZA 4FZ1A 2HVHA 3G6BA 2WFAA 4U6PA 2Z7JA 3OT7A 1Y76A 4PHAA 9ICRA 3EXAA 1Q3UA 9ICQA 4X62B 5HNKA 5IDJA 1HNWO 1X66A 5H9CA 2WF6A 4I5SA 5ALNA 4YJ3A 3TXQA 3M99B 5KAIU 1S5LZ 1Q7YW 2ZXWC 4BGDA 3SDLA 4YG2A 1T3QA 5H6QA 5EBWC 2KVCA 1MZEA 1VMGA 3A0BU 4LFAB 1XNQB 1OJHA 1BS3A 3QO7A 1FFVA 4DR1B 2AQ0A 1UA1A 5BY1A 4OJOA 3MFIA 4F92B 4JI2B 5CA1A 5CA1B 4GKJO 1AR1B 8ICYA 4IQTA 4CS2A 3CJHB 3TADC 1ZD2P 1YJNV 5ALXA 3DC5A 1ROPA 4PH5A 1IZ3A 3FB6C 3E35A 5B66U 1HUZA 2EQYA 3O9OA 4X88A 3ZRWA 3UQ8A 1SV4A 2XCAA 2Q5ZA 2BDPA 2YEVB 2F4VO 3A2FA 3OGIB 4O3SA 2KQXA 2H5XA 4JI4B 1XMOB 2HW3A 4C7ZA 3ZDBA 2OH2A 3IC9A 2AGPA 3SPJA 5CA3A 1NK8A 2M9NA 2W7OA 3H1KH 2ZIWA 3W7XA 1PNLA 1Z5VA 5AIAA 4RUFA 3QE9Y 4OPAA 9ICGA 1NR1A 3QO5A 2YMPA 1N8RW 3ZS8C 4YD1A 5DECA 5JCOA 4PD4F 5DDMA 4XDLA 5ALRA 4F6RA 4F6RB 2QSAA 3W7SA 5ALVA 1NT2B 3OUFA 1N36B 1DTOA 1N48A 3D36A 5KMGB 1XMQB 1PK1A 1PK1B 8ICKA 2PGGA 2PUSA 4DV5O 4E2LA 3WK5A 5AIBA 4Q45A 9ICCA 2VS0A 1NK4A 4USAA 5EE9A 3OFNG 4DL4A 1Y88A 1MA7A 4I2IA 2Y1IA 4KLUA 3ABKB 2Q9LA 1MG1A 3AUOA 2JEIA 3WKBA 2PYLA 3MAQA 3VQYA 2UXCB 3RJIA 1L8DA 5AKJA 2ZTDA 5IYBO 4DV7O 1U48A 3FM9A 1OCRC 2YDEA 1XBLA 4PJ0Z 1TE2A 2D3OW 1IV8A 3RTVA 4Z6EA 3BS5A 3BS5B 1L7NA 4J11A 4D6TH 4FPPA 4DYLA 5BOMA 1URFA 2Y0SC 1TAUA 3GIIA 4X1IB 3B9JA 3ISCA 4K8ZA 3B0XA 2W3SA 3IHQB 1BPXA 5CP2A 5JJEB 5J0SA 3V72A 3RJEA 1FJGO 3F5WC 5GTHZ 2G07A 1U45A 4M9GA 4DR4O 4CF5A 3K06A 4B3SO 1SQQH 3H1IH 2J6UA 3SPHA 2F43G 2MUTB 1KC8W 2DYRC 2DQ3A 2B9ZA 2YY6A 3GV5B 3ABMC 1B4FA 3SPIA 4KP4A 4ED8A 3TCUA 1R6TA 1B3QA 4LP8A 4WFGA 5AI0A 5KFFA 5KNIA 4GZRB 2K4IA 5EE0A 3RFAA 7ICQA 5H5NA 4MHVA 1SXEA 4ELTA 1KN5A 4I9WA 4MVZA 2E5SA 4DUZB 5J2HA 4LNUB 1P7GA 1M57C 3HKZC 4UCRA 5LMNO 1J5EO 1VQ8V 4EELA 1WYGA 4DV3B 5EIBC 2ZCEA 2H3OA 3H1JH 4FLVA 3B09A 4YHHO 3L73H 3GIMA 4WBNA 1ZQJA 4KTQA 2YB1A 2W0FC 5J2TA 3J81N 5LHIA 1DK2A 4DSFA 3PW2A 2YI9A 1IBMO 3WK4A 2P5OA 3NRWA 3MHSC 5IYCO 1BGYH 8ICUA 4TUYA 4YMOA 3HR0A 4PV1B 4YIOA 3N2KB 3N7PD 5C0YA 3E22A 1V54C 4RO2A 1WWUA 2XOKG 4LFBB 5ALOA 5KG5A 4NY8A 3M7MX 2ESEA 2KKVA 1V97A 4LFCB 2HHUA 4ZI7B 4K0KB 2UUAO 2EZZA 4R8CA 2LM1A 3B0YA 2L6LA 1N63A 2BCUA 4Y2RA 1Q8IA 4TURA 2HHWA 3QO8A 3SJAC 2H3IA 2AHZA 3NGDA 3T2MA 4JI6B 3H4BA 5L1KA 1Q6HA 5FL7G 4FZMA 5BZBA 1E79G 3C90A 5EWGA 5B1AB 4MVMA 4O3RA 1SS3A 1XWLA 3OM3B 1K5SA 4DV0O 4UARA 1LVHA 4DR6O 5KAFU 3MR2A 4RQ3A 2OEHA 4JV2A 3VQWA 4MTFA 1WJZA 4J9SA 1PV0A 5C8YA 5C8YB 1P7DA 3E89A 2W54A 1W2BU 2NRTA 3RVYA 5J0QA 3BPZA 1B22A 1Z1VA 2LP7A 5DLFA 4TUQA 3JAWB 3V7LA 2G5HB 2XAJA 2XC9A 2HDOA 3VQXA 8ICJA 1R1BA 3CWBH 2DWEC 4BAYA 4M6WA 4M6WB 2Q73A 3UXNA 4B9LA 4PGQA 3Q8MA 2K9PA 5TISZ 1S97A 4XA5A 4CGZA 3QNEA 3PR5B 2RRDA 3RB0A 2WB1F 2NR5A 2BCQA 3AEIA 3RN4A 3KKAC 1V55B 3GWKC 4GKJB 2CH7A
chains in the Genus database with same CATH topology
1W0JG 5LBQA 3VOUA 3W7UA 1BMFG 1MABG 4RQFA 1YSCA 1OCOB 1GO3F 1K34A 2WLIA 4JAVA 3RBZA 5L3FA 1VQ4V 3ZCCA 1JCHA 2EJRA 1LNQA 1PNKA 4BIZA 3GB7C 4G27B 3G71V 1VQMV 4G28B 1KP3A 1RM1C 2OTJV 1A6SA 1CPYA 3W7TA 3DEEA 1NVPB 1ED1A 4KFMA 1WLEA 4L87A 3CCRV 4CRXA 1S77D 4KX3A 2ZIXB 4CDGA 1OUQA 1GKFA 3ZMTA 3E2EA 3PSTA 5HR6A 2DYSB 3F53A 2KHVA 2RHFA 2HJFC 1DLBA 5LHHA 3AQEA 2HMXA 3H0RB 4QIWF 2MRLA 1CRXA 3E8BA 2F2AB 3F5EA 3IG8A 1GM9A 4Z1MG 2JIZG 3X2QB 1PD3A 3WG7C 4EKWA 1VQ6V 1QCEA 2BOCC 3AG2C 1K8AW 4JYCA 3VBBA 4GX1A 5B1NA 2A0LA 3ZRXA 3CCSV 2VJ5A 1AJPA 3LNMB 5KA5A 3CCJV 3M6KA 4MW3A 2P67A 1OCCB 1XL4A 1KQSU 3K0DA 4UV8A 2VIXA 1ENVA 4MT8A 2N1RA 4WJ3B 1AJQA 3FB8C 3CP1A 2K89A 1VQNV 4GX5A 2JJ2G 4QE7A 3BEHA 5EBMC 4ZBMA 5EBLC 5CBHA 4BUGA 2BDUA 1GTOA 2WSSG 3ICXA 1M56B 2KKPA 2Y69B 2EINC 2EIKB 3SYOA 2ZIVA 2ZIVB 4XDJA 4TSFG 3ASOB 2MK3A 4NV0A 1M57B 2ZR2A 3ABLC 4FMTA 3H01A 2CRXA 3DTUB 3ZRSA 2WWWA 1J95A 3ASNB 4BIUA 4JPRA 1SZHA 2WLLA 4RQEA 1MSWD 3E8FA 3SAHA 3ONNA 2B5UA 3OGCC 2DF4B 4JMUA 3DGEA 3CC2V 1EBOA 1FXKA 4QE9A 2LFSA 4WFEA 1YJ9V 3NUQA 2IH3C 2EZPA 2HFEC 3SPCA 3ZRVA 4CZZA 4H37A 4P2ZA 2OTLV 1P7BA 4H33A 5B1OA 3L3FX 3PJSK 1V54B 4KMOB 2HLDG 3FB7C 1VQOV 4C0ZA 4MTOA 1FXHA 4P0QA 2QM7A 3C29A 3ETDA 4ZKIA 2VJ4A 2ZXWB 1H8EG 1THZA 1NZBA 1FS0G 2OYYA 3T4DA 1H2GA 5L3GA 3LDDA 2B1GA 1PVQA 1M9NA 4OXSA 3ZMUA 4J9ZB 1K33A 4MSWC 2W03A 4PDMA 1K9MW 1KD1W 3VC8A 2OCCC 4OJ6A 1R6NA 2M7WA 4FJCC 2JEUA 4WFAV 1OHHG 5B1BC 3I55V 3LSQA 1F4NA 1DF5A 2XAFA 3NXSA 3SJQC 2V1DA 1SRYA 4JTCB 4X89A 2IU0A 2EIJC 3CYMA 5CRXA 3STLC 2IJKA 1I5YA 1QVGU 1TUEB 3JD4A 3P30A 4JASA 2W04A 2K8BB 1FFTB 1K4DC 4MTGA 1D8BA 3G6EV 4R50A 2ZDIA 1R3IC 4HYOA 2F76X 2ITCC 2EIMC 2X6AA 2DGZA 4FE3A 3KFUF 4UV9A 3TETA 3RW0A 1NR7A 3CD6V 2G5IB 5LGNA 2HBMA 2PI4A 3CP8A 3E0FA 2FTKA 3OMNB 4QNHB 3ZIAG 3HB3B 4UXNA 1VQ5V 2H3QA 3B8NA 4MVUA 2YEVA 4LCUC 3CCUV 2DWDC 1AJNA 2LFRA 1AI4A 4JTDB 1PVRA 4KX5A 4BX9C 3A0RA 3SPGA 1YJWV 2G09A 1R6KA 2EBOA 2P7TC 2KJ8A 3ML0A 3MHHC 2YX8A 3N7SC 3LVWA 5CBGA 4IC9A 2K1EA 4UVCA 4WF9V 4U7OA 1JPXA 5KL8B 1F4MA 4U7NA 3ZMZA 2WLIB 3I56V 1R73A 3OPXA 1XL6A 1S5HC 3PSPA 1YIJV 2XAHA 1F44A 3CRXA 3AG4C 2ITDC 1BHAA 3ABTA 3K9AA 4CBCA 2IJHA 5C93A 1V55C 5CBFA 5E1AC 3CCVV 2GSMB 1SETA 5T14A 2EILB 1K5QA 4WFFA 2KHQA 2XIDA 1PL0A 3IN5A 1JX9A 1OCRB 3IC7A 3ABKC 4QIWC 1S0VA 1Y66A 2K4HA 3STZC 4QPKA 3CCEV 3CC7V 3ZN0A 3OMAB 2WAQF 3CMEV 2Y48A 2DQNB 1G4YB 1COWG 3K79A 2NV3A 2QA4V 2KJ5A 3ETGA 4P0PA 1PKXA 3T79A 5CMUA 3G4SV 1VQKV 2B1IA 3WG7B 2XNDG 5L3EA 2X0LA 2DYSC 3RVZA 2HBJA 2X6BA 3CYOA 2WLJA 3IFXA 3F7YC 3MD0A 4FZLA 1S3JA 2XI9A 4HAMA 4JYBA 1KECA 4GFJA 3FB5C 4OJLA 4A8EA 2JH7A 3SYQA 3SPIA 3X2QC 2A79B 2DYRB 2P90A 3ABUA 2KOBA 2PI5A 3ABMB 3CCLV 3WFVA 2LYAA 1BHBA 1AI5A 4NLCA 1IIPA 3LYSA 3K08A 1OCZB 1ORQC 2QE7G 3OMIB 2ZIUA 1BL8A 3SMVA 5DN6G 1YTFD 3M7DA 4MTXA 2OM6A 1GM7A 4PA6A 1URJA 1I5XA 1OCCC 2CK3G 4UUJC 3IG5A 2KB1A 1SERA 3T4ZA 2HOIA 2WAMA 1YITV 1EFRG 3UKMA 5HR7A 1L1FA 2KJ9A 3AG1B 4TT3G 2WLLB 2IJIA 1H8HG 5B3SC 5A0LA 3OEHG 3B8MA 2R9RB 1RPRA 1HEKA 2Y69C 3OE7G 1FXKB 2EIKC 3FYEB 5IYDO 1K3EA 4PA9A 1QR8A 4P30A 1HWYA 3F5AA 2IU3A 3ASOC 5DM6V 1M1KW 1AI7A 1QLEC 2H94A 2Z3YA 3D3IA 3EFFK 3JD3A 2NLJC 2G06A 2DW4A 5H6RA 4LBEC 5KUMA 2KD1A 1R3JC 1A0PA 4AYBF 5IY5C 4P0QB 1K4CC 1YT3A 1JJ2U 2M0NA 1Z1BA 1Z19A 3PSIA 2VKQA 1R3KC 3M6ZA 2ZXHA 3R65A 4U6PA 2Z7JA 1SESA 3ZMSA 4BW5A 2HVKC 1Q3UA 2JJ1G 2HKOA 1JQ0A 2V7QG 3F2BA 5IDJA 2R18A 2ZG6A 2K8AA 4QNLA 5H9CA 2XAQA 4I5SA 4FZNA 1GMGA 3M99B 1HIWA 2G08A 2OCCB 3JD2A 3OEEG 1Q7YW 1L6NA 2ZXWC 5H6QA 3H0MB 3O0FA 4WFHA 5EBWC 2KVCA 3QO7A 4R7CA 2EIJB 2EZOA 4NWIA 1CEZA 2K4EA 3LVVA 2KNJA 4OJOA 3GZFA 2D6FC 2OT5A 2Q6AA 2HG5C 1YTFB 2C2AA 5B1AC 1AR1B 2H8PC 4RAIA 2Q68A 1W0KG 2Q67A 4BJQA 3OR6C 1WUDA 1NH2D 2HR3A 3JD0A 3CCQV 1YJNV 3LSSA 1ROPA 2EIMB 3FB6C 3E35A 4X88A 2JGAA 2LKYA 4FIPC 3ZRWA 2XICA 5KL1B 3K3WA 3OAAG 2YEVB 3GWOA 3OW2U 2AHYA 5L3DA 2G0AA 2PMZF 2YSUB 1H38A 4PL1A 1XO0A 2RP5A 2R9IA 2H3VA 2ZR3A 4DXWA 3CC4V 2W6IG 2QEXV 2LBOA 2OH2A 2P6JA 5L3BA 1F51A 2H3FA 2JH1A 5EC1C 3IGAC 3SPJA 1K92A 5CA3A 3AG3B 3SQIA 2W7OA 2ZIWA 1UJWB 2HBKA 1PNLA 3N7RC 4RUFA 1JVMA 3W7XA 3LUTB 4PELA 1NR1A 3QO5A 1N8RW 3IP4B 1QR9A 4OJPA 5J9PC 2IH1C 3E8GA 4PA7A 4XDLA 4TWKA 1AROP 4F4LA 4ASUG 1RPOA 3AG4B 4KUMA 3W7SA 1RM1B 2XASA 1DF4A 5KA6A 3OUFA 4G2KA 1OCOC 1DTOA 3D36A 3ZJZA 2A9HA 3ZMVA 4X8AA 4JF3A 4PDVA 4GX2A 3CXCU 2F77X 1K97A 2GH1A 4E2LA 2IW5A 2WAQC 2YB4A 3OFNG 2Q69A 2HOFA 1PNMA 1MA7A 3ABKB 3K04A 1NKDA 3OR7C 3CMAV 1VQ9V 1MG1A 4XDKA 5EC2C 4WFBV 3BY6A 2ATKC 4P0PB 2EILC 2HVJC 3B77A 3SYPA 1CP9A 3JYCA 5IYBO 2IJJA 3AG2B 4WCEV 1K73W 1OCRC 1R3LC 4MVOA 2ZIXA 2D3OW 4LC1A 3FKSG 4MS2A 4FPPA 2Y0SC 1Q86W 1NH2B 1B6QA 2Y0SF 3ETEA 4N21A 4OJ5A 2KICA 4NLBA 3K0GA 2KIWA 4JGSA 2ZIUB 3W7WA 3KG2A 1M90W 3H0LB 3F5WC 2G07A 3K06A 2LHTA 3ALRA 3AQFA 3SPHA 2F43G 4RUEA 4GCZA 1KC8W 5KUKA 3PZPA 2DYRC 2DQ3A 4N23A 3ABMC 2KV2A 2EINB 3SAGA 2X7RB 1G8MA 4ACOA 3FYIB 2OXOA 3LDCA 2WLNA 4KP4A 4LP8A 1OCZC 3TCUA 4WFGA 3SYAA 1VQ7V 3SYCA 3ABLB 1KKDA 3RF9A 5HFMA 5LGUA 4PA4A 1QLNA 2W7PA 1Y4MA 2K4IA 1YI2V 3RFAA 1UPHA 4Q20A 1M56C 4I9WA 4MVZA 2E5SA 2QTOA 5HFLA 4MVSA 2GHYA 3MGVA 5LGTA 5GW7A 5B3SB 1M57C 3UM7A 2CN1A 3HKZC 3CCMV 2KEYA 2E1EA 3HKZF 1AI6A 4QJFB 1EZJA 1QBZA 1SZTA 2BOBC 2Z5UA 4JAUA 1VQ8V 2QM8A 4YXWG 4AYBC 3AG1C 1IXMA 1GM8A 1QLEB 2ZXIA 1ZWIC 3ASNC 4P9OA 1VQLV 3P32A 3JCZA 3JD1A 4ICAA 4O3MA 3TK1A 2HOQA 2YB1A 3C28A 1FXVA 1T94A 2W0FC 5LHIA 4U7CA 4MW8A 2H3ZA 1NQTA 3EHBB 5IY5B 1FXKC 3SAFA 2HBLA 3NRWA 2WPDG 1TAMA 2WLMA 3MHSC 4PDLA 5IYCO 3E8HA 4J9YB 2X6CA 1Q82W 4GT1A 3K03A 2GOLA 3N7PD 5C0YA 2WLHA 1ZQ1C 1V54C 4RO2A 5L3CA 3CPWU 1NBMG 4PDRA 3AL0B 1E1RG 2XAGA 2XOKG 1VQPV 2KKVA 5B1BB 4QPJA 3K1ZA 4P9PA 3VCBA 2JK5C 4R8CA 2JDIG 1JOYA 1NVPD 2ZQMA 2CPRA 1S76D 2ZD9A 3QO8A 1OZ0A 1Q81W 4XBFA 2JMGA 3KZXA 2H3IA 3F2CA 2AHZA 1MOFA 1KBUA 3T2MA 2NNUA 2UXNA 3E86A 3D2QA 2A3VA 5FL7G 3D2NA 4FZMA 1GK9A 1NJIW 5BZBA 1E79G 4GX0A 5B1AB 1QVFU 4MVMA 1F23A 3PSFA 2K8CB 3OM3B 1K5SA 3ZRWB 3D2SA 2E1FA 2QKSA 4HZ3A 2LYBA 2PMZC 2WLKA 4R6ZA 2JEXA 3F2DA 2UXXA 1PVPA 4MTFA 3F7VC 1S72V 2ZDIC 3ZN1A 1P7DA 3E89A 1W2BU 1WPXA 3RVYA 4DO2A 3GU3A 1ECWA 4MVQA 3OUSA 2DQ0A 2XVTA 2LP7A 4FK5C 1YHQV 2W6JG 1K7DA 2G5HB 2XAJA 2F8LA 4PL2A 2MA1A 3T1CA 2ZIWB 1E1QG 2DWEC 1XNSA 4BAYA 4MVRA 1P4RA 4UVBA 5CN0A 1V55B 5EK0A 4UVAA 2Q4TA 3E83A 3LDEA 4CGZA 4OO1J 3QNEA 2WB1C 1KP2A 2JHDA 2RRDA 5LHGA 2WB1F 3AEIA 3HPLC 4PA3A 1DRGA 4JTAB 1Q3VA 3AG3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NLB A;  2E1E A;  1D8B A;  4QJF B;  1GO3 F;  2CPR A;  1YT3 A;  2HBK A;  2MA1 A;  4O3M A;  2DGZ A;  2HBJ A;  2KV2 A;  2HBM A;  1WUD A;  3SAG A;  3SAF A;  2HBL A;  3SAH A;  4CDG A;  4CGZ A;  4OO1 J;  5C0Y A;  2E1F A;  2RHF A;  2RRD A;  3CYM A;  4NLC A;  4QIW F; 
#chains in the Genus database with same CATH topology
 1BE3 H;  1W0J G;  3GVM A;  2I6X A;  9ICK A;  5J0R A;  1O03 A;  4P4P A;  4MEX A;  3SJC C;  4RQF A;  3J7A U;  1OCO B;  1GO3 F;  4JAV A;  2HP8 A;  4GXJ A;  4DS5 A;  3QUB A;  1N34 B;  1JCH A;  3G71 V;  1PNK A;  4F4Y A;  1JRO A;  3GB7 C;  4G27 B;  2Q7E A;  3QEA Z;  2EAP A;  3CRC A;  8ICF A;  1BT8 A;  1D8L A;  1A6S A;  3JPO A;  2AJQ A;  1WLE A;  1SV0 A;  4RNO A;  1SGG A;  4DFK A;  4L87 A;  2Z0A A;  1N56 A;  4KX3 A;  3OGU A;  4CDG A;  5DGA A;  1XSL A;  4EFE A;  9ICM A;  3RYI A;  2JEF A;  4UCS A;  2RHF A;  2YTU A;  1C20 A;  5JTI A;  2JEG A;  4UCV A;  1IDS A;  5AM0 A;  3SEI A;  4C80 A;  2MRL A;  2F2A B;  3F5E A;  3ZHU A;  3PV8 A;  5J0P A;  3RR8 A;  3MR3 A;  1PD3 A;  4O3O A;  1XIL A;  3JAM N;  5ALW A;  4KLT A;  5KFW A;  4JYC A;  3VBB A;  4EBC A;  4GX1 A;  1L0N H;  5L9X A;  2NRV A;  2R9A A;  1XI1 A;  1AJP A;  4KLL A;  1EM1 A;  2F1I A;  4MW3 A;  1ZRM A;  3WKA A;  4GLX A;  1U4B A;  1V85 A;  1KQS U;  2QKA A;  1Q90 D;  2LO1 A;  3WU2 U;  2LJ2 A;  4IR1 A;  4DSK A;  3B4S A;  3FB8 C;  3HT3 A;  9ICJ A;  1B0X A;  4ZHQ B;  1VQN V;  3BA9 A;  1I0H A;  2JJ2 G;  4GX5 A;  5AK6 A;  4ZBM A;  2Q4P A;  3C2K A;  1PUZ A;  4Q8E A;  2WSS G;  1N5W A;  3ICX A;  4DSE A;  3GIJ A;  1M56 B;  1NJZ A;  3SYO A;  3TAC B;  2ETN A;  2YIA A;  3RYF A;  1BSM A;  4FLW A;  3LDA A;  3N97 B;  1FFX A;  2ZE8 A;  3H01 A;  5AKH A;  4IQV A;  3UMG A;  4DLE A;  2ILM A;  2PFQ A;  4YY3 O;  4RT3 A;  1J95 A;  1JAL A;  3HP6 A;  1XHX A;  3ASN B;  2BTQ B;  1SZH A;  4IT5 A;  1SA0 A;  1SA0 B;  3E8F A;  4Y2U A;  2FLL A;  5AI9 A;  5CHG A;  2DF4 B;  1H2N A;  1TGO A;  5FPO A;  3DGE A;  3CC2 V;  1WCL A;  2LFS A;  3PNC A;  1ZL8 B;  1ZQW A;  4B3S B;  8ICI A;  2ZTC A;  4CZZ A;  4H37 A;  4LZG A;  4H33 A;  4DK0 A;  1Z2G A;  3L3F X;  4YD2 A;  2WF5 A;  3V7K A;  1HNZ O;  1YDX A;  1FXH A;  4NLN A;  1HUO A;  3C29 A;  4ZKI A;  4CH3 A;  2VJ4 A;  4ABM A;  1H8E G;  5L3G A;  2OYY A;  1IBK O;  1L8O A;  5J0T A;  1M9N A;  5D49 A;  4L8J A;  4MSW C;  4CS3 A;  5DGB A;  4FM2 A;  5HML A;  4PDM A;  2QWR B;  1R6N A;  5IIM A;  4FJC C;  4NJ8 A;  4WFA V;  5LMN B;  1OHH G;  1BCC H;  8ICW A;  3GV7 B;  3TAQ A;  1BNP A;  4QWE A;  2XAF A;  3KOO A;  4JTC B;  4X89 A;  4F5P A;  5CRX A;  1BPY A;  4IIJ B;  1XSN A;  5KT2 A;  1I5Y A;  4YHH B;  2BSK B;  2YML A;  1EXN A;  3K5L A;  2W04 A;  5FP0 A;  8ICA A;  4BXO A;  2NRW A;  2ZUC A;  1IBM B;  1L3T A;  4R50 A;  1A32 A;  4I55 A;  5AI5 A;  1VF6 C;  2ZDI A;  5EOZ A;  3KHG A;  1O9G A;  3ED5 A;  2JV3 A;  2DGZ A;  4FLX A;  4UV9 A;  3LWM A;  2LM4 A;  3RW0 A;  1NR7 A;  2LW7 A;  2PI4 A;  1I94 O;  3CP8 A;  3FC4 A;  2EZY A;  3PR4 A;  3OMN B;  3A0H U;  4YR3 A;  2UUA B;  4UXN A;  3KCY A;  1VQ5 V;  3CCU V;  3BRC A;  5F2V O;  4KLJ A;  3QU4 A;  1KYO F;  4JTD B;  2XGQ A;  4BX9 C;  3AU6 A;  3LNN A;  2G09 A;  4NL9 A;  2P7T C;  2QLT A;  1D9F A;  3MHH C;  5CBG A;  4FFB B;  3AG7 A;  4WF9 V;  1M4U A;  4ZH4 A;  1M93 A;  2WLI B;  4DL7 A;  4DL2 A;  1Y74 A;  1JX4 A;  2ZNJ A;  1SB3 C;  4DOC A;  2BCR A;  1XL6 A;  2E74 B;  5AKX A;  5TZV A;  5L1L A;  2EJ7 A;  2LW1 A;  5LXT A;  4C8O A;  4DV0 B;  5J2A A;  5J2C A;  4DR6 B;  1NJY A;  1TK8 A;  5CBF A;  1V55 C;  3CCV V;  2AU0 A;  1SKW A;  4JTA B;  4RQN A;  2YI8 A;  3Q8P B;  3PN1 A;  3M9N B;  2PFP A;  3IN5 A;  4I2F A;  2B0C A;  4QIW C;  4KLD A;  3RB3 A;  4LH7 A;  1NI8 A;  4B3M B;  4ZOL B;  3ZDE A;  1ZQG A;  8ICO A;  3CC7 V;  3ZN0 A;  3R9K A;  4DV4 O;  3G6V A;  2KK0 A;  4I2H A;  1XHZ A;  3L9D A;  3ETG A;  4F6E A;  7ICH A;  1PL4 A;  5IJ0 B;  5CMU A;  5IJ0 A;  3J81 j;  3G4S V;  1S8O A;  5D4B A;  3WG7 B;  2XND G;  2LYH A;  5KFY A;  1Z00 B;  4DRX B;  3RVZ A;  2HBJ A;  4I2J A;  2X6B A;  2AZ0 A;  4G3I A;  4JK1 A;  4FZL A;  4RT2 A;  4O0I A;  2CTP A;  3FAV B;  4OJL A;  3CRA A;  2NYV A;  3UO2 A;  4DUY O;  5CB4 A;  3CCL V;  5JRT A;  1T5E A;  3SI8 A;  1BHB A;  3KZI Z;  1RYR A;  3K4G A;  1OCZ B;  3SEN A;  3SMV A;  2MSN A;  4O3N A;  4MTX A;  1GM7 A;  5KX5 A;  1URJ A;  4MF2 A;  4KMU A;  3H8W A;  1L8L A;  3TAR A;  4KLE A;  1GRJ A;  4I0X A;  4NB5 A;  3T4Z A;  4NTW A;  2PXI A;  5L1I A;  2OIG A;  4NKG B;  4YCX A;  3PX0 A;  1DGJ A;  2HCF A;  3AG1 B;  5KG0 A;  1KUQ A;  4TT3 G;  3QVN A;  1H8H G;  4O2B B;  1XEQ A;  2RDC A;  4TOI A;  1ZSP A;  2VA8 A;  2R9R B;  4UB6 Z;  4LF8 B;  1FXK B;  2V9W A;  4QZH A;  4Z6D A;  1HWY A;  1IXB A;  1AI7 A;  1QLE C;  1RFY A;  2H94 A;  3UQ2 A;  1N33 B;  2Z3Y A;  3ZHV A;  3OSP A;  1YEW A;  3I5D A;  4BWJ A;  4CC5 A;  2CDY A;  3JAR B;  4X1Y A;  4F4X A;  1FAF A;  2M0N A;  1Z1B A;  9ICB A;  2I5H A;  3C23 A;  3S6J A;  2VKQ A;  5HHI A;  7ICT A;  1KMI Z;  2ZNI A;  2FI1 A;  2ZXH A;  3R65 A;  1SES A;  3QZ7 A;  4O2A B;  2HKO A;  3ZX6 A;  2Y9T A;  2V7Q G;  3OHA A;  1ZQP A;  2R18 A;  5DED A;  2K8A A;  1J2M A;  3V6J A;  1HNX O;  4FZN A;  3T5K A;  3JPS A;  5IWA O;  1HIW A;  2G08 A;  3ETR A;  2OCC B;  4NLK A;  1L6N A;  2Y4U A;  1KEJ A;  3H0M B;  1QSS A;  1X9X A;  4ED6 A;  2HHV A;  4QZD A;  2C2E A;  3Q4H A;  3Q4H B;  3WB0 A;  4R7C A;  5JU5 A;  2R8G A;  2EIJ B;  1CEZ A;  3HKC B;  9ICE A;  2VQF B;  4F4K A;  1D2D A;  2OT5 A;  2R72 A;  2E8M A;  2DOS A;  3M8R A;  1SQP H;  3GIK A;  4RAI A;  2Q68 A;  1W0K G;  4C4R A;  3OR6 C;  4O4L B;  3JD0 A;  2EIM B;  5EYP A;  5EYP B;  2A1J A;  4UAZ A;  3OD4 A;  4Y2J A;  1HNZ B;  1BZK A;  3M1Y A;  3OAA G;  5KFB A;  1Q43 A;  2F95 B;  3ETL A;  2XHB A;  3OW2 U;  1IBK B;  2G0A A;  4ECZ A;  1NS1 A;  3H9V A;  3CXH F;  1YZ7 A;  1XO0 A;  2ZR3 A;  4BIO A;  3CC4 V;  2H3V A;  4DXW A;  1VF5 B;  3MDS A;  4CE6 A;  2QEX V;  3KBB A;  2W9C A;  4US9 A;  2JH1 A;  2W9C B;  1K92 A;  2JRI A;  1TK5 A;  2CTW A;  1DOQ A;  3AG3 B;  4LF6 B;  3U10 A;  2HSZ A;  4PA7 A;  2QGN A;  1ARO P;  9ICI A;  2HHX A;  4J9P A;  3BAA A;  1RPO A;  3AG4 B;  4ASU G;  3G6Y A;  4J7Z A;  1TVA A;  4C7Y A;  4Y2Y A;  4ICG A;  5JVD A;  4MFA A;  4DQS A;  4A5U B;  5A2Q N;  2VA3 A;  2LPE A;  4YQW A;  1BVS A;  1RYS A;  4RQ6 A;  1SXD A;  4PDV A;  2VQF O;  2F77 X;  5BPC A;  1K97 A;  2GTS A;  3WKD A;  1I94 B;  2WAQ C;  2ARH A;  2HOF A;  2Q69 A;  3OR7 C;  3RYC B;  5EC2 C;  2AXT U;  1LKY A;  1WCN A;  1TV9 A;  9ICT A;  4K3A A;  4ED2 A;  3CRQ A;  4F4W A;  1PPJ H;  4JB3 A;  1LUW A;  1Z4O A;  1K73 W;  4WCE V;  1HJP A;  3MR6 A;  3SV3 A;  5DG7 A;  1BPB A;  3JCU Z;  3KHR A;  4TV9 A;  4TV9 B;  4LC1 A;  4JWM A;  3JAS A;  4EB6 A;  1RSO A;  3QG5 A;  4MS2 A;  8ICH A;  3HKE A;  5DBB A;  1NH2 B;  2GLE A;  2XY5 A;  3ETE A;  1NU1 H;  4N21 A;  4OJ5 A;  3K0G A;  5JH7 B;  2ZIU B;  5KFO A;  4UAV A;  1ZTE A;  2KN7 A;  2KZZ A;  4BW9 A;  5IIO A;  3H0L B;  4LWS A;  4LWS B;  2V4Q A;  3ALR A;  2G38 A;  2XGP A;  1NK7 A;  4P2H A;  3CE2 A;  4RUE A;  5DB9 A;  3D8C A;  4DR7 O;  1X42 A;  3SAG A;  2X7R B;  3FYI B;  3TJT A;  4RPX A;  2RDI A;  3QUQ A;  1DK1 A;  1OCZ C;  4NVP A;  4X65 O;  4IQU A;  3SYA A;  1VQ7 V;  3ABL B;  1KKD A;  2A7W A;  3RF9 A;  5LGU A;  2CAZ C;  4DV4 B;  2W7P A;  8ICE A;  1TKD A;  1Y4M A;  5B66 Z;  1YI2 V;  1UPH A;  3ZDC A;  5DB6 A;  4NXZ A;  2EAN A;  9ICS A;  3EZ5 A;  2LGW A;  1XOU A;  2CN1 A;  2ZT9 B;  2BQR A;  3CCM V;  2E1E A;  1QQ6 A;  2OWO A;  1QBZ A;  1SQX H;  2BOB C;  4JAU A;  1ZQR A;  4DFD A;  3KHL A;  1SZX A;  4I2G A;  3AG1 C;  1GM8 A;  2C22 A;  1JI7 A;  4JI3 O;  3DDH A;  5ALE A;  5F3X B;  4DUY B;  2HOQ A;  2P6R A;  4EZ9 A;  4EEK A;  4U7C A;  1C7Y A;  2QM4 A;  4MW8 A;  3EHB B;  1FXK C;  5AI8 A;  4DV6 B;  3SAF A;  2HBL A;  1Y76 B;  4JUZ A;  4PDL A;  4CF4 A;  5A9G A;  2E8N A;  4J9Y B;  1QH9 A;  2X6C A;  1Q82 W;  4GT1 A;  3QZ8 A;  1SWW A;  2W9B A;  2DPI A;  5L3C A;  4ED7 A;  4YJ3 B;  1NBM G;  2ZUB A;  3AL0 B;  2XAG A;  4PDR A;  1SWV A;  4YVZ A;  1WP7 A;  1NZ6 A;  5BR8 O;  3QUT A;  3G80 A;  1ZQV A;  5ALL A;  3T1H O;  5H2F U;  3VCB A;  2Y9U A;  1VIB A;  2JDI G;  1JOY A;  3D3Q A;  4IRK A;  2A19 A;  2UXB O;  4R8U A;  3ZED A;  5J2F A;  1Q8K A;  1ZQU A;  2IBZ H;  7ICN A;  4XBF A;  4ECS A;  4AP9 A;  3BQ1 A;  3NR7 A;  1KBU A;  4PI0 A;  5KFL A;  3WB1 A;  2UXN A;  4TQR A;  1WB8 A;  2A3V A;  5KHH A;  1NJI W;  3NRZ A;  4GX0 A;  4KLI A;  2QWN B;  3ZRW B;  2QKS A;  3PY8 A;  4I4T B;  4OD0 A;  4I4T A;  2KVS A;  4X64 O;  4NM1 A;  5ALK A;  2LYB A;  2PMZ C;  4R6Z A;  4UAU A;  1A76 A;  2F3N A;  3ZN1 A;  1U9L A;  2Y0I A;  2DFL A;  4DO2 A;  1JJO A;  1BQZ A;  5KFE A;  2XVT A;  3L72 H;  5J2D A;  1YHQ V;  2W6J G;  5FLX N;  4ECR A;  1K7D A;  2F8L A;  3SJB C;  4CH4 A;  3T1C A;  3JSL A;  2ZIW B;  4C8N A;  3Q8L A;  4HNA A;  1XNS A;  4C4T A;  2EX3 A;  3RFR A;  5CA0 A;  2UU9 O;  2KG5 A;  5K4L A;  1KU9 A;  5CN0 A;  1F0M A;  2OCE A;  3QF7 A;  5EK0 A;  4JV5 O;  1US6 A;  3PX6 A;  4TQD A;  3UT5 A;  3FYH A;  2JS3 A;  2JHD A;  4LVS A;  5LHG A;  5DDY A;  7ICR A;  1JRP A;  3ZHS A;  4C8L A;  3AG3 C;  1ZQS A;  3W7U A;  2YIB A;  5IT9 N;  2C28 A;  5ALD A;  4JI7 O;  2NRX A;  1K34 A;  5KG2 A;  3T3F A;  2ADQ B;  4UW9 A;  2BPG A;  2AW9 A;  4IL6 U;  2QB1 A;  1KFT A;  3DXR A;  4G28 B;  2AHO B;  5J2E A;  4FM1 A;  3DEE A;  1UA0 A;  1IM4 A;  3IJ4 A;  2AGO A;  3CCR V;  1S77 D;  3DV9 A;  2ZE6 A;  5LYJ A;  1OUQ A;  1D8Y A;  2IOH A;  3PST A;  3K9S A;  5LHH A;  4KHP O;  1COO A;  3H0R B;  1N61 A;  4QIW F;  4UCU A;  4LF4 O;  3SYZ A;  4O3P A;  1GM9 A;  4DF8 A;  2JIZ G;  1EN4 A;  1ZQK A;  3ISB A;  1QCE A;  4B9T A;  5B1N A;  3C3T A;  4CF3 A;  4FM0 A;  3EVK A;  4KN7 A;  5AKG A;  3S3W A;  4O9M A;  3CCJ V;  1TVK A;  4PHZ A;  3C5F A;  4RUA A;  3ZDA A;  3RJF A;  2VIX A;  5DQI A;  4B9M A;  2N1R A;  7ICP A;  1AJQ A;  2K89 A;  7ICF A;  5CBH A;  1GTO A;  5LOV A;  3JAT A;  4I2B A;  2KKP A;  2Y69 B;  4JV1 A;  4XDJ A;  2HHH O;  3NVW A;  2MK3 A;  4NV0 A;  2P4K A;  3T5H A;  3ABL C;  3H1H H;  4YIP A;  2CRX A;  4WBN B;  4FLY A;  1NTK H;  1NKC A;  4DS4 A;  1M5I A;  2F23 A;  2WWW A;  3DTU B;  3ZRS A;  5J2T B;  1MSW D;  4BIU A;  4JPR A;  4RQE A;  7ICI A;  2F66 C;  4UFZ A;  3SAH A;  2B5U A;  4TUY B;  5CEH A;  1YJ9 V;  4ECV A;  1VF7 A;  2I1Q A;  3E22 B;  5KFS A;  5E79 Z;  3H7I A;  3K58 A;  2IH3 C;  3SPC A;  1VLB A;  3ZRV A;  8ICG A;  3C3S A;  5AG2 A;  5KG4 A;  4DR7 B;  4CS4 A;  1VDV A;  2HLD G;  4C0Z A;  1MZF A;  3Q8R B;  4QZI A;  3ETD A;  1S0O A;  2EDU A;  3TQ1 A;  4X65 B;  3T4D A;  1NZB A;  1ZOL A;  2B1G A;  3T1Y O;  2YID A;  4QZE A;  4MEY A;  5KT6 A;  3Q8Q B;  4PJ0 U;  7ICU A;  5J0O A;  1KD1 W;  3VC8 A;  2AZ2 A;  1ZQL A;  3T5J A;  1ZQT A;  2M7W A;  1U49 A;  2OCH A;  3IAY A;  4NXM O;  2XCP A;  4Q6G A;  4CH5 A;  1KW4 A;  3MR5 A;  3SJQ C;  2V1D A;  3T5L A;  1QVG U;  1NJW A;  4AIL C;  3JD4 A;  4JI3 B;  2K8B B;  2QWQ B;  1D5N A;  3M8S A;  4LF7 B;  1K4D C;  5GTH U;  2BE3 A;  3NTU A;  4GYC B;  3QU9 A;  5L1M A;  1WA8 A;  9ICU A;  4NR1 A;  2C2R A;  1SKS A;  3LWL A;  1HNW B;  2X6A A;  4QWB A;  3LK9 A;  3TET A;  2NO4 A;  1L7M A;  9ICP A;  2HBM A;  5J8Y A;  5BR8 B;  3EPG A;  4P4O A;  3NS1 A;  1QQ5 A;  5AM1 A;  3WKC A;  3JPT A;  2CGO A;  3T1H B;  2E3T A;  3B2E E;  2H3Q A;  3V6K A;  3B8N A;  4NXN O;  4PZO A;  1OV9 A;  2DWD C;  5B5E Z;  5ALQ A;  1GH6 A;  1PVR A;  4KIT B;  4UB1 A;  3BZK A;  2UXB B;  4RPY A;  3A0R A;  4G9B A;  2CH7 B;  2BCV A;  3HKD A;  2YX8 A;  4UVC A;  2M6Y A;  4BDP A;  3BAB A;  4U7O A;  2BZF A;  5KL8 B;  3OJS A;  4X20 A;  1UT8 A;  7ICK A;  3I56 V;  4PZN A;  4ECW A;  5JCO C;  4F2S A;  2ZJA A;  3PSP A;  2XAH A;  4HYK A;  3CRX A;  5CWR A;  5ALP A;  4X64 B;  1BHA A;  4J41 A;  2F4V B;  4F72 A;  4P4M A;  2IJH A;  4QZC A;  2AGA A;  5III A;  5T14 A;  3D36 C;  3TFS A;  3RAQ A;  5HP4 A;  2EIL B;  3E58 A;  1K5Q A;  1T3N A;  2KHQ A;  2XID A;  1PL0 A;  4EX6 A;  2WA4 A;  3RYI B;  3N2G A;  4QWD A;  1JX9 A;  3IC7 A;  3ABK C;  5JWP A;  2R70 A;  3HW8 A;  1Z4N A;  2AH5 A;  4EYH B;  3STZ C;  1Z3E B;  3CCE V;  1HDJ A;  3OMA B;  2WAQ F;  2UU9 B;  2Y48 A;  3JAK A;  1G4Y B;  3K79 A;  3QX7 A;  2NV3 A;  1ZD4 A;  2QA4 V;  1T4G A;  4P0P A;  1PP9 H;  4RQ5 A;  1SL2 A;  5AI6 A;  3QYP A;  4NLG A;  4KLO A;  5J2G A;  5L3E A;  2X0L A;  3RYH A;  5AI4 A;  1SKV A;  2CTR A;  1KBH A;  3IFX A;  9ICN A;  1A77 A;  3MD0 A;  2ASJ A;  4UB3 A;  4I28 A;  1ZUQ A;  4HAM A;  4U3J A;  3RBD A;  1XS9 D;  1KEC A;  4U3J B;  4Z1V A;  4DV5 B;  1RM6 C;  2YS8 A;  1N0N A;  4JI7 B;  5KG6 A;  2PI5 A;  4MFF A;  3VQV A;  4DQQ A;  4RQ0 A;  3WFV A;  1LUV A;  4NLC A;  1IIP A;  4QZ8 A;  2JS5 A;  1BL8 A;  5DN6 G;  3NVV A;  2OM6 A;  4PA6 A;  1I5X A;  3CS5 A;  2WTF A;  3MBY A;  4DV7 B;  3JPQ A;  1FPO A;  4FLZ A;  3R66 A;  4UUJ C;  3IG5 A;  1ZQE A;  4XRH A;  1QNM A;  4CC6 A;  2EZX A;  3RYF B;  2XY7 A;  5J2U A;  4KLQ A;  1FFX B;  4B3T O;  1UHU A;  4OGQ B;  5KHJ A;  4ED0 A;  4B9V A;  2JGU A;  1L1F A;  4LF4 B;  5TIS U;  4B6J A;  4UB4 A;  3TAN A;  1KFD A;  4IRC A;  5KFP A;  1AR5 A;  4AHC A;  4RWU A;  2PF4 E;  5A0L A;  3OEH G;  3A0H Z;  4GKK O;  2JRZ A;  2BCS A;  2Y69 C;  5DKW A;  1FJG B;  4PA9 A;  1M1K W;  5DM6 V;  4DR4 B;  1X2I A;  2JVD A;  1QHT A;  1ZQN A;  2QB0 A;  3D3I A;  1KKC A;  4JYY A;  2NLJ C;  1I7F A;  2DW4 A;  3EW9 A;  4DSJ A;  1YT3 A;  2IHM A;  8ICC A;  1MN8 A;  5J2B A;  3HKB A;  4DLG A;  1Z19 A;  3PSI A;  2OIE A;  3C2M A;  4NLZ A;  3M6Z A;  2UUC O;  2EAM A;  1XSP A;  2KFZ A;  2F93 B;  3G67 A;  3ZMS A;  1RPL A;  2ZE5 A;  5IYZ A;  2Q8V A;  2GUZ A;  1JQ0 A;  3F2B A;  5J2J A;  2ZG6 A;  4YP3 A;  2XAQ A;  5KHG A;  1J5E B;  1GMG A;  1X9S A;  2HHH B;  4LZD A;  2GO7 A;  2F1M A;  3JD2 A;  2W8K A;  3OEE G;  2RJZ A;  5AHX A;  2OHF A;  4DW1 A;  4EZ6 A;  3L71 H;  4WFH A;  3O0F A;  2JZB A;  1V9P A;  5AKE A;  1KDH A;  2RN9 A;  5LP6 A;  5F9L A;  4BXO B;  1ZX3 A;  4J9O A;  4NWI A;  5KFI A;  2ASL A;  4I55 B;  1AQ6 A;  3C1Y A;  3GZF A;  4ELV A;  2Q6A A;  1ZQC A;  2IM9 A;  5DG9 A;  3ZBH A;  4KL1 A;  5B1A C;  4ECX A;  2H8P C;  1WG8 A;  3UM9 A;  2Q67 A;  4BJQ A;  1NH2 D;  1WUD A;  2HR3 A;  3CCQ V;  3AK2 A;  3LSS A;  4B3R O;  2UUB O;  4X66 O;  5J0U A;  2N04 A;  4UAS A;  2JGA A;  2LKY A;  2Y4T A;  4FIP C;  1GN4 A;  4RNN A;  4DR2 O;  3BHP A;  2XIC A;  5KL1 B;  3CHX A;  3K3W A;  4W4L A;  3QNM A;  2PMZ F;  2AQ4 A;  2RMK B;  2BPC A;  4UBB A;  1U96 A;  3T1Y B;  2RP5 A;  3AM9 A;  5DQG A;  3RB6 A;  2W6I G;  2F1H A;  2LBO A;  9ICH A;  1KSP A;  5L3B A;  1F51 A;  2H3F A;  2EUL A;  5KT7 A;  4JI0 O;  1Y74 B;  4NXM B;  5BXZ A;  5J0W A;  1N0J A;  5GTI U;  2P66 A;  2D8C A;  2HBK A;  3N7R C;  1JVM A;  5LXT B;  4Z6C A;  5HMM A;  4Q8F A;  4ZIB A;  1ZQQ A;  2HHQ A;  1ZET A;  3K5M A;  2IH1 C;  2BR0 A;  3ZI4 A;  1VEW A;  3K57 A;  2YIC A;  3UPQ A;  5KFA A;  2FL4 A;  1DF4 A;  5KA6 A;  4EBE A;  4G2K A;  1OCO C;  5LL6 Y;  4DEZ A;  2A9H A;  4X8A A;  4JF3 A;  3NVY A;  4GX2 A;  1WP8 A;  3FAH A;  2IW5 A;  2P35 A;  2UVW A;  2ISP A;  2YB4 A;  1PNM A;  4O4H A;  4O4H B;  4XDK A;  4O4I A;  2VWJ A;  4WFB V;  3M9O B;  1SV0 C;  2EIL C;  4NXN B;  3B77 A;  3UMB A;  1CP9 A;  1NI3 A;  2N74 A;  2FPM A;  3AG2 B;  1R3L C;  4MVO A;  2ZIX A;  2J6T A;  1VJ5 A;  7ICG A;  2ZIN A;  3FKS G;  4I2D A;  5AKZ A;  3V6H A;  1B6Q A;  2PFN A;  2Y0S F;  1X9W A;  5CB4 B;  2KG7 A;  5KTQ A;  4FVM A;  2KIC A;  8ICR A;  2PKE A;  2V4R A;  3CRM A;  3V7J A;  3TI0 A;  2GWS A;  1M90 W;  2CXY A;  1IVS A;  3QEB Z;  4LF5 O;  5KX5 B;  8ICM A;  8ICX A;  4JAA A;  2ZJ5 A;  5FPR A;  4I0X B;  5KUK A;  4EBD A;  3PZP A;  4N23 A;  4O3Q A;  5ALU A;  2OXO A;  2WLN A;  1L0L H;  2ZM6 O;  3EYZ A;  3SYC A;  1RXW A;  2CUG A;  4YXJ A;  5HFM A;  1HW7 A;  2HI0 A;  1NTM H;  1M56 C;  3BCC H;  2QTO A;  5HFL A;  2GHY A;  3MGV A;  5LGT A;  1M6Y A;  5GW7 A;  5B3S B;  5JQG A;  2WF9 A;  4M9N A;  3UM7 A;  3L74 H;  1PZN A;  2KEY A;  4DFJ A;  3HKZ F;  1AI6 A;  4QJF B;  2O57 A;  2Z5U A;  2LQT A;  4YJ2 A;  1YZB A;  4AYB C;  1IXM A;  5KFU A;  4X1Y B;  2FDR A;  3ASN C;  1NOM A;  4O3M A;  3TK1 A;  4BWM A;  1T94 A;  1TA8 A;  5IY5 B;  2H3Z A;  1NQT A;  4U3F H;  4FS2 A;  1S0N A;  4H0L B;  2WPD G;  4JI1 O;  1TAM A;  1AR4 A;  3CW2 C;  3E8H A;  4RQ8 A;  1NJX A;  2WLH A;  2DPJ A;  3BZC A;  1ZQ1 C;  3CPW U;  4ELU A;  1ZQX A;  4F3O A;  4Z2W A;  4O4J A;  4O4J B;  1VQP V;  2RLT A;  5B1B B;  2W9M A;  4P9P A;  4B3T B;  3KCX A;  2JK5 C;  4YY3 B;  2IBK A;  1WN7 A;  3ZHR A;  2CPR A;  1TK0 A;  4IHJ A;  4IHJ B;  1H2S B;  1N34 O;  2ZD9 A;  5EZY A;  3SR2 C;  4GKK B;  5ALY A;  2AXT Z;  1OZ0 A;  4Q44 A;  1XMO O;  1Q81 W;  4R66 A;  2KZM A;  1QQC A;  1MOF A;  3DSQ A;  3CSX A;  2Y0P A;  3N28 A;  4UB8 Z;  3E86 A;  3D2Q A;  1P84 F;  4JI8 O;  3PW4 A;  3JSN A;  1QVF U;  4ECQ A;  2DWQ A;  5AM4 A;  1F23 A;  4I2A A;  5LA6 A;  4NM2 A;  2A1J B;  3TAD A;  2FYU H;  3D2S A;  2KSO A;  2KSO B;  3H8S A;  1JFF A;  4BR6 A;  4HZ3 A;  4IQW A;  2WLK A;  5FNV A;  2UXX A;  1PVP A;  3F7V C;  1S72 V;  2ZDI C;  4J03 A;  2Q0O C;  3SZ2 A;  2UUC B;  4B7K A;  5GON A;  2VQE O;  1ECW A;  2YUA A;  2DQ0 A;  1ZD3 A;  4FK5 C;  3BFR A;  2RDJ A;  1Q6I A;  2ZIO A;  4PL2 A;  2MA1 A;  2BPF A;  4H44 B;  2W11 A;  4R64 A;  2QR4 A;  4F93 B;  4MVR A;  1P4R A;  1L5U A;  4UAY A;  4UB5 A;  4KLF A;  4QZG A;  4UVA A;  2Q4T A;  4NL9 C;  3RH5 A;  3LDE A;  4OO1 J;  3JAL A;  3AMZ A;  2WB1 C;  3C5G A;  1AIL A;  4FBU A;  3HPL C;  3KD3 A;  5JVD B;  1ZJN A;  2R8K A;  2RQ5 A;  4TWK A;  1SL1 A;  4ECU A;  1Q3V A;  4R63 A;  4C7U A;  5KHI A;  5LBQ A;  4DL3 A;  4RQ2 A;  4DK1 A;  3HPO A;  9ICX A;  3RBZ A;  2YMQ A;  4B3R B;  4YMN A;  1T7P A;  2UUB B;  4X66 B;  4ED1 A;  5ITZ A;  5ITZ B;  4DR2 B;  1KP3 A;  1LKY B;  3PVX A;  2OTJ V;  1G1X B;  1CPY A;  5BMV A;  4US8 A;  1B43 A;  1NVP B;  3OJU A;  1ED1 A;  4KFM A;  3RJJ A;  4B9U A;  4JYA O;  1GKF A;  1UFI A;  2BQ3 A;  1RQL A;  3AEV A;  5HR6 A;  2KHV A;  3JAS B;  3IDW A;  1RSO B;  4EB6 B;  1DLB A;  3AQE A;  3OHB A;  3HKE B;  4JI0 B;  4K4G A;  1CRX A;  3E8B A;  1K5O A;  4TUP A;  5KAI Z;  3IG8 A;  4Z1M G;  3X2Q B;  1U47 A;  5AM3 A;  3WG7 C;  5H2F Z;  3A0B Z;  5KFT A;  2BOC C;  3AG2 C;  1J97 A;  4GXI A;  3GFK B;  3N4M B;  2K60 A;  1PM9 A;  4RU9 A;  3ZRX A;  4B9N A;  1H2M A;  1OXJ A;  4TV8 A;  3CCS V;  2VJ5 A;  3OTQ A;  1F5S A;  1FKA O;  2DJV A;  3LNM B;  5KA5 A;  3RB4 A;  4GC7 A;  1NKE A;  2KTQ A;  4YFK A;  3SV4 A;  2P67 A;  2ZIM A;  1WAZ A;  1ZQA A;  1XL4 A;  3BJY A;  4ED3 A;  2W3R A;  2DKX A;  3K0D A;  1W59 A;  4OX9 O;  4J9M A;  4M0A A;  1ENV A;  4DSI A;  1Y67 A;  4UV8 A;  2UXD O;  3OTF A;  4WJ3 B;  1NK9 A;  3CP1 A;  3THV A;  1YVW A;  3ZHT A;  5EBM C;  3TXS A;  1XU4 A;  1KQQ A;  5EBL C;  2BDU A;  2UVV A;  2WF8 A;  3CB2 A;  3JPP A;  4TQS A;  4CH6 A;  1ZQD A;  2RQ6 A;  1Q5O A;  2IMW P;  2EIK B;  4LFB O;  3SD7 A;  3ASO B;  5CB1 A;  2PY5 A;  4KLM A;  1M57 B;  1ZXI A;  4YN4 A;  4DQR A;  1ZQH A;  1IBL O;  1IUR A;  3K75 D;  1QCK A;  3LSU A;  2WLL A;  4H13 B;  2ASD A;  3ONN A;  2Q0A A;  2FPL A;  4J9R A;  1ZYQ A;  1V38 A;  4EEQ A;  4JMU A;  4LF5 B;  1TAQ A;  3WK7 A;  2ALZ A;  1EBO A;  2PYJ A;  2W9B B;  3NUQ A;  4CNQ A;  2OYQ A;  5KT3 A;  2YMM A;  2HFE C;  2OTL V;  5B1O A;  1K1Q A;  3RH4 A;  2C2D A;  1N4C A;  4ZOH C;  2KKW A;  1V54 B;  1VQO V;  5IIL A;  3FB7 C;  3AU2 A;  4F2R A;  4MTO A;  1GAX A;  4P0Q A;  2QM7 A;  1SQG A;  1ZLZ A;  1N5X A;  1KL9 A;  1FS0 G;  1WPB A;  3LDD A;  3L5K A;  4R8U B;  4FFD A;  1B06 A;  4OXS A;  2DN9 A;  2CGN A;  2BHN A;  4DSL A;  1S10 A;  2OCC C;  4OJ6 A;  1B04 A;  3MFH A;  1COK A;  2ZE7 A;  3FFQ A;  3IM1 A;  2IA6 A;  2UVR A;  1WB7 A;  3L70 H;  5B1B C;  4FLT A;  3LSQ A;  1F4N A;  1DF5 A;  2IU0 A;  2EIJ C;  5DBA A;  4IYH A;  3BQ2 A;  1YZ6 A;  1ZQY A;  1GN2 A;  1N32 O;  4JAS A;  4PHD A;  1ZAU A;  4MTG A;  2EAO A;  8ICL A;  1D8B A;  5KHK A;  3G6E V;  2GV9 A;  2VAN A;  4JI1 B;  2DBY A;  2MAX A;  2L35 A;  9ICF A;  5ALG A;  1R3I C;  3QUC A;  2F76 X;  2IOF K;  2ITC C;  4QWA A;  5KFD A;  4J10 A;  2EIM C;  3CX5 F;  5EE3 A;  3CJH A;  3HJE A;  1HNX B;  1XNR O;  4FE3 A;  4HNA B;  1UCV A;  3KKY A;  5IWA B;  3CD6 V;  3M8A A;  2G5I B;  5KFX A;  1ZJM A;  2FB5 A;  3EPI A;  2FTK A;  5LGN A;  5JUM A;  5CA0 B;  4QNH B;  4FZ0 A;  3HB3 B;  3BQ0 A;  1ZQZ A;  4J9L A;  2YEV A;  4LCU C;  3UT5 B;  4DR5 O;  1AI4 A;  1X6J A;  1BNO A;  4KX5 A;  4I27 A;  3DC6 A;  1OW5 A;  2A1A A;  3Q8S B;  3BDP A;  3ML0 A;  3BQT A;  3LVW A;  8ICT A;  4IC9 A;  2K1E A;  2K4P A;  5IIN A;  3KKA A;  5ALT A;  1JUD A;  1F4M A;  3ZMZ A;  4JI8 B;  2ES6 A;  1DGS A;  2LGQ A;  1MC8 A;  5KG3 A;  1R73 A;  2QWO B;  3OPX A;  1S5H C;  4TUS A;  1YIJ V;  3PO4 A;  9ICA A;  3AG4 C;  3DXR B;  3RGB A;  3ABT A;  4Y2V A;  2ZKO A;  5E1A C;  2GSM B;  1SET A;  3O65 A;  4PGX A;  1JN3 A;  2JXJ A;  4C4S A;  1NKB A;  5LYJ B;  2VQE B;  2ISO A;  1S5L U;  1NNL A;  3FD9 A;  5KMG A;  3GQC A;  1KFS A;  3L4P A;  1RP3 B;  2K4H A;  5AK5 A;  5G5H A;  2L5Y A;  3ZD9 A;  5J0Y A;  1O9H A;  4QPK A;  2YXL A;  2EH9 A;  3CME V;  2AGQ A;  5KG7 A;  3GDX A;  3G6X A;  4RNM A;  3H8J A;  4PHP A;  1PKX A;  1VQK V;  3H8M A;  1D5A A;  5KFK A;  2DMX A;  2N05 A;  1VAR A;  2FLP A;  1SC5 B;  3CYO A;  1TVK B;  3F7Y C;  2RCV A;  1Q3E A;  1S3J A;  4IS7 A;  2HVI A;  1J2N A;  1XC9 A;  3FB5 C;  1I08 A;  1L7P A;  3SYQ A;  3X2Q C;  1MQ3 A;  2A79 B;  2KOB A;  3MDC A;  4YXM A;  5DB8 A;  4X1I A;  3WKE A;  1AI5 A;  2QKC A;  4QGP A;  3UMC A;  4Y2P A;  3K08 A;  2QE7 G;  1ORQ C;  4AQY O;  3TGU H;  5KAF Z;  3M7D A;  3RRG A;  4M47 A;  1S5J A;  4DV2 O;  5LOV B;  3JAT B;  1X9M A;  1X40 A;  3RH6 A;  3WK9 A;  4JYA B;  1ZQO A;  1SER A;  2MUT A;  3ZDD A;  1LB2 B;  2WAM A;  5AIC A;  1T8E A;  2GTA A;  3UKM A;  4ECY A;  2F8K A;  5HR7 A;  2W0X A;  1NTZ H;  1F7Y A;  1AP5 A;  3MC1 A;  3BA8 A;  4R65 A;  2R8J A;  3AN1 A;  4EEY A;  1KRP A;  3B8M A;  1KKX A;  1RPR A;  1HEK A;  4J9K A;  5DG8 A;  5EE1 A;  2EIK C;  1K3E A;  4LNU A;  1BGX T;  4YR2 A;  3ASO C;  1RQN A;  3APO A;  3ISD A;  3EFF K;  5KFJ A;  4O5E A;  4J9N A;  1AP6 A;  5H6R A;  5KT5 A;  5KUM A;  1R3J C;  1A0P A;  4AYB F;  4GIB A;  1JJ2 U;  4DOA A;  4DQI A;  2ODG A;  5KT4 A;  3I76 A;  3D6J A;  1VP7 A;  2KSD A;  4NTX A;  4OX9 B;  1R3K C;  3APQ A;  4EYI B;  2UXD B;  7ICM A;  2VRZ A;  3WK6 A;  3C1Z A;  4BW5 A;  1ZD5 A;  5AKY A;  2HVK C;  2YN4 A;  2XO7 A;  2BCC H;  2JJ1 G;  3TAP A;  3N2K A;  4PI2 A;  5KFG A;  4QNL A;  5D5Q A;  1FYJ A;  2W9A A;  4CCH A;  3RWR D;  2DE0 X;  4I7Z B;  2NN4 A;  4UCO A;  3CNH A;  4ZI7 A;  1IBL B;  4GUN A;  3A8T A;  5DB7 A;  3RJK A;  2EZO A;  2R8I A;  4J80 A;  2K4E A;  3I1Y A;  3LVV A;  2KNJ A;  1MSD A;  2D6F C;  1WA8 B;  3ZD8 A;  4Y2Q A;  4QZF A;  4ECT A;  1QTM A;  1GN3 A;  2C2A A;  2HG5 C;  2PTM A;  1YTF B;  1VF6 A;  3IV6 A;  4XUS A;  2E8O A;  3RR7 A;  3PO5 A;  4MF8 A;  4C8K A;  2V4D A;  1AB3 A;  5JJJ B;  1NK5 A;  2D2C B;  4J7J A;  3RJG A;  5CA7 A;  3GWO A;  2AHY A;  3WU2 Z;  2BQU A;  3MGH A;  5L3D A;  2W43 A;  2YSU B;  4KLH A;  2FE9 A;  1H38 A;  4LR3 A;  4PL1 A;  2R9I A;  8ICV A;  2KE7 A;  4FO6 A;  2QWP B;  5KFN A;  4F8R A;  2FKX A;  2P6J A;  3HKD B;  4PHE A;  5EC1 C;  3IGA C;  3JAW A;  4X20 B;  2GBO A;  2FMS A;  4B3M O;  2WHE A;  3SQI A;  3P3P A;  1UJW B;  1RYU A;  5DLG A;  5AKK A;  1K1S A;  3LUT B;  4PEL A;  5J2K A;  1RXV A;  3K5N A;  1N32 B;  3IP4 B;  1QR9 A;  4OJP A;  2UVU A;  2LMR A;  3OSN A;  1DXS A;  3E8G A;  5J9P C;  4F4L A;  4EX7 A;  4DFM A;  4KUM A;  2P6U A;  3HIL A;  3UQ0 A;  4K35 A;  1RM1 B;  5E79 U;  2BGW A;  2QAR A;  2QAR B;  2XAS A;  3PW5 A;  1AVM A;  3AK1 A;  3GIL A;  3ZJZ A;  2GDS A;  3SR6 A;  3N2G B;  2YC0 A;  3ZMV A;  2PFO A;  4Q43 A;  4M2Y A;  4F91 B;  3CXC U;  2GH1 A;  1XNR B;  5K1P A;  1H2L A;  2ZJ8 A;  1QSL A;  5ALJ A;  1QU7 A;  1N2X A;  2FMQ A;  3K04 A;  1VQ9 V;  1JA8 A;  1NKD A;  3CMA V;  3JAK B;  1TAE A;  2QJ1 A;  3BY6 A;  4JV5 B;  1FEZ A;  5C5J A;  4QWC A;  4K4H A;  4P0P B;  2HVJ C;  2ZUD A;  4DCC A;  4DR5 B;  2P22 C;  3SYP A;  4QW9 A;  3RYH B;  3JYC A;  3ZHQ A;  1P49 A;  2IJJ A;  1L7O A;  5CJ7 A;  3JPN A;  1BQ0 A;  2KMD A;  7ICO A;  3U0Z A;  1Q86 W;  1CI4 A;  3M9M B;  4NLB A;  2KIW A;  3MDA A;  1U97 A;  4JGS A;  3W7W A;  1ZRN A;  3KG2 A;  4AI8 A;  3QTC A;  5KFM A;  4LF8 O;  5D5P A;  2FML A;  2KP7 A;  4DOB A;  4DL5 A;  1ZQM A;  2IHN A;  2LHT A;  2ATL A;  3AQF A;  4F50 A;  1N33 O;  4NYK A;  4GCZ A;  1XUQ A;  1YCI A;  5J2U B;  4KHP B;  2KV2 A;  1Q46 A;  3C21 A;  2EIN B;  1G8M A;  3IRU A;  4ACO A;  3LDC A;  5JJN B;  3CEI A;  5B5E U;  1S9F A;  3RRH A;  1QLN A;  4I29 A;  5G5G A;  4PA4 A;  5ALZ A;  3QXG A;  4Q20 A;  4ZHQ A;  4HAI A;  3NAS A;  4MVS A;  4JV0 A;  2QB0 B;  1EZJ A;  4IYI A;  1NK6 A;  2XT9 A;  1SZT A;  2QM8 A;  4QW8 A;  8ICQ A;  4YXW G;  1LR1 A;  3HRD D;  4F5Q A;  4HBN A;  4P9O A;  1QLE B;  1ZWI C;  2ZXI A;  2A06 H;  5CR0 A;  4UQG A;  1VQL V;  3P32 A;  3C2L A;  3JCZ A;  3JD1 A;  4ICA A;  3QU2 A;  5GTI Z;  3HKB B;  1FXV A;  3C28 A;  1Q6U A;  2BTQ A;  2QKQ A;  4X9Q A;  4AQY B;  1RG6 A;  2WF7 A;  4FS1 A;  2YXH A;  2WLM A;  5IYZ B;  2GUZ B;  2P4V A;  4DV2 B;  1SQV H;  1XQ8 A;  3K03 A;  2GOL A;  2E3C A;  1ZL8 A;  4RUC A;  3QU5 A;  4KN4 A;  1E1R G;  3J80 N;  2QTS A;  5DBC A;  1CXZ B;  4F71 A;  4QPJ A;  3K1Z A;  2JZB B;  5LP6 B;  4W4K A;  2IOF A;  3ETQ A;  1NVP D;  2ZQM A;  2PZS A;  1S76 D;  1PK3 A;  1X59 A;  1SL0 A;  1SIJ A;  1QQ7 A;  2JMG A;  3KZX A;  1CUK A;  1BPZ A;  3F2C A;  4F5O A;  2NNU A;  4LF9 O;  5BOL A;  3D2N A;  1GK9 A;  2BKE A;  4LF6 O;  5K1X A;  4FLU A;  3PSF A;  1JMK C;  2K8C B;  4IIJ A;  4YR0 A;  2E1F A;  3ORY A;  4KXR A;  2BSK A;  2CTQ A;  1UQV A;  4DF4 A;  2KIV A;  4XQ8 A;  2JEX A;  3F2D A;  4IGG A;  3P3N A;  1WPX A;  1L3U A;  4RZR A;  1JIH A;  3GU3 A;  8ICN A;  4MVQ A;  4MFC A;  3OUS A;  1QSY A;  5J8Y C;  2JR5 A;  1L3S A;  5J29 A;  5LMU O;  1MNG A;  5ALM A;  1E1Q G;  1FIQ A;  4UB2 A;  9ICW A;  4GC6 A;  3PW7 A;  5AK4 A;  4UVB A;  1L3V A;  3WK8 A;  1UPG A;  4JI5 O;  4RQ7 A;  2KFN A;  2HJD A;  3E83 A;  5ALI A;  5IJ9 A;  5IJ9 B;  1KP2 A;  4PA3 A;  1FO4 A;  4QZ9 A;  1DRG A;  3OTO O;  4QZB A;  1JXL A;  2ATK C;  2YXY A;  3VOU A;  4FFB A;  1BMF G;  2F44 A;  1RZT A;  1MAB G;  1NZP A;  1YSC A;  5EIB D;  2FLN A;  2WLI A;  1VQ4 V;  5ALH A;  5L3F A;  3KHH A;  4J7K A;  3ZCC A;  1IXR A;  2EJR A;  4BIZ A;  1LNQ A;  2W8L A;  4Y2T A;  2R8H A;  4O4I B;  1VQM V;  9ICV A;  4UAT A;  1RM1 C;  2JGD A;  2JGD B;  3W7T A;  1ZQB A;  1XDC A;  2WA3 A;  1HR0 O;  4YMM A;  4CRX A;  2MU2 A;  4IRD A;  4DR3 O;  2ZIX B;  5IIJ A;  4M9H A;  3E2E A;  3U26 A;  1ZQF A;  3ZMT A;  4DV1 O;  3UCS C;  2DYS B;  4OCZ A;  3F53 A;  4DO9 A;  3U11 A;  2ZTE A;  2HJF C;  2Q7G A;  4ZOL A;  2HMX A;  2J6S A;  1YF2 A;  4O5K A;  2KG7 B;  2XTA A;  8ICB A;  3S3X A;  2I9G A;  4EEN A;  4EKW A;  2O6K A;  1VQ6 V;  4X5V A;  1K8A W;  2HEP A;  7ICJ A;  1HP8 A;  2B6G A;  4KLG A;  3FX7 A;  4UAW A;  2A0L A;  7ICE A;  1Z00 A;  4RPZ A;  4DRX A;  3TFR A;  3M6K A;  5J0X A;  2E5L O;  1MA1 A;  3FAV A;  1OCC B;  1EZV H;  3FDS A;  5IIK A;  4MT8 A;  1UT5 A;  4E4E A;  5AKL A;  3PW0 A;  4DV6 O;  1X6I A;  7ICS A;  4PPX A;  3QU7 A;  4QE7 A;  3BEH A;  5J2I A;  5AKI A;  4BUG A;  4K4I A;  2RNB A;  5JQG B;  4X62 O;  5KFR A;  2VA2 A;  5KFQ A;  4C8M A;  1DK3 A;  2EIN C;  2Q0Z X;  2ZIV A;  2ZIV B;  2KZ3 A;  4TSF G;  4YJ2 B;  2ZR2 A;  4DL6 A;  5ALS A;  3H1L H;  4RQM A;  5AM5 A;  4FMT A;  1XNQ O;  3BVO A;  4LFA O;  5ALF A;  9ICL A;  8ICP A;  4DR1 O;  8ICZ A;  1IX9 A;  4O2B A;  3RT3 C;  4UCT A;  1EN5 A;  3OGC C;  4JI2 O;  4GXK A;  3JPR A;  3H4D A;  1FXK A;  2YIB D;  2BTO A;  5EWE A;  4QE9 A;  4WFE A;  3HX0 A;  4PGY A;  2HHT A;  2LI6 A;  3PX4 A;  2EZP A;  4P2Z A;  1P7B A;  2E8P A;  1Z5W A;  3PJS K;  1XO1 A;  4KMO B;  3Q8K A;  4O5C A;  4F5N A;  3JAR A;  3MAB A;  4DQP A;  1RDF A;  2ODM A;  2ZXW B;  1THZ A;  4I2C A;  4F5R A;  4RQ1 A;  1H2G A;  1BPD A;  5EZY B;  1PVQ A;  5F9N A;  2MW2 B;  3WB2 A;  3ZMU A;  4JI4 O;  3H40 A;  4J9Z B;  1K33 A;  1O08 A;  2W03 A;  4M9L A;  4O2A A;  2E76 B;  3K59 A;  1K9M W;  4M9J A;  2JEU A;  1ZQI A;  1SKR A;  3I55 V;  5LP6 C;  5D46 A;  5LA6 B;  3PML A;  1MQ2 A;  3NXS A;  1SRY A;  2JEJ A;  3KZI U;  3CYM A;  1JFF B;  3STL C;  2IJK A;  1TUE B;  3P30 A;  4LJX A;  5KFZ A;  5KFV A;  1MMM A;  3KTQ A;  5FNV B;  1FFT B;  3HKC A;  4KLS A;  1S0M A;  3EWA A;  2XY6 A;  5GON B;  4TQF A;  1N36 O;  7ICV A;  1X4T A;  1IG6 A;  4HYO A;  1XMQ O;  4OPH A;  4D7T A;  2P06 A;  5DQH A;  1N60 A;  3KFU F;  4O4L A;  4B9S A;  4JZ2 A;  1FD9 A;  2NO5 A;  5AM2 A;  3E0F A;  4X1K A;  4X1K B;  1SQB H;  1SZP A;  3ZIA G;  5KLV H;  4UB6 U;  5IE9 A;  3BQ7 A;  4MVU A;  2B21 A;  3N27 A;  4DFP A;  2UXC O;  1NK0 A;  2VWK A;  1AJN A;  1GN6 A;  2LFR A;  3JAL B;  3RJH A;  4Y2X A;  3THO A;  3PMN A;  3SPG A;  1YJW V;  2DUY A;  2EBO A;  1R6K A;  2KJ8 A;  4EFB A;  3N7S C;  4LF9 B;  1JPX A;  5L1J A;  4U7N A;  2E75 B;  4J9Q A;  4RQ4 A;  2FPK A;  4JZG A;  1F44 A;  3TKA A;  1JR9 A;  4B08 A;  4IR9 A;  2ITD C;  1WWV A;  5BMV B;  3K9A A;  4CBC A;  5C93 A;  1KB9 F;  3B40 A;  4NTY A;  4DWI A;  4I50 A;  4I50 B;  3L75 H;  1G6U A;  5EWF A;  1JXE A;  2ADP A;  2Q7H A;  3F5T A;  2F1J A;  1SF9 A;  4FFK A;  4WFF A;  4BWA A;  4K8X A;  5KFH A;  2DL0 A;  3RAX A;  1TFR A;  5AK3 A;  1OCR B;  1S0V A;  4Y2S A;  3UXP A;  1Y66 A;  1YXB A;  5LMU B;  2DKZ A;  3CRR A;  1D9D A;  1LV5 A;  4Z6F A;  3RYC A;  2DQN B;  1KTQ A;  3UXO A;  1COW G;  1TUB A;  1TUB B;  4JI5 B;  2KJ5 A;  3T79 A;  4DUZ O;  3UO3 A;  2B1I A;  4J42 A;  4UB8 U;  3I28 A;  2DYS C;  4TV8 B;  1Y6X A;  3EUB 2;  3OTO B;  2WLJ A;  4DV3 O;  4LH6 A;  3SGI A;  2XI9 A;  4JYB A;  2FMP A;  4JWN A;  4GFJ A;  1KLN A;  4A8E A;  2JH7 A;  2DYR B;  2P90 A;  3ABU A;  3ABM B;  2CE4 A;  2LYA A;  4B7E A;  3BS7 A;  9ICO A;  3MGI A;  3OMI B;  2Y1J A;  3LYS A;  2HHS A;  5JH7 A;  4FBT A;  3AK3 A;  2ZIU A;  1EN6 A;  2YQE A;  1YTF D;  2NRZ A;  1N62 A;  5KG1 A;  3HWT A;  1HR0 B;  2QDO A;  4DR3 B;  1OCC C;  2CK3 G;  4E0D A;  1SQF A;  4DV1 B;  2KB1 A;  4LFC O;  2D3D A;  2HOI A;  7ICL A;  5HHH A;  3GV8 B;  4QZA A;  4DW0 A;  1H2K A;  1WNS A;  1YIT V;  4K0K O;  1FFU A;  1EFR G;  4F4Z A;  1BPE A;  5KFC A;  2KJ9 A;  4UBC A;  2WLL B;  2IJI A;  5B3S C;  4D7S A;  1XRE A;  2A3Q A;  3OE7 G;  2FJ6 A;  3FYE B;  5IYD O;  1QR8 A;  4P30 A;  3F5A A;  2IU3 A;  4JI6 O;  3K1R B;  4I2E A;  3JD3 A;  2E5L B;  2G06 A;  4LBE C;  1JMS A;  2KD1 A;  3RBE A;  3K5O A;  5IY5 C;  4P0Q B;  4M04 A;  1K4C C;  2XUM A;  8ICS A;  2ZM6 B;  2W55 A;  4I9Q A;  4LF7 O;  4IL6 Z;  3NVZ A;  4FZ1 A;  2HVH A;  3G6B A;  2WFA A;  4U6P A;  2Z7J A;  3OT7 A;  1Y76 A;  4PHA A;  9ICR A;  3EXA A;  1Q3U A;  9ICQ A;  4X62 B;  5HNK A;  5IDJ A;  1HNW O;  1X66 A;  5H9C A;  2WF6 A;  4I5S A;  5ALN A;  4YJ3 A;  3TXQ A;  3M99 B;  5KAI U;  1S5L Z;  1Q7Y W;  2ZXW C;  4BGD A;  3SDL A;  4YG2 A;  1T3Q A;  5H6Q A;  5EBW C;  2KVC A;  1MZE A;  1VMG A;  3A0B U;  4LFA B;  1XNQ B;  1OJH A;  1BS3 A;  3QO7 A;  1FFV A;  4DR1 B;  2AQ0 A;  1UA1 A;  5BY1 A;  4OJO A;  3MFI A;  4F92 B;  4JI2 B;  5CA1 A;  5CA1 B;  4GKJ O;  1AR1 B;  8ICY A;  4IQT A;  4CS2 A;  3CJH B;  3TAD C;  1ZD2 P;  1YJN V;  5ALX A;  3DC5 A;  1ROP A;  4PH5 A;  1IZ3 A;  3FB6 C;  3E35 A;  5B66 U;  1HUZ A;  2EQY A;  3O9O A;  4X88 A;  3ZRW A;  3UQ8 A;  1SV4 A;  2XCA A;  2Q5Z A;  2BDP A;  2YEV B;  2F4V O;  3A2F A;  3OGI B;  4O3S A;  2KQX A;  2H5X A;  4JI4 B;  1XMO B;  2HW3 A;  4C7Z A;  3ZDB A;  2OH2 A;  3IC9 A;  2AGP A;  3SPJ A;  5CA3 A;  1NK8 A;  2M9N A;  2W7O A;  3H1K H;  2ZIW A;  3W7X A;  1PNL A;  1Z5V A;  5AIA A;  4RUF A;  3QE9 Y;  4OPA A;  9ICG A;  1NR1 A;  3QO5 A;  2YMP A;  1N8R W;  3ZS8 C;  4YD1 A;  5DEC A;  5JCO A;  4PD4 F;  5DDM A;  4XDL A;  5ALR A;  4F6R A;  4F6R B;  2QSA A;  3W7S A;  5ALV A;  1NT2 B;  3OUF A;  1N36 B;  1DTO A;  1N48 A;  3D36 A;  5KMG B;  1XMQ B;  1PK1 A;  1PK1 B;  8ICK A;  2PGG A;  2PUS A;  4DV5 O;  4E2L A;  3WK5 A;  5AIB A;  4Q45 A;  9ICC A;  2VS0 A;  1NK4 A;  4USA A;  5EE9 A;  3OFN G;  4DL4 A;  1Y88 A;  1MA7 A;  4I2I A;  2Y1I A;  4KLU A;  3ABK B;  2Q9L A;  1MG1 A;  3AUO A;  2JEI A;  3WKB A;  2PYL A;  3MAQ A;  3VQY A;  2UXC B;  3RJI A;  1L8D A;  5AKJ A;  2ZTD A;  5IYB O;  4DV7 O;  1U48 A;  3FM9 A;  1OCR C;  2YDE A;  1XBL A;  4PJ0 Z;  1TE2 A;  2D3O W;  1IV8 A;  3RTV A;  4Z6E A;  3BS5 A;  3BS5 B;  1L7N A;  4J11 A;  4D6T H;  4FPP A;  4DYL A;  5BOM A;  1URF A;  2Y0S C;  1TAU A;  3GII A;  4X1I B;  3B9J A;  3ISC A;  4K8Z A;  3B0X A;  2W3S A;  3IHQ B;  1BPX A;  5CP2 A;  5JJE B;  5J0S A;  3V72 A;  3RJE A;  1FJG O;  3F5W C;  5GTH Z;  2G07 A;  1U45 A;  4M9G A;  4DR4 O;  4CF5 A;  3K06 A;  4B3S O;  1SQQ H;  3H1I H;  2J6U A;  3SPH A;  2F43 G;  2MUT B;  1KC8 W;  2DYR C;  2DQ3 A;  2B9Z A;  2YY6 A;  3GV5 B;  3ABM C;  1B4F A;  3SPI A;  4KP4 A;  4ED8 A;  3TCU A;  1R6T A;  1B3Q A;  4LP8 A;  4WFG A;  5AI0 A;  5KFF A;  5KNI A;  4GZR B;  2K4I A;  5EE0 A;  3RFA A;  7ICQ A;  5H5N A;  4MHV A;  1SXE A;  4ELT A;  1KN5 A;  4I9W A;  4MVZ A;  2E5S A;  4DUZ B;  5J2H A;  4LNU B;  1P7G A;  1M57 C;  3HKZ C;  4UCR A;  5LMN O;  1J5E O;  1VQ8 V;  4EEL A;  1WYG A;  4DV3 B;  5EIB C;  2ZCE A;  2H3O A;  3H1J H;  4FLV A;  3B09 A;  4YHH O;  3L73 H;  3GIM A;  4WBN A;  1ZQJ A;  4KTQ A;  2YB1 A;  2W0F C;  5J2T A;  3J81 N;  5LHI A;  1DK2 A;  4DSF A;  3PW2 A;  2YI9 A;  1IBM O;  3WK4 A;  2P5O A;  3NRW A;  3MHS C;  5IYC O;  1BGY H;  8ICU A;  4TUY A;  4YMO A;  3HR0 A;  4PV1 B;  4YIO A;  3N2K B;  3N7P D;  5C0Y A;  3E22 A;  1V54 C;  4RO2 A;  1WWU A;  2XOK G;  4LFB B;  5ALO A;  5KG5 A;  4NY8 A;  3M7M X;  2ESE A;  2KKV A;  1V97 A;  4LFC B;  2HHU A;  4ZI7 B;  4K0K B;  2UUA O;  2EZZ A;  4R8C A;  2LM1 A;  3B0Y A;  2L6L A;  1N63 A;  2BCU A;  4Y2R A;  1Q8I A;  4TUR A;  2HHW A;  3QO8 A;  3SJA C;  2H3I A;  2AHZ A;  3NGD A;  3T2M A;  4JI6 B;  3H4B A;  5L1K A;  1Q6H A;  5FL7 G;  4FZM A;  5BZB A;  1E79 G;  3C90 A;  5EWG A;  5B1A B;  4MVM A;  4O3R A;  1SS3 A;  1XWL A;  3OM3 B;  1K5S A;  4DV0 O;  4UAR A;  1LVH A;  4DR6 O;  5KAF U;  3MR2 A;  4RQ3 A;  2OEH A;  4JV2 A;  3VQW A;  4MTF A;  1WJZ A;  4J9S A;  1PV0 A;  5C8Y A;  5C8Y B;  1P7D A;  3E89 A;  2W54 A;  1W2B U;  2NRT A;  3RVY A;  5J0Q A;  3BPZ A;  1B22 A;  1Z1V A;  2LP7 A;  5DLF A;  4TUQ A;  3JAW B;  3V7L A;  2G5H B;  2XAJ A;  2XC9 A;  2HDO A;  3VQX A;  8ICJ A;  1R1B A;  3CWB H;  2DWE C;  4BAY A;  4M6W A;  4M6W B;  2Q73 A;  3UXN A;  4B9L A;  4PGQ A;  3Q8M A;  2K9P A;  5TIS Z;  1S97 A;  4XA5 A;  4CGZ A;  3QNE A;  3PR5 B;  2RRD A;  3RB0 A;  2WB1 F;  2NR5 A;  2BCQ A;  3AEI A;  3RN4 A;  3KKA C;  1V55 B;  3GWK C;  4GKJ B;  2CH7 A; 
#chains in the Genus database with same CATH homology
 1W0J G;  5LBQ A;  3VOU A;  3W7U A;  1BMF G;  1MAB G;  4RQF A;  1YSC A;  1OCO B;  1GO3 F;  1K34 A;  2WLI A;  4JAV A;  3RBZ A;  5L3F A;  1VQ4 V;  3ZCC A;  1JCH A;  2EJR A;  1LNQ A;  1PNK A;  4BIZ A;  3GB7 C;  4G27 B;  3G71 V;  1VQM V;  4G28 B;  1KP3 A;  1RM1 C;  2OTJ V;  1A6S A;  1CPY A;  3W7T A;  3DEE A;  1NVP B;  1ED1 A;  4KFM A;  1WLE A;  4L87 A;  3CCR V;  4CRX A;  1S77 D;  4KX3 A;  2ZIX B;  4CDG A;  1OUQ A;  1GKF A;  3ZMT A;  3E2E A;  3PST A;  5HR6 A;  2DYS B;  3F53 A;  2KHV A;  2RHF A;  2HJF C;  1DLB A;  5LHH A;  3AQE A;  2HMX A;  3H0R B;  4QIW F;  2MRL A;  1CRX A;  3E8B A;  2F2A B;  3F5E A;  3IG8 A;  1GM9 A;  4Z1M G;  2JIZ G;  3X2Q B;  1PD3 A;  3WG7 C;  4EKW A;  1VQ6 V;  1QCE A;  2BOC C;  3AG2 C;  1K8A W;  4JYC A;  3VBB A;  4GX1 A;  5B1N A;  2A0L A;  3ZRX A;  3CCS V;  2VJ5 A;  1AJP A;  3LNM B;  5KA5 A;  3CCJ V;  3M6K A;  4MW3 A;  2P67 A;  1OCC B;  1XL4 A;  1KQS U;  3K0D A;  4UV8 A;  2VIX A;  1ENV A;  4MT8 A;  2N1R A;  4WJ3 B;  1AJQ A;  3FB8 C;  3CP1 A;  2K89 A;  1VQN V;  4GX5 A;  2JJ2 G;  4QE7 A;  3BEH A;  5EBM C;  4ZBM A;  5EBL C;  5CBH A;  4BUG A;  2BDU A;  1GTO A;  2WSS G;  3ICX A;  1M56 B;  2KKP A;  2Y69 B;  2EIN C;  2EIK B;  3SYO A;  2ZIV A;  2ZIV B;  4XDJ A;  4TSF G;  3ASO B;  2MK3 A;  4NV0 A;  1M57 B;  2ZR2 A;  3ABL C;  4FMT A;  3H01 A;  2CRX A;  3DTU B;  3ZRS A;  2WWW A;  1J95 A;  3ASN B;  4BIU A;  4JPR A;  1SZH A;  2WLL A;  4RQE A;  1MSW D;  3E8F A;  3SAH A;  3ONN A;  2B5U A;  3OGC C;  2DF4 B;  4JMU A;  3DGE A;  3CC2 V;  1EBO A;  1FXK A;  4QE9 A;  2LFS A;  4WFE A;  1YJ9 V;  3NUQ A;  2IH3 C;  2EZP A;  2HFE C;  3SPC A;  3ZRV A;  4CZZ A;  4H37 A;  4P2Z A;  2OTL V;  1P7B A;  4H33 A;  5B1O A;  3L3F X;  3PJS K;  1V54 B;  4KMO B;  2HLD G;  3FB7 C;  1VQO V;  4C0Z A;  4MTO A;  1FXH A;  4P0Q A;  2QM7 A;  3C29 A;  3ETD A;  4ZKI A;  2VJ4 A;  2ZXW B;  1H8E G;  1THZ A;  1NZB A;  1FS0 G;  2OYY A;  3T4D A;  1H2G A;  5L3G A;  3LDD A;  2B1G A;  1PVQ A;  1M9N A;  4OXS A;  3ZMU A;  4J9Z B;  1K33 A;  4MSW C;  2W03 A;  4PDM A;  1K9M W;  1KD1 W;  3VC8 A;  2OCC C;  4OJ6 A;  1R6N A;  2M7W A;  4FJC C;  2JEU A;  4WFA V;  1OHH G;  5B1B C;  3I55 V;  3LSQ A;  1F4N A;  1DF5 A;  2XAF A;  3NXS A;  3SJQ C;  2V1D A;  1SRY A;  4JTC B;  4X89 A;  2IU0 A;  2EIJ C;  3CYM A;  5CRX A;  3STL C;  2IJK A;  1I5Y A;  1QVG U;  1TUE B;  3JD4 A;  3P30 A;  4JAS A;  2W04 A;  2K8B B;  1FFT B;  1K4D C;  4MTG A;  1D8B A;  3G6E V;  4R50 A;  2ZDI A;  1R3I C;  4HYO A;  2F76 X;  2ITC C;  2EIM C;  2X6A A;  2DGZ A;  4FE3 A;  3KFU F;  4UV9 A;  3TET A;  3RW0 A;  1NR7 A;  3CD6 V;  2G5I B;  5LGN A;  2HBM A;  2PI4 A;  3CP8 A;  3E0F A;  2FTK A;  3OMN B;  4QNH B;  3ZIA G;  3HB3 B;  4UXN A;  1VQ5 V;  2H3Q A;  3B8N A;  4MVU A;  2YEV A;  4LCU C;  3CCU V;  2DWD C;  1AJN A;  2LFR A;  1AI4 A;  4JTD B;  1PVR A;  4KX5 A;  4BX9 C;  3A0R A;  3SPG A;  1YJW V;  2G09 A;  1R6K A;  2EBO A;  2P7T C;  2KJ8 A;  3ML0 A;  3MHH C;  2YX8 A;  3N7S C;  3LVW A;  5CBG A;  4IC9 A;  2K1E A;  4UVC A;  4WF9 V;  4U7O A;  1JPX A;  5KL8 B;  1F4M A;  4U7N A;  3ZMZ A;  2WLI B;  3I56 V;  1R73 A;  3OPX A;  1XL6 A;  1S5H C;  3PSP A;  1YIJ V;  2XAH A;  1F44 A;  3CRX A;  3AG4 C;  2ITD C;  1BHA A;  3ABT A;  3K9A A;  4CBC A;  2IJH A;  5C93 A;  1V55 C;  5CBF A;  5E1A C;  3CCV V;  2GSM B;  1SET A;  5T14 A;  2EIL B;  1K5Q A;  4WFF A;  2KHQ A;  2XID A;  1PL0 A;  3IN5 A;  1JX9 A;  1OCR B;  3IC7 A;  3ABK C;  4QIW C;  1S0V A;  1Y66 A;  2K4H A;  3STZ C;  4QPK A;  3CCE V;  3CC7 V;  3ZN0 A;  3OMA B;  2WAQ F;  3CME V;  2Y48 A;  2DQN B;  1G4Y B;  1COW G;  3K79 A;  2NV3 A;  2QA4 V;  2KJ5 A;  3ETG A;  4P0P A;  1PKX A;  3T79 A;  5CMU A;  3G4S V;  1VQK V;  2B1I A;  3WG7 B;  2XND G;  5L3E A;  2X0L A;  2DYS C;  3RVZ A;  2HBJ A;  2X6B A;  3CYO A;  2WLJ A;  3IFX A;  3F7Y C;  3MD0 A;  4FZL A;  1S3J A;  2XI9 A;  4HAM A;  4JYB A;  1KEC A;  4GFJ A;  3FB5 C;  4OJL A;  4A8E A;  2JH7 A;  3SYQ A;  3SPI A;  3X2Q C;  2A79 B;  2DYR B;  2P90 A;  3ABU A;  2KOB A;  2PI5 A;  3ABM B;  3CCL V;  3WFV A;  2LYA A;  1BHB A;  1AI5 A;  4NLC A;  1IIP A;  3LYS A;  3K08 A;  1OCZ B;  1ORQ C;  2QE7 G;  3OMI B;  2ZIU A;  1BL8 A;  3SMV A;  5DN6 G;  1YTF D;  3M7D A;  4MTX A;  2OM6 A;  1GM7 A;  4PA6 A;  1URJ A;  1I5X A;  1OCC C;  2CK3 G;  4UUJ C;  3IG5 A;  2KB1 A;  1SER A;  3T4Z A;  2HOI A;  2WAM A;  1YIT V;  1EFR G;  3UKM A;  5HR7 A;  1L1F A;  2KJ9 A;  3AG1 B;  4TT3 G;  2WLL B;  2IJI A;  1H8H G;  5B3S C;  5A0L A;  3OEH G;  3B8M A;  2R9R B;  1RPR A;  1HEK A;  2Y69 C;  3OE7 G;  1FXK B;  2EIK C;  3FYE B;  5IYD O;  1K3E A;  4PA9 A;  1QR8 A;  4P30 A;  1HWY A;  3F5A A;  2IU3 A;  3ASO C;  5DM6 V;  1M1K W;  1AI7 A;  1QLE C;  2H94 A;  2Z3Y A;  3D3I A;  3EFF K;  3JD3 A;  2NLJ C;  2G06 A;  2DW4 A;  5H6R A;  4LBE C;  5KUM A;  2KD1 A;  1R3J C;  1A0P A;  4AYB F;  5IY5 C;  4P0Q B;  1K4C C;  1YT3 A;  1JJ2 U;  2M0N A;  1Z1B A;  1Z19 A;  3PSI A;  2VKQ A;  1R3K C;  3M6Z A;  2ZXH A;  3R65 A;  4U6P A;  2Z7J A;  1SES A;  3ZMS A;  4BW5 A;  2HVK C;  1Q3U A;  2JJ1 G;  2HKO A;  1JQ0 A;  2V7Q G;  3F2B A;  5IDJ A;  2R18 A;  2ZG6 A;  2K8A A;  4QNL A;  5H9C A;  2XAQ A;  4I5S A;  4FZN A;  1GMG A;  3M99 B;  1HIW A;  2G08 A;  2OCC B;  3JD2 A;  3OEE G;  1Q7Y W;  1L6N A;  2ZXW C;  5H6Q A;  3H0M B;  3O0F A;  4WFH A;  5EBW C;  2KVC A;  3QO7 A;  4R7C A;  2EIJ B;  2EZO A;  4NWI A;  1CEZ A;  2K4E A;  3LVV A;  2KNJ A;  4OJO A;  3GZF A;  2D6F C;  2OT5 A;  2Q6A A;  2HG5 C;  1YTF B;  2C2A A;  5B1A C;  1AR1 B;  2H8P C;  4RAI A;  2Q68 A;  1W0K G;  2Q67 A;  4BJQ A;  3OR6 C;  1WUD A;  1NH2 D;  2HR3 A;  3JD0 A;  3CCQ V;  1YJN V;  3LSS A;  1ROP A;  2EIM B;  3FB6 C;  3E35 A;  4X88 A;  2JGA A;  2LKY A;  4FIP C;  3ZRW A;  2XIC A;  5KL1 B;  3K3W A;  3OAA G;  2YEV B;  3GWO A;  3OW2 U;  2AHY A;  5L3D A;  2G0A A;  2PMZ F;  2YSU B;  1H38 A;  4PL1 A;  1XO0 A;  2RP5 A;  2R9I A;  2H3V A;  2ZR3 A;  4DXW A;  3CC4 V;  2W6I G;  2QEX V;  2LBO A;  2OH2 A;  2P6J A;  5L3B A;  1F51 A;  2H3F A;  2JH1 A;  5EC1 C;  3IGA C;  3SPJ A;  1K92 A;  5CA3 A;  3AG3 B;  3SQI A;  2W7O A;  2ZIW A;  1UJW B;  2HBK A;  1PNL A;  3N7R C;  4RUF A;  1JVM A;  3W7X A;  3LUT B;  4PEL A;  1NR1 A;  3QO5 A;  1N8R W;  3IP4 B;  1QR9 A;  4OJP A;  5J9P C;  2IH1 C;  3E8G A;  4PA7 A;  4XDL A;  4TWK A;  1ARO P;  4F4L A;  4ASU G;  1RPO A;  3AG4 B;  4KUM A;  3W7S A;  1RM1 B;  2XAS A;  1DF4 A;  5KA6 A;  3OUF A;  4G2K A;  1OCO C;  1DTO A;  3D36 A;  3ZJZ A;  2A9H A;  3ZMV A;  4X8A A;  4JF3 A;  4PDV A;  4GX2 A;  3CXC U;  2F77 X;  1K97 A;  2GH1 A;  4E2L A;  2IW5 A;  2WAQ C;  2YB4 A;  3OFN G;  2Q69 A;  2HOF A;  1PNM A;  1MA7 A;  3ABK B;  3K04 A;  1NKD A;  3OR7 C;  3CMA V;  1VQ9 V;  1MG1 A;  4XDK A;  5EC2 C;  4WFB V;  3BY6 A;  2ATK C;  4P0P B;  2EIL C;  2HVJ C;  3B77 A;  3SYP A;  1CP9 A;  3JYC A;  5IYB O;  2IJJ A;  3AG2 B;  4WCE V;  1K73 W;  1OCR C;  1R3L C;  4MVO A;  2ZIX A;  2D3O W;  4LC1 A;  3FKS G;  4MS2 A;  4FPP A;  2Y0S C;  1Q86 W;  1NH2 B;  1B6Q A;  2Y0S F;  3ETE A;  4N21 A;  4OJ5 A;  2KIC A;  4NLB A;  3K0G A;  2KIW A;  4JGS A;  2ZIU B;  3W7W A;  3KG2 A;  1M90 W;  3H0L B;  3F5W C;  2G07 A;  3K06 A;  2LHT A;  3ALR A;  3AQF A;  3SPH A;  2F43 G;  4RUE A;  4GCZ A;  1KC8 W;  5KUK A;  3PZP A;  2DYR C;  2DQ3 A;  4N23 A;  3ABM C;  2KV2 A;  2EIN B;  3SAG A;  2X7R B;  1G8M A;  4ACO A;  3FYI B;  2OXO A;  3LDC A;  2WLN A;  4KP4 A;  4LP8 A;  1OCZ C;  3TCU A;  4WFG A;  3SYA A;  1VQ7 V;  3SYC A;  3ABL B;  1KKD A;  3RF9 A;  5HFM A;  5LGU A;  4PA4 A;  1QLN A;  2W7P A;  1Y4M A;  2K4I A;  1YI2 V;  3RFA A;  1UPH A;  4Q20 A;  1M56 C;  4I9W A;  4MVZ A;  2E5S A;  2QTO A;  5HFL A;  4MVS A;  2GHY A;  3MGV A;  5LGT A;  5GW7 A;  5B3S B;  1M57 C;  3UM7 A;  2CN1 A;  3HKZ C;  3CCM V;  2KEY A;  2E1E A;  3HKZ F;  1AI6 A;  4QJF B;  1EZJ A;  1QBZ A;  1SZT A;  2BOB C;  2Z5U A;  4JAU A;  1VQ8 V;  2QM8 A;  4YXW G;  4AYB C;  3AG1 C;  1IXM A;  1GM8 A;  1QLE B;  2ZXI A;  1ZWI C;  3ASN C;  4P9O A;  1VQL V;  3P32 A;  3JCZ A;  3JD1 A;  4ICA A;  4O3M A;  3TK1 A;  2HOQ A;  2YB1 A;  3C28 A;  1FXV A;  1T94 A;  2W0F C;  5LHI A;  4U7C A;  4MW8 A;  2H3Z A;  1NQT A;  3EHB B;  5IY5 B;  1FXK C;  3SAF A;  2HBL A;  3NRW A;  2WPD G;  1TAM A;  2WLM A;  3MHS C;  4PDL A;  5IYC O;  3E8H A;  4J9Y B;  2X6C A;  1Q82 W;  4GT1 A;  3K03 A;  2GOL A;  3N7P D;  5C0Y A;  2WLH A;  1ZQ1 C;  1V54 C;  4RO2 A;  5L3C A;  3CPW U;  1NBM G;  4PDR A;  3AL0 B;  1E1R G;  2XAG A;  2XOK G;  1VQP V;  2KKV A;  5B1B B;  4QPJ A;  3K1Z A;  4P9P A;  3VCB A;  2JK5 C;  4R8C A;  2JDI G;  1JOY A;  1NVP D;  2ZQM A;  2CPR A;  1S76 D;  2ZD9 A;  3QO8 A;  1OZ0 A;  1Q81 W;  4XBF A;  2JMG A;  3KZX A;  2H3I A;  3F2C A;  2AHZ A;  1MOF A;  1KBU A;  3T2M A;  2NNU A;  2UXN A;  3E86 A;  3D2Q A;  2A3V A;  5FL7 G;  3D2N A;  4FZM A;  1GK9 A;  1NJI W;  5BZB A;  1E79 G;  4GX0 A;  5B1A B;  1QVF U;  4MVM A;  1F23 A;  3PSF A;  2K8C B;  3OM3 B;  1K5S A;  3ZRW B;  3D2S A;  2E1F A;  2QKS A;  4HZ3 A;  2LYB A;  2PMZ C;  2WLK A;  4R6Z A;  2JEX A;  3F2D A;  2UXX A;  1PVP A;  4MTF A;  3F7V C;  1S72 V;  2ZDI C;  3ZN1 A;  1P7D A;  3E89 A;  1W2B U;  1WPX A;  3RVY A;  4DO2 A;  3GU3 A;  1ECW A;  4MVQ A;  3OUS A;  2DQ0 A;  2XVT A;  2LP7 A;  4FK5 C;  1YHQ V;  2W6J G;  1K7D A;  2G5H B;  2XAJ A;  2F8L A;  4PL2 A;  2MA1 A;  3T1C A;  2ZIW B;  1E1Q G;  2DWE C;  1XNS A;  4BAY A;  4MVR A;  1P4R A;  4UVB A;  5CN0 A;  1V55 B;  5EK0 A;  4UVA A;  2Q4T A;  3E83 A;  3LDE A;  4CGZ A;  4OO1 J;  3QNE A;  2WB1 C;  1KP2 A;  2JHD A;  2RRD A;  5LHG A;  2WB1 F;  3AEI A;  3HPL C;  4PA3 A;  1DRG A;  4JTA B;  1Q3V A;  3AG3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...