4QJIA

Crystal structure of the c-terminal ctp-binding domain of a phosphopantothenoylcysteine decarboxylase/phosphopantothenate-cysteine ligase with bound ctp from mycobacterium smegmatis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
229
structure length
212
Chain Sequence
HHDMAGVKALVTAGGTREPLDPVRFIGNRSSGKQGYAVARVLAQRGADVTLIAGNTAGLIDPAGVEMVHIGSATQLRDAVSKHAPDANVLVMAAAVADFRPAHVAAAKIKEPSSIDLVRNDDVLAGAVRARADGQLPNMRAIVGFAAETGDANGDVLFHARAKLERKGCDLLVVNDGWLLSADGTESALEHGSKTLMATRIVDSIAAFLKSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantothenate--cysteine ligase
publication title Crystal Structure of the C-terminal CTP-binding domain of a Phosphopantothenoylcysteine decarboxylase/phosphopantothenate-cysteine ligase with bound CTP from Mycobacterium smegmatis
rcsb
source organism Mycobacterium smegmatis
molecule tags Ligase
total genus 62
structure length 212
sequence length 229
chains with identical sequence B
ec nomenclature ec 6.3.2.5: Phosphopantothenate--cysteine ligase (CTP).
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04127 DFP DNA / pantothenate metabolism flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CoaB-like 4qjiA00
1P9OA 1U7ZA 4QJIA 5INTA 2GK4A 1U80A 1U7WA 1U7UA
chains in the Genus database with same CATH superfamily
2PX6A 3GZ4A 3O3NB 3SDZA 3WBFA 3QE9Y 2X1LA 3L7NA 3OTGA 1JR3D 4IJ5A 4OP3A 4BQEA 4I55B 1E77A 1JALA 4ZC1A 5BSVA 1E4YA 3NONA 4E31A 2VNJA 5HOQA 2X3UA 3I45A 3COZA 1P5FA 3M83A 4DV5B 1E4VA 4EX7A 1ZBQA 1HA3A 2J67A 2R62A 1J97A 1OYVA 2SCUB 1KSFX 1Y6JA 3X1YA 5BMVF 5C7OO 4B79A 2ZUFA 2H5JA 1NVTA 1DUVG 3H4VA 3PE4A 4FFNA 3AP2A 2XCRB 5ERGB 4RDHA 2Y1CA 2JA1A 3ENQA 4J1TA 4UU0A 3PFBA 1BMFA 3OF3A 3KAJA 1ZJ4A 4WK0B 5EIHA 3I8OA 1J07A 3ZVNA 1GARA 4QEDA 1WXIA 3OFKA 1ZJWA 2VAVA 2EYQA 1CRZA 1E18A 1HG0A 1VJ0A 1XN1A 2I3ZA 3IC5A 4LHZA 3T0GA 5TIIA 4IFBA 1Z4OA 1QV6A 4NATA 2H65A 3WGLA 3EH1A 4URHA 1AHNA 1SB8A 3BGVA 3Q6MA 3HZOA 2BOVA 2YZNA 3A1UA 2LV8A 4M21A 4EQ6A 3QEMB 1MX5A 1PNTA 1T6YA 3R6TA 1ZI8A 3BMCA 4RZHA 1JFSA 2ZT8A 3LUAA 1CQWA 4JOBA 1J0AA 1J00A 1ZGGA 1DSSG 3COVA 1FUUA 1L4GA 4U7DA 1P1HA 3NI2A 4I0WB 3IESA 4BQIA 1LCIA 2QSYA 2GTHA 1VMIA 5ITZA 1AKQA 1M8KA 2K7FA 3CH7A 3DFKA 3BB4A 3PI6A 2QLJA 1GPLA 4X44A 4E5MA 2GHQA 2GHIA 3TCNA 1HH4A 4RE6A 4P80A 1P9NA 3I5YA 2O20A 4IG4A 4JI5B 4CIVA 2CV2A 3BHJA 4MI6A 1L1RA 2XRMA 4QNMA 4HNRA 4FJ0A 4KQ9A 4RSMA 1QGOA 3O4IA 4M86A 3RAJA 4CEHB 4X1YA 4BNDA 3M4ZA 4XYMA 4MW5A 1N9GA 2J85A 2ZM6B 3AR4A 4ER5A 1MORA 4K9OA 4DR5B 1U28C 1U1GA 3G2MA 4O59O 4DXAA 2Y9MB 5FEMA 1QCYA 1SXGA 1U8CB 5JI3E 4C2TA 2ZIAA 1T9AA 1EM8A 3D7MA 3EA5A 3G0CA 3U4IA 5ALFA 5IKOA 4DCUA 2A6PA 4HAVA 4WXPA 2O5EA 5DT9A 5FI3A 1D1TA 1FUKA 2V3VA 1LSSA 3M5CA 1JQJC 4HB2A 3SX0A 1U0TA 4MQFB 3RRXA 2FZLA 5EXDA 4E21A 3NHWA 3OZGA 3EGIA 2PUGA 1ZICA 3GLHB 4I1IA 5BSTA 2PUDA 1NOIA 3A1FA 3DE0X 1YJAA 3DV0A 4ALIA 5E0OA 2GBPA 3O38A 3UV6A 3U5TA 4IDBA 3WG9A 4E5UA 4ZCLA 5K0SA 5DNVA 1ZJYA 3I39X 5AKKA 4ZIRA 3AKZA 1HT2E 2V7QA 3E70C 2JS7A 4MS4A 1RVV1 4MUNA 4MVJH 2P27A 4ONEA 1T9BA 5KWIA 2YYZA 4BXOB 3DL7A 2P9YA 1S02A 2CHEA 3I2IA 3QV2A 1BAPA 5K0FA 4JBNA 4LV8B 5ENZA 2PLNA 3SCZA 5LD2B 4YR9A 2UYQA 5H9VA 4RIFA 1DL5A 1H0SA 4XEUA 2OM6A 1ID1A 1V9SA 4KRXA 3J80A 3OEED 3H3FA 5K3SA 2P1RA 3A25A 5HKOA 3AUUA 5DGHA 3T7IA 1H2ZA 4AMZA 5IJWA 3OQBA 3H19A 4RW0A 5ICCA 2ZR9A 3BD9A 4O2AF 1UPTA 3W2IA 1AUXA 2M9MA 4QGAA 2ZUCA 3EYAA 2HF9A 3ZD9A 1W1IA 4IDAA 3Q8XB 5MN5A 3MM4A 4MI3A 3MJ4A 1T36A 1Z74A 3OT5A 2FI1A 3R7WB 3ZLBA 5FBVB 3AW8A 1UXGA 4POAA 4FMPA 4QNNA 4G41A 1G5IA 2AR0A 2B34A 2MINB 3IBYA 1C4WA 1VECA 4I4CA 5B1IA 4KFRA 4EPWA 1PDOA 2BTEA 3T5TA 3GX1A 2OQVA 3QTTA 3F8SA 2RI6A 1O8BA 2YN4A 4UHJA 3CJTA 1T1IA 2A8YA 2XA2A 1NAIA 3QUTA 4YXWA 1IOWA 3UFBA 4CT5A 5KNBA 4ZAXA 1PF7E 2NUTB 1ESDA 3TNJA 3Q3HA 3W1VA 2BE7A 4Y6QA 3OE7A 1XRJA 2RFLA 4OHZA 3SHTA 3VKHA 1ODTC 4UTOA 3U6BA 4D8XA 2FEOA 1F8YA 4HLUA 2VK8A 1WB5A 3GCXA 4J0KA 1UXKA 3G0BA 3L6BA 2QTNA 2HW8A 3R7NA 3N2GB 1KI7A 3FOBA 4BLOA 4FZVA 3ROGA 5EIXA 5DK4A 1IPHA 3FUTA 3GCDA 1RPNA 2QX4A 3PUXA 3X1WA 1KFJB 2R8EA 2W2LD 2Z6VA 3HR4A 2FSSA 1DPGA 1Q0SA 1U04A 3KOYA 4EGSA 1HI9A 3FETA 4FEYA 1R2QA 2OYCA 2EP7A 1F4LA 1XMVA 3DHEA 2QZPA 5KYUA 4GKKB 1VQ1A 5F2OA 4QXRA 3QFCA 1SCJA 2GCEA 2CZGA 3QSGA 5CCBA 4GKJB 4KMOA 5FUXA 2XZTA 2YXNA 3D02A 3DNPA 3PB3A 5A2QA 4L5BA 3QF4B 4XCQA 3CN9A 1ZD8A 4OLFA 4IJQA 1VCOA 4QDOA 3ZWDA 1LBQA 2OHVA 3JZIA 1G3MA 2RGRA 2X0FA 4G0QA 3DBRA 3IUSA 1NPYA 3EZ6A 3IEPA 1A1VA 1P1IA 3IPXA 4UNSA 3CG0A 2ZJ2A 3UK1A 5C5CA 4PZPA 1H3NA 1WBJB 3T7AA 2Z6UA 5DWDA 1AA9A 4B3BA 4BU1A 4GOND 4FNMA 1N6IA 1DUSA 4FSDA 4FX2A 1QS0A 1M6VA 2NZ8A 3FNRA 1FLNA 3DXFA 4KXUA 4MW6A 1IB6A 1P9OA 2HRCA 2YVKA 3F47A 4XWGA 2QD1A 1VBMA 1TMOA 5EMKA 3UK0A 4AMBA 1FK8A 3GNQA 3QUCA 3ZV6A 5EUCA 1RWMA 2INGX 4FSXA 4QUKA 3A6JA 4WZAE 4BX2A 3RAFC 5GOTA 2B7CA 1J56A 4BKRA 4IKEA 1XDUA 1XRNA 4TYPA 1P3JA 1Y0BA 1N4AA 3RVPA 2QIOA 1NV9A 3EZ2A 1XJ5A 4NLLA 3MHPA 1TM3E 4J1SA 1RC8A 4QRHA 3U3ZA 1SWVA 2YJTD 1NIPA 3RIXA 1A4IA 5B1EA 1VBKA 2BMWA 2BGNA 3PUWA 1N2JA 1P4SA 4G9GA 4I4TF 2JFXA 2Q0QA 1FTYA 1QGUB 2O8CA 2H54A 1Q1AA 2BGGA 3ELDA 3FN4A 1PFKA 5LQDA 4E30A 1Q7BA 4PO1A 2X7XA 4ZU3A 4IH9A 1ZK3A 1U8TA 2P9BA 4XIIA 5F9MA 5L4NA 3UENA 3C7CB 3NTXA 2C2HA 4B45A 4K2AA 4IMIB 4WTOA 2AQHA 3FOEC 4ID3A 2WSSA 3E5MA 1RSZA 1L4BA 4G1UC 1GGEA 4D3FA 2FDCA 1YVPA 4P8RA 1UC8A 3C3KA 4OHXA 3ZPXA 1COWA 1T2UA 4C3VA 2JHGA 5JZMA 3VDQA 3GWZA 3UB4A 3H9BA 2VA8A 2CNWA 4UXHA 3GJ6A 2JI4A 5FL7D 5B7NA 3SIWA 5M29A 3ZXXA 1UH5A 1YB6A 4FCVA 3CXUA 4LY6A 1OTXA 2XXBA 1LY1A 1QYDA 1WX1A 2QQFA 1D2CA 3TSYA 4B0PA 3OG9A 5CM9C 2Z4SA 1OLOA 3VISA 2GYWA 1RRVA 4Y2RA 3EGDB 2VUUA 1I13A 4PBTA 2DOKA 4D43A 4IZOA 3EBPA 2JLBA 2O8FB 2IDJA 1R6UA 3T52A 6YASA 3EMBA 5FOUA 1B8OA 3WMFA 3SF8B 2XRZA 4JYAB 4ZRNA 3FYUC 4GM4A 1JIQA 1NW3A 2EW8A 3PNOA 2A9JA 2C3YA 4WOKA 3L4BC 4ETWA 2XMDA 1IXZA 5EFZA 3RKSA 1XJQA 3MBOA 2PRKA 3VV3A 2H2GA 3V7NA 1FFDA 3ZCRA 3QFRA 2BR3A 4TMXA 2A33A 3ONWA 4TRJA 1XD8A 3LDFA 5CVJA 1YAJA 1BWQA 2WJPA 3BDAA 5REQA 1HDIA 2ZIZA 1FVXA 5AW9A 5I5EA 2LPMA 5FLKA 3T38A 1XE3A 1R9NA 1GTL1 2HGSA 1SG6A 4IV0A 3U0VA 1XDDA 1IWOA 3NQ41 4LGMA 3TH5A 5CFRA 2JIBA 1RRGA 2C04A 4ZCMA 4OUDA 1F0NA 5JMOA 2ODWA 3JWEA 3NV9A 2HF2A 2A0UA 5BNWA 1R8SA 4P3YA 4P0QB 1YA6A 5JG7A 1U9JA 1KQNA 5K0CA 1IM2A 1S0UA 3OQIA 3K15A 4JJ4A 5HRCA 2C42A 5HE8A 1AT1A 1X7ZB 3C8HA 3HM9A 1AGPA 4EPXA 4UPVA 4EUNA 1WXGA 2E4YA 2QGZA 1OLUB 3DJFA 3E18A 4JOQA 3TQHA 4I81A 3UWPA 3H99A 4XR9A 1NDQA 1U2DA 1MA0A 1A5AB 1PL6A 1V7CA 3ZDZB 4FJ1A 3AHGA 5CT5A 3VDXA 2DHCA 4DCOA 3VNRA 2OECA 3F4LA 5JZSA 1OROA 4LGCA 2DPHA 3RU2A 1SXJE 4C3UA 1G8FA 2WJWA 4HY3A 1NF9A 5K8IA 1ORDA 1E1RA 1QFMA 3NV7A 2BGRA 2XSZD 2OHOA 2DBQA 4D9MA 2FW0A 2CFIA 3RARA 4K6GA 2H2WA 4YT8A 2B92A 1K6MA 2GLUA 4CKXA 4CFSA 1JMVA 3OZFA 3QXGA 3MTJA 2JARA 4YV1A 3MVEA 4GBMA 5I9NA 1WMDA 1QWSA 3JVEA 3G1WA 3A1WA 5EHIA 2Q7DA 3DLHA 4G2NA 4NR0A 1M6WA 1VGQA 3A7EA 3O4GA 5EHNA 5FWXA 3TOVA 2XXJA 1Z16A 1YRWA 1DO2A 2XF8A 3EY4A 5H59A 4IGAA 4JHXA 6REQB 4YP7A 2UZ4A 3HUEA 4TZTA 5JQGF 2AKEA 2EKLA 2G6BA 1EDEA 4K3VA 4DIEA 2HIAA 1FDOA 2Z2IA 2FPSA 2I4TA 4QBGB 5DE3A 4B83A 1AHHA 1C9EA 2P0EA 4XFKA 1JFRA 4LJLA 4DR7B 4PZ0A 1O9HA 3M7IA 2RIPA 3HJUA 3L8ZA 4S0XA 3RFUA 2AJTA 2QLFA 1EG2A 4ZMRA 2ZSDA 1KVSA 3K2BA 2VQFB 3BT7A 4MTCA 1D0VA 2BP7A 2PWBA 5F2KA 5AWFC 2NMVA 5IAGA 1M2JA 3H05A 4D8VA 1G2PA 5CX1A 3S4YA 4YI3A 3LPMA 4KV9A 2WWWA 3TD6A 4PICA 1M10A 4BB5A 4UBNA 3BA1A 3FZGA 4UNPA 2R0QC 1W1UA 2J33A 4K9KA 4X00A 1C2TA 3NHSA 2ZWMA 5G1NA 5ES3A 1C7QA 3D4IA 5EWMA 3H2YA 3LGSA 3LTEA 3EFBA 3V48A 1GSOA 4KQGA 3WV5A 1D1PA 2WZBA 1M3SA 1NJ6A 3H4IA 5K3BA 1V96A 3RVLA 1JPVA 1CUIA 4M0KA 3IFSA 3EVBA 1TRKA 1Z8FA 2CNKA 3L4EA 3HA5A 3IEKA 5B1SA 1F7UA 3SM9A 4EYSA 3CQ9A 4CI9A 4ZT2A 4OQDA 5HKKA 3SHQA 1EQAA 2GVDC 4YECA 5LBUA 2DTEA 3DYVA 2QY6A 3QYPA 4OMCA 3T34A 1EVKA 3MBKA 2ZDHA 4JBWA 5GP1A 3K1TA 4B6GA 4CCSA 5BRJA 3M49A 4DR3B 3LOQA 2ON6A 3ZXSA 4RWZA 3D64A 2C4MA 4ZTZB 4QWMA 2V7TA 4PG5A 4FFMA 3RC2A 3BFJA 2XYRA 3ORFA 3IB6A 4JP5A 1DEXA 3DAOA 1Q7TA 4OB8A 1RKQA 2ZROA 5IFKA 3DM5A 3A1EA 3EA4A 4LQDA 4MI9A 3CW8X 1BW9B 1CY7A 5KOHB 3QNMA 2XYHA 2VYNA 1WXWA 3SKXA 3ME5A 5C37A 1XAJA 1KWGA 1WB6A 3QJ5A 5K6RA 3TQTA 3S5JA 1U8ZA 2CVPA 4S1NA 4LHWA 4DV6B 2RH8A 3ICVA 4NYIQ 4DHEA 4NC9A 4HDSB 3ZQJA 4G0XA 4RK6A 1TUBB 4ND4A 1DBIA 5AVTA 2LW7A 4FM9A 1F5SA 5F77A 1KZ1A 2DHEA 3E9MA 3F1KA 3HYRA 2GCGA 2QT9A 1KDPA 3OUZA 3R9XA 3OA2A 1OWOA 4RVUA 4GX2A 3I1FA 3TLMA 4C4TA 4D56A 2R79A 1N2ZA 4DSZA 1QP7A 4Y30A 1NMQA 4CIXA 1H8HA 3K0FA 1HYQA 1KI6B 1P75A 1UOEA 1NLZA 2CFSA 4LSZA 4O4HF 4NJEA 2J0VA 4B3DA 4CUJA 5AO9A 4REQA 3K4QA 5FBKA 1Q7RA 5ICGA 2FPMA 4BKOA 2NACA 3PGLA 3WNZA 2PS0A 1W5FA 4HF7A 4F04A 1WO8A 5LN1A 5K8VA 1V1MB 2G4VA 2C7VA 1T5SA 1HLGA 2ILTA 2XA1A 3FWNA 4C04A 1QE5A 1C1XA 1T10A 1LLQA 2QTAA 3IP7A 1GFSA 3BIXA 4RO0A 1SOWA 2WFLA 3KWMA 1JAHA 4AIIA 3LT4A 1V26A 3M2TA 4HEHA 3LVRE 3U7EB 1AU9A 1UBSB 4H7EA 1PQYA 1VHTA 2PFSA 3OLQA 4Y6PA 4X54A 2OXIA 4DLVA 1LV7A 3F6EX 2HK6A 5B1HA 4RMHA 1U3CA 1WCIB 1CW2B 4V0SA 3KJZA 3TNFA 3REQA 1DT3A 1HXHA 4PHGA 1F14A 3IAUA 4EVIA 5CFMA 5IF9A 3RE1A 3T7JA 3CVJA 3MSCA 1A9TA 1GQFA 2IS6A 2BV3A 1QLHA 2LKCA 1FXWF 4N0EA 1QOQB 5B4VA 3OWXA 4HDMA 2ZUDA 2XT9A 2BSAA 4ZQFA 2DH5A 1QO0D 1QK5A 1T8TA 1E2PA 3A9WA 4PC6A 4G6ZA 2JJ8A 2XCOA 2ECQA 3IQWA 2PWPA 3BDIA 3CT6A 5C5EA 1FTWA 2WB4A 3F74A 3PWZA 2A59A 1U7HA 5BN4B 1GILA 1V35A 2NO4A 2Q29A 3FMOB 4Z3KA 4OHUA 2EOAA 3U44A 4DOMA 1C14A 5DHPA 5TV2A 2OO7A 1I14A 2OBYA 3RG8A 2WJ4A 1USIA 5A5VA 2Q4TA 5DHUA 4TOIA 4OQYA 4ZOAA 2VATA 5DHRA 5IAEA 4HV4A 5LQNA 2H7VA 4ZCTA 1LC3A 5LWQA 4AYXA 1QVWA 1Y9DA 1XX6A 1SO8A 3NFYA 4MGYR 2QNIA 1E9VA 4FSHA 2JGIA 2QR2A 2PLRA 1Y1SA 2QSJA 2W2KB 4MGZR 4L16A 3WLNA 1CS0A 4XIJA 4UU7A 3NKFA 3PDJA 4RLSA 1YS1X 2W6ID 4AZ0B 1II8A 4RTPA 2YWCA 5ED0A 1NW4A 2ORIA 3U7HB 2Q5LA 1AHIA 1AHPA 4CM6A 2FFHA 2FEWB 1K08A 3IP9A 4G0ZA 3CZQA 1C8VB 1IEWA 1XYVA 4I99A 2W2VA 5E6RA 1PEKE 2YJ4A 3RYFB 3OPQA 4B3SB 1S4QA 3QLVA 3AVXA 4YRSA 4DLPA 4WKCA 4B6FA 1N0HA 2J4CA 3FGOA 1YFJA 3RD5A 2JFPA 3ESBA 1FS4A 2CLCX 2GBFA 1QX3A 2A0WA 4GVPA 5KWVA 4EMSA 4M9SA 5JV5A 3GGJA 1CUWA 1MOQA 5DTRA 5CH5A 3WX0A 2QLTA 5E4YA 2ZRDA 3Q3GE 4DG5A 1T0JB 3X1XA 4Q4LA 3P26A 4V02A 2JLRA 2QZSA 1CUXA 1RPAA 3D8BA 3F6PA 3ZHQA 5KQPA 1KP3A 3GFBA 4WDRA 1O1YA 3C74A 2OILA 2Z1MA 4UCQA 3JAKB 4HTFA 1DBRA 2ECOA 1RW4A 2JAUA 2AFHA 5HILA 2J9RA 2XTJA 1EYZA 4EIWA 2DUJA 3JPWA 1J6UA 1GAQA 1OPXA 2F9MA 4DA8A 3GR6A 2B5VA 2NU7B 4BATA 2O2EA 1EXVA 4PQFA 1VKHA 4JUAA 4LVNA 1WBBA 5JWRA 3UPTA 1Z33A 2A5JA 4YS6A 1C41A 1P29A 2Z3VA 4DMFA 1XMOB 1F1JA 1Q0LA 3ABQB 4MV0A 1JRLA 4UUNA 1QSGA 4IJKA 3SWWA 5JD4A 2WUDA 4J8PA 5JSZB 3THYA 4B2IA 1ZC4A 1E2IA 3AUKA 2QVZX 3ZU6A 3IQGX 5HX7A 1FRVA 1RI1A 1Z8DA 4FDTA 3W04A 2C9DA 2G5PA 5DTEA 5HIMA 3C7AA 4JKIA 4U0KA 3FI9A 4DR1B 4HAWA 2YUTA 1HEYA 1U9YA 1ULSA 5FBRB 1WSWA 1U8EA 4HDKA 1LBSA 1N2SA 1OZHA 1SIBE 3HB0A 3QKSB 4NZMA 1JB9A 1VOTA 3ZWVA 5DNYB 3W5AA 5KQRA 2X14A 3DC7A 4BRZA 2WJGA 5BV1A 1PFGA 1Y3IA 1ZMRA 3OIWA 3ECCA 2YV1A 1JBQA 3S3TA 5ADHA 5JCOC 3MTDA 2CZQA 3GT7A 3AESB 3P2YA 2CL5A 2H11A 1EJ6A 1XCLA 3CVXA 3EF3A 2R7AA 4CEJB 3ZWMA 3O75A 3PHCA 1TTPB 1VPDA 3AJ9A 5J5VA 1ESCA 2FK8A 2ZE7A 4H7PA 4K87A 3FOFC 4F6RA 5KNBH 3O8OA 2JJ2D 1HT3A 4QLOA 4A0GA 4D9FA 3RU7A 4LI0A 2IIVA 1BGVA 1RYYA 4C0QC 3L06A 2GAFA 5KQSA 1ZM3A 2R8OA 4B81A 4U7HA 1RM4A 1JT2A 1RRMA 4TZ0A 3ZWPA 4C7OA 3GYGA 4K6CA 2B0CA 4FI3C 1OI2A 3H1PA 4H35A 1K6JA 4H15A 1GZUA 3VSBA 4MIYA 4ZJUA 4BP1A 1OH7A 3LRXA 4LRXA 5EIAA 2B4RO 3OECA 2WICA 3SQLA 1LTHR 2XUIA 4NBNA 3B9PA 3TOXA 4DQXA 1IDN1 1R6AA 3A05A 3DL2A 1OYOA 4NCIA 2QMYA 4WBXC 2OZKA 2ZUUA 3EDYA 1V3VA 3TRFA 1Z5UA 3OCVA 3FIJA 3OX1A 4TXNA 3MUEA 2XDQA 1KS2A 1OOEA 4JB0A 1XAGA 1BOOA 1GNSA 2QM3A 3LX4A 2I6FA 2VKTA 3PZBA 2FSUA 3R5KA 4EKNB 1NA5A 4ARIA 3INYA 1HR0B 1VFNA 1TKAA 3PRHA 5CA1B 4OOEA 4HDRA 5I8WA 4A8HA 1S5PA 2QUZA 4IUYA 2EDCA 1SCUA 1EK1A 2CB0A 3GJYA 3KLMX 1Q6YA 1DARA 4KQCA 3KKKA 2X7HA 3N2NA 5E3HA 4CMIB 3ZDDA 3HSYA 3V6LA 1PW7A 1NJ2A 2KX7A 3IBSA 5LIPA 3WKDA 1VA4A 2VNAA 3UJNA 2O1WA 4MS3A 4X6XA 5H5JA 1IG3A 2E9SA 2WKRA 2XW6A 2W2PA 3K9CA 2B98A 4EZIA 4N65A 4LJ6A 2JLVA 4TWBA 3SFVA 1PJ2A 1E3EA 2FQWA 3NGXA 4UVIA 5IEJA 2DU8A 2A1TS 5ALGA 1FRZA 3GFQA 1WBDA 2HWWA 3OUUA 3GUZA 3AF2A 4WHMA 1L5KA 3C3CA 4JJ6A 4LK2A 1F2UB 3MIZA 3HBFA 3ROXA 1HY3A 1XO1A 4MW1A 2RBEA 3I5XA 4Y2QA 2GBLC 3QFFA 4TLCA 4E2WA 4EFNA 4RZIA 1I4DD 2PD4A 3NOVA 3IBGA 3G17A 4BFYA 3DTVA 1NWCA 3K4PA 4IFIA 4H6VA 4DNQA 2JFFA 2NYAA 2ZTVA 3KE9A 1PYOA 4KGXA 1FFGA 3U1VA 1ZR2A 3H13A 1UK8A 4ZU6X 4ENQA 5CDHA 1CDOA 1K4MA 2GPNA 1FFXB 1XEWY 3IXQA 3P1JA 3DFFA 3PXAA 2OPHA 5AM3A 4ZO9A 4OATA 1Y82A 3KZOA 3OPMA 3Q2OA 3QVGB 4G1FA 3RBZA 2AUTA 1TYDE 4OPMA 1AKNA 2RG7A 3HN7A 4TLEA 4Y67A 3AHIA 3RSFA 1ZITA 3C15C 1KYXA 1Q2UA 3PEVA 2H18A 2FJUA 1RWQA 2FSVC 4JXJA 5EPEA 3T9FA 5I4IA 2ZJ0A 2I66A 3P2JA 5DGXA 1N78A 4ZMSA 2HPVA 2PGLA 1ONPA 3NIBA 1XALA 2WMYA 3IQIX 2XCLA 2OAEA 2HUNA 3KEQA 3TEJA 3PG5A 3VYWA 4UC0A 4D4IA 3AJAA 1NNI1 4YYZA 4RF2A 4B2YA 5HDQA 3K1AB 4N5NA 4LJ4A 2P7HA 4JI7B 1P18A 1GYPA 4MSUA 1Z25A 3DXZA 4X1IB 4IW3B 3B7GA 4TS9A 2UYOA 4GYWA 3P9PA 3IHLA 2P67A 4R1PA 2AWNA 1LVHA 3N2YA 2QAGC 3RKRA 4IFEA 2ECKA 3WAJA 3DAPA 4KOEC 3DM9B 5EUMA 1KY3A 2AYYA 3S1AB 3CNNA 4BPBA 1ZLXA 4NMLA 1A9RA 2CYCA 4WRRA 2Z56A 3OKCA 4DZZA 2JJ1A 4M1ZA 3M4YA 5L51A 2GXAA 1A97A 5CLGA 5FI0B 5CDTA 1UMCA 1QGYA 1UXOA 2QL5A 4DANA 2Y71A 4FYMA 4HDAA 1QH8B 3QXJA 3D3NA 4BMZA 2AC4A 2P2CA 1KFCB 4G8CA 1MB3A 2C29D 2CWDA 3ODGA 1CYEA 1XWFA 2VJQA 4BWFB 1T1GA 3GBVA 5L3QB 2VXBA 3R23A 4IF6A 3O8QB 5LOVF 2VTKA 3CRQA 1H4VB 3FUUA 1GYQA 3ORHA 1UPXA 4HAUA 1QPGA 1X7HA 3JU3A 4TV9A 3LXRA 4QDZA 1WP9A 2GEVA 5CX4A 5EYPB 3IKJA 5E9QA 3RUEA 3REFA 4Z7NB 4B82A 3IRVA 1M5RA 3Q5EA 3VR6D 4LKOA 3LD9A 4BTEA 1IUNA 4P3XA 1U11A 1UJCA 1YZUA 3I52A 4L4ZA 3HNPA 1KERA 1U28A 4P54A 3I2FA 4FINA 3RRBA 3ROMA 3WB1A 5E1DA 4W5TA 3OQMA 1CF2O 3ZBQA 3H1AA 1WZEA 1UKBA 5JY1A 1X7YB 1H6AA 4RVNA 1ECGA 1FYDA 3PYXA 4F8JA 2PLAA 4IH1A 3ZE6A 4RHUA 1G66A 2Q5CA 2X86A 3FVWA 1GGFA 1OAAA 4JI8B 1ZZGA 5ALMA 4AUNA 1B7GO 4LKRA 4GDFA 1ZH6A 3JZDA 4WERA 4C20A 4RVDA 4G5RA 4M8SA 1IEQA 1A5BB 5HTKA 4BKPA 1Z34A 4R2WA 1JU3A 1MJFA 1E59A 4EITA 2GPJA 3PYLA 5L40A 1U3WA 1W4CA 3EJ6A 4DCSA 1L8OA 1XD2B 4L0DA 3AQ4A 1UAAA 2EIHA 5C8VA 2Q4DA 2CC2A 1OFIA 5L9AA 5KX5B 3H42B 4DLXA 5EY5B 1JSLA 2ZIVB 1WVIA 4RIIA 4ILEA 1T5DX 1UWVA 2J07A 3LP5A 4U4AA 1GR0A 2IY8A 2O3SA 4U1RA 3U3MA 2D0IA 3URKA 4BJ1A 1B23P 1US8A 3ZH2A 3ZU4A 4V1CB 3ZCUA 3PXDA 3LA6A 1EHCA 1G42A 4JVSB 3TLGB 3NBMA 4Y2TA 1QRTA 2DVMA 3QJGA 2IUFA 3OU2A 3M34A 2EQBA 5CNJA 1MV8A 3CUEF 4GSLA 3ZGVA 2E4WA 3D2AA 4CKWA 3C1UA 1ZVKA 2G67A 3A10A 4WZAA 2VEDA 3TXYA 3M5WA 1SUBA 5AUNB 2ZIXB 5D8DA 9LDBA 4C6TA 2NP7A 4JGBA 4C7BA 3DL4A 4Y9RA 3I6IA 1MXHA 3LO5A 4PCUA 4OHBA 4F21A 1DEHA 2IXFA 5DH9A 1JI0A 1JJIA 3A36A 3DFIA 1IOLA 2E87A 2FA9A 2XF2A 1B15A 4RGVA 5GOZA 4O4JB 5JLJA 4QBIA 1XF1A 4Q7KA 4MPPA 3KR2A 3T7SA 3KALA 4J07A 3WNQA 5JD6A 3P52A 2ALJA 3LYHA 3WK8A 1P7YA 2AD1A 1ZIYA 3TLXA 3U4CA 1H4QA 2FPOA 1QHYA 3PDIA 3ZI0A 4ES6A 4H4EA 5F51A 2VCHA 5FUYA 4BMSA 2MSCB 3WGYA 3DHWC 4QQFA 1VSQA 3ANXA 1B3BA 4XQEA 5KB3A 1P9WA 1GFIA 2FEKA 1KO1A 1W0JD 4ZVMA 1RKXA 1MZPA 1IOZA 5DMXA 4YA6A 1BWSA 4R01A 3QOFA 4BLPA 1DIRA 1OIWA 2PNJA 3U4AA 1M7GA 5A4KA 2QY9A 3Q9NA 4L6AA 2BEUA 1TQHA 2FUG1 3Q9UA 1BWPA 3RHZA 3OZBA 1M8GA 4DA0A 3F7NA 3K2EA 4MRSA 1IQPA 3DE3X 4QELA 4CODB 3ND6A 1OIXA 2NVOA 1QYWA 5JYDA 4M8LA 1YMQA 4P4NA 1P17A 1NTOA 3CCBA 4X94A 1A7KA 1CFZA 1Y4SA 1OE0A 2VRWA 5EQJB 1Q5PA 2AF3C 1N8TA 4UMEA 4AXXA 4BQSA 4KR3A 1JG6A 4AF6A 4KR6A 1I4LD 1LS1A 3JPYA 3KQQA 4Q03A 4N03A 1AK1A 5CJJA 1MCZA 2FXIA 2FHSA 3BK1A 4MWTA 5T6MA 3H86A 1GV1A 4JOSA 4K0RA 4X20B 1KBQA 3F7OA 5ALRA 3L43A 3KOMA 2CK3A 5AK6A 3EDRA 2ZJ7A 4IIFA 4ZT5A 3W6UA 821PA 2JGNA 4MVJD 5IU6A 3D3JA 1X8XA 1JU4A 3ZOKA 1HQYE 4JQSA 1E2BA 1U1IA 4UAGA 3WLEA 2G88A 3C3AA 1HV8A 2Y27A 2NZYA 1FTSA 1F2TA 4LUCA 2B35A 4TS4A 2WPDA 3E3AA 2DQSA 1CRPA 3EZ9A 3BMOA 3EZXA 1DQSA 4WCFC 3M6XA 5COAA 3KT6A 1AV7A 4JENA 3QVOA 1IJFA 1YMUA 3KUKA 2MU1A 4M1WA 3TD9A 2UZ1B 4CQLA 4YMVA 4KHPB 1UBGA 4HH3C 2JFYA 1GU0A 3UJ9A 3WL5A 2YHSA 3PPIA 4NY1A 5CEFA 5I7SA 1X1TA 2CF6A 4CF3A 1FFBA 4L2IA 1NYRA 2PXCA 2VDNB 1AS3A 1LLCA 2NYRA 5LXTA 4X66B 1ADGA 4XD7A 3OIGA 2F8TA 3B13B 5FWAA 2AN5A 4LDRA 4NOKA 2ZSEA 4PRLA 1KEEB 4CM3A 3TSCA 2QI9C 3PIIA 4NJOA 1U9ZA 2FMFA 3S40A 1ADCA 1SXJA 4LSMA 2GVZC 4UXIA 3II6X 5EZYA 4A6DA 2DWPA 4XAQA 3KFLA 1MVOA 2WFZA 2C9MA 3VR5A 2J0UA 1YKSA 2O0KA 4KGVA 5A62A 2W6JD 1BH2A 3C8MA 3ZIAA 1V43A 5E4TA 1V7PC 1SXIA 5IT0A 2V7UA 4BL5A 4X90A 4IIHA 3B1KA 3E1GA 4R9NA 3SZRA 1URPA 2I1WA 4LOHA 1FXSA 3F9IA 5JADA 3BXOA 4Z8YA 3E22B 3I12A 2D59A 3T4XA 4HWGA 3GEBA 3GRAA 3IAEA 4ITUA 1E8MA 2QGNA 4RPHA 5BYBA 4D98A 2ZRGA 3OPYB 1E1CA 1UODA 4EG7A 1WKCA 2YQ4A 4TN5A 1WMSA 2VCYA 1P0IA 1G59A 5INTA 3UW3A 4BCBA 2BFAA 3EPKA 1LW6E 2PA3A 1DMRA 3HI6A 4PZLA 3WGMA 3G5AA 1BNCA 2IY7A 4OY3A 2JHPA 1PNQA 3ZLVA 3IHWA 1RP7A 3N75A 2M32A 3DBVO 1QX4A 2FYTA 2JLSA 3GJRA 1L4UA 3QBTA 2PS3A 4DLTA 2YDYA 3PR2B 4X7BA 2JLUA 2VSNA 3FYUA 4BAGA 2R5WA 3I04M 4JR0A 1CE8A 1ZUD1 3VU3A 2ZEJA 4NBLA 5H80A 2IITA 3L4BA 4J4TA 3R5SA 4EY3A 4F9GA 3S0JA 2BM0A 3W7VA 1UXJA 2BFPA 3NS7A 1IY9A 2ZVQX 3AHCA 4EUSA 1A4RA 2JFUA 4BGVA 1JR3E 1YHNA 1H3EA 2R1UA 2A1UB 4HL6A 1E92A 3V8MA 3D7KA 5KJFA 2YX1A 3R77A 1SUAA 1NMYA 1CZKA 4B6SA 5HMMA 1L7MA 1QMPA 1F9AA 2D2IA 1WSAA 2L19A 2OZVA 2WNSA 2G06A 2ZJBA 3LGAA 3T5GA 2UXDB 1G6Q1 3I4LA 4E13A 5IZCA 1XDBA 3DAFA 4KWTA 4PO8A 4C0SA 1U2GC 3KCNA 4W99A 3RGWS 1CJMA 1XGKA 3MBIA 1P0MA 1SEPA 4GC5A 1MTZA 1ZZEA 3NATA 5A9TA 5K99A 2IBTA 1XQ9A 4H0CA 2PZLA 5CT9A 1I7DA 1EAYA 1ECPA 3QA9A 4M49A 5D6OA 4A2WA 1Z5GA 2BGJA 2EWVA 5DLEA 4ZV7A 2B0JA 5LYJB 2KW5A 2P91A 3PCXA 4QD3A 4ZRMA 2VDWB 3QVWA 3WGQA 1U7UA 2WD9A 3KKOA 2JD2A 1INLA 1MB0A 1XVLA 3O2SB 3NCTA 1NXTA 4MJXA 2C8LA 2YS7A 1EFVB 4MO9A 3V4FA 2H4FA 4RACA 2WWIA 3G0OA 4R40A 2XUQA 3T9BA 4C7KA 3P0IA 3W6OA 1K98A 4W1PA 1NXSA 4L4XA 1E1LA 4E5YA 1SCQA 1EVQA 3MJSA 5E8RA 4ACBA 4FC7A 4HEA1 3BMNB 3SE7A 2W2XA 4B32A 3B78A 4KE8A 3SBOA 3ZE1B 4KSYA 1CZOA 4BAUA 5JJKA 4JYBA 3FBWA 4Y0VA 4I1PA 3CG4A 5D2CA 5DPMA 1CLEA 3DCYA 3P9YA 4IFTA 2I62A 5T4HA 1KJ9A 1NLUA 2X41A 1TEHA 5HIJA 1J0CA 1PZMA 4PVDA 4FWBA 2XE8A 1E1QD 3EG9A 3BJMA 4PLGA 4KYUA 4N8SA 1IRIA 4G1EB 7ABPA 1EHYA 1XQYA 2G4CA 5AFSA 3AHDA 1E2JA 3JAWA 3U3KA 3C4QA 4RV9A 5DZSA 3EARA 3NEPX 5FPQA 1GDTA 3QVLA 1Z39A 2VS1A 1G16A 2PKWA 2PDAA 2AJBA 2V5VA 1MU0A 2QEQA 3FY4A 5CU7A 1ZL2A 2AHOA 4JLAA 4WACA 4JIMA 1PJLA 2KBFA 2GXSA 1RHQA 2X77A 2R48A 3JYOA 5DBHX 4AP5A 1MHPA 2WYHA 3DDCA 3MCZA 3IDOA 1GOTA 3BXHA 9ATCA 1AXEA 5IBCA 3R3SA 1J0BA 2REQA 4YP1A 1R4MB 5F9HA 3A9SA 4RQBA 2E89A 4YACA 1K75A 4G56A 2DT5A 2V0CA 3CIOA 1L7DA 3MSXA 5E0KB 1HOXA 2JFGA 2X22A 3KU4A 3PX3A 5F3WB 2QBYB 4JP8A 4JZYA 4ETNA 1NRXA 2PMDA 5HK9A 3GFFA 5HBGA 3SVTA 1UK6A 4LK3A 1UT6A 4HGOA 4PPNA 1VDZA 4Y2PA 1NJ5A 2FSHA 4NWIA 2A88A 3AKYA 3VM6A 1VI2A 3ZGYA 5JS1A 2O2YA 2R1TA 4K1LA 3AERB 2FQYA 4TTSA 3LBIA 1A2KC 4WY5A 1VPWA 1C81A 4LVUA 1PE0A 4FEEA 3BL6A 5DBFA 4OQNA 3ZHBA 4C88A 3B6IA 1ESNA 3IA2A 1YZNA 4ZCIA 4R81A 1EP1B 1KRWA 3THRA 3HJCA 1QH0A 1QR6A 5AW8A 1M66A 3FCCA 4JS0A 4BNIA 2VYFA 1CEQA 1UWKA 4M6WA 1G7TA 1FJXA 2BRUA 2EF0A 1PL0A 4HKTA 3GCGA 4AN0A 1N57A 4C06A 2FZCA 2RKWA 5ARCA 4DY6A 1E3DA 3TTSA 3W06A 1NLFA 3Q0TA 3N3BC 4BLQA 5DI3B 5HM8A 1IONA 1Y5MA 3V8VA 4BNLA 2JGEA 1MT0A 2ZP1A 3BKXA 3OF5A 4KZPA 1B8UA 2J6CA 2Z30A 1REQB 2ZRAA 4GZLA 4RPCA 2O1XA 3LHKA 1AKTA 1L4YA 2C8JA 3MJVA 1PGPA 1OXTA 4ZN6A 5A0TA 1CK4A 3UF0A 1T9KA 4V1CI 2FEAA 5F2EA 4U02A 1E3JA 3VPCA 3H1TA 3PSAA 2YXPX 4CIYA 3ZDCA 2QRGA 3U0BA 1PGJA 3QPAA 2BMJA 1E4EA 5SICE 5TPZA 2IJGX 2V6BA 4GBED 3JASA 4LZPA 4ZCRA 5L7WA 1XYGA 4XH9B 1UBJS 2PUHA 3OJXA 5GWXA 3USCS 4GR4A 4WFIA 1YQDA 1M8JA 2R6AA 4UEWA 2PSJA 2XE4A 3CB2A 3M82A 4XLZA 1JAIA 2QL7A 3UMFA 3WBJA 1G9XA 2BBTA 3P4UA 3DE1X 4O2AB 1Z0JA 4KOAA 1TF5A 4E5VA 3SK0A 2WTUA 2I87A 2YZGA 3AILA 4W1RA 1T9GR 2NXCA 2WW8A 1FQOA 1YZ3A 3BG5A 1P0CA 3R09A 4AF8A 2KYRA 4DIBA 3CX8A 1BJRE 3BEDA 5C5DA 4URXR 2FN4A 4QVIA 2I2DA 3HLYA 4M7RA 5TGTA 3V3TA 4KN8A 2H9IA 3IR6A 4CCYA 1WW3A 3ILXA 4J2OA 4JKOA 1GA4A 4HS4A 1KDZA 5FWYA 1I1HA 3CR3C 2JAXA 4JQZA 4DXDA 2WBLC 4V0MA 3JZAA 2JVJA 2JLAA 4MQEB 1R0XA 5KNDH 1QHSA 1BXRB 1TZMA 2X5XA 3BRQA 4JX9A 1VL2A 4WT7A 5BNFA 5GONA 4QE3A 1JEYB 2ZAMA 3AI2A 4RM3A 4EDFA 4G25A 3SS9X 1W6UA 2NYUA 4Y6LA 4KK4A 4OJMX 4F72A 1NE7A 2EKZA 2VYCA 4LCEA 1ISPA 2GPYA 4I1YA 3I53A 5A0FA 3H65A 1FU8A 2HMVA 1L5GB 4NZYA 4JUDX 4H0FA 1Z0DA 1T2AA 5HUJA 3DMDA 4Z3OA 1L7RA 4LF8B 1CD5A 3DOHA 5JMTA 3BWDD 2PPLA 5IVKA 2ZS8A 4A0SA 2W5UA 2ADOA 3MGCA 2QT1A 3WQBA 2RHWA 1M74A 5KTKA 4WJZA 1KAEA 1ZD2P 4PPGA 1WNTA 3L1HA 1KMQA 2WT8A 2ORWA 4II7A 2D0DA 5TF4A 3TM4A 2CFOA 4WFJA 1YO6A 3O95A 4OFWA 2F2TA 3PFNA 1CHDA 1LRKA 3KQSA 2Y77A 4Z1MA 1I5EA 4C14A 3GJQA 5FTKA 4IUBS 5JAMA 1EX7A 2V9ZA 1BIFA 2ZSJA 1CUAA 1O08A 4K1XA 4ETMA 4FLFA 4Q7LA 4TKUA 4JQCA 4CDRA 4RD0A 3WC4A 2WU4A 1F6DA 3G5LA 1C3LA 5BQXA 1KZ9A 2DUNA 3ETNA 4HGPA 4I5FA 1VG0B 2JDID 5DJ5A 4OHRA 3EAGA 1Z06A 4NFHA 4R1TA 4ACAA 4QZVA 4ZVKA 3EEYA 3GJ8A 2BFDA 1L7VC 2OKGA 3MEQA 2ATEA 1RXSA 2PD3A 2F8MA 2B69A 3UAGA 4AW9A 1M8PA 2O1EA 5C8XA 1Y1TA 2H4JA 4BZPA 4EI2A 1F60A 2OG1A 1Z8NA 4XARA 2QJOA 4DKXA 2EJCA 3R6LA 3SD7A 1EA5A 5BMOA 2QE6A 2QQ0A 2BF4A 3H7AA 2QS9A 2VSOA 4CNBA 3AVOA 4TM8A 4TMFA 3LWDA 5G41A 4YJKA 3TF5A 3CF4G 2VH1A 4UM5A 4Z6KA 2AFIA 2BJHA 2CL6X 2IIPA 2YVQA 3GRYA 5E9JA 2FFJA 2WILA 3OIDA 5AK5A 4Q24A 3FSGD 3E9ZA 2IUUA 3QLUC 1KYQA 1V11A 2IBMA 4DPLA 5T8KC 1Q19A 5DFAA 4I4TB 1Z7WA 1EWKA 3D0OA 5DHQA 2QQEA 5JAQA 2QP4A 1C9DB 4IHKA 3RREA 3STHA 3S7ZA 2VFAA 3HV2A 4UZFA 2GZRA 3C7KA 3KZNA 5B5SA 2IBSA 2WKPA 4W5QA 4P4SA 4ZOCA 3C16C 1WPQA 1HWYA 2ZR8A 4G4SP 1QK3A 4MZDA 3SQXA 3OPYI 4Z9AA 3KTFA 4PIVA 4D3ZA 2V6JA 4EPYA 3FHCB 2ZS9A 1LLUA 3R0VA 3AIOA 4J7CA 4UDYX 3L6OO 1U7WA 4ANFA 4CUZA 3HVKA 4KXNA 4RVCA 3CRMA 3ZTWA 3TRIA 2VPXA 1G8AA 3MRXA 3FPSA 4ZKEA 3TWOA 4LFAB 4UM9B 3BF7A 4FMDF 1PZXA 5KYNA 4D2IA 4Q9AA 3VJRA 1MQ8B 1TU4A 3LBNA 3BZWA 4L75A 1KIMA 1QE0A 2GHRA 3UWKA 2H1RA 2H2FA 3ROQA 3B48A 3DE6X 3KWLA 1JI3A 5ED4A 1P1CA 2EFHB 5EE9A 3C1AA 4BMNA 1L6RA 1SIOA 1U6KA 2I2CA 3QX9A 5JDIC 2C2BA 1YKFA 4DREA 1FYWA 1T2DA 2GGSA 4WNIA 4ZO8A 5K5EA 3GZNA 3UM9A 5KIAA 1C9YA 3VC1A 1BMDA 4BC0A 5KSWB 1R10A 1ZU4A 1IJBA 4EEKA 4IMJB 4TV9F 2YVAA 2H1OA 4H60A 1TYCA 4JVMA 3WK9A 3T1NA 3DWFA 2BPOA 3DE4X 3B1VA 2FN3A 5DTJA 1W19A 3QOWA 2CL0X 1UBCA 1CNMA 2FPWA 2Z43A 4D4KA 2XNJA 3DHVA 1T5HX 4WJKB 3LXUX 5ARDA 1COZA 5TR9A 4QBHA 4R7TA 2A0XA 3FJYA 4IGIA 4YMIA 3O90A 2OGWA 2GSWA 1Y8QB 3H6HA 1MRNA 3R3XA 4D8WA 3AIMA 2NVWA 4C4SA 1WTCA 2VDQB 3NHAA 3ZWXA 1WF6A 2BCJQ 1E5DA 2F9FA 2BZSA 5KQLA 3IRUA 1YZFA 1XBTA 3ESRA 3W5HA 3V8BA 5G2OA 1S89A 3V46A 1TT5B 4PAGA 3KUDA 1F0PA 4J03A 2HN9A 4REOA 5SZKB 4AUKA 1W581 3L7JA 1NUTA 5B58C 4HWOA 3CF0A 5GQSA 4M88A 1P4HA 2CLEB 3IP1A 3MJEA 5I9IA 1JR4A 3CINA 4FGUA 1V16B 3DMRA 4YJHB 1IHUA 1VDMA 1Z37A 1WOYA 2NV6A 1A88A 1SG0A 1L5OA 3AEKA 4GUAA 4MV8A 1NNUA 1KDVA 3VRHA 1LRLA 2CY0A 5KOJA 1XTZA 3I6MA 4JKYA 3HVIA 1C9KA 1VJTA 4HK4A 4LC9A 3E7XA 2ISSD 2GASA 1IUOA 1WW8A 4IZIA 3VPDA 2QJRA 4CM1A 1ISMA 1GXSA 1XRRA 2BFEB 4TN1A 2H08A 4F46A 3D3QA 2X42A 1E2LA 4ND8A 1DJPA 1ZMBA 4FILA 5G4LA 5FL3A 4Q7JB 1DKUA 4OG2A 4TQ9A 5HBRA 4Y98A 1UK9A 2P78A 1XOIA 3U4QA 2E2WA 3WYCA 4NOLA 5A6SA 1Q0QA 1J42A 4EHAA 4CLOA 4NCXA 2GBLA 2WIGA 1Y8CA 4Q6WA 1S3SA 5JXHA 4YJFB 4LECA 1E6CA 4DB4A 5E3JA 3VSCA 2CJWA 3G0IA 5EIBD 2PZKA 1WU7A 4YCDA 1DU4A 4DIOA 1E3IA 4NCAA 1BQ4A 3SFTA 4JC0A 1Z68A 5T4FA 2RC6A 3Q41A 3MS2A 1W0KD 3AUAA 4KQ6A 5LQAA 1QQBA 2C7GA 2VVTA 3ILYA 4J0QA 3LPLA 1NQ5A 1UMDA 1Z6QA 5EFOA 5KNBD 3H6GA 3SPXA 1JR2A 3ROKA 4J4HA 1VHWA 3GLKA 1USGA 2KHZA 2FSVA 1MXFA 1N8SA 5JAPA 2H2HA 2WNHA 3RT9A 2J9FB 3Q5DA 4QOHA 2A0FA 4GF5A 4BFTA 4H0NA 2C96A 4GPBA 1YK0A 4HMQA 3ORQA 4MHSA 5A7GA 3TTVA 3GFRA 2O3RA 3JQ9C 1P31A 4ITRC 4LC0A 4ZFNA 3H17A 4TTPA 4FGSA 1X0VA 2AUMA 2JI7A 3G7UA 3GLRA 1IXRC 2ODAA 2CDBA 4KAFA 2WYUA 2A0KA 1TYBE 2MDTA 2HRZA 2H7YA 3IOEA 1XV5A 3KC2A 1K0UA 2AX4A 3LZ6A 1Q3HA 1PX2A 2QM0A 5AVZA 3WGOA 4QODA 5CYFA 3RYCB 3FFTA 3KHUA 4PAMA 1MX3A 3E15A 2JFBA 2ODPA 4XDHA 4DUGA 3RC7A 4UTVA 3QLEA 5LMCA 1BCRB 1BO6A 4MB6A 4E70A 1KGSA 1CZUA 2EGUA 2MYTA 1D7AA 1XTSA 3NWOA 3FA2A 4NZNA 4QTTB 4ZYWA 2Q50A 1EVLA 1TUGA 1UMBA 1FDVA 3E5HA 3L5KA 5K8CA 2O8EB 4LWZA 2PVPA 4MAFA 1OAOA 2JIMA 4KYVA 1GGNA 3V1MA 4A82A 3BWXA 3RV3A 4N7BA 3I32A 3B1FA 3NNNA 1EP9A 3RC9A 1QMGA 4TTIA 5K0JA 4LF9B 2J3HA 1AGXA 5F1KA 3UB3A 1PS0A 2NXEA 1NPDA 3GFOA 3MYYA 3EIOA 2C5SA 2OHHA 2FZGA 4M1OA 2BHLA 2BEWA 5DCYA 4TMWA 1KJWA 4JJKA 3JATA 4B6RA 1P1RA 4D92A 4YCMA 4D0NA 2B8EA 3UK7A 2MSKA 3MFYA 3MFQA 4LOIA 4MGEA 1XVIA 2WTNA 4MCJA 4Q4AB 4DV0B 3U4MA 2MSEB 4OHFA 3M2PA 4FONA 1POXA 3R7LA 4LCJA 2Z5VA 4XZ3A 2EARA 4ZQCB 2IEYA 3W9YA 4H1UA 4RA9B 3BK2A 3EXIA 1WMEA 4HATA 1FU7A 4NBKA 3SXUB 1L7AA 3NU1A 2WQ6A 4HD8A 4NYMR 1QORA 1M0SA 2EJWA 2R751 3M4JA 4PZUA 4ZOEA 5LXTF 3S2UA 3L1IA 5FYDA 1I4EB 2F8LA 1GUDA 2F1HA 1DOHA 4EYKA 1E0AA 3PQFA 2XUFA 3Q2KA 1RQNA 1GCUA 1XP5A 5AK4A 4O1HA 5EZYF 3W79A 4PAOA 1MZVA 2VYVA 1QJCA 3CMMA 4TTTS 2YC2C 1K68A 4QFMA 4YQEA 1W49A 4GQAA 1FFCA 3I09A 4E94A 4ZGGA 3MINB 3INTA 3SQOA 3TBFA 4QKQA 4G4GA 3OCJA 5EQTA 4ZI7A 2B7BA 3P4XA 5BPHA 5F3RA 3OTQA 3D7NA 5C8ZA 1XL0A 4P33A 3H5VA 5AOVA 1TJPB 3WYFA 3I01A 3OFNA 2VT3A 2FU5C 3HXPA 1C5KA 3RKUA 1IC6A 1VPTA 5IYZA 2VJNA 5I7FA 5MDHA 4AO6A 1VPLA 1P8JA 2D5LA 5BWMA 3K0CC 3SYRA 1YS7A 2JFZA 2WTAA 2JJYA 3QV1A 4AS2A 4EG1A 1D4FA 3K6KA 3LY7A 3AINA 5EWJA 1ZJ5A 3GUVA 1F5NA 1Y3HA 2HZ7A 2WAOA 2WI8A 4G4IA 4KV7A 5C52B 4DWJA 4RORA 1TLFA 5HFAA 4ZYTA 4LHXA 4G5FA 1J8FA 3PNPA 3KVYA 1QHXA 2FOXA 3CCCA 4N5LA 4AMUA 5JZVA 1HSZA 3W7AA 4YUAA 3L7OA 5AW6A 3TN7A 5EZ5A 1KF0A 3FG9A 4OYHA 1TX4B 4F7DA 3AEUA 4ZO7A 5E7JA 1L5YA 2BY4A 1P2TA 3LQ1A 3G88A 2ZS7A 2VOEA 4R54A 5GVRA 2YXLA 3SXPA 1Z8HA 1QFJA 3CSSA 3KUCA 5CFPA 1G20B 3RIEA 2VR1A 1Z0UA 2NV2B 3H5RA 1V8OA 1H6DA 2OESA 1ISGA 2A5FA 1EEXB 5EINA 4CKEA 1TCBA 3RAPR 3MT8A 3KYBA 5IAJA 1KE1A 3D8RA 2QPLA 2ZBGA 3IUBA 2CXQA 4PQYA 4E09A 1E5XA 2VF8A 3JR3A 4XIFA 5CLJA 4XGIA 3CSUA 4M0FA 4DPKA 3BERA 3DTNA 5AHWA 4UUOA 1OT3A 3C87A 3JQQA 3OAAA 1F4PA 2NIPA 4OQQA 4PSAA 2OV2A 1OILA 3RLFA 2H2IA 1ZEJA 2FETA 5FV7A 4OM8A 5J2TA 1XPOA 3TQFA 4RELA 1G6KA 4XD2A 1IBCA 2ACVA 1XVVA 4HQKA 4MVJM 4GKBA 1P8AA 1LRJA 4M7WA 4ND6A 2F17A 5DSTA 3A2KA 3HYSA 3ZE2B 2NU9B 1DZ3A 1CY2A 3UV3A 3ELYA 3RWOA 4ZT7A 1V5GA 2OQ2A 2OP1A 3OICA 1SQFA 2V0NA 1Z4JA 2CE7A 2XQKA 1T6ZA 2HPAA 4KIUA 1Q0UA 4BAZA 5ER6A 1L3BA 2C98A 1PYGA 1BE0A 4BNMA 2FZVA 1Z0IA 2J3MA 3RFCA 2MCFA 4DLKA 4L9AA 4E5SA 3L02A 1DNPA 4PHHA 2BCEA 3WK4A 4PTZA 1YD7A 2QN7A 1L1FA 3GXBA 4UZEA 4HG2A 5TXGA 2D2FA 4QTYA 3D6NB 2PUTA 2XEXA 4LYGA 2H7CA 3AFOA 4YBZA 4F4UA 4NHOA 3BGWA 3GMTA 1R6BX 3KDSE 1FSPA 4R3WA 3DZHA 3U62A 4WCFA 4EB6B 3K8QA 3P0JA 1ETUA 2PPVA 3HCOA 4JEIA 4EELA 1PR3A 4YRFA 3LUPA 5FOVA 2KBEA 5J59A 2EF1A 2BVNA 4BYGA 2JZNA 3E9DA 4QYMA 5GIOE 3CW9A 1BKYA 4LNHA 5U1PA 1Z73A 4GP9A 4L7QA 5JASA 4MCIA 4EMBA 4KUGA 4H6PA 1D2EA 1XTQA 1Y3AA 2VUSA 3E1KA 4WK6A 3KXIA 4YMSA 3RK0A 3CNLA 2OK8A 4XKJA 3OTOB 5JR3A 4ZYVA 4BKUA 3TW0A 1U0JA 2YXDA 1SVMA 2ZJZA 3MUOA 1N6NA 1V2HE 3I73A 1NU8A 3LQRA 5LCXA 2J09A 4JJEA 4CUKA 1SC1A 2I2BA 3H11A 2C7BA 3PWTA 5CHYA 3IVMA 4RF5A 4A36A 4MRNA 1V5IA 3KWJA 5ADVA 2DTXA 4Q6BA 5T41A 2NSLA 4TSFD 1ZW6A 3TDNA 3VOBA 4B40A 4GI2A 2WRZA 3EIUA 1G9SA 4B84A 1JH9A 5GZ6A 1A7UA 1UZAA 4LI3X 1R0YA 3F7MA 2W11A 4M9QA 3GELA 1Q0TA 4I7EA 4PG7A 4Q37A 4LF5B 4F93B 4AS1A 1JZQA 4QYIA 2FRVA 3BJEA 3F3MA 3TLYA 3AM4A 4R1SA 1I3NA 3OZTA 5TY0A 3VDRA 1NVDA 3PFWO 1ECBA 1FYVA 4YAWA 4TUYB 5H02A 5A7FA 1LXCA 1ABEA 2GRAA 2OFXA 2X8AA 3DDZX 4F6RB 2ATIA 1ZJJA 2I8AA 4FUTA 5JD3A 3GLIE 1KI4A 2VHWA 3S2ZA 3VTFA 3VNBA 3S1SA 4ZKDA 1PK8A 3RFVA 2B2XA 2PJUA 1O6BA 3KTDA 4W6ZA 2EGGA 3ONFA 3D3KA 5HXAA 2Z5GA 5HIIA 2A9FA 4A8PA 2UZ0A 2ATVA 4X92A 3PUVA 5IH3A 3SNKA 2PT5A 4CG2A 3LP6A 3STXA 1ZY2A 4U2CA 2V96A 3I2GA 1K86A 3V8EA 5LNK1 2Y1XA 3DEZA 2H8KA 1SVUA 1XEXA 2EKBA 3FDXA 2AOWA 5ITWA 2JGDB 3ADKA 4GPAA 1TA9A 2QE7D 2VXYA 2ZBQA 4A16A 2QIPA 4O2BF 3FGZA 4YIKA 3GVPA 2OOKA 1PR6A 2XGGA 2QMEA 2WMNB 3DE5X 3WIVA 1LSJA 3ORRA 4L02A 4AIRA 1IWBB 1X1BA 4AN4A 1YA4A 1CUHA 5AIAA 1T1RA 1RM0A 1VSTA 1MABB 1NI3A 2J32A 1PR0A 1JGTA 1U2GA 4FW9A 4XLLA 4WXHA 4FE4A 3TZEA 2B1RA 1ZK2A 2C77A 3P71T 4GP7A 3ZCXA 5MF6A 5BNZA 2YW9A 3IDFA 4LXGA 2HLHA 4DV3B 3HKEA 4WDQA 2ZXUA 3MT9A 3EC1A 1RWXA 3OEEA 4MQMA 4A0FA 2N42A 4JC8A 2ZWOA 4DYDA 2VSQA 1IN6A 1AO3A 3HUDA 1SC4A 4KI7A 4JOCA 4F2DA 4BO1A 1KJJA 4YH1A 4YRNA 1PV4A 3QQ5A 3JWPA 3ASUA 2IEBA 1QB8A 1GTVA 1WUTA 1P6XA 1UFKA 2EBWA 2VDKB 5HKBA 4P3NA 2C4UA 4OJQA 4ZT6A 5GONF 2IYRA 4DMMA 5CA0B 3KOUA 1XEFA 4PM4A 2YHBA 1K97A 1W2HA 1JG4A 3A1VA 1ZRSA 1OGIA 3RRMA 4DLAA 4LG1A 4F4JA 3BD7A 1XZKA 2HWXA 4ZGBA 5BSWA 4D0SA 2IIQA 1E9FA 2BR5A 4QVGA 4LXTA 2D54A 4E5KA 5I9LA 4TV8A 2DT8A 3HB4X 1EQ2A 1T9HA 2BKXA 2QVGA 3BMQB 3Q7IA 4RY2A 2Q8QA 2WJYA 1Q22A 2XX3A 3R74A 3SDSA 2QX6A 1U80A 1Z0AA 1QBGA 3HY4A 4IV5A 4UM8B 1T91A 5D87A 1A8IA 3D2CA 3OM9A 2X1HA 5E6SB 2ZT7A 4XGQA 1XMQB 2ESRA 1RHJA 1E66A 2BFMA 3OPVA 1NQUA 3OTHA 4GXNA 2IS1A 4HQ0A 3AT1A 3WGIA 4JXZA 1A72A 2KJQA 2VP5A 3A11A 3KZMA 1Z82A 3WP0A 2A92A 3UHPA 5AJVB 1O4WA 1RI5A 2FW7A 3JQ7A 3OJWA 5KYYB 1DWQA 2PIDA 3FWKA 3G1UA 4DZRA 4K2HA 3SIXA 4CFYA 3GL9A 5JS8A 1ESMA 3C6YA 4KEAA 5A9SB 4JWTA 3B2EA 1CX9B 2O19A 1DFGA 3P8ZA 3EFOA 2W83A 4ILKA 5ECGC 2IP1A 1DB3A 5LOVB 1AMNA 4LMBA 4J0EA 4HX2A 1NAHA 1VXOA 3P4YA 4P3PA 4RDXA 4RTKA 2D3TA 5H8WA 3TLKA 2DJ5A 1U5BA 3ZK8A 3H2IA 5I8ZA 1QJ4A 3S28A 1K4YA 3OZVA 4DRXB 1DTSA 4RSRA 4X95A 4BCDA 2C2KA 1PFQA 1WV0A 5TGDA 1JHZA 1KAHA 4YUWA 1FDUA 1MF7A 3EXHC 1JR6A 1M2EA 2DSNA 4F9EA 1RS0A 2GM5A 3EVAA 1VBFA 2ZG6A 2ZPUA 3ZJVA 4F92B 1MN6A 1EMDA 4JEUA 2IEZA 3KEGA 3W4KA 3SHFA 4EB0A 1C3OB 1JE0A 1JHYA 2AGVA 3PU6A 1BU5A 1WDWB 1NI4A 2ZSFA 1IY0A 4I1UA 4PZ9A 4UW9A 5CAEA 4ZXFA 2GZMA 1Q0PA 2CCJA 3GO4A 4FLEA 3AM1A 2Y99A 3CN7A 4RLHA 3HWX1 4I4LA 1NLMA 2PZBA 3ZHVA 1XSEA 3N0XA 2ZPAA 1Z6GA 3WP1B 1XQ6A 1K7YA 2DM6A 4YGXB 1EXNA 1M1UA 4OQZA 1AKVA 2HMSA 4AY4A 4QJBA 2JAWA 3UMGA 3WGVA 2VN8A 2GZAA 2OAQ1 2YL2A 1NX6A 4URYR 3DUFA 5LBIA 4BMXA 4AJKA 3FCEA 3U7QB 1O0BA 3NLLA 4UTNA 5CCDA 1QZXA 4GLFA 4IZ6A 4LRWA 3BXZA 4JI1B 3AV0B 1Q95A 3GFSA 4XB6B 4E2YA 1EM6A 2VF4X 5GM1A 2V8BA 1QAQA 3C7TA 3HCCA 4GWKA 3STTA 1JAXA 2PKXA 3UQYS 1AQYA 3DONA 3AO0B 4BP3A 3NBUA 2DQKA 1P5JA 3S2GA 4W8GA 2DFVA 3SS7X 3ZCTA 1RQXA 1DFHA 1S7GA 2ZI9A 3HYNA 3IB3A 3QIAA 4FYIA 1P44A 3M1YA 1YR3A 1F8UA 1U3GA 1UEXC 4JQOA 1IVYA 4MJ7A 4MWOA 1DDOA 1VMEA 4RBNA 4OXIA 1GAEO 1FYXA 2ANCA 2RHTA 4JBIA 2XOKD 3JVVA 1X70A 3O74A 4H4DA 5G4KB 5H4HA 1DXQA 1Y5RA 4CNQA 1SCDA 3PFFA 2ORYA 1X1RA 2P65A 2FPPA 1PR4A 1PRYA 3MCAA 4GVLA 4BZWA 4D44A 1HQDA 1UIRA 2IHKA 2ZXEA 3BD8A 4X1KA 3N2EA 2QN9A 2X8JA 1NQOA 3MJHA 4MP6A 1QGAA 1KP9A 5FPYA 1I2MA 1XB2A 2F59A 1QIMA 3WDSA 3RJMA 4Y1EA 3R76A 4FI3F 5LP6C 2IL1A 2W42A 2FUEA 2DSTA 3ROTA 2Q6TA 1AA6A 4YNBA 5F21A 4OHPA 2JKVA 3W5VA 1TO1E 2B4TO 2G9QA 1N3IA 4JITA 5DOVA 2H1WA 4BPRA 4ALKA 4FGZA 3SZ3A 3LS2A 1IZ9A 1Z75A 2C8VA 3DBHB 1Z4IA 4MVJE 3DF7A 3FTNA 1CV2A 3QNUA 4URZR 5EJEA 2AG6A 2QN1A 4I2NA 1XCGB 4BNJA 3MERA 1M2VA 5MFPA 2PH3A 2Y1OA 4FT2A 3WLTA 1LBIA 2IU4A 3EA0A 3AM3A 2ZRKA 3OCUA 1GCAA 1EX9A 1M2WA 3GCWA 4RZUA 2DHDA 3P94A 3JQBA 2GPWA 4LTMA 4EY6A 2QSZA 4RABA 3K31A 4JYCA 4YV0A 3VYUB 3NKLA 4RZ2A 3L7KA 1NPTO 5FBWB 2AOUB 2FPIA 1O95D 4L0MA 3JD4A 1G3QA 3BWVA 4MYDA 4R5HA 5IJ9A 4O4LA 1A69A 4IDEA 2FFAA 5FUMA 5L6LB 4GZ6A 1D5CA 4U2FA 2GJ4A 1VC2A 2YICA 3ETLA 1J9GA 2LD4A 4PZAA 4HJXA 4JODA 1V4NA 2G77B 4DMHA 1RXWA 2QMOA 2R6JA 2VG8A 2XSZA 2YASA 5IC5A 1G21E 3WGNA 4P9NA 1DLIA 1SHTX 3ASYA 1HC7A 1ISSA 3SEFA 4BQNA 1K7EB 2FUKA 2PVSA 3HB9A 3PJRA 2YXBA 3AMVA 3GVXA 2J5BA 1YUMA 1M2OA 3C41J 3FPBA 3LIIA 3UCEA 2BSXA 2C7QA 5DSZA 3VZRA 1V45E 3BE4A 4X85A 3SC2A 2GTIA 2QZJA 5L3SA 3PC2A 2AOXA 1ZUNA 5IDWA 3WMRA 3QLTA 1XEAA 3L84A 1QDLB 4CI0B 4FS8A 3ENZA 3QX3A 2PEYA 1DC3A 3KOWA 2DG2A 2ZETA 4WLUA 1U1CA 1JBEA 2QM7A 2VXOA 3QLUA 3TZQA 5K51A 3U4GA 2P9JA 3OO1A 3SQWA 2Q5FA 1ANKA 2H7XA 5T8KA 3TPFA 1DAOA 3TCXB 4EX6A 3WJ2A 3ZE0B 3R4CA 1YS2X 4YT2A 5BRAA 3GGCA 3SHWA 4CKBB 5KKCA 2NUBA 4CU5A 1PAUA 4ZAYA 4NH0A 2D0PB 3OE1A 5EJIA 2J87A 5A3VA 3SQNA 4N8EA 4KR2A 2Q6OA 4KODA 4UBLA 1PG0A 1NF8A 2WVGA 3ZK7A 4FB5A 5BV2P 5KNDD 1C0EA 1P6QA 2Y0CA 1KO7A 5CDSA 4GEGA 2R1VB 2XWBF 1SPBS 4ZQIA 3GN1A 1T5IA 2Z2XA 5HF8A 2IV7A 2R7MA 3ZHYA 2OVBA 4GLLA 2Q49A 4I9FA 3UQZA 1RXUA 3ZKWB 3COSA 1NASA 1VE7A 1HPLA 4Y1GA 2ZRHA 5IN4A 2JF0A 3A04A 2NSYA 2G09A 3LI2A 1TC1A 5AI4A 2IOYA 3DMPA 1UPBA 2ZBDA 5BUCA 4KNYA 3JZMA 3ZV4A 3OX4A 1S2DA 2WUEA 4HRYA 4LX8A 3ZBPA 2YKGA 4KXFB 5TF0A 1GKKA 3G59A 5CLLA 4ZEMA 2ZIEA 1VLVA 4AJ2A 4GE0A 1ML4A 4FMBB 4TWZA 1TEZA 4AJNA 1KS9A 1U98A 2FW6A 4P93A 5TT0A 4INZA 1GN9A 2GZDA 2V74B 1H8ED 1L5RA 3WADA 4CMCA 3T3OA 3NHZA 3SBDA 4UBMA 2XWJI 2WUFA 1J70A 1SA0A 4JL5A 4WZBE 4X6YA 1KMHB 4YMWA 4EUKA 5JDIA 4JYZA 1VJ5A 4HLNA 2PZMA 2F00A 2RAUA 3UTDA 2HMYB 3RTCA 5HF6A 1HZJA 3IDSA 3FCUB 3L6DA 3T1YB 3E61A 4IWNA 4OYRA 4GVXA 3QW4B 1UOPA 4FFSA 2IOQA 3BSSA 4M1YA 4BZQA 4S2EA 3QSYA 4YQYA 1NM5C 4CRWB 5HCUA 1WCWA 5D84A 3P9RA 16PKA 3CEAA 1TJ3A 1XZGA 5AI8A 1XJCA 3CNBA 4RJKA 4P6VF 3VO9A 4ENUA 4U7WA 4E1VA 1AD2A 4KDFA 4O1IA 3IAFA 1EVYA 3CSDA 1Y3FE 3N5CA 3PGA1 4WCVA 2BKVA 4A8TA 1YZYA 5LA6F 3WWDA 4F6CA 3WXMA 2DGDA 1VSUA 2H85A 1AY0A 4CJXA 4CLEA 2Z9CA 3K4HA 1GFZA 3EMDA 3BCHA 1ZI9A 3DZJA 3PC4A 3GG9A 2VTEA 4BGUA 4RADA 1RCUA 1S3GA 3K71B 1VA5A 4N47A 4DXHA 5A0VA 1M73E 4ZO4A 2YS6A 3UHOA 1QF6A 3RADC 2OCKA 3GH1A 1T3SA 3UA3A 1T3LA 1EGAA 4CHTA 5H82A 2ZB4A 4CKYA 1X87A 5LLSA 4BRSA 1OKKD 5G1OA 5MFZA 5KVSA 4UHCA 5DIFA 4ZI7F 3VPSA 4OM7A 3GFVA 3EJWA 2OV3A 1KPIA 4RKRA 3GJSA 2ZSUA 2XNDD 1JJ7A 4R8MA 4KR9A 5J2UF 1Y1RA 3N05A 4EJFA 1MAVA 1QLWA 3LHSA 4L95C 1R6XA 4WN9A 5IYZF 3ZHXA 1S2IA 4UUPA 1JFFB 2O2ZA 1W44A 2X4DA 3AIIA 4MA0A 4ISCA 5IMSA 2YCLA 5EP3A 2WHPB 1KVTA 1E61A 2ZTHA 1H0RA 4HN2A 2VP6A 4M4SA 5JSHA 1DAPA 2DQ4A 2Y66A 1GFWA 4Z7JA 2HLDD 2BMFA 4COOA 4IXDA 1M2FA 2JLQA 4LZOA 5CIYA 2ZSBA 3EISA 1QO0A 1HMPA 1YC5A 4BIMA 1DRVA 4OIFA 3RRFA 2CVFA 3I76A 4KBYA 4MYUA 3QI7A 4CTJA 3F9CA 5LDDC 1VKOA 3KJIA 4LRSB 2AXPA 4LMPA 3H83A 3DZBA 4UU1A 1C3JA 1QYVA 2CSUA 2XHEA 4KFUA 4XB1A 1CEXA 3L07A 3ZX4A 3JQ8B 5JVDF 4UVGA 5BWCA 3MJFA 4II3A 1WHTA 2DFLA 4PHFA 5JJLA 1OXVA 4X24A 3HA3A 5ALSA 3SU8A 1I3MA 1VLLA 1FSFA 1Y7HA 2H1LA 5B6PA 3K8YA 5G0TA 2D7CA 2QSUA 1IBKB 4IDOA 1UDCA 2HNBA 3UK6A 4V03A 2POQX 3WGHA 1O97D 3MUNA 1XZHA 5BN3B 2JFNA 2WOJA 1EFHA 4ON9A 4TQGA 1JLLA 5G1PA 2AD5A 3HB5X 2R6CA 2QTVA 4YTEA 5FR2A 4DKJA 2IH4A 1L9KA 5AKEA 1Q0HA 3ANYB 3JQ9A 4L08A 4RHYA 5KDLA 2P5YA 4FIDA 1E9AA 1U8YA 3AC0A 3KL2A 3QUQA 4JDPA 4MP3A 4OMUA 4PEVA 5SZHB 3QENA 4N9QA 4TTRA 3EEQA 1FP7A 5HQ3A 1U63A 5BVGA 3EIEA 3I4FA 4UFOA 1QH9A 3EF0A 3NTQA 4XDZA 5LQRA 4KE9A 4Z4HA 3LFUA 2OFWA 1XKXA 2JGMA 2NTNA 3FGNA 4RL6A 5IF3A 4YASA 1A7JA 5BR7A 3B52X 2HQOA 4B5KA 2HJSA 1ZMOA 3D8SA 5BN1A 1TPZA 1QIEA 2PLFA 3KKEA 4INPA 1CLUA 2F43A 4EZEA 2RAVA 3P97A 4NAHA 3W9BA 2PKEA 3GJ4A 3SFZA 2JIZD 1LBTA 2QRZA 1KZ7B 1J09A 1HORA 5A5GA 1CQZA 1XZBA 4HXEB 4MYRA 4A2PA 1E0DA 1GL6A 3UGQA 2IEDA 4WI1A 3HR8A 1FFHA 5H3HA 4A23A 5CR9A 4XM0A 2Z9DA 1X3SA 1BVYF 3HEAA 2CVZA 1B2RA 1QO9A 3COWA 1I6KA 3NOQA 1EP3B 1EUDA 4RPGA 4DG9A 1TT7A 1YIAA 5EZSA 3PEFA 2CVOA 3KK0A 3G5TA 4OJNA 1ODIA 6ADHA 2W8BB 1QRRA 1NKVA 1RU3A 1ZXBA 1XRLA 3HDJA 3KKZA 4HGNA 4R0NA 2FWBA 3EDOA 3W8DA 5J47A 5EJGA 1RHMA 3H75A 4ERNA 2CD9A 3WJ7A 4ESOA 5CD1A 3L7BA 3OPNA 5FULA 1F0YA 4IS3A 4ZHQA 1ZD1A 3DLTA 4FOOA 4FYYA 3WO0A 2Y1KA 2I2FA 2UVDA 2BELA 2ZRQA 4EENA 2N3ZA 3HBNA 1OTYA 1ETHA 2ARKA 2A0YA 4XOIA 3J81k 4LV5B 4K9QA 3KO8A 3PTLA 4QL3A 2DHQA 1AN9A 3W5SA 4B6JA 3G8YA 2MYUA 2QJTA 3ETCA 4QDTA 5BSUA 4PG8A 1YHYA 2QI9F 4FX5A 4L4UA 3ZZUA 4AT1A 3HGQA 1HNNA 1NN5A 1KH3A 2P7IA 2HA7A 2D2EA 3AUFA 4X9XA 5E6UB 5EIOA 3EEFA 5AVKA 1PFWA 4C7OB 2ORED 3QKUA 2I3GA 1IJKA 2WTXA 4PXAA 1Z4MA 3FPEA 3SI7A 1D2RA 2JJ2A 1FBTA 2Q3CA 1VHQA 3D5TA 5EN4A 3A6HA 5G3ZA 5BN5A 1FUYB 4HNQA 2X40A 5FCDA 3CKMA 3EOBI 3HXQA 1YJXA 1UFQA 2BFFA 5JISA 1GCOA 2Q5QA 3EWNA 3W5IA 1DEOA 5A05A 3AFIA 4UE2A 3C4VA 5A1JA 1AB6A 3AGPA 4RHFA 3V97A 1MVNA 4KO4S 4OA5A 2OXEA 3TPZA 3K0CA 1ZCAA 3VMMA 3TIGA 1KK3A 1NATA 3PIDA 3GHYA 3STYA 3IUJA 3UVEA 4M0DA 2ETXA 5K0LA 3P0HA 4JSYA 5CFNA 1DRWA 1UFOA 2P9FA 2VQDA 3NOOA 3N0VA 4G07A 1Y1KE 1UMKA 5D00A 5LUAA 3HJRA 5EOVA 2N0SA 3EXEA 1BE8A 2D1SA 2FN8A 5L3VA 4ZZ0A 2IX3A 1OV4A 1ZOIA 4D4JA 5KDOA 3LT5A 4EEZA 1VI5A 4U7JA 1LSUA 3WRXC 4TL8A 2IKQA 5IS2A 3TZLA 3Q5GA 4CCWA 3KYIB 1MFPA 1EA7A 3K9WA 4EB8A 5KTPA 3L4KA 4G4SO 2DY0A 4JWKA 4RANA 2GDJA 4W7HA 4ZQBA 5B58T 3CUTA 4D0RA 4DEVA 1LI7A 1IQRA 3E05A 2PGAA 1YQEA 3KXKA 1RT9A 1L8AA 3OJEA 4MWBA 3T3GA 4RM2A 4HMPA 4DIUA 1LPPA 2JAPA 1T8YA 2HHHB 3JV7A 3GN2A 3QVJA 5EJ9A 2C7RA 4AKHA 3U26A 3LCUA 1GVNB 3T3PB 4FKZA 4OXKA 3L49A 4IIBA 2EU8A 3AWIA 3FBGA 2Z2ZA 1Q6ZA 1KY4A 4TKVB 3MN1A 3DH0A 1B8VA 1O77A 2XCSB 4DL9A 4HO1X 2VDRB 1GRVA 2FR8C 2GYVA 4YPVA 5CB4A 3RAEC 2ZU0C 4A8JB 3EASA 3FPFA 4M1TA 3FFXA 1D2NA 1NVKA 4J0GA 4IIUA 2JJMA 1S3FA 4EHBA 1W4BA 3AFMA 3PXEA 4GEKA 2D2VA 5LIRA 3ZZ0A 5GAJA 2J3DA 4NH4A 1QHEA 2RHOA 3DL0A 2WYVA 2P9HA 2K5UA 4MUXA 2HQBA 5I48A 1Q1ZA 2H1IA 3JWIA 3EC2A 5E7IA 3VHRA 2YHIA 3VH2A 3G0DA 1R1DA 4BFLA 4EBFA 2I80A 4PLFA 1E2NA 2SECE 3AEQA 1ZJZA 1Y1PA 3MC1A 4RFSA 4A10A 1VCNA 4W1QA 4KPYA 1OX4A 2CXHA 2GX6A 3E8SA 4O2RA 3D0RA 7AT1A 1KO4A 3KS9A 3M6AA 2FKAA 3FYTA 2EFDB 1FS6A 4YJ2F 1WW2A 3T7KA 1S2MA 4LJ5A 3CUUA 3ZTTA 3TOSA 3VPHA 2ZYVX 2ZU6A 3EXFB 3O26A 4ARZB 2RHBA 5TB5A 1ENOA 2BDUA 1N6OA 2R47A 5C7IO 1WMFA 4TV8F 4Q3LA 4ADSG 3GAMA 1QUFA 1XU9A 1ULBA 2VQ3A 3ABSB 4R3UC 5CP8A 4OMDA 2XRYA 4NF2A 2QDXA 3HRHA 3DE7X 2FP4A 3RR2A 1SU7A 1TM4E 2GCOA 5IAAA 1NBIA 3GRZA 4Y9TA 3W2TA 3V33A 1AX9A 3HJFA 1ZH4A 4ZVSA 5JZ9A 3JCZA 3LRPA 3IALA 5C3UA 4B85A 3B1JA 2P9QA 4HUQA 3UA4A 4CTOA 3G5UA 2PT6A 4FMDB 3IOYA 1ORHA 3IOBA 4GC9A 1JPNA 2EX1A 2G04A 1SNYA 2D5IA 2QTLA 3LJKA 5ALLA 1YB2A 3EDCA 4AP9A 1A9XB 1V3UA 3VR2D 1ZG3A 3KQUA 3NWPA 2JVKA 3ACCA 3CPEA 1MJ5A 4OBXA 1XCOA 2GK4A 4WESB 2GJ9A 3H8SA 1YVDA 4HXFB 2PKCA 3PHGA 4C0AC 1NW5A 1WZCA 3A6KA 2WE7A 4CKCA 3IP6A 1NOJA 1NUPA 3MWEB 4IJUA 3R20A 1L7XA 2A1TR 1E69A 4EA7A 4D9NA 4FMCF 2PGOA 1QWOA 5EMLA 1UPUA 3ZR4B 3V3KA 1E9SA 1LFAA 4LOAA 1SQ0A 4MI1A 1W85B 4JJFA 5KC9A 1GKUB 2EXXA 2Q7OE 1V95A 5BWNA 4M7PA 1J2YA 2B20A 2QVXX 1PDVA 2ZIUB 1HE2A 4JR1A 1PT9A 2FZ4A 5E7QA 5JARA 3FOCA 5AR1A 4C9BA 3OM8A 4MYHA 2C9CA 1RRKA 1OBHA 2R6ZA 3AUTA 2YVUA 3CRVA 1HUQA 1C1HA 3PHIA 4IIGA 4ENTA 1QK4A 1H1LA 4KIJA 4LOKA 2V7PA 2UZAA 3CPSA 5FADA 3VR6A 2GO7A 1NU6A 2G76A 5BW5A 1NZJA 2WSBA 5HE9A 3DULA 3Q6NA 1PT7A 4KMSA 1L7QA 1S8FA 4IIVA 1E0KA 4M0UA 3TXAA 3VTAA 1KXJA 3IMCA 1D4AA 2WF6A 5EP1A 1W7AA 4IHJF 3U19A 1GQRA 5IK2A 3A6GA 2XQVA 4H7HA 1NMSA 3BREA 3L1JA 4CXMA 4OYYA 3AVWA 1JHVA 1XFAA 2O4UX 3HCEA 2VCEA 4UULA 2Y1LA 4G1MB 1Z6TA 3ZHOA 1NJ1A 1NN3A 3OZWA 3ZHTA 5IKEA 2BTOA 1IHPA 3DLBA 1FPMA 1ONBA 2GOYA 2F7SA 2P4HX 3D6AA 4Q4DA 5JFGA 4I9GA 1E9BA 4KACA 1U0OC 3BM5A 3FTQA 1WXQA 4Q4JA 4UE3S 2QRNA 3VSAA 5SZIA 4MKRA 4LNUB 1VPEA 3OCZA 3M6MD 3V2UA 1HFKA 4DYHA 3WE7A 3UWOA 2LE0A 4JJGA 1Y3DE 4PYJA 5KMGA 1MJGM 4JT8A 3AQIA 4ETIA 3HY3A 2E4UA 1D4OA 3N8KA 5F76A 1MW8X 4I5IA 3L7IA 2FSFA 5BSEA 4RXMA 4NMHA 3C97A 3ADPA 4LHSA 5KTNA 4PN7A 1JVBA 1AKEA 1Z5WA 4K9NA 3Q0EA 3WJAA 1RMQA 1RQ2A 1XTIA 3FNHA 4JCCA 1ZJ6A 4JB8A 2GUGA 2ZT5A 3DFMA 2OXRA 5AKGA 1ESZA 4FFPA 2QUIA 2P6NA 1S4MA 3RTAA 3QE3A 4PV7A 4QOIA 3V4RA 4E3ZA 2ZT6A 3D3EA 4KE7A 4PLVA 4RGBA 3LOUA 1EPUA 2V4MA 3OWHA 2RGDA 4HRAA 4IRMA 4YAEA 4BB6A 1VJ1A 2ZE5A 4YCLA 4JJZA 3HWSA 2CNNA 4WN3A 1JMKC 4LDQA 3X0DA 3LUHA 5LPNA 1GUYA 1CJVC 1J2RA 2OCBA 3CLRC 1CUUA 1OZAA 1U3TA 2LR0A 3OBBA 3RBVA 5C7LO 5H9WA 4XWTA 2E5FA 2I2XB 2PX0A 1FSSA 2MYPA 3I6QA 3UWMA 4CL2A 4HH0A 3ZXYA 4RJIA 2NXJA 4YDHB 3NFRA 2HA6A 1Z7EA 3NHRA 3GLGB 4BV2A 1FJ2A 1DRKA 3O31A 4PR0A 2CYAA 5AHKA 1H2AS 3KJFA 2N9UA 1LDNA 4PAWA 4Q4HB 5HEKA 1LFDB 3DMTC 3UFXB 5IKXA 1YZLA 1SXPA 2I2AA 2ZQ5A 4PONA 4ZT3A 1UC4B 4DQKA 4X45A 3MWDB 2BH9A 5ANRB 4UPEA 1A7AA 5A06A 3C6QA 1UQUA 2J3QA 3BF8A 1W0JA 2BM1A 5ESXA 2PUFA 1SVSA 3VHXB 1RP1A 3ZWYA 2FPKA 4GGPA 4ZHSA 1NKTA 2YWGA 5A3QA 2EAUA 4H4CA 3DF9A 1G6HA 1QQ6A 4HNGA 5IG2A 5E1MA 5ALNA 3EGXB 1WEHA 4BFZA 2PX4A 2HU8A 2WG2A 4B3RB 3NO4A 4U9UA 1KBZA 4F3CA 3SR3A 1Z36A 1BU8A 1GKYA 4GMXA 4B47A 1BN7A 2WHQA 3RUAA 4OD0A 4XQCA 4LDPA 1R18A 1I32A 1LZKA 3AY3A 1SKMA 1Y7IA 1Y3CE 3L0IB 3OH8A 5F35A 4QREA 4HWRA 4MKGA 4YV7A 4BQOA 4BVLA 3RC8A 3OFVA 2C5AA 4KXXA 2BFNA 3SOZA 2IOHA 3O0DA 1ZP6A 4G8JA 4ATNA 3GT4A 3BPSA 2QRQA 4I6EA 1NI5A 5K3DA 1QCCA 4O4IF 2OAP1 3JALB 1KMNA 3AJEA 4MQBA 4MVJA 3IILA 4P5EA 1Z6ZA 4TRRA 3EXHA 3RC3A 2JBAA 1H2HA 2E6UX 2PXXA 2PRJA 2XMPA 3I34X 2GLXA 3G02A 1RI4A 4FPXA 4MVYA 4X7PA 4G81A 4BLSA 3DDNA 3TLJA 1T0PA 1YOVA 3IBFA 1FL9A 5TQ0B 3S7TA 3V4PB 5HGXA 4MS1B 4E5PA 4TT3D 3K0AA 1DKNA 2P2SA 4WY8A 3IVCA 3CKLA 3W4IA 2NNLD 3CF6R 1H65A 5K3FA 5AK3A 2GKSA 4EHIA 5D5QA 4KDEA 5IC4A 4GKVA 1C1YA 5EJMA 2G28A 2LGJA 2AJDA 4FR2A 1WKVA 3BGDA 3NBKA 3TIXB 2O8BA 1V1RB 4ZAFA 1EP2B 3VYRB 5KS2A 4DRZA 2CT8A 3INGA 2H5LA 4CIAA 4GQBA 2IZ7A 3AG6A 2CEKA 2ZJOA 3RHTA 3LLMA 3V4VB 4NU6A 4AJHA 3JARA 4IGKA 3FJ1A 3LZDA 4LBYA 1ENYA 5TT1A 2IVZA 3GEDA 4BO0A 5F7ZA 4BZZA 1AQUA 2GR9A 1ZH8A 3O9VA 4NJMB 5E3IA 1MMFB 3T4EA 5A3RA 2BYTA 5D86A 5K6TA 4DR4B 3B3GA 1P80A 2PZFA 4J1TC 4GR9A 1CULC 3HVRA 4CR7A 2IDKA 2W6JA 1V8ZA 5FOSA 2C5LA 2X9QA 2ENWA 3DEYX 5E8JA 1ICEA 4F3KA 2H6EA 2MSNA 3LUCA 4HDNA 4UBOA 4CYMA 4NENB 2DR0A 4BHTA 4ZYZA 3AVUA 2A2ZA 1IN4A 2GM3A 5HJ2A 2C5BA 2F3SA 2PSSA 3KT0A 2QXTA 5LQSA 1VYHA 3OIUA 1E79D 3AONB 4XGKA 3ZKAA 4ALNA 2V1XA 2BTQB 1NUSA 1G8SA 1E7WA 4FN5A 4N3AA 4Z4GA 2QUAA 4D42A 3DVLA 1JECA 4U8HA 2FV8A 5IM5A 2WHRA 5HIAA