4QJIA

Crystal structure of the c-terminal ctp-binding domain of a phosphopantothenoylcysteine decarboxylase/phosphopantothenate-cysteine ligase with bound ctp from mycobacterium smegmatis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
229
structure length
212
Chain Sequence
HHDMAGVKALVTAGGTREPLDPVRFIGNRSSGKQGYAVARVLAQRGADVTLIAGNTAGLIDPAGVEMVHIGSATQLRDAVSKHAPDANVLVMAAAVADFRPAHVAAAKIKEPSSIDLVRNDDVLAGAVRARADGQLPNMRAIVGFAAETGDANGDVLFHARAKLERKGCDLLVVNDGWLLSADGTESALEHGSKTLMATRIVDSIAAFLKSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the C-terminal CTP-binding domain of a Phosphopantothenoylcysteine decarboxylase/phosphopantothenate-cysteine ligase with bound CTP from Mycobacterium smegmatis
rcsb
source organism Mycobacterium smegmatis
molecule tags Ligase
molecule keywords Phosphopantothenate--cysteine ligase
total genus 62
structure length 212
sequence length 229
chains with identical sequence B
ec nomenclature ec 6.3.2.5: Phosphopantothenate--cysteine ligase (CTP).
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04127 DFP DNA / pantothenate metabolism flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CoaB-like 4qjiA00
4QJIA 1U7UA 2GK4A 1P9OA 1U7WA 5INTA 1U80A 1U7ZA
chains in the Genus database with same CATH superfamily
4BNJA 2IHKA 2D8AA 3LRTA 3NHJA 1VIDA 4K6KA 4HEJA 1FU8A 5FBKA 2H2FA 3PFHA 3I5UA 3TM5A 3L8EA 1L4FA 3GH1A 1DEKA 1V3UA 1E9AA 5C8VA 4LJRA 3UJ9A 4C4SA 1TU4A 1NXPA 3LUHA 1ACLA 3M6IA 3SPXA 2CDBA 4EUHA 1YBFA 1QFSA 1O9BA 1EG2A 4M37A 3HCDA 3C4QA 2GTHA 3V4ZA 2HRBA 2JDID 5EQJB 4M0MA 5AVWA 4D0NA 4N6OA 1QAOA 2Y0BA 3HN2A 3JWEA 1FPQA 1GA6A 4YX9A 6NULA 3KLNA 4JZKA 3HY4A 5A7HA 1EJBA 1CUHA 5TPWB 1O4WA 4H4CA 4F3RA 4EG3A 4LN1A 1AA9A 4TVSA 1SCIA 2HLDA 5K0CA 1QGAA 3KQVA 3VKHA 1QYXA 1WXFA 3E9NA 1KPGA 1RFLA 2QD4A 5EA2A 3W06A 3TI9A 1X86B 1K5PA 2NADA 3BBLA 3F2VA 4EVQA 4KWIA 3NM4A 2YKGA 2DR2A 2QM0A 3N2GB 3UPUA 1RAIA 1TYDE 3E22B 1N1EA 4FB4A 5CAEA 1ORDA 4QULA 1W85A 1GT6A 2JCGA 2DCMA 4J0FA 3LWBA 2A7QA 2X86A 4FYYA 4ML3A 1SHKA 4PBTA 3TR0A 2JANA 2OBFA 3OZXA 4LECA 7MHTA 2R6GA 1RACA 3OE5A 2OKCA 2P9QA 5DX8A 1X19A 1XNQB 2ZUEA 1VJCA 4HN2A 1PW5A 3B2QA 4RX1A 3IAUA 3LZDA 5FWXB 2L82A 3PQ3A 3KRTA 3K5PA 3VU0A 1ZK0A 4OM7A 4C0BA 4UMEA 5EIBD 1YK0A 5EJ6A 3PC6A 1Q0QA 2AOTA 1PK9A 2G28A 1I9GA 3R9IA 4JJIA 4EHBA 4AJPA 5THKA 1JXMA 1XTRA 4X61A 1U9YA 3K4PA 2AK2A 4Q3NA 4BX9A 2IE0A 4EJSC 4UBKA 3RH0A 5K4GA 3NAGA 1WXDA 3EIFA 5EE3A 5L3QA 1PSWA 1ZFNA 5FPTA 4AURA 2X76A 4CKEB 2VJBA 2J6IA 3JWIA 5FWYB 2YUIA 3V7WA 4B3FX 4BQPA 3LC2O 1BOOA 4M87A 5G02A 4LPKA 4B44A 2YJ4A 1XZLA 4I9NA 1UMCA 3IDFA 2NPFA 1IB0A 1JG1A 5K6TA 4ZVOA 1V2HE 2BSXA 3CRW1 3TOVA 1CK4A 4TMFA 2PBZA 1D4AA 1TC1A 1D2RA 3A1EA 5CURA 1IBKB 5LBUA 1KMHB 3KDAA 5KTKA 5LQRA 3MXOA 1S0UA 3UJCA 1KS2A 3IOEA 4S1OA 1XQVA 3MJHA 4NV3A 5DZSA 2O23A 4AMZA 2K7FA 4Q1DA 2C4NA 3CGWA 2AN4A 2JFWA 1A8IA 1BVYF 3B1VA 1KZ7B 5ECGC 4MR8A 2Q49A 2Y77A 2AX4A 2FKNA 3BRWA 2GZHA 5KSOA 1VJGA 4NXNB 4XWAA 2QTAA 5HUJA 2WD7B 4WN9B 2CVQA 3L4BC 3VZBA 4HDMB 4RQUA 1A8PA 1Q1NA 1H2EA 3NEJA 1XLTA 3G89A 3QFRA 2PQ0A 1HT0A 2A5LA 1DXOA 2JHFA 4JLSA 2AFHE 4MLCA 3HU5A 1O77A 3IX7A 4CMKA 1YXMA 4PHTA 5K45A 1V8DA 1ZP6A 5EHXA 4YP5A 5LFAA 4R3UC 3D31A 1B14A 1G8KA 2ONKA 3IR7A 5LPNA 4AB1A 5JMOA 3N1UA 3CE6A 4GXNA 3KZMA 4MNTA 3EX7C 4X60A 2EX0A 1WDLA 1LJ8A 2YYZA 3R6LA 4MQLA 4H7JA 2O2HA 4JJZA 5HA5A 3F49S 3AERA 3ZTTA 3MTDA 4WK0B 1SU4A 4Z1MA 4CR6A 1DJMA 2XQFA 2J4FA 3CUVA 4R9SA 4B0PA 1GNQA 5AIBA 3I2GA 1QFZA 3MJ4A 4OYHA 4OYLA 5EFOA 1EFPA 1H3NA 3R7WB 4E1VA 1L4MA 3RK4A 4KITB 5LOVB 1Q1BA 1UOEA 2CXNA 4F5YA 3HDYA 3ROQA 1SZCA 1DJOA 2A78A 2OM2A 4MWGA 1MRSA 2F4VB 1AKQA 1IY2A 2VAMA 2ZI5A 6ABPA 2HI0A 4JQYA 4JP3A 2E49A 1DUIA 3NEAA 3PQEA 4KMMA 4HGQA 4RTPA 4I6EA 1VYUA 2VHEA 1JYFA 1M2FA 2ZRPA 4CYMA 4E70A 3GFVA 5KYYB 2O5EA 1O0SA 1ZC3A 4I4CA 1PL0A 3NNDA 2FQXA 4MVCA 4Q19A 4WN3A 5H8WA 5ETJA 2XB8A 5C8YA 1CR2A 4NH4A 1IUPA 2JJ2A 2OYSA 5FBHA 3AJ9A 4MV9A 5FBZA 5IN4A 1U02A 2C2MA 2OLJA 3CS3A 3DAHA 1P5FA 5KBYA 4TRJA 1RJFA 3T7JA 4A8JB 3F96A 1YKGA 1BDIA 1IULA 3NKLA 1QR2A 4NU6A 2PL5A 3KZVA 4MVYA 4WFIA 3UMVA 4O1HA 1A71A 3TDKA 1QBGA 2XXBA 3X2FA 2OGTA 4RKWA 5B3KA 3IAS6 4QDTA 1QC5A 4RJ2A 2ACVA 1CUBA 1L4LA 4PYQA 1USWA 1NDUA 3OZFA 2GT1A 4HHEA 1N1MA 1G2OA 4DLBA 2QX6A 2PMFA 2ZPAA 4G8CA 2OKGA 3TGLA 3UWKA 2DG2A 4JZYA 1JFVA 4QBTA 1ABBA 3CSUA 1C2YA 1PJZA 3G9UA 1XCGB 4PLGA 4F5DA 4UTOA 1X9HA 3GGDA 3C7DB 1RP7A 4OOFA 1RBZA 3X43A 3ZU6A 2UXCB 3GCGA 2NUTA 3WVNA 2NO5A 1ZVQA 4EMSA 1V25A 4YV1A 1I7DA 1FU7A 2ACEA 4GQBA 4KKVA 4V0MA 1IXKA 1MOQA 1VLHA 4I9FA 1S8FA 4PXYA 5DXAA 4RO0A 1W0JA 3V55A 4ZAXA 4KO4S 5DK4A 2PGIA 1VTKA 1HTTA 1L8AA 3ZHZA 3EEYA 4JH0A 1PL8A 1UK9A 1ZL2A 3IMFA 1POXA 2H07A 4YONB 4E6EA 5AUNB 2A9JA 3I1JA 4BMCA 2JARA 2SCUB 1RXUA 2LUOA 4CN8A 2WAOA 2WJJA 4BE7B 4R54A 2GS9A 3V8PA 1C8LA 5F77A 4O3MA 1E2MA 4J43A 5DO9A 4EFMA 1QVRA 3I9KA 1J9ZA 2BGLA 2YXPX 2OK7A 5D86A 1L3IA 2QUKA 3DL2A 5IXSA 3UYLA 3OIDA 4E2FA 1ZW1A 2YQ4A 3M3DA 1W96A 3G0DA 1UMCB 1UXOA 2YMQA 4C3OB 1KU6A 4II7A 4Z51A 1FTQA 5FA5A 2FW1A 4GX0A 1E6CA 2ECQA 4J0JA 1P62B 3O8NA 2AI3A 5BQ5A 1JEAA 1ZWLA 4R9NA 1O3YA 2C2OA 4F3YA 3WLMA 4H7FA 3HU2A 1G60A 1NI4B 1U3VA 3EZLA 3FR7A 1YZHA 3EASA 3N2YA 2XADA 2BDTA 2IY9A 3GUUA 3ZK8A 3UGQA 4P8RA 2WE8A 3QNWA 2ORYA 2D00A 3EVFA 5JDIA 4R51A 1OA0A 3QU5A 4I55A 1IK6A 1U9CA 4FGUA 1MX9A 4KIGA 4LRTB 1YOBA 3TLAA 4KFCA 4O2BF 4YV0A 1D2MA 3VNRA 1AU9A 1NLUA 4YRAA 4YB8A 4EPYA 1IEWA 4OQMA 3HZRA 1L7EA 2VJKA 4PZ9A 1TZJA 1U0FA 1M0EA 3SR3A 2JZNA 2EOAA 1Y6RA 1ADCA 1QZXA 4G1CA 4JT9A 4QNRA 5AVTA 3DE7X 1ULSA 4IIHA 1DJQA 1O94C 4HNRA 4D9KA 1CNFA 4QTUB 4OTZA 1FYFA 4TS3A 1YA8A 2JHAA 3I12A 3JD2A 1SC6A 3IB3A 1U0JA 2IEZA 3DC7A 3ZQ4A 6LDHA 4MQFB 1LC0A 2B4QA 2CZQA 3MOIA 4H77A 2ODBA 1IY9A 3MGAA 1F0PA 3MWDA 1GGKA 2K4MA 3IIIA 1GPDG 2RH9B 1KDVA 2GPWA 4G86A 3U7IA 5FB3A 3PEFA 1F06A 4XCXA 5K3BA 2WP0A 2NWQA 1I32A 4US2R 3BRQA 1OXTA 4XM0A 3AONB 2Z6VA 1MGOA 1B43A 1Z68A 5EP2A 3R7WA 2XUDA 3Q1KA 2J67A 2QPOA 4B3SB 2O8BA 4JI4B 4KX5A 5CB4F 2RIRA 1YH3A 5WRFA 1YZFA 2AKEA 3VKFA 1TTHA 3FVTA 3QFFA 3ZE1B 3ORFA 5BSKA 4MVJH 1ZQ9A 3N8GA 3RK1A 1CRZA 1YB5A 2W6QA 4UBMA 1G38A 2XF2A 4LKOA 2ZM5A 4MUFA 1QIIA 4MUEA 5HOQA 2FXIA 4FFBB 2DYKA 4KBGA 1U5BB 5GM1A 4ZYUA 1C7RA 3T1YB 4R2WA 1QTRA 1EJ6A 3CJTA 2AA3A 3LY8A 3IBTA 4LYHA 3FPCA 3WA6A 1FDSA 3AQ4A 4YT5A 3FIJA 2VTEA 4ZU1X 2PVCA 4FCCA 4FX5A 3D1JA 4FPXA 2GM9A 1RJ9B 2PLAA 2VXCA 2ZAOA 3D7LA 1XF1A 2XAUA 1ZD8A 2QTVB 3EODA 5ELMA 4C4TA 3GEIA 3VTFA 3UAYA 1IQ0A 3LI2A 1PJ4A 2JASA 5C5IA 2DETA 1CUGA 3L8ZA 2DWPA 4YALA 4A92A 3O2JA 4BEWA 2R8EA 3FKJA 1LBHA 3UHOA 4XARA 4L75A 1H6DA 1VCHA 4GPEA 3GEDA 1A4IA 3BWVA 2R8ZA 2Y1WA 2IUSA 3MWYW 5BV1A 1K98A 3A2KA 2XODA 2SCUA 1B7GO 3IP9A 2CJYA 2I3DA 5IMSA 2M6RA 4RFVA 4J1TC 1UPTA 1KI7A 3LCJA 1Q0PA 4JOSA 2Z09A 4WESA 3BE6A 3QEKA 3RUHA 2DFTA 2WEKA 3B51X 2ZI3A 3BULA 4N3AA 2UXBB 1FNBA 4BQEA 1T5IA 2K2QB 2FWRA 2MT9A 3BZUA 3O95A 4L02A 3RS7A 3LHSA 2ZPTX 3OEYA 1PJSA 1SKQA 2C83A 3IE1A 3GQBA 4DLKA 4W6ZA 3WB9A 1TQ8A 3DTNA 4GVXA 3VHXB 2VJMB 4AL4A 5DW0A 1UPUA 3VR5A 2AEMA 5FOSA 4CR8A 3AVXA 1KWKA 5HEKA 3T3GA 3EA5A 3KM0A 1B1AA 2HIAA 3OKFA 1WSBA 2JBAB 3JQ7A 4RAOA 3IUNA 3KZNA 1HZZA 4YK7A 3RBXA 1NNEA 1NKSA 2BBTA 3A6EA 4DNQA 1S8AA 3JVDA 3TPCA 3A0RB 1KZ6A 1UIMA 1T2NA 3E2MA 4N7BA 2RB4A 4R68A 1LZLA 4TXMA 5F7JA 5A05A 1Z18A 3R0ZA 4XDGA 1T4BA 3MA0A 1NJGA 2XYVA 4CMJA 1MO2A 1T2VA 1BCSA 1YD7A 3UOAB 5AKYA 3IEMA 3FFBA 1K97A 3S8MA 1G5TA 1N75A 1BCSB 2W2LD 3BC1A 1P3Y1 1WDTA 1DQRA 2AC7A 1PD0A 5KCMA 4J49A 2LCQA 4N39A 4N9WA 3F4LA 3AR7A 5DMHA 5HQTA 3R7AA 4KXYA 1F0KA 1RYZA 1ZGHA 2WFZA 4MSUA 4HNTA 3THXA 1ZMBA 4JL5A 1XRLA 1GUBA 1RWNA 1AUOA 1VKHA 2AVNA 5K03A 1U9ZA 3EJ6A 4QE3A 3KTFA 4UJ5A 2BV3A 1ULHA 2VJAA 1T9GS 1DKRA 4HWPA 2XIJA 3Q9NA 3QF4B 2ABWA 4R98A 1ODSA 1OLOA 1VL2A 4ND5A 3U7EB 5L51A 4JOQA 4DA7A 2WG1A 1VHLA 2XNSA 2EIXA 3BCHA 4TSFA 2V97A 3D2LA 5EGNA 2AR7A 3LGXA 3GLIB 2FUNB 2PXXA 4F06A 2CDNA 2GN0A 3I53A 5DM1A 1O87A 1OU4A 1OY1A 4HB4A 5BMOA 5JH7B 1LTKA 4YRZA 3UAXA 4MKIA 2BBWA 1LF0A 1I24A 3LT4A 5T6BA 3TRJA 3TEMA 2NTNA 1YI1A 5CXSA 5AW8A 3SHVA 2HLDD 5K0TA 2VRBA 3KV1A 3QX8A 2IH2A 1JZSA 1YJ5A 2I3GA 5HJ5A 1W35A 3D6FA 4PNPA 3VM6A 1RQPA 2I29A 2Z04A 1XZFA 2B20A 4M49A 4QREA 4UATA 4ZGBA 2NYAA 5JV5A 2O8VA 1SXQA 2WM2A 4OQXA 2CUZA 2BMDA 2H1IA 5EOVA 4YBRA 3GT0A 4PGHA 1L4UA 1ZAKA 3PXGA 4EA7A 2P9EA 5A06A 5GGYA 1J2YA 2CE7A 1BAPA 3AY7A 5AM5A 5T67A 2YJ3A 1E0DA 4X20B 2FN4A 3M6AA 4RL4A 3D3KA 1LQTA 5GONB 2DY0A 4N3BA 1MENA 2FSSA 1T10A 3UJHA 1NULA 3CT6A 1K27A 4KQXA 1RYMA 4Q3EA 4NKRA 4RA6B 4JLNA 1U0BB 5P21A 3QSYA 2UUPA 3E53A 4Q24A 4YHHB 1L4KA 1SA0A 3HN7A 3U37A 4BJ1A 5KQPA 5HF8A 1J8FA 3R7LA 2IEAA 3OEHD 3VISA 2VHTA 3DWGA 5AVRA 1YS4A 3V4FA 1DC8A 5EIEA 4TTSA 4EKDA 5CDSA 5HYVA 2QTFA 3H42B 1N6NA 4NPAA 3QVKA 3G1TA 4ZXPA 5TV2A 1BWRA 2XDYA 3TX6A 5JYCA 5K8IA 3QVWA 4QJ5A 1IZ9A 1ENPA 3MLAA 2QIOA 4TYMA 2JAQA 2FW7A 2MMGA 4GEGA 4ID3A 2QZPA 3PDHA 2CVFA 2GF9A 4ZO8A 5ALGA 4YROA 3D54D 2EZUA 1V48A 1SMKA 3F7NA 3GW8A 2FX3A 3WR5A 4AC9A 4AP6A 1MW8X 3HABA 3IQXA 5A62A 4NCXA 4IS3A 1H3FA 1ILWA 4J4TA 2QIPA 2X6RA 3ITKA 4NCJA 3C0KA 4MHOA 1Y4AE 4Z4IA 1OIVA 2HA4A 2SKCA 4E15A 4WCVA 2PUBA 4ZHQF 4CM7A 1I7PA 2YR0A 3GEEA 5DGTA 1TOAA 1NI5A 1EXNA 3I01A 3PGA1 4N6NA 4D8XA 5JDCA 4L50A 2UZ0A 3TXAA 1RADA 2LP4Y 4CM5A 3TOXA 3SBDA 2X3YA 3BZWA 3P5SA 2X8JA 3O8OA 2H00A 2A0FA 5K0GA 4U7JA 4TT3A 2JD2A 3C6YA 4JYCA 2W22A 1GSOA 4N0PA 4OBWA 3U16A 3PVSA 2NU7A 4UE3S 4FYIA 3EWSA 5SICE 6REQA 1PP4A 3M4NA 4Q4AA 4IDEA 2Q21A 2ST1A 1W5FA 1MGPA 1XPJA 2ZE5A 1UM9B 3Q12A 3PT9A 4YFYA 1HNXB 3CONA 5CB8A 2HF9A 3VNBA 2W6JD 1BXRA 1XDUA 2GAJA 1BG6A 4LRXA 5D2CA 2HA2A 3L0ZA 5JJKA 4I99A 4WJKB 3T12A 4Z1MD 5LLDA 4K9KA 3FNRA 3RKUA 1RLUA 4GPAA 1QTQA 3MB8A 3MTBA 5EXSA 2P40A 5A0TA 4I5EA 3GUHA 2PD4A 3TZEA 4NF2A 5JSYA 3STWA 3AT1A 2NTVA 3QYAA 4F46A 4R3WA 3ND8A 4DR5B 1SCNE 1YQTA 1HKHA 5JAUA 3DB2A 3L9XA 4E5YA 3ECCA 5FYDA 1OTYA 1OUMA 4WIAA 3LOUA 1PFQA 2IKSA 3JQFC 5B4VA 4E4YA 1GQYA 2XUOA 4J9UE 4ZAWA 3B8EA 4IF6A 2NUTB 3LVQE 3KQPA 4IVPA 4MWCA 4S2UA 1P2FA 4JLMA 3JRXA 5B1IA 2UZAA 4WE3A 4D8TA 3HLTA 4FWIB 5DH9A 5H4HA 4HNGA 2OXIA 4A9AA 2G09A 2C5HA 3IDSA 4GZLA 1RE1A 4P92A 5IP5A 3U3DA 3M1YA 4ERXA 1CYEA 1HQDA 2YHIB 1CUEA 1Z4KA 5DTIA 2BMAA 4Q7KA 4EI7A 1ADJA 2B7LA 2ZYDA 4FU0A 1J2EA 2JLWA 1ZZGA 5IJ9A 3I58A 4OG2A 4EJFA 4QDUA 4V38A 5D6OA 3O7MA 5C5DA 4S05A 4U2DA 1D7OA 4OAQA 1LLQA 4FDVA 3KO8A 3SBEA 3E9DA 3VYRB 2I91A 3MM4A 4RLQA 3DZBA 5BXQC 5I7VA 1OH8A 3REQB 1JDBB 3CLUC 2WU1A 4WZ6A 2J4DA 1F60A 1OROA 2X22A 5K3FB 4GR4A 2P6OA 1TRKA 2UYYA 4RHCA 2BTQA 4WGGA 3UA4A 4OYYA 2ZI9A 3EEBA 4NZPA 2V7BA 4W8OA 4BO1A 3ET5A 1JKFA 1O08A 3AM4A 1NBHA 3DDOA 4GUDA 4QT0A 3L7KA 1FXUA 2GERA 3LQ1A 1RBMA 4WADA 3FBGA 4R0NA 1X1BA 3HO8A 4X8LA 4ZAZA 4BNKA 1T6NA 5DISB 2AMJA 5IDWA 1V7CA 2I7VA 1H6AA 3LWZA 2C82A 1JQBA 5CT6A 4DUYB 3RC8A 3U60B 1G64A 3AZQA 2BH2A 1W0JD 3WZLA 2GPBA 1V43A 4O2BB 1NG9A 2F3QA 1SG6A 3D5QA 2E5LB 1N7IA 2RG1A 2TMKA 2V7VA 3ZDEA 1AMUA 1RBYA 1B0ZA 2GN9A 2BGUA 3MJFA 4B83A 1VJ0A 2VTBB 3PQ2A 3FGNA 4KQWA 3SJ7A 2W2TA 1RHUA 2VPTA 9ABPA 2OHJA 2VH1A 5DKFA 5KTNA 1NMQA 2DT5A 4RA9A 1Z7BA 4PZEA 1XZQA 2DPXA 3DXXA 3LHDA 1N6IA 1FX0B 4X64B 4DAEA 2QJFA 4M6WA 3B9BA 2C5AA 2QPTA 1OGIA 4JVSB 4DIEA 4KH1A 1FW6A 3MSCA 1P5ZB 4NPCA 3CB4A 2ZYSA 3GLFA 1SAYA 1DEOA 3RBZA 3PPXA 1UC5B 3HBAA 5DHUA 1VBFA 2AMFA 5I8ZA 3V9PA 2JG3A 4LF8B 4Z49A 2QL7A 2XTZA 2YJ5A 1O94A 4Z5XA 3FJ1A 5F1YA 2IPOA 5LQAA 2FJUA 1PS8A 5FX2A 5HKLA 1RHMA 2A1IA 3B52X 2RI0A 5AKLA 2FAXA 1XO1A 4WRRA 2C92A 1IG0A 1UFRA 4IDGA 2WUWE 2ZR7A 1QWSA 1XOIA 4JEIA 1KSGA 3TG2A 3PE4A 2EKDA 3NEYA 4NYMQ 3EHEA 1Y7TA 3V8NA 2YXBA 2R65A 2PX8A 3KFXA 1PFVA 2Q4OA 5CDFE 5I48A 8MHTA 2CXUA 4I5IA 1VL6A 4KWTA 4TKUA 3VR4A 2HR1A 1HOXA 1VL5A 2CNDA 4BWGA 3U7QB 4C0AC 3M9LA 1UANA 4M60A 2BOVA 3ETGA 3B9QA 4UHEA 1JTFA 4DB2A 2HHCA 1I14A 2EYUA 2IQ5A 1K2VN 1VDZA 4MR7B 1A04A 4L9AA 3LBHA 5AM0A 3NOVA 4EAQA 4FDTA 3PRYA 4IGFA 2BGWA 2EFGA 4MR7A 1Y81A 4MRSA 1A1SA 5LVAA 1Z9BA 2GVNA 3V3KA 2KYRA 2ZAYA 4JVOA 1FUYB 2NNWB 1CETA 4EY6A 4X1IB 4PHFA 4ZZ0A 5JS7A 5K6AA 2QZ4A 2FFBA 5FYQA 4YT4A 2J3HA 4A3SA 3RUEA 2VYNA 1R0KA 3WWPA 2XWQA 3EW9A 3U3JA 3UPDA 5P8WA 4AN4A 4OHXA 3MSXA 1U94A 4PYIA 3ENNA 1PWZA 4X66B 3BWDD 4H60A 1N5MA 1UKVY 3FTDA 2WIKA 2I99A 2GPSA 2ZB3A 3NDJA 2W2NA 3DVAB 4M1SA 4G2TA 1ZI6A 3RB8A 4D9FA 2V5UA 1R0CA 3FNBA 4NLLA 4MROA 2H29A 2LDXA 3HB5X 4HN9A 5IBQA 4WAUA 5JCJA 2XRZA 1CIPA 3O4VA 5CA1B 3L18A 3R8FA 1C1DA 3B2EA 5DWDA 4YRPA 3NKFA 1UFKA 1GPNA 2O3RA 3NV9A 2B3DA 3L9WA 4HH4A 1OVGA 2X2EA 2J48A 4JROA 3E6AA 4ZEOA 3V33A 1JA9A 2MR6A 4O4HB 3L4KA 2HFKA 1CVRA 2YHAA 1NR7A 4NC9A 2W93A 3EFEA 3GA7A 3TIVA 4ITRC 5A4DA 4LXIA 1AVTA 1RWKA 4HWSA 2CT8A 5L6LB 3T1OA 1IUOA 2C1EA 2XMGA 3ZGZA 3ZGNA 3OKPA 1GR0A 3R0XA 4G1EB 1QIFA 3DO6A 1GAXA 1YS1X 1Z2CA 1Z34A 5A4AA 2X4IA 1IWPB 1H2XA 3NGXA 4HLDA 4J0QA 4YRCA 4JUIA 1Q14A 2JD0A 2QP9X 1U80A 2IJGX 4NG5A 4JP5A 3ZCPA 1KDRA 1WO8A 2FF5A 2FMIA 4P7JA 1SUFA 2YH2A 3RR2A 2DHCA 2J3DA 3RFVA 3RUAA 2WTUA 1P9NA 4WNCA 2VHVA 4FKMA 3UJ3X 4V0RA 4MVJM 3QA3E 2HBRA 5M04A 1NKVA 1KDYA 3UUWA 3FKSA 4MOWA 4GQAA 3R9WA 2VXOA 1JT2A 1IJBA 1KI3A 2B61A 1SVKA 2FSFA 3CZRA 5LA6A 3VKUA 1XQWA 3AIIA 4UNPA 3JZDA 1E2EA 4V03A 2ZBEA 1T8PA 3FI9A 4JBGA 1TFUA 3PNMA 3K94A 1NAHA 3UJDA 5EGSA 3NIBA 5F3DA 5IAKA 3RUDA 5J43A 4B32A 2WWTA 4G1MB 1CS4C 2HA7A 2ZTSA 1AHNA 3INRA 3MQ2A 4RCYA 2A6PA 1BWSA 1UBGA 2F2TA 1VKOA 4FJ1A 2BFPA 4EPVA 1RVDA 4E22A 4AY4A 5KYUB 4UJ3A 3IMCA 2OXCA 2XCIA 2HUPA 3QKSA 4YO8A 4LF9B 4LYJA 1GITA 4M3NA 4EWLA 1NT2A 1Z7YA 3JCZA 4NU0A 4KE8A 2FN3A 3ZY6A 2V1UA 5A4FS 2FR1A 4J0CA 4RXMA 4YMIA 3WRVA 1PR6A 1YC2A 4M8NE 2HEIA 3MWJA 1ZCFA 4UCQA 4ZVSA 3WS7A 1UIRA 2XCTB 2JZCA 2R2GA 1W1UA 2X9GA 1IQRA 4I50B 3DONA 3QEMA 5ALWA 1B74A 3EZYA 2VDMB 4V1CA 1GPUA 3HM2A 3PLRA 4RANA 5KJ1A 2J0VA 4B3JA 1OI7A 4FONA 1OASA 4DHWA 4YCJA 4BRZA 1VLJA 2GM3A 1OLXA 2C7VA 5B1YA 1NSTA 2PMKA 1Q15A 3QWHA 1EB8A 1YZ3A 5I4BA 1QH0A 1XVVA 4HUQA 4FCWA 3T1TA 1JXOA 4MVJF 2EQBA 3RGGA 1XZHA 3OZDA 4MDEA 4DIBA 4NI5A 5CVUA 1PYGA 4ED9A 4M76B 3C6QA 3GARA 5DN6D 4LGMA 1QOQB 2JH3A 1UC4B 1LQ2A 1NQ5A 2HY7A 3LFUA 2BY4A 1LPBB 4GQIA 4PX9A 3GXOA 4WCFB 1TYEB 2FUG6 5I9SA 4H3VA 3R4CA 1IONA 1USIA 3G88A 3OI7A 5HTKA 1P9OA 1QHIA 4NEQA 1KTIA 5JD4A 4I1SA 3ZBQA 1F1JA 1SQSA 2ESRA 2OMEA 1CY8A 1IJEA 5CRIA 5EWJB 3DKVA 4CM4B 1WUTA 1ECPA 1H8HA 1URPA 1JQ3A 3RVBA 1DKUA 4YRGA 2ZIAA 2RHMA 4YEDA 1SB8A 1G17A 1T4CB 3EIQA 2EGHA 3ZI7A 5AM3A 3D6MA 1VL0A 2RCNA 3CHYA 2V3CC 5DGIA 5BMVA 3SJAA 5CFRA 1DV2A 2AXPA 1KMNA 4TMKA 5BNZA 4JUFA 2V6MA 1JZTA 3M8KA 4H6VA 2FP4A 2JB9A 4NESA 3T4EA 3C7TA 1W581 2PK3A 3HHEA 2J8ZA 3IVXA 4QU9A 5IZCC 2HA3A 4Q0MA 3IOMA 1N6PA 1RQ7A 5TGZA 1D0SA 2QRVB 5HK8A 4DCCA 2HMVA 1KNXA 2VZEA 5EVCA 3ERCA 2FX2A 4HZGA 3MTGA 4GBGA 4J1SA 3B6EA 1MQ9A 3L82B 2IL1A 5KOHA 1UDRA 2O5VA 1ODIA 5GONA 2PRIA 3T38A 2JKVA 4XX0A 3WMWA 2CLLB 1BN6A 2JLAA 3BDAA 3HC7A 3TJZA 5SYAA 1BE1A 1OF1A 1NQUA 4JJAA 1KO5A 3GPLA 4CEJB 3S2EA 5B55A 1Y89A 1WABA 4PZ0A 3NAZA 5AKJA 2R1TB 2F1IA 2PXHA 4YRMA 1DFIA 3JS5A 4ASUD 5AYVA 5CFPA 1JMYA 4DXDA 2QGNA 2VCEA 2YCBA 1PVOA 1S9HA 3ORRA 2HREA 1CQIA 5KNDD 5CIWA 3EWNA 4ACBA 1JG3A 4LJKA 4B6EA 2IU0A 1QP8A 4D41A 3OZBA 4GOKA 1LK5A 3HFGA 4ME6A 1RWMA 5IT0A 2YRFA 2FEAA 4C21A 5BURA 1Y0BA 1L7DA 1ZRHA 1GL6A 3DA8A 4RFSB 2XW6A 4B3TB 5DRYA 1QSGA 3G0CA 1QONA 1VL8A 4DNXA 2CXPA 4G8DA 2FW6A 3O5AA 2YN0A 5F98A 1NNI1 3R5JA 2IZZA 3H11A 2NP7A 1Z6QA 4NU8X 1D8TA 3OPVA 4WK4B 2XDAA 3VH3A 1XU7A 2MWMA 4MRMA 2B4YA 1EE9A 3A1UA 4IH9A 5G0WA 4XKJA 2FLWA 4UHBA 4A2WA 4CE6A 4CU5A 5BVHA 3MEQA 4BN0A 1IZYA 3CT4A 5BOSA 5KMGA 3I9FA 3QEAZ 3FTFA 1N3YA 2WV9A 3JW8A 4HAOA 3GRKA 4D97A 4F45A 4A36A 1Z45A 3JVUA 4GWLA 3EXHA 4HQ0A 5FFMA 1K86A 3KJIA 1DB3A 3LSYA 3IUMA 5TE9A 1FQOA 1R15A 1U0HC 3L4BA 3PUZA 2PAFA 4MEAA 1EX1A 2JJ8A 4NENA 1N6LA 1S2GA 4KN5A 4QUGA 2I6UA 1RPAA 2I03A 2R6HA 4BXOA 4WOJA 2JHCA 4KU4A 1MDFA 3HUUA 5F9FA 2W2XA 3OG9A 4MCHA 1E63A 3MYYA 1XB2A 2XLCA 3Q6MA 1MEOA 4IQ8A 4Z9YA 1GQOA 3NHKA 4RNDB 4AJIA 4OAOA 3ETEA 5AFSA 1XWIA 5E7QA 1TO2E 4KAXA 3IQDB 1Z17A 3U26A 2ZLBA 3AL3A 3VYTB 4XIYA 2C03A 2FOLA 1TJYA 3AWDA 1EQUA 4BFUA 2YINC 3N3AC 4B0OA 3SC6A 2H2DA 1NVVQ 1JR3D 4F4FA 3ZJ4A 1KO7A 4Z86A 4RK7A 4GZ3A 1CHDA 2BF7A 2J3EA 4EBBA 2WR8A 4ALNA 2CHUA 1A0OA 5LZ5A 1DV1A 1OV6A 3K9QO 1QP0A 2CNLA 4NABA 2I2FA 5ALNA 3DSRA 4DV0B 3MZ0A 3ZVKA 4LZOA 3WE7A 1EUCB 2IXAA 3H1EA 5AHRA 3HVIA 1Z5VA 2VWGA 3KHTA 1LW7A 3P2IA 4HBGA 3SZ3A 4CLRB 2V55B 2XNKA 1OFIA 4OREX 5EXXA 3ZKWA 4K05A 4OUKX 5K0LA 1XPRA 4B4WA 3QLTA 4B33A 2A9VA 3IYLW 3TSWA 3B48A 3WB1A 1BS2A 2VJDA 4LCEA 3FRJA 3ZOZA 1Q7EA 1E1RD 4D1YA 2QJTA 4POOA 3WAGA 1IXYA 4B9AA 1KF0A 1H5UA 5JNTA 5AOAA 1R5OA 1C9MA 2VA8A 3MAAC 3HVRA 1LDMA 3TG8A 2Q5OA 3VNUA 4K26A 4NZ9A 4UQOA 3D02A 4MKZA 5FLYA 5EJ9A 4ARZA 1I5RA 4DV2B 4X65B 3NOQA 5IFLA 2PKXA 4CUKA 2IP4A 3EIHA 3H4TA 3OCWA 2E3JA 2GF0A 4BX3A 2XNHA 4EEZA 1AK1A 1K7SN 1I3NA 2QX8A 2X6QA 3AU9A 3KJFA 4W9NA 1F2UB 4OHZA 3T5TA 5B2FA 3T5PA 5GIOE 1PLKA 2NYUA 4PLZA 4EP1A 1O5IA 3OQ6A 4R16A 3LW8A 4F04A 1UWVA 3ONVA 1Y6QA 3MD0A 1GAJA 4F4HA 3AERB 1QORA 1NBMD 2AGVA 1BFDA 4IINA 4W4TA 3RVOA 4RJLA 5KUTA 1KORA 4D45A 1Z5UA 4ZIRB 3I9OA 3MUNA 4KTVE 5TARA 5B4UA 3OTQA 4ZOLF 1C1HA 2AZ4A 1PK8A 2FSVA 3KPJA 3LC7O 3LO8A 4W7IA 5DI3A 5EESA 1J23A 2B37A 2F3RA 3LBFA 1GGEA 3G3EA 4DVJA 1T5BA 3OZEA 4YGYA 2QTLA 1DBRA 4V24A 2PFSA 4OXNA 4WN9A 2FDRA 2CLMB 1XZCA 1TJNA 1KK2A 4G5YA 4J29A 2BUBA 4XYLA 1ENYA 2DFNA 1YZNA 3CBQA 4DUGD 5AESA 1ZN8A 1B16A 4JLDA 4HXEB 4KQ1A 4DM4A 9LDTA 3R6DA 5DPMA 5JISA 3ASZA 4TXNA 2WJAA 4PO3X 1BU8A 5BUSA 1E4VA 4QFMA 3SHWA 2GLTA 2PKCA 2V9CA 1Y7IA 3C3XA 4RF4A 2LE0A 2Q7DA 1I5OA 3QOXA 2EKQA 3ACDA 3RYFB 5IKPA 2AOWA 1SY7A 1SK8A 4L4RA 4MV4A 3AF4A 2H0QA 3GRFA 5CPFA 2DLCX 2VHZA 5FV4A 4HCJA 4B3CA 2ZETA 1Y80A 3HJAA 3R44A 5AHOA 2Q5FA 2VLIA 5A6SB 5EKUA 5C2JB 4YUZA 3HA7A 3TEFA 5BUZA 4Z9AA 5F2OA 3ZCTA 4B6QA 4IHJB 2H5IA 4QYWA 4GF5A 3H97A 4CKCA 5HZMA 1Z0DA 4EPTA 3IV6A 1TQDA 2PKRA 3EGXB 2VT2A 1GYPA 4YGXB 3MWEB 2BPOA 2OAEA 1CUWA 2EEZA 1W0KD 2LZ0A 3ZWCA 1R4MA 3DLIA 1JWAB 1T1RA 3F1LA 1I0ZA 1NR5A 1AV7A 1LPSA 2F8LA 2XNDD 2GQ0A 3GNQA 1GPLA 3CTMA 2B25A 2HJSA 2R79A 2QRGA 1NZFA 3I4FA 4HFNA 2IK8A 5BN4B 3BXPA 3A1SA 3AW8A 1GPKA 4GNKA 2VK1A 3E18A 3NHRA 4JR0A 5F64A 5FTMA 1T8RA 4MB2A 5GP1A 3VPAA 1VYTA 1YS2X 1THZA 4Z3KA 3VR5H 4K6CA 3FBTA 4FWTA 2YHUA 3KPUA 4R2XA 4AUKA 5KVVA 5KYWB 1RJEA 4UNSA 1EDZA 1KAMA 1VSVA 2XRFA 4US1R 3SF0A 3ZKWB 5ULLA 4P86A 3LTNC 4J6FA 1K8QA 5EEHA 3SC2B 3HKCA 3AP3A 3W3AA 3W3ZB 2WVJA 3KJZA 4DDUA 4RTKA 1PWXA 1A9RA 2F4NA 1UMBB 3L7CA 2WMDA 1E1YA 2YWGA 3B6MA 3O9MA 4PO8A 2IVZA 3JTEA 5DM4A 5IJXA 2HM7A 4MHTA 1MAAA 1JIJA 2ZJ6A 2AC2A 3LKDA 4M1QA 3F6EX 1KFCB 3GGOA 4DTIA 4BGDA 4IUYA 4ZGGA 5BVGA 3WXMA 1EK1A 1I4TD 1XDZA 1YU9A 3UBMA 1A5TA 4D5GA 4Q1VA 3SD7A 4UHDA 1C50A 3LPCA 4Q00A 4CV2A 2I6GA 3BQ9A 4M36A 4XB2A 4XSGA 1JSRA 4EA9A 4YAKA 4D80A 1Q57A 2AOVA 4JGIA 4LBWA 4EX7A 4XVCA 2V7PA 5T7BA 1TZKA 5LD2C 5J2TF 2ZSAA 3AFGA 4U9IS 1JHYA 5EIHA 3VHXA 1M8GA 1B2LA 2XDWA 3SLRA 4G85A 4HH3C 4KB5A 3VAYA 3D2BA 5FUBA 3ZPXA 4BZQA 1VCNA 4REMA 3V7FA 3PRKE 1IHDA 1X87A 2CGEA 3EPRA 2CLCX 1MJFA 3Q9LA 3C74A 1F6WA 2GSWA 4GU5A 3UV6A 2IXEA 3PFIA 4W5JA 4LFAB 4ZHQA 4LY0A 2I33A 1DO2A 4W1QA 1WB6A 3PQCA 4O5OA 5C81A 5JBIA 2GCEA 1IN1A 4RK1A 3G8BA 3ANXA 1DKLA 2JGIA 4OK5A 2WE7A 5ED4A 3FPGA 3PU6A 4QD3A 5K0SA 5JH7A 1R0XA 4B4OA 2XUFA 3HCEA 1DJLA 4NYIQ 5TMBA 2PMEA 4LFBB 4PZUA 3IKMB 4BB6A 5L4LA 1L3BA 1RE0A 1VPEA 3NX4A 3DLTA 2W58A 1PHRA 1MMFB 2R5NA 2VYFA 4PLHA 3CH4B 3GRUA 3SXJA 4KN6A 3G2PA 4FUTA 5ALHA 5DNUA 3TKLA 5E4FA 2Z5FA 3OKCA 3PKZA 2BELA 2JIQA 3S2IA 1VJTA 2Z58A 5K3EA 2WG0A 3FNQA 3O31A 3VV2A 3IIMA 4L8FA 3KXKA 4JXJA 1OE0A 5LUBA 1V11B 4HNSA 1HT3A 1RJGA 2NU6A 4NV1A 2QKYA 4QOIA 1A2KC 2G07A 3KJQA 4QVKA 3WMXA 2M6SA 4M9QA 1SXGA 1SKYE 5JQGF 2FSPA 4Q9AA 3TRHA 3U4QA 5TB5A 3F47A 2BEVA 2VUSA 5ESDA 5CCXA 4URZR 1OREA 1U11A 1J09A 1PTJC 1TECE 4Y2RA 3UMJA 1ECLA 2W4QA 1L5HB 1Z07A 3I64A 4ZRMA 2BHLA 3NHAA 5JXHA 1N2HA 2YIMA 1AHHA 1Y5IA 4OV6B 4ATNA 1SB9A 1Y37A 1H23A 2JFVA 3EDYA 1RT9A 3E82A 3O3NB 3IODA 5I4IA 2XYHA 2ZWPA 4ZQIA 5CA0A 1QS0A 3PWSA 2FWJA 1HFWA 1PGJA 1W47A 1E1MA 1QGYA 1XLTC 2ZJYA 3SQOA 3MN1A 5LUAA 1DFHA 5H1YA 4W5OA 1PVDA 3QFCA 1G7SA 4OH7A 4WBSA 2IXFA 5C35A 1W0CA 4EF4A 1A96A 4ZYYA 2DWOA 4L2IB 1D0IA 3G8YA 1V9CA 3JWHA 5EWMB 4ALMA 4IMRA 4Q4JB 4UUQA 5KWJA 4PNHA 2CKDA 4DABA 4ZHSA 1L5ZA 4ILKA 5ESWA 2DPHA 2HWWA 4A5OA 3O73A 1QCYA 4DA8A 1BHJA 1NBAA 3HB4X 3L05A 5COBA 4OP3A 4MR8B 5BV7A 3L1JA 3ZTYA 4XWWA 1GPWB 1GQSA 1T4CA 1YL6A 3COWA 3HUEA 3K9WA 1Z13A 3HQ4O 1DAGA 3Q11A 5EIAA 1MEJA 2JC3A 3UGKA 5D85A 1OJLA 1WHTA 2PX5A 5FCDA 4HZUB 4L74A 3L40A 4UBLA 4LBVA 1SIUA 3R5FA 3FLBA 2W43A 1QAMA 2QXUA 4HAIA 1B42A 3T9CA 3CTPA 2OAQ1 2MSEB 4ZD6A 2JGFA 1LXCA 4I2NA 5FTWA 3SDBA 3TW0A 4CDNA 4ISBA 3K8QA 3FPBA 3GEPA 1UJ4A 4NBVA 4Q9KA 3L92A 3S2FA 4B3BA 1GDTA 3VDMA 3GMIA 3J7AC 5MN6A 4NBLA 1UP7A 3YASA 1NM5A 4G5RA 5FOUA 1V5GA 3TVYA 1W9MA 3U3OA 1Q7TA 4F7DA 4DSNA 1JT9A 2J45A 1DIRA 7REQA 4MI6A 3ZBUA 3H2JA 3MUFA 1T6XA 1DEXA 4WZBA 1ZHFA 2BD0A 5B53A 4NV0A 3AF0A 1S4MA 2GJSA 1I01A 2ADFA 1EINA 1USUA 3O9VA 4CIAA 2DERA 1GGNA 3HWX1 1G9XA 2QYOA 3A28A 1Z47A 4BAGA 4X45A 3X3HA 2PKQO 1E62A 3DZJA 5ER9A 2VNKA 1DIAA 5ALYA 5PGMA 5GY7A 3SNHA 2Y4OA 2FUCA 3GJ0A 5DP2A 1FNNA 1JFFB 1HMPA 4ASUA 4QYMA 4XGKA 4BNLA 4QJIA 4LJYA 4XR4A 3BF8A 5K0BA 1OFTA 1VA5A 3BN3A 2IX3A 5CAEB 4PN3A 1R2QA 3PT5A 5D3KA 4OCZA 2H9AA 5THXA 1T1JA 1S2OA 3L41A 5AI4A 1Q7RA 5DP1A 1FFBA 2DWCA 2QYSA 4YN3A 4KTTE 1QG0A 4L8LA 2VYVA 5DLPA 4CIWA 4M9SA 3W5SA 2HT6A 3H5VA 3O92A 1C9NA 3SZRA 5F2NA 1JKJB 1CY1A 4CQJA 3SVLA 3LJKA 2VT6A 4M0FA 1HE2A 4RD4A 1X2BA 1LKZA 3T5CA 4I5FA 1F8FA 4MDYA 2R68A 3IHKA 1DRUA 1ZUWA 1W59A 3IA7A 2GWHA 4PLCA 3S68A 4CIVA 1UMDA 2WSLA 2V03A 1TCCA 4PLWA 1SBYA 4M0PA 2ZUFA 2KPOA 4LF6B 4I9HA 2G9QA 2UVPB 1E58A 3FMVA 4CG0A 1ZCJA 2QT0A 3BFPA 3DCIA 1MVLA 2P41A 4LQ4A 1E2HA 1FP2A 1M76A 2ZQYA 1P5RA 3V6LA 1T24A 5AVYA 3K1JA 2OSBA 5HRAA 2AMLA 4OXKA 2Z1MA 5AVOA 1RVV1 2C9BA 1GPBA 2FMUA 5ALEA 5J58A 1TAUA 1J5EB 2PUEA 2CLEB 3QPCA 3DUFB 5T8KC 10MHA 3K1ZA 2HWYA 3FSRA 1RQNA 3BG5A 3IMEA 3QJ5A 4ZALA 4D0GA 1XU9A 3BMCA 3PD7A 3KOYA 5E6UA 3IT0A 1V4NA 3TNLA 1GJRA 3FROA 5AOVA 5B2ZA 2LRHA 4DG9A 4D96A 1I2ZA 1HE1C 4HYEA 2A58A 3KQLA 3PXAA 5C0OE 3JAMA 1ZI8A 4PZCA 4QYIB 4KXXA 4QXMA 3TNYA 2E4UA 3B3QA 3TMAA 1JR3A 1NMZA 1B2RA 1IDOA 2PFGA 4UU0A 5ESXA 4CG2A 2XH8A 2RB5A 1ZHHA 1QHHB 2YVQA 2W70A 2W2KA 3ZQJA 4KAJA 1MDBA 2QRZA 1QIMA 2P6NA 3GLQA 3FUTA 4KXMA 1E9RA 4NBSA 4DA9A 5IZ4A 2Q62A 3PA6A 1QE5A 1SXJC 1Y82A 3DDSA 4Y1RA 4YDRA 5FPKA 1JEYB 3NBFA 2QUAA 1B8OA 3KKLA 4CFSA 1JXAA 2QL5A 3PHJA 4Y30A 1EVKA 4XYBA 3VV3A 5CDYA 2Q1XA 2J31A 1FK8A 4W63A 1CEYA 2AR9A 2WLTA 5I7OA 4P4GA 2NQ8A 2AFRA 3WNQA 5U4XA 4TL9A 4YJKA 3TZ6A 4MCIA 3F90A 4CM6A 3I32A 1RKXA 1GVHA 1NN1A 2KMLA 3O9ZA 4ZHQB 3AKZA 1O5OA 4TWRA 4F5WA 2GSDA 5THQA 3WKDA 2MDTA 4X6UA 4G1VA 2XSZD 4ZO9A 2A9PA 2JLRA 4DA4A 2ZI6A 3P9XA 4CN9A 3VFDA 1IQUA 3SQNA 1W5EA 2G5GX 2HIMA 3CUWA 4TXLA 5JW6A 3KDSE 3FFWA 1Z6ZA 2CLDX 3TLYA 1B3RA 2ZJBA 3W8DA 4AD8A 5KTRA 2WYVA 3EVTA 3SM3A 1Y9ZA 2C0CA 3OE7D 4RZ2A 1G7TA 4I3FA 2IWHA 3GJZA 3QG5A 1Z2DA 1NI3A 4X93A 3EXG1 3PGLA 4M9UA 2BEKA 3IALA 5F1OA 1TKAA 2OV8A 1PZEA 4E3WA 5BQFA 5HIIA 3ZH2A 1P9LA 1X0XA 4DM3A 5HRCA 1S2NA 3PUXA 4BVGA 5KJEA 5JMTA 3PXUA 4QGSA 1GHTA 2PUWA 4B7CA 4EKIA 3L7MA 4LISA 4UHCA 1P0PA 3F71A 1Z37A 3K8YA 3WWEA 1JIVA 4D3ZA 2ADOA 2YCLA 5E3JA 3O8CA 1CB0A 2P35A 3GJ5A 4QDJA 3SXUB 3OZ7A 1A77A 3EW7A 3SXPA 1A5BB 1KK1A 1N8NA 2JIZD 2ZRCA 2ZJ2A 4B31A 4YMLA 3MYRA 1KPIA 1NBMA 3H2HA 1SEPA 3HXKA 1USGA 3ONDA 2YQZA 3Q5GA 1IE3A 1XK6A 1E1DA 3X1DA 4CIDA 5ITVA 3DHYA 1HURA 2RI6A 2IHZA 3Q72A 4B4DA 5FL7A 1L8XA 4WZAE 2OORC 3A9TA 3GRAA 4HQFA 1QF7A 4DQLA 3N74A 3P26A 4M4SA 4AT1A 4HAUA 3BMQA 1E20A 2C84A 4KNVA 4YRNA 4IIEA 4IIBA 4X9XA 5DNAA 3K70D 1JDPA 3COPA 5I5GA 1ZU5A 4C5AA 1SXHA 2HGSA 3ZVRA 1PL7A 3OQ1A 5DYYA 3VKVA 2B82A 2QRQA 4TS9A 2O8DA 3ZQ6A 3FR8A 4P6VF 4MCJA 3DTTA 3KR1A 5SZKB 4W5QA 1P91A 1AZTA 1QZ3A 4UUMA 3B7WA 4FYHA 1CJMA 4IDHA 5T64A 3ZE6A 4F2DA 3QKWA 1XN4A 4PZZA 2HCRA 2P62A 1MRNA 2X2OA 3DBVO 1M1ZA 3PQ6A 1D4FA 1TZ2A 3H6GA 1YZTA 1VI5A 3IXMA 1HDOA 3ZHSA 2R8YA 3HLYA 3UANA 1OB2A 1P1HA 3L8DA 2YZKA 3HWSA 2J9GA 3P2JA 3OQHA 5ENZA 3RIYA 3PQFA 4BQRA 4CWAA 4L9RA 4QNMA 3BWXA 3D1LA 1X13A 2W37A 2VDJA 4IMJB 1KDOA 5TVKA 1Y48E 1W29A 2W0SA 4O2AB 1HZZC 2HJVA 3LUJA 2XLBA 2J3JA 3OCJA 4AJNA 1WZEA 1EZ4A 2I8LA 3AR6A 2JFBA 2WMNB 3DCJA 4PTZA 3GPIA 5REQA 4C30A 2AFIE 3N9IA 1ZN2A 1K7FB 4JBHA 1NYRA 1LUAA 3KL4A 5KX5B 1CXZA 3C5VA 2BR3A 1Y3BE 3FYTA 4L9SA 1NFRA 3VYWA 4K9NA 5CM8B 4NNJA 3O4HA 1NLMA 3S2UA 3HACA 2O8EA 3BXXA 3AHGA 4U2GA 4XQEA 4MMXB 1BRTA 4J4HA 2GZAA 1R50A 3O8QB 4RGBA 5JWRA 3K71B 3Q8LA 1KVRA 3VR6H 1I7SB 4KI0A 2EZ4A 2FYTA 5I9BA 3CEMA 4QLAA 1DG3A 4D3DA 1UJ5A 3KDPA 1AM4D 5EERA 3R3ZA 3JR3A 3RJZA 1ESMA 2A35A 1VRCA 4RTOA 1RPJA 1GNPA 5HZGA 3DGFC 3L7IA 1CZOA 4RZUA 1NMYA 3PD1A 5BT9A 5L4SA 4M8KA 5KEIA 4G0QA 2C58A 3F8TA 4CUZA 1JFSA 3IKJA 4DY6A 1E9DA 2B1GA 2QG4A 3ISJA 2OYCA 4GDFA 2BEUB 3V8QA 3LQYA 4F1WA 4KNYA 5A9RA 1LFAA 1D1TA 1GZ7A 2I1QA 2IV3A 1EVEA 4PG7A 3PDJA 1F20A 2ZKIA 3W7VA 2C94A 2D2FA 3HR8A 4TRNA 1UXHA 3FHOA 4CJXA 4C7BA 3VGJA 4RESA 4ZPJA 1DBVO 3RG2A 4MTCA 4IXNA 4DLYA 2BUCA 3SE0A 1V16A 2JFQA 1A76A 8ATCA 5PNTA 4FD3A 3WGNA 1HORA 2BFDA 4IX9A 1M7HA 5DK6A 3ZWNA 3IP5A 1V35A 2RHLA 1LTQA 1L1FA 1MPTA 4NIMA 1WBDA 1HDZA 2ECOA 4YJGB 3FJYA 1UT8A 3UIEA 1Y33E 4KPUA 4DEXA 3U7HB 1H0SA 2P3OA 3UHPA 1MTOA 1ZGZA 3K9HA 3QVJA 3WLJA 4EMUA 1LVHA 3EH2A 4HGNA 3UMFA 2KJQA 2FXVA 2ISCA 3QKIA 4N0DA 1JQDA 5FQNA 4CKBB 2X4DA 4FYKA 5BORA 4D99A 5AVQA 3DFFA 4JNCA 3STVA 5BR4A 4EHKA 5DNEA 3C3DA 3GP8A 3VHQA 3QW4B 3JATB 3I0ZA 3BK2A 1K2WA 2ZRLA 3ONFA 1TIBA 1BHO1 1M1YB 3CW2A 1DQYA 2V8BA 1TT5B 3LK7A 1Q6ZA 1BHQ1 1T3ZA 3OHSX 4M9ZA 5IXJA 3R3HA 2IC5A 4FEGA 4L2IA 4V2IA 4W82A 3UK7A 4EZEA 3BILA 2OILA 1J7JA 1SBNE 1IRIA 1BGVA 4XTRA 3GZTB 1CQXA 5AICA 1GN8A 2YZMA 2EDCA 3FCOA 2IYXA 1XPUA 4Z3DA 1BYIA 1ELOA 1M2JA 2GASA 4UUOA 3T15A 5BPFA 2AZTA 2NQ2C 2QMEA 1PT6A 3ENVA 4G0YA 4K9LA 4AUEA 3GZ4A 1RTKA 4C6RA 3HRKA 4RMNA 2A94A 1Z56C 1CRQA 1GRVA 1UKYA 3U7RA 5LMNB 1MV8A 3CLKA 4OIFA 5IUNC 3ICWA 2CCKA 2EFJA 3ZHXA 5CLFA 1GT91 3NBMA 3OM8A 2QAJA 5GOZA 1FZQA 5EMKA 1WW8A 1D2GA 5FT9A 5AI8A 3WNVA 2N0SA 3JQDA 3FMOB 3M5CA 1CQIB 1E7SA 3I8XA 3LWNA 4XIGS 2AV6A 4MR9A 5JYBA 4F1KA 4H9GA 4EUEA 1NVWQ 2P2NA 5E2IA 1V4VA 3NYWA 1KKLA 1DADA 3ZWWA 4MO2A 5JAIA 5JQGB 3GG2A 3QY0A 1O97D 2P27A 4LZWA 1J33A 1BD4A 4PSCA 3S3TA 4R7ZA 4CF6A 3N8HA 5E38A 3MAJA 5EAIA 4EHJA 4QPZA 2ZSFA 3L1UA 2OBYA 4U39A 3WQRA 1I2CA 3DPSA 3STUA 4GUAA 4IIJB 3L6EA 4D3XA 1A8HA 5FWDA 4QNNA 3G2KA 4DCJA 1YB4A 2IUTA 1THTA 1U2SA 1MRZA 3HEAA 4UE2A 4KCGA 3NHPA 4X95A 2BKEA 3E7XA 5FUXA 2CFIA 1K4KA 5CT5A 4J7UA 4WESB 1JAIA 3GLFE 2XGMA 1KH2A 1WQ3A 3ZOKA 621PA 3ZZNA 2P7IA 4ITUA 2GD0A 2B1RA 4ND4A 3P4YA 4TV8B 1X92A 4E2XA 3O3OB 1FMJA 1W2GA 4UNNA 1EDEA 5IULC 1GV0A 3H86A 2PN1A 1K5GA 1JAYA 3IUEA 1D2EA 1AKEA 3VR2D 1R12A 1XDSA 1R8XA 4NFLA 1JG7A 3I1IA 3ZIDA 2YNMA 3D0RA 2O8EB 3H6KA 4C03A 2PKEA 2FRVA 1U7WA 1F6BA 2OFWA 4F3TA 3VZQA 1JA0A 3WYBA 1ZW6A 2PWPA 3EUEA 4B7XA 4B17A 3TMYA 1J56A 5B6PA 4Q3LA 5FHRA 1HDRA 2FE1A 3I4LA 4L16A 5IH7A 1KP2A 2WF7A 3DR5A 1RI3A 1GY8A 1O8BA 5NLLA 2WSSD 3A06A 3M81A 1QCZA 4LW8A 1CJSA 4RIGA 4YDHB 1KVQA 3KSUA 3JX9A 1P9RA 1THGA 4HYYA 1VB5A 1JKJA 1K66A 2NACA 2ROQA 3EMBA 1QNFA 2I6TA 1II0A 1ORIA 2YWCA 2ZBRA 1Y4ZA 3QBDA 1MZVA 4ICIA 4R2LA 4WZBE 3NTVA 3QWFA 4WXRA 5F12A 3U3RA 4MVJI 1BCRA 1RWOA 4YMTA 2YN4A 4NJEB 4OLHA 4TL6A 3IR5A 5FBWB 3RSGA 1XMIA 1N0HA 3PZRA 3P9ZA 1OZ0A 2OV6A 4XFDA 2Y71A 1QR6A 1CR0A 2ZREA 4BMZA 2GEJA 3W34A 3SKXA 1NQWA 3ZWVA 3COZA 2B4AA 2P2CA 3S4YA 5BWLA 3A14A 4OD0A 4BNXA 2R7AA 4D0LB 2XVZA 3FYDA 5IVDA 3SK0A 3N7UA 2NZUG 5DBIA 1ENOA 3RQSA 1GGFA 5F4BA 421PA 2PJDA 4RPIA 5FPQA 2PWYA 1C9YA 2NPOA 2O5RA 2HC9A 2EKBA 3BQMB 4I50F 1QVWA 1E4EA 2CKMA 4D3YA 4MX8A 4NNOA 3BMCB 2OO5C 1MJ5A 1DG9A 3AUJB 4B46A 4WD3A 2C7BA 2QGZA 1FY2A 1N2BA 3HBLA 4QBHA 4AJOA 3DF7A 4N5LA 2CDAA 2AOTB 5D7NA 4EQZA 3T54A 4BKPA 5EWLB 5BSVA 4FLFA 4MK4A 3MQ4A 1OILA 4QQFA 3W6OA 3CXUA 5FFFA 3ZBTA 3V2GA 3PF9A 1CJBA 1R1DA 3LUKA 4QBGB 3WKAA 5LXTA 2WFAA 4YRSA 4MIEA 4Z9BA 4ZV7A 1G6Q1 1HYHA 5KTPA 2NSDA 4D79A 3IQGX 2WTAA 3MBOA 4MMZB 1UR5A 1WHSB 1ZQ1A 4AU1A 2ZBPA 3L8MA 4RHUA 3BFVA 3EZ7A 1CY2A 4N5DA 4XIFA 5HGJA 2I9KA 3RYHB 1E4OA 1YUMA 3GRVA 3E8SA 2JLYA 3BTUA 3FHLA 1VLZA 1AQLA 1DAPA 2RAUA 7MDHA 4MI1A 5E6UB 2MSWA 3GI1A 3LUFA 1IM5A 5IX8A 3QF7A 3QVGA 4FEYA 5FBRB 3CH6A 4P3NA 4EYEA 4F2WA 2ALJA 4YRLA 3N0TA 2E55A 1Z7EA 1GKLA 1TQ2A 1K06A 2QMHA 3IAHA 2GDJA 1Z12A 3LBNA 1AGXA 4NZMA 3GPBA 3NXSA 1SUDA 2EJUA 1J49A 2D7CA 5JVDF 4Z4GA 2ZUUA 3B1KA 3E05A 2PL9A 5ALIA 5FDFA 4EGCB 5BN5B 5TSDA 3VC3A 4B43A 4WNYA 2NO1A 1G5RA 1CZKA 1M10A 1KAOA 4XX1A 3E9QA 2FMKA 1K0UA 5HGXA 3LT0A 4G0WA 2DSNA 1BMQA 2PGLA 1G3RA 2C2HA 2GZSA 1A2QA 2N1BA 4LWQA 4BFSA 1XELA 4L07A 2J32A 2XVMA 2HDNB 1Z4PX 2HLHA 2HRCA 4O4IB 3WO0A 4CKXA 5J5CA 2XTAA 3QK7A 4BO6A 1TZCA 4MUMA 4B85A 5HF9A 3S8EA 3E8XA 1FP4A 1KEVA 2XTNA 3SQLA 1A9QA 2DMRA 3D2AA 4YI3A 5G1OA 1JX6A 1ZUNB 2IDMA 4CDMA 4OM8A 3BHMA 2Y0EA 5EUQB 3ZDYB 4F6LA 1SJ9A 2H8GA 4COKA 2ZVPX 2FZKA 3WTCA 2DE0X 2Z2XA 3T95A 1MF7A 3I92A 4LOJA 2Q07A 4D0SA 5JG7A 2XSZA 3HNOA 3KB1A 3FFTA 3PI6A 5JPCA 1ISMA 3FHJA 3GLKA 2QN3A 1N57A 3HADA 1G4HA 4KODA 4BVBA 4BBAA 3HDGA 4JJGA 2HYIC 2EBHX 4IKOA 5B64A 2YJGA 3EAGA 1KJQA 2M1XA 1DOAA 4I6GA 1HFKA 2VDKB 4KGDA 5DLEA 3S40A 3TQFA 2YX1A 3OE7A 3U7JA 4DCSA 5G4KA 4A0HA 4MINA 1M34B 2QLBA 4W8GA 4HEQA 3Q10A 4M99A 5LP1A 4Y9RA 2G6TA 3C15C 4X8OA 2IS6A 2EXXA 3L5KA 5IM5A 1R3DA 3HU3A 4NBRA 3UFXA 4KRXA 1T9GR 4AN0A 5ICFA 5AM4A 5CD9A 2GZ3A 4OVKA 2Q1SA 4TQGA 3KQQA 5HS4A 2WT8A 3KYCB 3MRVA 1TU0A 4ZQCB 1Z2AA 5CLIA 4P84A 4UD6A 3NU1A 1U8CB 2VF7A 2DZDA 3LCRA 4GBMA 1XJQA 1WMBA 1VMIA 1N78A 2H4YA 5FL7D 1NFFA 1BU5A 2H08A 1EZ1A 2VJQA 4PPNA 1P6XA 1P1RA 2N42A 5BR7A 1Z4NA 5HF6A 1XYYA 4BIIA 3A8TA 4RE6A 3CXRA 4XLLA 5EJIA 4D9GA 1VLVA 2GZ1A 3DVSX 2WKRA 2W90A 1XD8A 1C3JA 1QYIA 8AT1A 3QP9A 1CHNA 3GEHA 3JSAA 4JUDX 2WF5A 4P32A 4Z4HA 3WQBA 1LK0A 5BSFA 1KS9A 5IYZA 5JS6A 1QWOA 2OESA 2VP5A 4GVLA 3WDKA 4O3FA 3L84A 1R0LA 1M6EX 4ZVKA 2HBQA 1XZBA 1U7HA 3ADKA 3FPJA 3OT4A 4QC2A 2KWIA 2GARA 1W1WA 3NFYA 5IAEA 1QCDA 3PUIA 3CCFA 2HA5A 4FFRA 3EE6A 3KKKA 4ZI3A 2ZRGA 5K8LA 2JBAA 1RWVA 2CXTA 3GRRA 3JQ7B 3LA6A 2C29D 4LXYA 3FH0A 4YRJA 3N5CA 1PBTA 4AX8A 5DM2A 5F5NA 1IIBA 2YY7A 5EP4A 4NNPA 2WDPA 1GDDA 5I4KA 4M0DA 3O21A 4EI2A 4PEVA 1OZGA 3HGTA 1J99A 1YDWA 2ZYGA 2Y0CA 1ECFA 3BB1A 3JQBC 4QTXA 4B3RB 2E5FA 4MUKA 4LC0A 4LY3A 1RWQA 4S1VA 2YMPA 1FNCA 5JAPA 2E5WA 3W2IA 2B8NA 1GDHA 5I7HA 1VC2A 5U9CA 1FX0A 2XA9A 2EDAA 3OP4A 5IXYA 1WIWA 1E2IA 3ITEA 2HSZA 2OA0A 1IBMB 4ND8A 1ZSVA 3HMQA 2PS9A 2Y1LA 2ZYVX 3OICA 1NXQA 5JFTA 4EHHA 3RYCA 2AOXA 1JJBA 4BRWA 4HDQB 1LWNA 1E3EA 2OO7A 2QXYA 1Y3DE 3A37A 3CLSC 2EGGA 4HWRA 1R0WA 2BFEB 2QAGA 1C0IA 3DOHA 4FXPA 3V32A 1DPFA 2ODQA 3ED5A 2Q1TA 3DMGA 4AJ1A 1SBTA 3QFTA 1AF7A 3KZCA 4JGGA 3P8ZA 2C4KA 3GDWA 2AYXA 3RFFA 1KEZA 1E1QA 1PK7A 4K8OA 4TN1A 3MHTA 1GQRA 2WF6A 5LQDA 3IQIX 2W71A 1X77A 2Y9MB 1PW7A 2FW8A 2RG7A 2XR1A 4FILA 4GPZA 4H31A 2D3TA 4HPWA 3K31A 2AQIA 4MP6A 1ORHA 3R7FA 2JK0A 2XHEA 1V41E 5A03A 5K6RA 4FC6A 3DO5A 1XTQA 2PLRA 3B6IA 3O3CA 1MOSA 1H2RS 4C6TA 3DLAA 3Q2OA 4PSVA 1VJDA 3MHPA 5ENDA 4YWHA 2AS0A 2H1CA 4RVGA 5ILQA 3ZDRA 2X0KA 4YCCA 1M72A 4KE9A 4FX2A 2EV9A 3RAFC 3I9NA 1B8PA 3UOGA 6Q21A 4DR6B 1JR6A 1LCIA 1AKWA 2COUA 2P68A 4W7HA 2IUFA 1MKYA 5F23A 3QTTA 3I8SA 3V9AA 5KIAA 3EGOA 2HGZA 3V4RA 1NVTA 4QRIA 1WPGA 3O0TA 4W8HA 2ZRHA 4WKOA 4RL6A 1EXVA 3S1AA 4ZI7F 2R00C 2GXQA 4UFOA 1GPJA 1X7GA 2GA9A 3DOUA 2BYTA 2Q2OA 1ZH8A 2BTQB 4ESVA 4L5AA 2F9MA 1L9KA 5TMDA 3T7IA 1SKYB 1O6CA 2FG7C 4MRVA 4PINA 5FOVA 4X44A 3ABQB 1FTWA 5F2KA 3T7DA 3TUJC 4F5EA 1QIKA 1QM5A 4LWPA 4S1NA 4YCSA 3MNFA 1Y6ZA 3Q1LA 1P7PA 4U2KA 1X7DA 1F2TB 2JF0A 4CUJA 1LSOA 1RC8A 2LGJA 1E79A 3H9JA 3M34A 3ZWYA 4WFJA 1XVAA 5H59A 4HLQB 4MQEB 3ELWA 4ZARA 5BNFA 4YA6A 5IT5A 2IIPA 1KY4A 2F00A 3I4CA 1KFJB 5A71A 3R8CA 2PL3A 1M5TA 1KJZA 4DJAA 2VJOA 4DV6B 2ZS7A 1T4DA 4BC1A 3GFTA 2VOJA 4UMFA 4MITA 1N3BA 3CINA 1QUEA 2W2PA 4DQVA 1V1MB 3KAKA 3ESZA 3IUQA 3KXDA 4RM3A 5EQDA 2O2CA 3BSYA 5EPOA 4BLOA 3AF3A 1XT6A 2NTEA 4LHYA 5ADWA 3GXBA 3OZUA 3RTDA 3Q8WA 4TLAA 4TTPA 2OHHA 5FI1B 4B74A 5FEUA 1WMFA 1TM7E 4OA5A 4O08A 5CTAA 2J0SA 4FOOA 4A03A 2QORA 1W93A 2AFIA 4LSMA 3GGJA 2CHEA 1EG7A 2QXTA 1VCMA 3FG9A 3FAZA 4D9CA 2R1UA 2UZ1A 1P2GA 3K1AA 3AUKA 3PPVA 3P0JA 5GTDA 5KC8A 4RULA 4P22A 2Y93A 5ICSA 1T6BY 5KQSA 2ECKA 3NKVA 2EJTA 3RAGA 1ULUA 2P8JA 4DHEA 3HYTA 3C1UA 4ZO7A 1K8RA 1YTUA 2CW5A 2O2DA 1P39A 3AQIA 3SJUA 3WQSB 4LRQA 4MV3A 3IRVA 2IODA 5F76A 5KSPA 5KVCA 2ONYA 4LF5B 3KKOA 1IXSB 4FMBB 4ENVA 3OJCA 5A2QA 4HF7A 2YS6A 2XOKD 4JQOA 5JC1A 4BNTA 4DIFA 2R6R1 4G0VA 2P2GA 1RHJA 4QFDA 3HZOA 4TQAA 5AVUA 4L6IA 1R6XA 4QOSA 1M2VA 2O1EA 4XB6B 3K6KA 5AH0A 3RWOA 3ILSA 4KSYA 3ZDXB 3AB8A 3QVLA 4ND6A 3NRBA 3THOA 1SCQA 4YQZA 4L5YA 4D82A 2IV2X 2D5AA 1K7CA 5DNYB 3F9IA 1FS6A 2AE1A 3NHZA 4JJ6A 1QO0A 2CLFB 2FPSA 1BCRB 3I01M 3IQFA 4TV8A 5K51A 3STYA 3U80A 1UWKA 2CY0A 1GAQA 3L06A 4RS4A 3ZE0B 4N54A 5EJMA 3Q8KA 2H4JA 3OLQA 1KP3A 1JB9A 1KNQA 2GNAA 3PXCX 4QEZA 4OX9B 5F7OA 5KQLA 3RRYA 4LXGA 5EZQA 3VMMA 2B94A 3G5LA 4CKWB 2PX0A 5AVZA 2ZRDA 1W75A 2Z4SA 1NIJA 3R4VA 3UAWA 5AMXA 3BGWA 4YP1A 2IU4A 1H9CA 3RYIB 1HGXA 1M2WA 4EQ6A 3RIHA 3VTZA 4OP2A 3D0QA 1AHIA 1X8XA 2YDXA 3VR2A 3PICA 4EM6A 3NWPA 1M1XB 4UEWA 2GHTA 1HG1A 1UZLA 4FCVA 1YJXA 2IELA 3ANSA 4N3GA 2A0UA 2X5XA 2E87A 1NX9A 3SZLA 2J9RA 1EUQA 1JI0A 5E9JA 4QOEA 2JVKA 2ZXFA 3OU6A 4KRGA 5M2QA 5BW6B 1JLLA 5DXFA 1DTWB 2DQZA 1I30A 5CLGA 2IV7A 2C5SA 1UC8A 2M2IA 1QOPB 1CJUC 4MUXA 1M5RA 4LZNA 4E11A 4UTRA 2RKBA 2Z98A 1RCTE 3EN0A 2XZDA 1PWYE 1AHPA 3HYSA 3NYRA 3WZMA 4K9PA 4UEJA 2VPXA 4CLHA 2NQTA 4M1ZA 5ALTA 5KWIA 2BLNA 2IYPA 2NO0A 1GARA 3E2IA 2VLBA 1MC4A 3QXGA 4TKZA 2UYOA 4J3NA 4DIOA 1L4BA 3E27A 3E8MA 3TE7A 6PFKA 4F97A 3Q3VA 3N8KA 4A73A 2PZ8A 2GHQA 1U98A 3N6VA 1K8ZB 4AIIA 1OU0A 3VU8A 2Q3JA 2TYSB 4I14A 1JHQA 3N6RA 3A6LA 4NOJA 5BQOA 3R9XA 2C5BA 1Q44A 1NPYA 3KVRA 1I8TA 4REOA 5J1TB 4F4UA 4OXQA 3R1IA 3FPEA 3SBXA 1Y3CE 4HT3B 5KOJA 4H6WA 5TQ2B 3WL8A 3C1TA 4BB5A 5JXIA 4EY7A 3B1FA 5KNBD 2Q45A 4PLYA 2QG9A 5F3WB 4KGXA 2CDCA 1HEIA 3NHSA 5CA0F 4DV5B 5I9MA 5CNKA 2ZWOA 1N92A 4MPPA 1DWQA 1O8CA 5BWBA 2FP4B 1FUUA 1JBEA 4JCOA 1L5LA 4XB1A 2Q4BA 4LZAA 3CYFA 3ZLUA 4MYUA 1B0AA 1GZDA 1QVAA 4OIMA 1IBRA 1GVNB 5AHKA 5JMPA 2R6CA 1X7HA 3EEIA 1H4VB 1WXXA 4OHOA 3TQTA 3PE6A 1SR8A 4KO1S 4EO9A 4XGNA 1N5JA 2M1ZA 4XWYA 4WOPA 3H8SA 1M6VB 4EYSA 1SQ5A 2Q3MA 3OT1B 1FRQA 1NVDA 2PH3A 3SFTA 3NLLA 1XP8A 2SECE 2V7XA 4L6AA 5KB3A 3VR4H 2Z3VA 2IYRA 1UC9A 4MAAA 4F6RA 3PL1A 9ATCA 2GUWA 4F11A 5EJ8A 4CEIB 2CL6X 3RM3A 5DXJA 4UPVA 4TV9B 3NIDB 3PSAA 4P54A 1Q1QA 2O7NA 2O5CA 5I7FA 1LY1A 3F0TA 3ET4A 4C1BA 1QYWA 3K9GA 1LBTA 4FW9A 1V9SA 2Z1NA 1OIXA 2H1OA 4FZ5A 2G5TA 1OT5A 1S3IA 1JIXA 2O0MA 2W2VA 3HKEB 3KJNA 3NHWA 4FOSA 4JLBA 2J9YB 4G63A 1OHHA 4DQUA 5K8JB 3RF7A 2CEKA 3IEKA 5CNIA 3BEOA 4Q66C 2W7TA 2AJTA 4YASA 5DF1A 4ZQFA 2GXSA 4LJ8A 3IEXA 3GEGA 5FRDA 1PQWA 2O1WA 2YOHA 3G6KA 2CXHA 3QH4A 3L93A 4NHEA 5T4BA 2H7CA 4JI6B 4KJXA 2NVWA 3P0HA 3L0DA 4BC0A 5JTUA 1P33A 3GU3A 4DQXA 4BVLA 4O8ZA 4CDRA 4KO2S 4JLVA 1QRAA 2AG1A 3W79A 5M3BA 3TUIC 3B85A 4UOZA 4M38A 5SZJA 5A3JA 1RAEA 4CIYA 1SCKA 4HAXA 1VIYA 2YIVX 4RSGA 5JNWA 4DPMA 4BAZA 5LN1A 1PLLA 1QPZA 4RD2A 3K0KA 4XFJA 3AEUB 4O29A 3MINA 3HYRA 3KLBA 1PT8A 3PUWA 2EF0A 1CZHA 2CLSA 4HQ6A 2SICE 1VBMA 2MYPA 3FFXA 4V0SA 5LZ4A 5IRCD 1BJRE 1WZ2A 3INYA 2XWBF 1KTVA 1L7RA 3OVMA 4MW7A 4RVOA 3FOEC 3EGCA 3T0GA 2R6JA 4RZIA 1FFHA 3QXSA 3GMSA 3K53A 3QNUA 2PWAA 4Q7JB 4ZOCA 2IS4A 2H2GA 3PJDA 1YHYA 3LF1A 4CMBA 2PXCA 5AQEA 5H3LA 2J85A 5HCUA 5KOYA 2XGJA 1RYHA 4JP8A 2VKQA 1MVOA 1JLSA 1G6KA 3N0XA 3QGMA 2C1ZA 3KD3A 4FGSA 4PE5B 3VZPA 4QUJA 3WK6A 3EPLA 2OCAA 3MJVA 4DBLC 1FVOA 1O96A 3QUBA 1TVKA 5C8DA 4LYEA 1FPMA 1UDWA 2FJ0A 3I61A 4RU1A 1HRDA 2M6KA 1XN1A 1ZJ6A 3D6TB 3ONNA 2K5UA 2GZRA 3WK9A 3GJ3A 3TQOA 4MWEA 3BL6A 3PEUA 4A16A 4QLBA 1ZNQO 4XJSA 1XU4A 4KQIA 4XJXA 5A3RA 2F7SA 2ODPA 2NV6A 5IAAA 3CLTD 2VNAA 2H0AA 2H1HA 3ZWBA 4AKGA 1G8GA 1GZ5A 3LLMA 5GM2A 5JSHA 1QV6A 2R6FA 2ZWVA 4AP5A 3DOJA 5DNCA 2LXNA 4G81A 3MFYA 2OP1A 1WLSA 4QECA 1TYZA 4TLCA 1OX4B 2FPIA 1UM9A 3DMHA 3T0FA 5LMZA 2PUCA 1V9LA 2LR0A 2VDUE 4I5DA 4ZOQI 1BMDA 1MC1A 4BYGA 3O8BA 4C6SA 2CFOA 4IR7A 4YH1A 5DHSA 4OBXA 4B4KA 1PO7A 3G2LA 1N5OX 3JALB 1YT5A 2FZLA 1G8HA 2M32A 2YIJA 4I46A 3A4YA 4TM8A 4U6NA 3FB1A 5A5EA 5J47A 4PQEA 3VO2A 2AT1A 2OWEA 2HWUA 2NVBA 1PJQA 2DY1A 3E23A 1GYQA 3LL7A 4P4NA 4RF3A 1XZNA 5FBVB 2CV2A 2XZTA 4COOA 1EKXA 3ETDA 3KT0A 4LVOA 4UEKA 1H2FA 1JALA 3JWPA 4RE5A 4A4DA 1IQPA 2WSMA 2D1YA 3U56A 2IU6A 1C2TA 1YB2A 3C7KA 1JHAA 5FJIA 3ZLBA 2RAPA 2YIDA 2OCGA 1CS0B 3ZY2A 1ZBQA 3GJ8A 4HFJA 3OU7A 3CE9A 3FTQA 1E3WA 3O1IC 1T3HA 2FEXA 2WA2A 1PJ3A 4V1CB 3HI4A 3O38A 2OY0A 3EZ2A 2PL1A 3M3HA 3SR0A 5JMWA 2VQFB 5TQ0A 4MVJE 4IG9A 2FY8A 1T8WA 2EJWA 1WKVA 2XT0A 3U5ZB 3TR6A 4JWKA 4XXHA 3TZHA 1DBIA 3PPYA 5JNRA 2OM6A 3GL9A 2YASA 2CFTA 4MTLA 4RTJA 3I83A 1WBBA 2EWMA 4JVNA 1G16A 3ZW8A 1W9HA 4QHYA 4US0R 4HGOA 2QD5A 4FDLA 1JH9A 4L4YA 1E1LA 4L6CA 2CJFA 2V0GA 2TMGA 2I67A 5G0VA 4AK9A 4GGOA 5EKSA 1C4WA 3EC1A 1U0SY 4UAJA 3RRXA 2Q5CA 1BROA 4Z0NA 1RRPA 3W6ZA 4B48A 3CZ9A 3ZEIA 3QQ5A 2RD2A 4TLLB 3DAGA 3RVDA 1RI1A 1VG9B 5JASA 1N9GB 2BFFB 3MUEA 1GSIA 2F64A 4RJKA 4B3MB 3ZLTA 4IEFB 1K3FA 1EK2A 1NHWA 2OENG 2V58A 1SZJG 1Q1GA 3M89A 2XUZA 2AJLI 3QIVA 2F1OA 5M29A 1BDMA 1UPFA 2DVMA 4J3FA 1C9JA 4CXMA 4BP3A 2B7BA 4QDKA 1QS0B 3ROZA 5B7QA 5IF3A 1GZ6A 1OW3B 3HY3A 4GP6A 3VPHA 4CQMD 2JEZA 1JNXX 1T0JB 2XUIA 2YFQA 1GR1A 3SEAA 3VDNB 5M34A 1TD9A 3SBOA 4PS0A 3SSOA 2MMCA 3O2QB 5GZ3A 3EMDA 2OFOA 4IF4A 4D4IA 2FPPA 1PZMA 4MV6A 3F9RA 5LBIA 2XXAA 3BX1A 3LXMA 5DB4A 2Y0PA 4HJXA 3PUJA 3V3TA 3I45A 3VZCA 2ID8A 4K87A 2YQ5A 1I33A 3MERA 4OB6A 1V96A 2JATA 1B6GA 4G9GA 4KYIB 5AK6A 2A3NA 2GJ9A 3CN9A 1QHHA 4HUJA 1Z2OX 3EPPA 3SC2A 2Q5QA 3P19A 3VU9B 1Z74A 5JSQA 1ZU4A 2PBFA 1WMEA 1YC5A 2BBSA 3IIKA 1ESEA 4JDUA 2C88A 2KQUA 3CLTC 3WHKA 1LDNA 4L08A 2H57A 5AKIA 3SG0A 2ACWA 4DIKA 3A6PC 1Y4SA 3EVDA 3TF5A 1PR5A 2FN7A 1IVNA 1HE4A 2XTMA 1B76A 3QM1A 4LPSA 4PPFA 1W34A 2M98A 1QRRA 2RGNC 2VP2A 3DPIA 4ESEA 1JE1A 1K1EA 5B6IA 2CL5A 3LHKA 1WQ1R 3I5AA 5JQGA 5D01A 3G5AA 5JJIA 4CM9D 1QYRA 4Y8VA 4YJ2B 4RCVA 6AT1A 2CYBA 3HB7A 4KMOA 5KZMB 3A7DA 1BN7A 3TE6A 2PJUA 4WEQA 1KQPA 5AQ1A 1QE3A 3V8VA 1KAQA 1WM1A 4U5QA 3Q0EA 4IPTA 3CBGA 1RRMA 3BH7A 3KUDA 4OEHA 5DT9A 1G6HA 1ZOOA 4TWBA 1FP4B 2B78A 1R9NA 3LOPA 1B8UA 1EFPB 1XE3A 4J0GA 3VI3B 4AYTA 3OCXA 4BEBA 3GLRA 1Q0TA 4LNAA 1KERA 2X5KO 4PRYA 4YIHA 4YUXA 1SCAA 1VSBA 4RTNA 1HL3A 3DZIA 2WYWA 3GH3A 3L0BA 4P3YA 2H1FA 3T7SA 2JCXA 4ITVA 5IN5A 2I1WA 1F2VA 4V0KA 3UUEA 4EYOA 4H7PA 2A84A 2EZ9A 5EIBC 2D1FA 4WY5A 3RHTA 5FULA 1QPBA 1ZPDA 2GGSA 2GCPA 1GNLA 1VKJA 1EHYA 1OX5A 3OQIA 4PAMA 4JLOA 1WVGA 3DKPA 5E3IA 1FUEA 1NNUA 5ERGB 2D7DA 4F96A 3N6XA 3PNPA 1EUYA 1YUNA 2O2JA 5MDHA 1TB4A 4RK0A 3EGDB 3GQBB 1HYBA 2XQGA 3UMSA 4PTYA 2XA1A 1JIKA 2Q9AA 3OLXA 2JGJA 3IBGA 3G1WA 1M73E 3O84A 3L4JA 1WVMA 5JZSA 3QLUC 4P81A 4YJHA 2I8AA 2IZ0A 3T8YA 5LR6A 4BP9A 3L8CA 1YZVA 3WJAA 1EGMB 3K5WA 3NTUA 4NATA 3F5FA 2QUIA 5IH3A 1PHPA 2Z30A 3AUFA 4M8LA 4WERA 3QWBA 1JLLB 3KB6A 1UDCA 2C00A 1C1DB 4H1UA 4KPUB 4C7OB 3TH5A 3PGXA 1L7MA 2NUPA 1TI7A 2QSYA 1JDJA 1NXXA 2N47A 4IGKA 4PPGA 4RZSA 5EE9A 3CH7A 4N1AA 2I2DA 4G0ZA 1FC0A 1TW3A 1GLNA 2RHGB 4HSEA 2D3WA 2ATEA 4ZQBA 4U4AA 1QO0D 1M0TA 1M6HA 3DFUA 3N2GA 1WLYA 2NSLA 3MIIA 2PLWA 4MYHA 4QRHA 1JEQB 3IBFA 4JDPA 5CBPB 5HBRA 2C9MA 4IOKA 5EEGA 1GCIA 3O6VA 5DHAA 4BO5A 1O5TA 3M6UA 2ENWA 5IJZA 2FK8A 2W8BB 2OORA 5E6RB 1LX7A 2CFCA 1QG4A 3GELA 3BKXA 4K9QA 4BCDA 4Q7MB 4PYJA 3WTBA 4HNVA 1FNMA 4ZYWA 1Q22A 1B1CA 3EFBA 4AFNA 4B35A 1L7BA 1E4EB 3CR8A 1OIWA 1P5HA 1BQEA 2PA0A 3T3OA 4MV7A 2O3TA 2WTNA 2XXAB 5EZYB 2POCA 1DXQA 1N6RA 1GWNA 1Z4OA 2JD1A 3KYJB 3I73A 3IV9A 4JBXA 4H4DA 3ZY3A 2ATCA 4PYOA 5DHRA 4YRIA 4G2NA 3NV7A 3ZH9B 3C3WA 2FSUA 4JJ8A 2RGWA 3T1NA 1OTHA 2PH5A 1YJQA 3DW1X 4LHVA 4CKEA 1U2GC 1OYWA 4YCNA 1Q7CA 5ICGA 1X7ZA 2C9DA 1AGPA 2BLLA 2OCYC 3D4PA 2ES4A 4DCTA 2PZJA 4YWJA 3E3AA 3F5DA 1GGJA 4L0MA 1KEEA 3SYNA 3K0HA 4RKEA 1WTCA 3ZU3A 2QZ9A 3N39C 4K7JA 5CBKA 4L78A 5A3QA 4Y0AA 3UAGA 3T9DA 3AHJA 1R16A 4TT3D 3GY0A 5K4AA 3LV8A 4RKRA 4R1MA 3G5MA 4P58A 1OWOA 1SOMA 1E60A 1KY5A 1PF7E 1WEHA 2HRRA 3FCUB 4RY0A 1QHEA 5F21A 2IP2A 2JFPA 2DHEA 2Y1FA 2QJOA 1VI2A 1SCUA 3M5PA 4LAFA 3K9CA 2C8VA 3D3WB 4YACA 4ZOLB 1KJYA 3VUFA 1Z3CA 3RLFA 3KKPA 2B1QA 3BJRA 4YP6A 3ZVLA 1UAYA 5EZSA 1QH9A 1W8IA 1JBKA 3KALA 2GCGA 5JAOA 4P82A 3R3VA 4GT1A 5K0JA 4JI0B 2ZDHA 2AG5A 3I9V6 5ADUS 4CLOA 1J0XO 2VT3A 3RHZA 1IYZA 4BCBA 3DMNA 1WW3A 1W4ZA 3VOSA 4X7PA 4RMIA 1IIRA 3TL6A 1E3WB 5K0FA 3ZD8A 4RTMA 2W9XA 2PTHA 1BEZA 1WCIA 3ROMA 4BV8A 4EVRA 1V8BA 1SXIA 1AQIA 4K6FA 1SVOA 3TZBA 1YACA 3NTRA 3QV1A 2AWOA 5JQWA 2XGGA 3B9PA 3P27A 3V1UA 1U3WA 2HSGA 4LWOA 3ZWAA 5LIRA 1RLJA 5ILOA 4QO8A 5A5FA 1WZCA 2IA5A 2NZWA 4ID9A 2BJVA 3EBOA 4JXXA 2O06A 4U00A 1EUDB 4KN8A 2AF3C 4C20A 5HZHA 5HPYB 2DR0A 3QVSA 3DF9A 4MRAA 3OJOA 4F86A 1WDWB 3USZA 2XZOA 5EIXA 4OBEA 2IBTA 1P1IA 1F8UA 5EJAA 3FCAA 4H27A 4KQEA 1PGOA 3VVMA 5JJBA 4KNWA 2NV0A 3UXEA 4K0KB 4AM8A 1QV9A 3EG9A 5JAMA 2JCVA 4U3JB 1RP1A 3EUWA 3H11B 1REQB 3PVZA 4DCVA 3R7SA 2NP6A 1YJAA 3DDZX 4A8JC 4LUCA 3D6AA 1VI6A 1YOVA 3MCZA 3WC4A 4L8YA 4J0EA 5CXQA 2A59A 3OQPA 4DIDA 4I08A 4WH0A 2J5QA 4HB2A 4QATA 2J5RA 4YY3B 2P4SA 3UBTA 5CM9C 1NF9A 5FFNA 1JSXA 3WMGA 2IVFA 2O57A 2Y68A 3P52A 2IYOA 3K4HA 4MXDA 2FPKA 1GRRA 2QTZA 3O7WA 5BQXA 2CFRA 5HIKA 2DRIA 4WXYB 4