4QJIA

Crystal structure of the c-terminal ctp-binding domain of a phosphopantothenoylcysteine decarboxylase/phosphopantothenate-cysteine ligase with bound ctp from mycobacterium smegmatis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
229
structure length
212
Chain Sequence
HHDMAGVKALVTAGGTREPLDPVRFIGNRSSGKQGYAVARVLAQRGADVTLIAGNTAGLIDPAGVEMVHIGSATQLRDAVSKHAPDANVLVMAAAVADFRPAHVAAAKIKEPSSIDLVRNDDVLAGAVRARADGQLPNMRAIVGFAAETGDANGDVLFHARAKLERKGCDLLVVNDGWLLSADGTESALEHGSKTLMATRIVDSIAAFLKSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the C-terminal CTP-binding domain of a Phosphopantothenoylcysteine decarboxylase/phosphopantothenate-cysteine ligase with bound CTP from Mycobacterium smegmatis
rcsb
molecule keywords Phosphopantothenate--cysteine ligase
source organism Mycobacterium smegmatis
molecule tags Ligase
total genus 62
structure length 212
sequence length 229
chains with identical sequence B
ec nomenclature ec 6.3.2.5: Phosphopantothenate--cysteine ligase (CTP).
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04127 DFP DNA / pantothenate metabolism flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CoaB-like 4qjiA00
1U7WA 1U7ZA 5INTA 1U80A 2GK4A 1U7UA 4QJIA 1P9OA
chains in the Genus database with same CATH superfamily
2V3WA 3ETLA 3RTBA 1J99A 1MP0A 2JGRA 3HDHA 4G24A 3WLIA 4URVR 1AUOA 1J0CA 1I2MA 3AXTA 5B2EA 2QBYA 5BR1A 1ZH8A 4D79A 3UCXA 2IP1A 1JN0A 3E5NA 2JIMA 3I9JA 4QU8A 4I1OA 1OKKA 4ZQBA 5U4XA 3RKUA 1EINA 3C16C 4C89A 1WB4A 2IUEA 4UU0A 3UMFA 5HHTA 1KAQA 1F2VA 2DKNA 2PGNA 4Y2RA 5AVYA 2HQBA 1HDCA 1QCZA 3BUSA 3U5ZB 1N6NA 4XR9A 4MVJA 2XBUA 5CLQA 2GZDA 1ENOA 4Q3AA 5DRTA 3ENNA 2QV7A 3LLVA 4PE5B 4YFYA 5L4SA 3LC2O 3ZIUA 4ZO7A 1E63A 4I8XA 2BWJA 2QMEA 1HX7A 1Z37A 4Q9KA 5IVPA 2IZOA 3KPWA 5HCNA 3QOYA 3NOXA 3ICCA 2NZVG 5AKXA 2EHJA 4B2YA 3FDZB 3HJHA 1Z0AA 4JKIA 4AIIA 3OQ6A 3T7DA 4MEJA 2NTJA 5GM1A 3DA8A 1C0LA 1FNDA 4IXDA 4YLEA 4QPNA 3SC6A 1X80B 3ZEIA 1HNXB 5LQSA 2JGIA 3OFKA 4FOSA 2JJQA 2JARA 3TIFA 4PRYA 1CLUA 4AN1A 3LPNA 1DKQA 3EYWA 1EVEA 1ZSVA 1W52X 1Z4JA 3Q40A 3GJXC 4A6DA 2O2SA 5C0OE 1Y80A 3EIFA 3RD5A 1JVNA 1XVLA 2HJVA 4EZIA 5ICMA 1KI6A 1ODJA 4JLPA 3K6SB 2BGJA 3A04A 3N8NA 3Q2KA 4MV9A 5CX1A 3F5FA 2BKLA 1VBFA 1B3RA 3NHLA 4PAWA 1R9GA 3CHYA 3NXKA 3UCFA 1FNMA 3A3KA 4KE6A 4N0QA 1QH0A 1U5BB 1U2RA 2C54A 3ZLUA 4DC9A 3JU3A 2R47A 1YFJA 1LH0A 4YH1A 2X1MA 3ONWA 4FGKA 4CF3A 2YW9A 1N3LA 5EIBC 4OHFA 1CF9A 3ZDZB 1GZ3A 1VG9B 1YRBA 4IH9A 2JIQA 2WHEA 5EHXA 5CNKA 4YRNA 3NTQA 1T2EA 2ZJ0A 3WGJA 3ZVMA 5KWEA 2FZ5A 5DCWA 4ARCA 2RG7A 3PI6A 4KRGA 5DT2A 3RHFA 2VDVE 3QTBA 4QO8A 4B75A 3S1AA 3MJTA 4WA8A 3LRPA 4GDFA 1BX1A 4RHCA 4DZTA 5ES3A 4YYEA 1UK7A 3AEQB 1RD4A 1E2LA 2PX8A 3F98A 1IL0A 1U9IC 4IKOA 4ESOA 2HQOA 1CRQA 2C61A 4NE9A 1IM2A 2DQ4A 4EVSA 3R0IA 3KR0A 2YX1A 1TK9A 1SC3A 2EKQA 3EZFA 2HQSA 1PTJA 3FOWA 3DH0A 1QF7A 1R88A 4RY8A 2GB4A 1JEYB 2P2NA 3RVDA 3C3XA 1UCFA 1LX6A 2QTWB 4GPIB 3HR4A 3EA0A 4R1QA 5DMHA 2V8OA 3VPDA 3SSMA 3SF0A 2W58A 3L93A 2Q1WA 2PLFA 3CPJB 1Z8DA 2G09A 2ZWMA 4PFQA 1N5KA 4O4LA 1DKMA 1F1BA 4FD2A 3D6NB 1NBMA 5C4MA 1ZMXA 5AMXA 3U81A 1KU6A 4BX9A 2IYAA 1LBTA 3PCXA 4IIXA 3M9XA 4B3MB 4JEIA 2BEVA 3D6AA 4HAUA 3B53X 4UAUA 2P2LA 3G13A 3C7CB 4IZ6A 3FHJA 3IOYA 2R5WA 2A67A 3OBBA 2B9VA 2PZJA 4RD6A 4C0XA 1Y6QA 3HO6A 1RHQA 4EX7A 3TIIA 3FPKA 4EI2A 1XZPA 1W88B 4E4TA 5HK9A 3OSUA 1ZWKA 2B6NA 2R87A 4MW7A 3R6LA 4RHXA 2R4TA 4DDHA 5HQ3B 1WHTA 1U2QA 2GK7A 1XJWA 3EVNA 4GUDA 4W8OA 3EJ6A 3D5QA 2XUQA 5BWLA 1S1CA 2O1XA 5ENZA 1A27A 3KLPX 4M60A 3UJDA 1BD3A 2JFFA 3OICA 4YYZA 4Q37A 4W1QA 5ECWA 2C20A 5G4KB 5CYOA 1N7JA 1NBIA 2H4XA 3FR8A 4M1YA 1J5PA 5LLDA 2NW6A 4P92A 5C37A 2WAMA 2ID9A 4QHYA 3T12A 1J7JA 5F5NA 2XF8A 3TQHA 4F60A 4FLMA 1NTRA 5H1YA 1Y3FE 5FPPA 3GAMA 4DLUA 1EJ2A 1OWOA 4KN5A 5CG1A 1NVTA 3FVVA 5BSMA 2OCDA 4QHSA 4PBRA 4HDQB 1M7HA 2CB9A 2RH4A 2K2WA 4XCVA 3O2JA 4P0PB 3N8KA 1XVTA 3JARA 3OESA 4BL5A 1TA4A 1LTKA 2BGMA 4RIHA 2JI4A 2CCJA 2E7ZA 3C6XA 4KWEA 2I80A 3VKHA 5TT1A 3GMSA 3DCYA 1T5OA 3T52A 5KYTA 1N0IA 4GBJA 1XDDA 4IDQA 4EAAA 4MJXA 1R5BA 2NU8B 3FTDA 4BVAA 4CR8A 4RKFA 1T4CB 1P0IA 3PQ8A 1KY3A 3HNOA 4YQZA 2J32A 3D1LA 4G0MA 1H2BA 2QTHA 4C6TB 1G291 5JCZA 4OD0A 4O4JB 3JTEA 1XMQB 3V4ZA 5TQVA 2PBLA 3D59A 2L69A 4JXXA 1KSHA 5IJ0B 3EUAA 4L3OA 2X5XA 5J58A 1AQYA 3SF8B 2EBFX 2NO0A 2EFHB 2A1UA 1CFZA 2AXQA 2XX3A 3FNHA 4LIPD 4HTFA 3AUFA 3SR4A 4I36A 3ZJYA 1XHFA 4DWJA 4BMZA 4W9MC 2VNKA 5LPNA 1P4SA 1SOWA 3HZRA 2JI9A 5C1DA 1FDOA 2AHRA 2ZP1A 1TO6A 4U2GA 2OO5A 4U9HS 1GRRA 2AJTA 3B78A 3GBPA 4S2UA 4UBNA 1NYLA 1KRXA 4UTOA 3DMRA 5ANRB 1I2AA 3NEPX 1Q0PA 1UFVA 3CNEA 1FXSA 5AJVB 2HCTA 1CY8A 4ZU1X 1K4YA 3C7DB 4B2PA 4EAQA 1Z2EA 2JFVA 3W78A 5AKHA 4ER3A 1QXSA 1UM9A 4N6GA 4LX0A 2FFHA 2JLAA 1QHXA 3GMDA 5DM1A 4DTIA 3EDYA 4R81A 3CSDA 4EITA 5JAHA 5KNBD 5JNVA 3BMNA 2GXSA 4PGHA 4NFLA 3WGUA 2C96A 2UYQA 1SH7A 3A7EA 3LUPA 1AXRA 5EJ2A 3A27A 4OQ4A 2OZEA 1TX4B 3MTQA 1PNVA 3V7YA 1ECCA 4M9QA 2MYUA 2NGRA 2WICA 4V3CA 1VLJA 5FTMA 2XE7A 1VL0A 5CK4A 5FOXA 3WGKA 4D5GA 2TMGA 2X86A 2D8AA 3EGIA 3LKVA 3ZLJA 5I4KA 1VPTA 2XQKA 1GAWA 1Q1AA 2ORYA 2Z1MA 2OYCA 3WICA 5HMLA 1YZNA 3OJ0A 2IS6A 2ATXA 4IF4A 4U7HA 4BUCA 3I52A 2PXCA 5JQGF 1XKQA 4AVYA 4I2VA 2YJGA 1IQ0A 4ZN6A 4GX0A 1WR8A 2PKCA 4EGCB 5JMTA 3OLXA 3ONEA 4BWVA 4F2PA 1QG4A 4LZPA 5IZ4A 2QJWA 2ZAIA 2UUCB 5HGJA 3D6MA 3TS1A 4CZ2A 3FZQA 4EO4A 1ZISA 3ROEA 2RHBA 3COSA 4NH4A 4OB6A 5HP4A 4ENSA 1YC5A 4Y9SA 2EZTA 1MPTA 3K16A 1H1LB 3PENA 3X44A 3SHQA 3K0KA 3WAJA 4B9AA 2NU7B 2C2MA 5HS6A 4ESEA 1JALA 3NNNA 1A69A 1FUIA 3UPUA 3SDZA 3FR7A 1HSOA 4O8CA 4MDHA 4PZAA 2X5NA 4OQDA 2RONA 1HI9A 2FA9A 3A6HA 2EW2A 3OZRA 1IZZA 1UBHS 1HUQA 4W5JA 2JIOA 1OB5A 4LBZA 4TLLB 1DQZA 4EKIA 2EJWA 1Y3HA 2WWGA 2Q6LA 2OSVA 4JJIA 4Q47A 1WMAA 3WLFA 1LSJA 1UR5A 2PD3A 1ST2A 2QPOA 2GKGA 3LVQE 1BIFA 3I9V1 3W8DA 4EQ6A 1V16B 2HNAA 5LYJF 4D74A 3Q8MA 1Q1ZA 3HZHA 3AL0C 4AT1A 1W5SA 2CDCA 1VXOA 5G40A 3FZGA 4XTCS 4DEXA 5JPDA 2O54A 4FC6A 4IYRA 1L7VC 1E2DA 2ZIAA 5ICEA 3GT3A 2LVBA 1WXQA 1BXZA 2BGNA 5JI3E 2YJNA 4P8RA 3V7WA 5AWFC 2R2GA 4L1KA 1N2JA 2BGTA 4U00A 2YVAA 1MFPA 1QE5A 3IDQA 2IX9A 2WJ4A 3VPBA 1O3YA 5JDCA 5J23A 2R9VA 2XF2A 3OIVA 2IZ7A 1KC1A 4E5PA 2I8CA 1NTOA 1JLKA 2HQ1A 1EVLA 4KVAA 1VA4A 1JW9B 2VZLA 1RBZA 2FP4B 4HNAB 1XJQA 4HAIA 4I50F 1L8LA 1X7ZB 3V6MA 3DUFB 3UWMA 1U2DC 3GPIA 4WEOA 4L4UA 1K2VN 2CXHA 4DCOA 2ODNA 2VTBB 1EHYA 1LPOA 4IDCA 3O47A 2QUIA 1BGXT 2OQRA 4TMFA 1IVSA 1FVXA 1AZSC 4AL4A 3BZBA 2HSZA 1Z5NA 3EA5A 2MYNA 2QIOA 2ZJ8A 3T4UA 2W42A 3WIBA 5KHLB 3DZ8A 2NXJA 2BFDB 2ZULA 4TLCA 4U4AA 1UWLA 3ZDYB 3V2HA 2CLOB 5BMVA 5JSYA 3SQMA 2JFPA 2XCSB 2QD4A 1WIWA 1JGTA 3FOCA 4HYEA 3T6KA 1OWLA 1NC1A 4X71A 5FWYB 1R5JA 4U02A 3S4YA 1UUFA 4JC5A 4LJSA 4ZVNA 1ZMOA 4F3CA 5BW8A 5JTTA 3RC2A 3D4NA 2ACKA 1TM3E 3BTUA 2QHXA 1K08A 3JTMA 2QA5A 1RHJA 1O5OA 3TSCA 3IBCA 4OUDB 4BVEA 2NO9A 3K6RA 3A9WA 1YI1A 1V2GA 2IKSA 4MUYA 4MWZA 1DU4A 4MEAA 3HBFA 1UBNA 2R96A 3ZJ5A 5AVWA 3FKSA 1ZM9A 5TSDA 5F73A 3Q12A 2PTGA 3SZLA 3LXXA 3ENZA 3QU9A 4EFMA 3MBIA 3HXOA 3KHUA 1ZM2A 4BV2A 1BFUA 1TD1A 2GCIA 3R5FA 4QXQA 4RJ2A 1V26A 1ZUNA 1JUDA 1REQA 1K6EA 2AMVA 2GWRA 3A6JA 4ON9A 4ZCRA 5AW3A 2BGUA 2Y0PA 4FMCF 4WXHA 2IYFA 4NBVA 4TRNA 1P4HA 1RQGA 1OFTA 2F59A 4OQPA 1PQPA 3QBDA 4OXYA 5EP2A 1YOBA 6ABPA 2A30A 1ILEA 4YCAA 1G5TA 1ZW6A 3H5IA 1CS0B 4ML3A 5CA1A 5BR4A 3VR5H 5ELXA 3NRBA 1DI0A 2VJCA 1YR9A 1XZKA 2IZ5A 2YY6A 4J7AA 2X14A 1XHEA 5F23A 2ZJAA 4ZVPA 1LPNA 4LC1A 2IP4A 1FMTA 5CTJA 2ERXA 3SBXA 5CBPA 3TVYA 1L7PA 4OJKA 1EK5A 4X97A 1WULS 2WIJA 3ROGA 3O73A 5AM4A 5EMMA 1XDGA 3EZNA 2ZYTX 3WLTA 4URXR 1NJSA 1T0BA 1CY6A 3C1UA 3C1AA 4YRFA 1P1RA 1VTKA 3CFYA 4RDIA 4XJSA 1BVUA 2NV0A 2OVFA 2YS6A 1E69A 3DVQX 3EEIA 4K6HA 1QGYA 3LUKA 3O8BA 4J0JA 1X42A 2PS1A 5ENDA 3VPHA 1U7DA 3HYLA 7ADHA 2AL7A 4D4GA 4H31A 3HMQA 3BWVA 2XQVA 4HEQA 4D8WA 4P3OA 1DZIA 3HBJA 2YXLA 4QC2A 4XJXA 3VJRA 1B0ZA 2J85A 3FY4A 3PUJA 1KS9A 2H6EA 1JSLA 3LPMA 2XDWA 2I6TA 3A7DA 3RRYA 3G9XA 3W2GA 3HKEB 1ZOIA 2VDWB 1LS6A 3F96A 3KVNA 4MS3A 2EXXA 3I9MA 4WAUA 2MU1A 5LB2A 2Q07A 3T94A 3TTWA 1M2OA 4DA8A 1EH5A 1BJKA 2BVNA 1ECGA 2WAXA 4ZTZB 2PL5A 13PKA 4ISBA 1TDJA 1UOQA 1YU6A 3IUQA 3E4DA 5E38A 2Q5LA 1LKZA 4AKIA 2V7QA 1Z12A 1T4MA 1DVRA 3CCCA 5AKJA 1Z07A 1V3QE 2IYRA 3SHWA 2OZVA 4OFZA 2NUAA 3E84A 4I9UA 4B81A 2QL6A 3QYPA 4DMFA 1SD1A 2PDAA 1GU0A 1T3SA 2GNOA 1NU6A 2O5VA 3R2JA 5FAKA 4IFTA 1T9GS 2Q5IA 1GWNA 1K5HA 2JDID 4NU8X 3ZPXA 5E95A 4BIIA 2CJWA 2ZZNA 3K5WA 2H1IA 2Y27A 1IB0A 1XD2A 1O9GA 4R01A 1JQ3A 1F4LA 2PE5A 4ERNA 2BE7A 3JATA 4HFJA 5EIAA 4OL0A 5C46F 3KUXA 3CW2A 4PC1A 1BHSA 4IDDA 2Q2WA 5FNVB 1V4VA 2DRIA 3R6DA 3KBOA 1P7WA 3QPVA 2AW5A 2YHUA 4TTJA 3UK7A 4A2QA 1ISHA 1F2UA 4K9MA 3ILHA 4NSNA 1NM5C 5AD1A 4UUNA 3CA8A 1W6UA 5CU7A 1VB5A 3R0JA 1X74A 3WYEA 5ITZA 3COJA 4UVDA 4JA2A 2XWBF 2Z6UA 2FEMA 2K2QB 3N87A 1OT3A 2ESRA 2JI6A 4I1IA 4F91B 3DTYA 4WNAA 3T38A 1YVPA 1BKDR 1U8TA 2XVZA 3A14A 3PL5A 3UB2A 2O8FA 4NVRA 5TJ9A 1IXZA 2W8ZA 3OZWA 3P20A 1Q1GA 2ZT8A 3RH0A 1RABA 2PLAA 4Y9UA 4MRMA 5AM1A 5IZCC 1KQOA 1BE6A 1JECA 5IW8A 1ZVJA 1EJ0A 1GUYA 4WOJA 2NMVA 5E1BA 2ZBPA 5JC8A 1A77A 3GJ5A 5CCXA 3GCDA 1A4RA 1XV5A 4CGYA 1BVRA 1SVOA 3RS7A 1AMNA 4RBNA 4G5GA 5GY7A 3QSYA 2ZYAA 3C41J 4L3VA 1GEGA 4F86A 5JT1A 1UBCA 5LA6B 2OZKA 3D4PA 4Q21A 4C4PA 3W9YA 1CUSA 4MPRA 4NU6A 4JJKA 3SY8A 2ONJA 1VHTA 4AROA 1X1RA 1F20A 3SDBA 3ON5A 2MSNA 1X70A 5C5DA 5DV9A 3UJAA 3AI3A 3L1HA 3BM5A 3PFBA 1TJ4A 3MERA 1C4XA 3IALA 3R5SA 4Z4IA 4UBLA 4RLQA 3D4BA 1U7TA 1GYPA 2ZRDA 4ILEA 4IXMA 1SU6A 3T3PB 1S2OA 4FNOA 1YFLA 3IAAA 1IBCA 1S3FA 1A88A 2C9YA 2A78A 2X2FA 3FNEA 2B98A 3H2HA 4D9CA 1S8AA 5HOQA 2RAFA 3OTHA 2WFLA 3OCJA 4PX5A 2YWDA 1JDJA 1XTUA 4OJMX 4CM4A 5D6OA 3HHEA 2CXTA 3OC0A 2NLOA 1BE0A 4NCIA 5LZ9A 1B8PA 5CAEB 5A71A 4S1WA 1PYGA 2AQ8A 2IIQA 2VDUE 3NW9A 1E3SA 1PGOA 1ZIDA 1D2CA 2YCLA 3E6AA 3K9WA 4K7JA 1U65A 2Z8YA 5EWLA 4JBNA 1CRZA 2J4FA 3FWZA 1IM5A 4ZANA 3T8YA 4A0RA 3WQSB 4OHVA 1JEJA 5FP0A 4ZI2A 4I5IA 1MQ8B 1NMZA 3G23A 4BCDA 1BWRA 1ZA1A 2H52A 1MLDA 4FZ5A 1NF3A 5I4IA 1HFKA 2XVMA 3FMFA 3ESZA 1BJRE 3QRWA 3RGWS 2O3RA 3GCGA 2W4IA 3OCZA 5JYBA 4U7DA 4EYGA 1V5GA 1YASA 2P30A 4LRYA 6YASA 1GU1A 3ZXYA 4Y6QA 2CNLA 1DQRA 2EJBA 5DIFA 4PG5A 5BQ5A 1EP9A 2RHTA 3BL6A 4QBKA 4A27A 2UYOA 2NT3A 1GYQA 5C4IA 3C3WA 1FXWF 1NFRA 1JJFA 3FLBA 3GNLA 3SDSA 1SIBE 4S2EA 2XKAA 3EOZA 3P7MA 5LNK6 5LJIA 3KAKA 3OH8A 4ZT3A 2PU5A 5EYPB 3U37A 4XVUA 1XXHE 1J20A 4BECA 1H22A 3KSRA 3HKBB 4MYDA 2E89A 3FFAA 4KYUA 4LNAA 3BH7A 1L9KA 4X85A 4NJMA 2ODAA 5A9RA 5EWJA 3WB0A 3FF1A 2B69A 2VQSA 1UJ5A 5EJGA 3ZE2B 3EFBA 5EZYF 1Y3BE 3F3SA 3AEZA 2ZBRA 4V1CB 1EXNA 3P0IA 1ZLXA 2A1IA 4XQGA 1LX7A 3DDOA 5DYNA 1LNZA 2FHPA 1VIAA 2Q9UA 4RVCA 1T2NA 1T6YA 1VHQA 4G0OA 1FRZA 3N2IA 5H4HA 4M76B 2JH9A 5DN9A 5FBZA 4IHJA 2HXSA 2V6MA 4JA0A 3ZW8A 4XB6B 4MVJP 3E82A 1ORVA 2YR0A 3DFZA 1PBNA 4DREA 4Q4JA 1GNTA 3PEWA 1K5GA 3E48A 1RMYA 4LNUB 4PZPA 3CVJA 1MOZA 1GPUA 4OK6A 4QZVA 5JFGA 1UWKA 5J2TF 1RWOA 2BV3A 4ZVOA 2X1HA 2K87A 3NATA 4B4DA 2DY1A 1O5IA 4FT2A 1IOZA 3O3NB 3ZU4A 3HDJA 1YVEI 1LPAB 3HJCA 1RZRD 3A4TA 3PR1A 1P1FA 5L8VA 4XDYA 1CF4A 2LZ0A 1BZYA 5EWMB 1JIVA 5JJLA 1UZMA 5KX5F 1L1QA 1MT0A 1WTAA 1B8UA 4TL9A 3P9YA 4QAJA 4ALKA 2HF7A 1X0XA 1O5TA 3E5MA 4NBWA 1X7XB 1Q19A 3FYHA 5SZJA 3UH1A 4CBVA 1U99A 4HATA 2YRXA 3EBLA 4MW2A 4DDUA 2B20A 1ZXLA 3Q8WA 2Y1LA 2ZSUA 5JCJA 2JW5A 3LTNC 4WBNA 4XOUA 5A1JA 1E2UA 3PXEA 5ERXA 5AK5A 1NRWA 3GC6A 3CH6A 2Q2OA 1OXVA 2EFYA 4GZ3A 5KNDD 3S1LA 2GO1A 2GRAA 2EGHA 2JIRA 3ZVNA 1I1OA 5DLQC 3ZZTA 4TXNA 3RHZA 3GHYA 1J2EA 2VHVA 3QTTA 4YGYA 5K8IA 2ZUWA 1XSEA 4NEGA 3AY3A 3PYLA 5MN5A 1L5FA 1ECFA 1COWD 1BHO1 1JSRA 3CH4B 2GTHA 3D6TB 4EX6A 4D41A 3Q2OA 4P3KA 3C3DA 4DSOA 1P2TA 5K0GA 4Y6PA 3W5UA 3GWGA 5BSGA 4QOIA 3CG4A 3BKXA 5J3JA 1HYHA 4MOWA 1SUPA 4XEHA 3IEUA 4PZEA 2GERA 4ZOBA 4DR3B 4K03A 4L4YA 1C8KA 1R37A 2E9SA 2G4LA 2HDNB 1E7WA 4OM8A 1IZYA 2EIHA 3F74A 2PN1A 5AO9A 2HR1A 3AUUA 3ZI7A 2VKTA 1TCBA 1VCOA 2H1RA 3HWRA 4GVPA 4CQMA 2Q5QA 3PT9A 1ADGA 2YRFA 3ED5A 2CGEA 1G55A 4BQOA 1E3QA 3KETA 4YDQA 2C5HA 2P9TA 4FZRA 1ISIA 2QTVA 4C4TA 4L76A 2QR3A 1KO5A 3R23A 2XTAA 2RHDA 1BD4A 2XB6A 3LWDA 1BN7A 3PX7A 4GR4A 1D04A 5JAIA 3PJRA 2FK7A 4WKNA 2B7LA 2BFFB 3SU8A 5A9TA 1TVKB 3KKEA 3PG5A 5BW5A 5M3BA 1EP1B 5JC1A 3O91A 3M9LA 4QUEA 1J6UA 2O0HA 5CIWA 3U09A 2H8GA 4KMOA 5KSYA 2IYYA 2V5AA 3A1WA 1PS9A 2HLHA 3RTAA 3K0SA 1TE2A 3A28A 4O2LA 1H5UA 4ES6A 3DV9A 1L5YA 4P3YA 1C3LA 4Z8YA 4DPKA 3COZA 2HL6A 3HB0A 4X6XA 3CGWA 3FUUA 2PUEA 1KY5A 4XW2A 2ZJ4A 3PGXA 1J8QA 3NKLA 3QX7A 3JQ8A 3PWZA 4WXPA 5CRIA 5AICA 4MW6A 5BN3A 3OMXA 3CR8A 3EZGA 4MR8B 4J16C 3TZEA 2BF4A 5L7TA 5A6SA 4IMPA 1SBCA 1E66A 1IH8A 5TPWB 5IWAB 3TG8A 1A4UA 3GOQA 1G0OA 3PICA 2FLKA 2IIBA 5LR6A 2JGJA 3HNPA 1EGHA 2R86A 4M53A 1Y7IA 5DPMA 3DEAA 2DTXA 5HWSA 1P9WA 4R8SA 4Q3CA 1WE2A 4IGAA 3AKYA 4NS1A 3IBGA 1IOLA 3BJZA 1AK1A 1B0PA 3DP9A 2FX3A 2W43A 3HWWA 3P0HA 4NONA 3RAGA 2VPYA 3S5UA 4A0HA 1JL3A 2I4RA 3VVBA 2YICA 2R1VB 3BDAA 1NSYA 2R68A 5IBPA 1JFLA 5JD5A 1EZ4A 4LWOA 2ZPUA 2R8YA 2ZUVA 4DKXA 4E5KA 4N65A 1V8FA 1O4WA 1TAGA 3B1XA 4D9FA 5T57A 3T5GA 3AV0B 2J0EA 3WYCA 4Q1EA 2QQFA 3Q7PA 4S1PA 2IEGA 2BMDA 1ZCAA 2XLCA 4HDMB 4K6GA 4YJ3F 2CV2A 5FJIA 3HWSA 1EFVB 4TTAA 4DA0A 4KKXB 1OFUX 2C9OA 3T3OA 3MUOA 1W75A 3THSA 3AVYA 4NMLA 1GPLA 1PZMA 3L0CA 2J48A 4PAGA 3KR9A 4G36A 3C5WP 5AW6A 2V97A 1XLVA 5AOAA 5AT1A 5IAGA 3HA2A 1TUGA 1U1DA 3L9XA 2RAPA 2VP4A 1WS6A 2NNWB 3MQFA 4ID9A 4KAJA 4OB7A 4P98A 1XEXA 4IJVA 4RPCA 4D9GA 3NVDA 4EY3A 3IE2A 3HL0A 1NASA 1THZA 3V4RA 2Q3MA 3FKJA 1P1IA 2NSLA 4V0NA 1GN8A 4YRGA 2Y05A 3EEFA 1T8TA 3AZOA 2X1LA 3DEFA 2Q0HA 3HR7A 2QMYA 4RSMA 4JC8A 5K20A 1NXWA 5LOVA 2XXBA 4G5QA 1JHUA 4WDQA 2VWGA 5EQJB 4DLPA 3KSBC 4LF6B 1X7WA 1ZL0A 2FW6A 4KR6A 1XMOB 5KYVA 2GJAA 3IB3A 1DT5A 2P9EA 3NZEA 1BXRB 3IEVA 1QHSA 4ZCMA 2LCFA 2HFJA 3QW4B 4RJLA 4X8MA 3OURA 1D2GA 1ODTC 1M2VB 1WP4A 3IXMA 4N3NA 2EG9A 4Q9NA 2W2VA 4QQFA 3FTPA 1Y82A 1KH3A 4NU5A 1WKVA 3RVNA 2NG1A 1NJGA 4GP9A 2TECE 1O7JA 2GDZA 1FX0A 4PLPA 1F5NA 2QB5A 3LECA 3ORYA 4K46A 4RDHA 3U7HB 2D06A 2QM0A 1F17A 4NZYA 4WJKB 3ZE6A 3AETA 1XDUA 5EEHA 1G41A 1NQXA 4G4JA 2Q5JA 1GV1A 2CJFA 3B60A 1PNTA 5K4GA 1XRPA 4W9NC 1JQJC 2JCBA 4FYKA 4F45A 4HQ6A 4UDNA 4Q19A 1YRYE 4BC1A 1RYZA 5I01A 2BFBB 4NI5A 2VIIA 3IMFA 3Q2IA 4XDHA 4E5SA 1SKAA 1SCDA 2PZLA 1V7PC 4GOKA 4IDHA 4BO8A 1KARA 5LWQA 2WYWA 3ROQA 3ZUGA 3ROTA 1JPJA 1IONA 2JIZA 1CTQA 4HDCA 2VAPA 3NANA 5A3SA 2IV2X 3TGWA 4HAYA 4MMZB 3WMRA 4IHQA 3WSTA 4AY6A 1OTYA 4P31A 3EGWA 4FKZA 3NT2A 5C5EA 2P11A 2LR0A 5EVJA 1GITA 1T6NA 1WCYA 3ZHYA 4NF2A 4ASUD 3KKNA 3UAYA 9MHTA 2D0PB 2W6NA 1U7UA 1C30A 3CBGA 3KRTA 3I37X 3KVVA 4U6QA 4WHMA 5LBTA 4B0PA 4DNQA 4ESHA 5A6VA 5K6TA 2W2TA 3WLMA 5THXA 1RWPA 2I76A 1ZR2A 3KOMA 3ROMA 2E5LB 4JI0B 8LDHA 1Q5PA 1GNRA 3K2IA 2EKZA 2H7XA 3UOWA 4PZ0A 3OLCX 1MA0A 3TQOA 1DEHA 4XFJA 1K92A 5BSEA 2K4MA 3DFMA 5JZBA 2JATA 4E21A 3H7AA 3NU1A 2ACWA 2BOVA 4DGQA 1PGNA 1UINA 4UE6A 3DBLB 4DSZA 2PKXA 4UUQA 1Q3KA 2NNLD 1LZLA 2VYCA 3AM4A 1XA3A 3LXMA 1EG7A 4MV3A 4R51A 3WO1A 1P6UA 2DERA 3GLGB 2D2EA 3RSOA 5BVGB 4NMMA 1UDRA 4UM5A 3V1KA 1E3TA 2WHYA 3BDVA 4MP6A 1OCEA 2JF0A 3PK0A 3NGMA 4HDSA 1J2JA 3ZGZA 4Q24A 2HY7A 1W0KA 3V8RA 1BYUA 1K97A 4WZBA 3I9FA 3ISVA 3UJHA 3WRYA 4HNQA 3B5IA 1AN0A 2Z04A 5CB4B 2DLDA 2I2WA 3MAGA 3Q88A 2WU8A 1G8PA 2VH5R 4WOCA 2DFVA 4BU1A 3ENVA 1IBKB 3HADA 4QDXA 1ICIA 3UZUA 1DDOA 1S4QA 4LOKA 5F9HA 1Q0RA 4LOAA 5EP4A 4ZT7A 4CE6A 4NYJQ 1AXGA 3O94A 4RPHA 5FXMA 3OPYB 1B0UA 2CBZA 2VQFB 3ZCQA 4B6JA 2CV1A 2YWEA 3LFTA 4Q9HA 2ZU0C 1HZZA 1AF4A 4A16A 1OWNA 1C8LA 4EJFA 3SZMA 2ZE8A 1H4TA 5K0LA 4YJ2A 2W8BA 3FCYA 4IRUB 1B0AA 3PE3A 3WADA 2Q49A 221PA 3D1VA 3PRHA 4M87A 4NZPA 4EMTA 4RIFA 5GJWC 1J0BA 3BGVA 3ACBA 3R8XA 4D8UA 1QH1A 5AW5A 1E9RA 4TXLA 4L4RA 4UPDA 4ZAWA 5DBGA 3K30A 1P77A 1NUUA 5IYZA 1P61B 2AFIE 2J5QA 1B2LA 5DK6A 3VU9B 4KEAA 3I8OA 4PTZA 1EVQA 2Q8QA 4C29A 3P4UA 4QGAA 1GA4A 1GGKA 3C7KA 1QORA 5C3UA 2PIDA 5CT9A 1G42A 3WQBA 5HKBA 3I5MA 4RZUA 1PD1A 4DJFC 2XCOA 2FN4A 3LUAA 4R2JA 2OVBA 1I14A 2OEPA 1GNSA 1TKRA 5G1NA 2YTZA 2P1RA 3E4CA 4R0VA 1AUQA 5AK4A 2F00A 4IO0A 3NX4A 2V6IA 2J67A 1TW3A 4R69A 4WECA 4YRRA 4BQSA 5KQPA 3RYCA 3ADBA 3A1NA 4EPXA 3S68A 4IDBA 3JQQA 4TLDA 2KS6A 5EZYB 3B3FA 4BFZA 3ZD7A 2RGGA 4KWIA 3NIBA 3AL3A 1DEOA 3P27A 3ETCA 5CX1B 1LSUA 3EXEA 4ERXA 2VRWA 4ZQHA 1MORA 2NPOA 1AQLA 1SOMA 4OLJA 4I5FA 3GUZA 4HVAA 4IQ4A 3IYLW 3AT1A 2P2GA 2PJDA 4F2DA 2PZBA 1A5BB 1SR8A 3BSFA 4R1LA 3A1EA 4XYLA 1KFCB 3QXXA 2WVJA 5BY2A 4IW3B 4WY8A 5HTOA 1PT6A 3PJDA 3GAFA 3QMMA 1L5WA 2C3MA 3JWHA 1CUVA 1KRHA 2J8ZA 3VPAA 3N7TA 4AJKA 5GONB 2I67A 2Q3BA 1PR5A 4DLLA 2GESA 4E5VA 5B3KA 3NJRA 3QLUA 4DC1A 1RSZA 1WDMA 3ETHA 3R7LA 3ZDEA 4DR4B 2DR2A 6REQA 2Q99A 5HZMA 4X54A 3WGLA 4E1AA 5KYXA 2R7NA 5E3HA 3WMWA 1U7WA 4OX9Y 2VYNA 1PJBA 2QZJA 3QVVA 3BYZA 3GN2A 2QLMA 4RADA 4MQFB 2HRZA 4LS3A 1O6GA 3FWHA 5ECYA 4HBGA 2PS0A 4TSFA 8GPBA 4GP7A 3A0UA 3TBHA 2IYXA 4ZODA 5KKAA 1EMDA 1UBSB 1VJTA 2DPMA 3AUTA 3X1JA 5AM3A 2C4NA 2IOQA 1FNSA 4XWOA 1ISMA 1ZLYA 2WOOA 2QZ9A 1T8RA 4DDVA 3WP1B 3QKIA 4BY9E 1Y3DE 1DV1A 1XZ8A 3C5CA 3K72B 3L84A 1YB5A 2JVIA 4WUVA 1AH2A 4YP0A 4WACA 4YPVA 1DBIA 2PGIA 2EP5A 2IYNA 3RS5A 4L15A 1AV7A 5CFRA 2MJLA 2OUIA 3NC1C 2XMQA 3EC7A 3AFMA 1XRNA 3EE6A 3JWEA 3PDUA 4KN9S 4OXXA 2FMHA 3B6IA 2WE7A 3KP1A 1JAIA 2IU4A 2X6QA 1N1MA 2FRDA 1Z88A 1ZNQO 1FSSA 4UQLA 1VL5A 3LPCA 4P33A 1QTRA 1F2TA 3HLYA 4M6WB 3BHJA 4BRSA 1CPYA 3O4IA 4BZPA 1RKBA 1RP1A 3BXOA 3HRKA 1IJBA 4KAAA 521PA 1E4VA 1QHHA 4UMEA 4EMSA 1V96A 2QE7D 1U7ZA 4O4IA 4WD3A 3H6KA 4L74A 5BSVA 2BFEA 3EFOB 5F52A 2M6LA 1P72A 2PJUA 1YK1A 2Z56A 1OIVA 3NBFA 1WF6A 4C21A 3M2TA 4BLUA 2OHIA 1GY8A 2RKWA 1J25A 3QXGA 1VYTA 1SQ0A 2BJVA 3MJVA 1PF7E 4GMXA 4S3MA 4WNYA 4F2WA 1BWSA 1DBWA 2CXNA 3LC0A 1KK3A 2CL5A 2OCBA 3OJFA 4Y30A 3W1WA 4JLUA 3WGZA 1YVDA 2OV2A 1DRKA 3W5BA 1U2GA 1FP4B 1RRKA 2FH5B 3TSYA 3MT9A 2HM7A 2Q5OA 1PG2A 1G5RA 3EIQA 3KJEA 4O5AA 4PHHA 5KJ1A 4HADA 3PQEA 3T1NA 5M04A 3IQXA 4P4SA 1BW9A 1T25A 3E8MA 1NLUA 2C0PA 3UFXB 1RADA 1G6Q1 3D2AA 4HB3A 3JARB 3MTIA 1E0AA 4J0HA 4UCWA 3JSXA 4LOJA 1OF1A 4FFWA 4XB2A 1DC6A 3E2MA 3ICWA 1NRIA 1VSQA 5FQNA 4EGQA 2DEUA 4FN5A 3B2EA 2FZCA 3PCTA 4GU5A 4UM9B 1F8GA 1XTJA 3IKJA 3LLMA 1IPHA 1K7XB 1TI7A 2ZYWX 3VR2D 4O4HA 2GCPA 4OQMA 3GT7A 1FCJA 3MQ4A 3REQA 1QFZA 3L7BA 5C35A 4KBYA 4QRHA 3UJ8A 1DJPA 3N0WA 2C2KA 3F0TA 2JVKA 5DYYA 4C01A 3UY4A 4ESVA 3BDIA 1CY1A 4B3GA 2ZJ7A 5DWQA 4QYIB 2A1UB 1Y9JA 4NBKA 2ZROA 3G89A 4FOTA 1Q12A 2XHZA 2EFJA 1L6IA 3AJDA 2KB0A 4Q9LA 1MC5A 1A2OA 3DE1X 1XQVA 4PC2A 1E60A 4DIBA 4JLMA 3NYQA 2CKMA 4GX1A 2NQ2C 1S2MA 3IB6A 3W9BA 1UANA 5TEVA 1UJ2A 5KWSA 4HGNA 2XB8A 2ILVA 4KNWA 1XWFA 3DAOA 3L1UA 4YV0A 3G0CA 4BJHB 3RSGA 2AWOA 2ENUA 1JMVA 4WXYB 1A7UA 2FWPA 5AUNB 3NEJA 2HQRA 1I94B 4RPLA 5FOSA 1Y5LA 2IUTA 3LG2A 3QOXA 3AR3A 3KNZA 2CFOA 2BHSA 1KYZA 3E7DA 4RS3A 5E4JA 4NFSA 4PWYA 1QKKA 2NYUA 1UEXC 3L7JA 2JD1A 4JLBA 4OHOA 2NO4A 4JLNA 1VJDA 3PEUA 4BMYA 2C1ZA 5JD6A 2W2QA 3ELWA 4NJEB 3X1XA 4CDMA 3ADDA 4HX5A 4D0GA 1W73A 4C7VA 1VQ1A 2FR8A 2Q29A 2OGZA 1MZVA 1OBCA 3I6MA 5JG7A 5IASA 4YXWA 2KBFA 3PHLA 3M3DA 5FT9A 4HC4A 1R8YA 1P4GA 2K5UA 4XYEA 5DULA 1DIAA 1NJ2A 1OSNA 2CVZA 3RTDA 1W44A 2H4ZA 2FMUA 2D8MA 3I3SR 3VAYA 1U6IA 1G7CA 4MWGA 5AM5A 3TF5A 2O2DA 2WJVA 1L5OA 3AKCA 5AJWA 4D6XA 4ZYLA 2R84A 4U3JB 4Y1FA 5DKFA 4D42A 1GAXA 1MJGA 1P3JA 2EJTA 3IQFA 5EXXA 5JXWA 2HSJA 3QG5A 2SHKA 3U17A 2XGSA 3K9GA 1RACA 3EPKA 1DAHA 3PUVA 4DLVA 2R751 4EDHA 3BK2A 2V7TA 1GZSA 1QH8B 4XX0A 1NG1A 3L8HA 3LRTA 3C24A 4ETWA 3KQNA 3AVWA 4PU0A 4ND7A 1M3SA 1R12A 3VR3A 3BJEA 3PIRA 3G8AA 1A7AA 2N42A 2XYQA 5AQEA 4WCDA 2ECPA 2FAXA 3KYDA 2FEPA 2P4QA 1NW6A 5IPFA 4NPHA 4DM3A 5JADA 3O7WA 1X3SA 3N3BC 2CLEB 1KDOA 5CLIA 3RFVA 1BX0A 1M83A 1GU7A 1T2FA 3CZQA 3DP7A 4Q1DA 4DWOA 5DI3B 2AC4A 3RM3A 4H6XA 2CNBA 1C9JA 1QX3A 2FG7C 3RS9A 1Y5IA 1HZJA 3F46A 4B3FX 5LP6F 3PUXA 1Z7EA 1NY6A 2V7XA 4RPJA 1JAHA 2D4HA 4JGGA 1BOOA 3QPDA 1YJAA 2EZ9A 1WLSA 1ATIA 2OD9A 3F2IA 2YWJA 2WG1A 4G1FA 4QOHA 5EFOA 1C5KA 1E1CB 5JXGA 3OPVA 5JALA 1V8DA 2OMEA 5F35A 1EXWA 2GTPA 5B6PA 3TL6A 5SV2A 3OZ7A 4U2EA 1E2BA 2AFIB 4F71A 2I2BA 3ANYB 4R1MA 5JH7F 2UVPA 3GLRA 4KH1A 1JJIA 2VBFA 1Y8RB 3IUPA 3L8FA 2VUUA 3LKZA 1PP4A 2YWRA 1RTKA 3Q11A 3DEYX 1WMSA 1GRQA 1AUPA 1DJQA 4D9IA 5B3JA 4ZYYA 5AVRA 1YBAA 4JI4B 5DZSA 2ZKIA 3B13B 5CYPA 4F4IA 3GPCA 5F4BA 1NG9A 1WEKA 1ZPDA 2QI9F 2X41A 3KKZA 2HSGA 2YZNA 4U2BA 3ZNQA 4E3ZA 2B2XA 4Q5IA 4XUEA 1JFTA 4P22A 3F1LA 2APJA 5BMVB 2E4YA 1LGYA 5FV7A 2FEOA 2O2XA 3GFTA 4INZA 3F73A 1X0VA 3SS8A 1JR4A 1OGIA 3AFHA 1NP7A 3VAZA 2DYKA 1ZD1A 3EASA 5BN5A 5G0UA 3C85A 1QBGA 2VJDA 2W2LD 3FWNA 4D98A 3ELUA 4QXAA 1I2DA 5JSKA 4BVHA 5K8CA 5T4EA 4L8WB 2RHJA 3ND5A 3FA2A 4IGEA 4OQZA 4QDZA 4EPVA 5ALPA 4R54A 2CLSA 3CY6A 3ZK8A 4AN4A 5ER9A 4EJSC 1NW9B 4YUWA 3EPPA 1I24A 2JAHA 3OTQA 4HOYA 2PHZA 2HF8A 2JIDA 2RH8A 3E7PA 4ZAYA 3CISA 4EA8A 3LNCA 5A5GA 4JVNA 3ZCXA 4G1CA 4Y8VA 3TQFA 2JCSA 1RJEA 1XCJA 2Y1KA 2MYPA 3CX3A 3FSRA 5U9CA 4C6RA 3DVRX 1UK8A 3CV3A 2JJYA 3JD1A 3S8EA 4HWPA 4YP1A 4DV3B 2DUNA 2PUAA 1VPWA 5JS1A 2VJAA 2WMYA 4GNKA 2X8JA 1C1DA 3BC1A 1ZUNB 1REQB 1T4DA 2A7XA 1DQSA 3HCDA 2CW5A 4RKWA 5TPZA 4B7AA 5FUVA 4JNKA 3N2GA 3RNLA 4ZHQA 2PGXA 3QP9A 5JVDF 4H2DA 3RJ5A 4LTNA 1WXGA 5BUQA 2CD7A 2ZIUB 1KQFA 4DB4A 2HBZA 4J0EA 5G2OA 2BAGA 3S7ZA 3GJ0A 2ZR8A 3LWBA 5DYGA 4E2YA 3QHQA 4M89A 4TT8A 1S8FA 4RD3A 2B34A 3W2TA 3EX7C 4BKUA 2V59A 4TYQA 1Y1KE 1Y63A 2RJ3A 3U48A 3FZEA 3MZ0A 1XTVA 4ENRA 2FX2A 4KK3A 4Z9AA 5DT9A 1TYZA 2RBKA 4M8KA 3C1TA 3EEOA 2C3OA 2FDXA 3I30X 3FJOA 3P0JA 1CR6A 1VJ1A 2J08A 4ID3A 1HQDA 1R7RA 3FB4A 5DISB 2M1XA 4PFKA 5ALQA 5GZ1A 4DN6A 5ALTA 5BV7A 5JY6A 3VPSA 3OKAA 1PX0A 5D51S 1NWCA 1T36A 1AZLA 2D3WA 2PGJA 4MARA 1FDWA 3NLLA 3CNOA 3SM3A 3MTJA 3MWEB 4V0MA 4BHTA 3OLYA 4HH0A 1A04A 2RJNA 3F9IA 2WYHA 3H2IA 3RKSA 1YACA 3QUCA 3AF4A 4JL8A 3RKRA 1RQNA 4MV1A 1ZHFA 1DUVG 4RM3A 3DFIA 3OFVA 2BBWA 4A7PA 2OM2A 1T3LA 1PX2A 2C4KA 2WK1A 2BTQA 3HDGA 4K05A 4QSMA 3SJCA 3I1YA 5K45A 3G2NA 2FGJA 4RTLA 4BFVA 1E1QD 1U3WA 2ZWPA 2E82A 1SXJB 3I05A 1KNXA 1UMCB 2VH2A 5T6MA 1EAYA 4LGMA 1MDFA 1T1JA 5E6SA 5EIEA 3RLIA 3RF6A 2BGIA 5AI5A 4MA4A 3SICE 4L2IA 2WF6A 2GWHA 3IPAA 5AXDA 3U40A 1W5TA 1Y1PA 4XWTA 1QKIA 3EIOA 2QAGA 4PYJA 4LJRA 5EXTA 5REQA 4O3FA 4GOMD 1XD2B 4WKBA 5DASA 4EZBA 3C3PA 3BD8A 3WYGA 2E49A 3PVSA 1CB7A 1HE5A 3IKLA 4PLWA 4F4HA 3AB3A 4G1UC 1O6FA 4HMQA 4JBYA 2MSLA 4EPTA 2Q28A 2VP2A 1XO1A 3CLTD 3S99A 1HYQA 4R8MA 4KQEA 2CNOA 3BZUA 3A3OA 4EATA 3FF4A 5AVZA 5LKAA 2H63A 3QX9A 4PFSA 4C4AA 4DJ5X 4MDEA 1QHFA 5EKXA 3U4HA 5FPHA 1KSFX 2FWNA 3AEUA 5CIYA 4WNAB 2OHVA 1CR0A 2ZJ6A 3KWMA 3TRIA 4BGDA 1XZCA 2AI2A 4JODA 3VZDA 3W0LB 3BCUA 1JQBA 1IJKA 2XXAA 3MRVA 1T26A 1B15A 3VISA 2C31A 2JFBA 3DBVO 3IRVA 4BQRA 1CJMA 2O23A 3L7NA 3ZTYA 2AN4A 1AD2A 1JDBC 4BMXA 5BYKA 4A8JC 3UOAB 3MF4A 3H05A 4E3WA 3ZWNA 1DIOB 3EJWA 1NXTA 1SCKA 1G5PA 4HWGA 4Q6BA 1J0AA 1WVIA 2VDLB 3OZGA 2L19A 3CB4A 3OWOA 4LGCA 4OHWA 2B4TO 1KJJA 1OFIA 1M8JA 3BIWA 4YCNA 4NCHA 5LLSA 1OAOA 2XCUA 1RNLA 4X8OA 3RNOA 3STTA 5LJLA 4QFMA 2PA0A 3RODA 2C5LA 2X58A 2FXVA 2NUPB 1SZDA 4QU9A 3MPUA 1NOKA 4IX1A 3G59A 4CCYB 3CRVA 1KEPA 2C4TA 2JFWA 3DYBA 5T5QA 4BN5A 3FCCA 4P0QB 3WYBA 4Z49A 1W1IA 4LFAB 3PHIA 3PKIA 1IPFA 1U5CA 4CL3A 2L82A 2XIQA 1X19A 4OIFA 2FTKE 3UEOA 3ZDAA 3ZTTA 4FEAA 2UZ1B 4F9EA 1MQAA 5IJWA 1ID8A 3KT0A 3BWYA 1F0YA 4E31A 5HJ7A 2JHGA 1A9YA 1YKFA 1JKJB 1Q11A 4JN6B 4KRYA 3G9TA 2AR9A 3E7WA 4I4TF 4F6LA 1Z63A 2OK7A 6GPBA 3LP5A 1WUIS 2BFCB 5EN4A 1KTIA 4WKGA 3S2IA 4JT2A 3M6AA 2H54A 2ODWA 1R8JA 4CEHA 3NOVA 3D5EA 1EFLA 4MH0R 4B3HA 3CG0A 5P21A 5FTNA 4AS1A 2JLVA 1J33A 2W6QA 3EDOA 3NT5A 3FPBA 2PM8A 4P58A 4KVZA 4HAXA 3P5BA 4IJ6A 4Q3LA 3I9V6 5BQOA 4BGEA 3H0EA 1ZJWA 1W36B 1J9EA 4Z53A 5C9ZA 2VQDA 3W1EA 1TL7C 5AW8A 3UJ7A 1YR6A 2UUAB 1K1EA 2R25B 3R3VA 1QPGA 2HPAA 2EVWX 4O1IA 3C70A 1WU8A 2B2CA 3TMKA 1KAHA 2WIGA 3O3MB 4LXHA 5LU9A 2RAUA 5LWHA 1QNFA 3CT6A 1MRNA 4NS4A 3FFXA 5E9QA 2PH1A 4NFHA 2VPQA 1BDBA 1X77A 2E5FA 1RXSA 2IE0A 3AVQA 4G2NA 2LKCA 5JYEA 2QRVB 1GL6A 7YASA 1G2OA 3P0EA 3JS5A 1ZSYA 1IXKA 1KY4A 3GJ8A 3PDWA 4RVSA 1C4WA 5JI2E 2WQ6A 3HXQA 2QSYA 2PNFA 4E88A 1MQ9A 1WY7A 2ONKA 3UA3A 2G08A 2CC2A 1FFGA 1WVMA 2IKQA 1URPA 1ORHA 2ZSEA 3O31A 4IZIA 3S70A 7MHTA 4OK3A 5HXAA 3W9UA 2OB2A 1ZIOA 3FAKA 3FNBA 4NJMB 1OW3B 2O8EB 3DFFA 5EWJB 3EQ9A 1FF9A 4HD8A 1M6VB 2VJKA 4Q7JB 1CLEA 3H5WA 1C7ZA 2EWVA 3OEWA 1NW5A 4JCOA 5FAXA 3W3AD 3Q87B 4ZEXA 1P60A 1II8A 1QRAA 1W76A 4RYLA 2IFTA 3KXDA 5FDFA 3F47A 2ZOSA 1TT5B 1ZNYA 3N8DA 2HEGA 4BP8A 4BFTA 5HUJA 5BSFA 4CQLA 4UTNA 2IZZA 3GBSA 3KB1A 3L0DA 5EJEA 4KDEA 2NT4A 1TIPA 4JMLA 4G4SO 4GVLA 1DRVA 4UFOA 3UTCA 1IN7A 4XGIA 3V9AA 2V65A 3LHFA 3NKVA 3L9WA 1V71A 3AERA 1EVIA 1M2NA 3VZCA 3LK7A 2Z58A 1Z6GA 2C7OA 3U3JA 4ND8B 1JLRA 1PT8A 3MGBA 3ST7A 4OXIA 3TLBA 5MF6A 1GP2A 3NASA 3QPAA 4MKXA 1ZU5A 2IQIA 3P4YA 4N54A 4ETMA 1W59A 2QT0A 3WRWA 1LZKA 2PQ2A 5D2CA 5IX8A 2JB9A 3UHFA 5IN4A 2ZTMA 4XKJA 3W9SA 1I10A 3LQ4A 4J6FA 1DFGA 3GJ3A 1FFWA 4MUAA 4D99A 3VNVA 1XZDA 3OO1A 3UNXA 3O84A 4NAVA 1FMJA 3K1AA 3NUGA 3W2IA 1EZZA 1KERA 3VSBA 4YJFB 1AM4D 1ZK3A 3B70A 1GNLA 4R71A 4DJDC 5BN4A 5LN1A 1V1RA 4O25A 4HG2A 2XGOA 2VSOA 5JATA 1DC5A 1YL5A 1LPBB 5AVOA 5FLXA 4XPZA 3N75A 4NIMA 5KDDA 4WBNB 1B8OA 2O07A 1FTGA 4HBZA 5DO9A 3TR0A 5KMGA 2BUCA 2ECOA 1GG8A 1QHEA 4FB5A 2DECA 1VRCA 1WMDA 2ZBUA 3K53A 4MS4A 3ESDA 2ASVA 4HDAA 3TIGA 5AW0A 1A8IA 2W83A 2VUHB 4CHTA 2YUIA 4EGJA 2QE6A 2FW9A 4KGDA 2PFKA 1FU7A 1VP9A 3T3IA 4HKTA 1WM1A 5MN6A 6ADHA 1SD5A 3OIWA 1SA0A 3IHLA 5DW0A 1D6NA 4R84A 1CIVA 3GBVA 4KHPB 1K7FB 3AR9A 4ZT6A 5IF3A 3VC7A 4OJYA 4UKDA 1K9VF 3AI1A 4G65A 4NC9A 3EIXA 3EN0A 1I4TD 4FLFA 3FPLA 1A4IA 1SVIA 1FUYB 3HYSA 4NHOA 5DDIP 3SG0A 2PZFA 3U3OA 4I1PA 4RA6B 2HIHA 2PU7A 4CL0A 4LTMA 4LYEA 2X8BA 1DBVO 4IVPA 4EO7A 5IKPA 2H1CA 1ZEJA 3NOQA 1R00A 2F3RA 3INRA 5LQUA 1L5RA 2OXEA 2NO7A 2WZBA 4JUBA 3U7QA 4EARA 3E3LA 2NYVA 2WUGA 3BK7A 2TMKA 2LPMA 4E13A 2NM0A 1PLJA 4B6FA 4IS2A 2MSEB 3TLZA 3BFKA 4MQUA 4EJ2A 3AHFA 3N9IA 2LXNA 5CM9C 5IM4A 2GJKA 3R0XA 3E3NA 4E1VA 4BX3A 4DB2A 4KI0A 3N3AC 2AGVA 4LWZA 2WM2A 1LUAA 1CUBA 1QNLA 1N5IA 4KJZA 2O5EA 2UZ0A 3QMPA 1QO0D 5EPEA 5AKEA 1GT6A 1M33A 1G1AA 3HYNA 5GJVC 4DFDA 1BVYF 2Z2ZA 4CTNA 1X8XA 4MRAA 4PLVA 4XQCA 1UMDA 3QE2A 3ZK9A 1ODKA 4ZGGA 3COPA 4QEDA 2UXBB 1QBKC 3RARA 1AHHA 3U44B 4Z1MA 5GAJA 5THKA 2LBPA 3PV0A 3I0NA 2IPAB 4IFBA 4TTTS 3II6X 2XYGA 4DJTA 1R0YA 2GBFA 4BVJA 1E2KA 3CPSA 1TYCA 5BR7A 5FH9A 2V7WA 3WK5A 2HTEA 1KH1A 3I4CA 4O2AA 3JQ8B 1JIQA 2QTTA 1M6YA 2RSLA 4RCYA 5H80A 1Y8QA 4MWOA 3SMVA 3ZY2A 3GHHA 1JV2B 5AJXA 1SB9A 1P3DA 2HJGA 1NVUQ 3CIOA 3FYUB 5GOZA 4DIDA 1U0OC 3EZ6A 5GM2A 1MO6A 3KZNA 4B4KA 1AZTA 4AMUA 2HA0A 4V03A 3C45A 2YVQA 1TM7E 1X7YA 4GEGA 4CLOB 2P6NA 4RD2A 1H0HA 1U94A 2MMGA 5F21A 1M6NA 4YHHB 3N39C 2BZGA 2WSYB 3PFIA 2PVPA 2P5TB 4M9RA 1SUDA 3E18A 3GY0A 3OLZA 3ILVA 1TECE 3WB2A 1SHKA 5A9SA 5E1OA 3TRKA 4AMVA 5EJMA 1J2UA 1PDWA 1RHUA 3KEQA 1WUTA 1EXVA 1NQTA 3R6WA 5K8LA 1HLPA 3WLLA 2VRCA 4LE2A 5JS2A 3SJZA 3K2QA 4LZWA 1EX7A 3JQFA 3TRFA 3C3KA 3IT1A 2CDNA 1KEEA 1LC3A 1RPNA 1Y8ZA 4AF6A 1EWYA 1X2BA 1XBTA 1Y9ZA 2OMKA 4K0RA 3FXAA 2O1SA 2Y1WA 1S9DA 2PBZA 5H02A 1QVRA 4LF7B 4J1QA 2VBGA 4B8YA 1A50B 3SLGA 4B40A 2WIAA 4OA8A 2CSXA 1M2HA 3PQDA 2ZT6A 4HNRA 2DAPA 4DPMA 3ID6C 1OKKD 1YRAA 5EIWA 3I23A 5TQJA 1RBYA 1R0RE 2IPMA 3JQ9A 2V6JA 1KPIA 1M73E 3JQGA 4II3A 1LBHA 1ULSA 1CYDA 1RXCA 4PLFA 4UE3S 1SEVA 2FFAA 2CL7X 1W9HA 2XOEA 2AK3A 2ZS8A 1ZJZA 1JFFB 4BV9A 5K0TA 2ZSKA 4MUNA 4BBJA 3I9KA 4B3IA 4QT4A 1CP2A 4FK8A 3DKPA 5G1OA 4L28A 4FMDF 2WWFA 3QHAA 2NTVA 2QT1A 1DC4A 1GDDA 2P3OA 1YOVB 3H8VA 4LJ8A 3U0BA 2NVUA 5LOVB 4KNYA 3MT7A 3B82A 4P7BA 3L77A 2G6TA 1C3JA 1SIOA 2J0UB 4H1TA 4PHCA 2PLWA 4AY3A 5A4JA 5EFZA 2OPBA 1K27A 1TM4E 4NCNA 2ROQA 3RS2A 1HDZA 2VDMB 4LOLA 4HQNA 1QF6A 1NBAA 2XEXA 4RULA 1UOOA 3C3AA 1BGWA 1SBYA 4M55A 1V9CA 4HEJA 1E5TA 4P4NA 3LHIA 3U1VA 5KO2A 3J7AC 2YJ3A 5K0CA 1SQSA 4XD2A 5KJEA 4ZOLB 1L4GA 4TKMA 3A3YA 3EMDA 3NBXX 5BUCA 4QFCA 4XE5A 3Q6IA 2XQGA 1H1DA 4ZIRA 3PWTA 3SHOA 4PZ9A 8ADHA 5GP1A 4R7ZA 2G72A 2WJPA 4G86A 4F4JA 1LS1A 4S12A 1P45A 1XPRA 4D26A 5AOCA 3KG2A 5GMOA 1HEYA 3K70D 4GI1A 1S7CA 4V3BA 5F7ZA 4G97A 1QR2A 1SELA 4EECA 2AI3A 5AW1A 4DCGA 1MO4A 2AG1A 4POOA 1IQPA 3QF7A 3W6ZA 3ZOZA 1JPUA 2Y1GA 3P2MA 3CKLA 4OCZA 1U0HC 2PANA 2LUOA 1QPBA 1I1HA 2ASEA 3L8CA 3MD9A 4IUDS 4AJ4A 1VPVA 4P32A 3TIVA 4BLVA 4EKNB 1U7OA 3GGCA 2CVPA 2P2SA 2OA0A 3W90A 4KQHA 4RY9A 3K5IA 4Q7LA 1C30B 4YCSA 4G4GA 2I6GA 5FBQB 4HDRB 4AJHA 1U0BB 2R6ZA 1KI7A 2GD0A 2O06A 2ZB2A 4MLDA 4QREA 4Y0NA 4YONB 3RIMA 1KC3A 2H3HA 2ZANA 1OREA 3MS2A 3OPQA 4PX9A 3V00A 1UMKA 2FCRA 1KMHA 2ZK7A 3ETGA 3HWX1 4ECAA 1ZGAA 1P5FA 1P2UA 1M0WA 1CVLA 1BMTA 1GRVA 3M6WA 4WK0B 3V1LA 2WWYA 4WVLA 3H2ZA 1VL2A 2PKYX 4N12A 4Y9TA 1X3LA 4DMLA 2GD2A 4UNRA 4ZJUA 1H5QA 1NBEA 2P8SA 3BL8A 1P6XA 2Z3VA 3C6QA 3FNRA 3LY8A 3PYMA 4OB8A 4W4TA 4IQ0A 4NBLA 5GV7A 3BEOA 3ZU2A 1BAPA 3FUVA 3JZIA 2AQHA 2LKDA 2NWQA 4O2BF 5CR9A 5T41A 3TK1A 2IDJA 4ARAA 4Q1FA 5JYDA 1WCWA 1UXOA 1II0A 1MJFA 4EY6A 1TVCA 4HDSB 3HU5A 5JO9A 1E20A 2JLXA 4NDZA 1X2EA 1YUBA 3NJ4A 4LDJA 3SXUB 4UNQA 3NAMA 3D7SA 3TX6A 1MMFB 4MNTA 4ZYWA 4JIMA 1GD1O 1RMQA 4QLAA 4GLJA 4ZTBA 3Q3EA 4I4TB 3B9BA 3GJ4A 1XFAA 4HDNA 4RL4A 4O1MA 5IT9A 4DG5A 2JAPA 2V5UA 3CBQA 2O0MA 2Q62A 3F67A 4Q16A 5DEOA 2C4VA 2WTEA 3C7TA 1P0PA 1Y1QA 4YAKA 1H2ZA 5SYAA 2VP0A 1ZC3A 3GGPA 1DCFA 1EWRA 2AMJA 1MGOA 2P9HA 1VG0B 4XPIA 3RS8A 1M34E 5IG2A 2EX1A 2AIRA 4MUMA 1E8NA 1KWKA 1D9XA 1A3CA 2PUVA 3G5AA 2W8BB 4AECA 3CZRA 4JLAA 2O8NA 3RGGA 5KZMB 2QJTA 1UKBA 2XCQA 3R74A 4PG8A 2A8YA 1SCUB 3SVTA 5DTEA 3FN4A 4IH4A 1SPXA 4RHUA 1NVGA 3L4BC 1SC1A 1XZBA 1Y81A 4L57A 1U7PA 1ZONA 1W4CA 1TM5E 3BIOA 4WCFA 3RPEA 1W6RA 3AP2A 5BNWA 1YQXA 1T3TA 5IYZB 1RYFA 3TD6A 3GAZA 4IP0A 5F7JA 2PZMA 1N6KA 1QTNA 2HBYA 2B25A 3SK0A 1WPGA 4UXHA 1UXGA 3N07A 1ABBA 4GXRA 5TT0A 5T4HA 2Q2VA 2REQB 2YJ4A 5U1PA 3GH1A 4GXQA 2I8LA 1TYBE 3IQDB 3TSZA 1GFIA 3A58B 3IIIA 4B3TB 4Q7EA 3HVHA 4R5MA 3RUHA 2QN9A 4DBZA 3A8TA 1W4RA 5P8WA 4X41A 1FFSA 2DWOA 3UV6A 3OVMA 4TUYF 2YC4C 1TK2A 2BHLA 3K32A 5LQRA 3IEMA 3NTLA 4ANFA 3GLFE 3VPFA 1W2GA 2O7NA 2R6DA 2GGSA 1L7NA 1CDEA 3F4KA 4FHEA 1CE8B 1FK8A 5JE8A 1ADBA 2QY6A 3WKBA 4C4RA 1WQ4A 3AKZA 4KIGA 1YRHA 2HOQA 3QJ5A 4KFRA 2AI1A 2DHCA 4K3UA 3IAHA 2IYPA 5A3VA 4KV9A 2J31A 4PTYA 3EHDA 4GG1A 5B53A 1Z7BA 3I04M 3BG5A 3O21A 3LT4A 2DMRA 1RYMA 3CZMA 4J94A 4ZMRA 2WKQA 3B6MA 3HFGA 4JOBA 3AMVA 3CLSD 2BM1A 1RJWA 2JD2A 1N34B 4YMIA 3MQ2A 3AUJB 4GOJA 2CXOA 4JUIA 4OI4A 2QVGA 1RZVA 4BJ5A 4RK1A 3VNQA 2DOKA 2G88A 3N8HA 5FD8A 2JEYA 2Q4EA 1H94A 2GPYA 4Y6GB 3B5JA 2NQ8A 5BURA 3R3JA 4B31A 3OFNA 2QLFA 3X2FA 1TU3A 5EZ5A 2O7VA 2PCLA 4MAAA 4PYLA 4R9UC 1RC0A 2ZSBA 4RQBA 1VG8A 3FGOA 3A31A 4YBRA 5D01A 1XTBA 4ICIA 4MQ5A 5KYXB 3MHPA 5AHOA 2Q27A 2JH8A 1P4JA 4ITUA 1P0QA 4NKRA 2WJHA 2X7XA 5J4VA 5H0IA 4COKA 5M7EA 4OLAA 3HSKA 1XZEA 2H4JA 3PVZA 3QE3A 4WBXC 1QDEA 2VDNB 4WMLA 4YUAA 3AUKA 1FFEA 3KQYA 2VH1A 3DDNA 3LQ2A 1N2CE 5SYNA 3Q3GE 1W2WB 5BWOA 1G60A 2VUTA 2C9BA 1YE8A 1NOJA 2ZVPX 4HNUA 3BD7A 2IGTA 1BQEA 3O4RA 3ESRA 1KJ8A 1M1YA 2B4KA 5FI5A 3W4JA 1GPYA 1EB9A 1EUDB 2Q3LA 2ZJ1A 4TQ9A 5HDQA 5FUMA 1JDZA 3H8JA 4LY0A 2XD9A 3ZBUA 4OKIA 1PK8A 2QTGA 3VH4A 4A0SA 2H9YA 3QI7A 4UNIA 3QX8A 4AZVA 1YR2A 2VHYA 2E48A 3U4CA 4BO6A 5B55A 3IAEA 4R8LA 2XCRB 1SUCA 1T2AA 2GJSA 1KKLA 2ZT5A 4J4BA 2Z57A 4DRXB 2F1JA 4BVBA 1I8TA 4YJGB 1JQAA 3IVRA 5C1IA 3B38A 1YDFA 4O4LF 4CIXA 4GSLA 4OTZA 2JHCA 3AP3A 4PZDA 5LP6C 1BEZA 3Q3VA 2GPNA 2H2GA 2R8RA 3UWDA 2YWCA 3KQVA 3WK8A 3FZYA 5JW6A 1AB6A 1W36C 2NZJA 5A4AA 2CBXA 3AUAA 1E9FA 3KHKA 4WESA 1QG0A 7REQA 1PL7A 3DBHB 3KZVA 1GSOA 3ZVLA 2I3GA 3OY7A 1BA3A 2PX6A 2FKNA 1X1CA 3E1KA 3KPJA 3MMXA 3P9XA 3AG6A 3BCSA 4I55F 1LFAA 4BMVA 2A57A 2JZCA 1VGVA 1E3JA 4Q7MB 3M4YA 1E4OA 2P9ZA 4CT0A 1YDHA 2M1ZA 3ITNA 2I62A 2XB4A 2VA9A 3BMCA 1XZMA 2GLXA 4KX3A 3AM5A 4OK5A 3I2JA 1OR8A 3PGVA 1RXYA 1GGJA 2QI9C 3DXXA 2GVDC 4K6CA 5IC5A 1XN4A 1FP7A 3L6OO 1DEXA 5AJHA 3PC8A 3LQ1A 2Z30A 1YKSA 1QGDA 3P9QA 1NI4A 2H0AA 5E3JA 3ANNA 2R8OA 2HN9A 1JBEA 3EQ2A 2B7CA 1RXWA 5ECGC 1L7AA 5EEGA 4AQDA 4CKXA 1GAQA 1HRDA 1RWBA 3OE7A 1YQWA 3T4EA 3V8MA 4B7CA 1OZ0A 2C99A 4Z9XA 3NPMA 4FYWA 1WRBA 3AF1A 1QSGA 4G0YA 4PZCA 3DAPA 1AKRA 3HQ4O 3K6JA 4O4HB 4GM4A 3AVOA 3LX8A 4QJIA 5KAMA 3DT8A 4B34A 5EJAA 3A2NA 4YREA 3KCNA 3RYHA 3WRXC 4R1NA 3RJMA 4RESA 2OUKA 3E9QA 4XASA 2FMFA 3RUAA 3ZVRA 4B6SA 3QKSA 5F2NA 1WKCA 3QF4A 1CF2O 4RX1A 1CW2B 5K7SA 4YHBA 2X0JA 1IHPA 3HJTA 3JQPA 2W7TA 2NYRA 3I01M 2GDJA 4RFVA 2FQQA 2PJRA 4R9VA 5ULLA 1FZTA 2YHIA 3ZX4A 3IQGX 4WUTA 4C2UA 4XVHA 3A4VA 3CJTA 4M2LA 2Q9CA 2O6LA 1AZWA 4HSGA 2VJPA 2ACEA 5IAJA 2XRZA 2V7UA 3FX2A 3RSSA 1U2SA 2OXCA 2TRSB 4DXDA 1KI2A 2V8BA 4JITA 1WNTA 4G5FA 3EEBA 1W34A 1YJQA 4LY3A 1TCAA 2BFPA 3IMKA 1LW6E 3FKSD 1AK2A 2O8DA 4Q9JA 5F1OA 1RM4A 1H8HD 1XTQA 3I6ZA 3T9EA 3LUJA 1I32A 1A8PA 4D9MA 2XLBA 4Z2YA 3IAM1 1QJCA 1Y4DE 3K9CA 4LJ4A 1HYGA 5LXTA 5HRUA 2CMGA 3AFOA 2D2IA 4AMYA 4BZQA 1CQWA 4N82A 1EUYA 1Z5UA 4M83A 3C74A 3MGGA 4K2HA 2GBLC 4D25A 1F7VA 4ER7A 3M0EA 2D5AA 1ZAYA 4LBWA 5BWNA 3HHPA 4LRTB 2WTUA 1CUGA 4MRSA 2RGDA 3R9XA 1OC2A 1WWKA 2EDAA 1FOEB 2AEFA 2JFXA 3KL2A 4RZIA 4YRTA 3ZE0B 4DABA 1NYQA 3B7GA 3DNMA 4OFBA 4M8SA 1OAAA 3THOA 1PSZA 3WNQA 2O2ZA 4MTCA 3RJZA 2DCUA 1H3NA 3DTVA 4Q9IA 4FMDB 4QUHA 1NMQA 3NM4A 4JXJA 3L01A 4E5YA 5H3LA 4DLBA 1ZMRA 1M6WA 1IBRA 3L40A 5A03A 2BR5A 2XXJA 3MTEA 1DO2A 4IY1A 1OVGA 2DHQA 1ADFA 4KN8A 3U1TA 5HKAA 3PTAA 5T7BA 5HRAA 4MGZR 4N5NA 1YHZA 3M70A 3AQIA 4UBMA 4ZXFA 1ARZA 3B89A 3GEIA 4Z3DA 4A0QA 2JBAB 5TLSA 1D0IA 3AOEC 1HETA 1ICEA 1J06A 1R66A 2J4DA 4JI1B 1MCZA 4HUQB 3TZBA 3WFJA 4UZSA 1Z56C 3H18A 3REGA 3OAAA 2QV0A 1DAGA 3QUSA 2PZKA 2QNRA 4E5MA 1IMOA 3WE7A 1BJTA 1YQUA 2ECKA 2ADFA 2C57A 3GMTA 4FMPA 3GA7A 3JR7A 1ADCA 4DQ0A 1ML4A 3NYWA 1ZD5A 1DKOA 4X8HA 3NWJA 4X1KA 1PWXA 4ZAFA 4LHZA 6NULA 1KJYA 2QNBA 4XJVA 4PYKA 3HG7A 4QA9A 3CMCO 1EXDA 2CD9A 2V7QD 2G1JA 3VU1A 5AJTA 2PSFA 3EQ6A 3A05A 3KJQA 1K7SN 3LW8A 3MSXA 1FFYA 1ULTA 5KYWA 7ABPA 3S27A 2FWJA 4B71A 1YDEA 2WPNA 4ZJZA 3H11A 2GXUA 3MCVA 4BQPA 5CDFA 1VCIA 3R3ZA 2WNSA 4QUJA 4NULA 2UZ4A 2X15A 2HV8A 1SUEA 2QGNA 4RKQA 3KU4A 1XNJA 4K8OA 4CDNA 1CS4C 2AX4A 1UFOA 3KVYA 1AA6A 1OE0A 1YQTA 3CSSA 4C03A 1YH3A 3MUFA 1GHTA 1GPAA 2FSVC 2H3EA 1PFQA 1A8QA 3BWEA 3EUEA 5B58C 3OQNA 1P5HA 1QC5A 4ABYA 1DMRA 4H7HA 5AOBA 3A3PA 3T7KA 2FSSA 3HXPA 3KDAA 1NVVQ 4TMVA 2KX7A 1NV9A 1W1WA 2OV3A 4LY9A 4QQRA 4RU1A 2C04A 1N2IA 3OT4A 4YEDA 1S2GA 4I9HA 3RUPA 4YQFA 4RO0A 4ZPJA 1XP5A 2R66A 3FTQA 3SQNA 3ZHZA 1XMSA 2P9GA 1H0KA 1OIXA 1BDJA 4O2BB 4TV9A 4QNRA 2AHOA 3ACDA 3PGLA 3G8DA 5CFPA 3DXZA 3LL7A 5CFMA 1T6ZA 2QYSA 4DA7A 1ISPA 4MWSA 3GEBA 1U28C 4U7TB 1CUEA 1DOAA 2OPHA 1EEXB 1IDN1 4NXMB 2E18A 4TZ0A 1UJCA 2JFOA 2OYSA 5DMXA 2OO7A 1ZUWA 5EJIA 4C4SA 1EFKA 3Q10A 4BBAA 5KJ6A 5ETJA 3UG6A 1ODSA 4BNMA 3GLFB 1JHMA 2X0IA 1AX9A 4RM2A 3HBLA 1VGRA 3B12A 2HCRA 1ZD4A 1USWA 2BGKA 2FWIA 3FCAA 3J80A 3D8UA 1JPVA 1PG5A 2HWUA 1L6RA 3HSYA 3K9BA 4FCWA 4UOEA 3VHRA 4BYMA 1H3EA 4M7RA 1J70A 1VM6A 2BEJA 3E27A 3M4NA 4ZEVA 1ZICA 4X7MA 4CW7A 4CG0A 3KQLA 5ARBA 1WX1A 1WDTA 3DE0X 1E1DA 3KR2A 3N2GB 5FL7D 5LP1A 3S6JA 1KKUA 2RGEA 3H87A 3WLHA 4D92A 2CFSA 2V96A 3H65A 4R1TA 1YZLA 2VP6A 4J0DA 3UW1A 4IV5A 5ALFA 3W8EA 1X87A 3OJEA 1ZJ4A 3V33A 4EYOA 2EL9A 3Q3JB 3BILA 3E81A 4H0CA 1GLNA 5DCUA 5KHOC 2VKQA 3GG9A 5BO5A 4KRXA 1QZTA 3WJ2A 2AJBA 2WHXA 4UATA 4YT2A 2C5BA 3RFXA 1TAUA 3N1UA 4QPJC 1UT6A 2FW0A 1PJCA 3RRMA 3A6PC 5F1YA 3RE1A 2Z2KA 3D9QX 5JJ5A 3EULA 1BCSB 2NSHA 2V9CA 4MSUA 2QVLA 3M7IA 5CVTA 1M8FA 4IZOA 3QLVC 3R6TA 4ZCSA 1OV4A 1RBMA 5CA1F 3W8RA 3ZWWA 4AJJA 3CUKA 2QYHA 4ONEA 1ZCJA 3LYHA 3BXZA 3AHDA 1G21E 5F64A 1MZPA 2CK3A 2Z4SA 3HEAA 1DMSA 3JQEA 4H1VA 4KOEC 4B76A 1A8UA 2XA2A 3H7IA 3NWBA 5D5HA 8AT1A 1T8YA 1SO8A 5COAA 1RYHA 1ECJA 3TTUA 5TVGA 1UQRA 4G9BA 1E7SA 1ISFA 1ODCA 3EGXB 3I1IA 3QMVA 4TTRA 3T54A 3P9NA 4D4KA 4DCCA 3FWPA 4BBZA 1JMYA 2G40A 1N77A 3EISA 1NGSA 3H6HA 1U11A 4EG5A 4CM8A 4DRZA 2G70A 1U0LA 3RYTC 5F7OA 4TTIA 1US8A 2J0VA 3W5AA 4BC0A 3TEMA 1G5FA 1W4AA 1HDIA 2UVDA 1CUDA 4B6RA 1K7CA 4BJ3A 1W96A 4DMHA 3PUYA 4F84A 2WD9A 1UPXA 3DMYA 4L2IB 2E4ZA 1MO2A 3PL1A 3B6ZA 2BMVA 2I1VB 3R7NA 3RYFB 4R0MA 5LC1A 2B8NA 1QYXA 3U62A 2WU4A 1YFZA 1QWOA 1WL8A 5FORA 5FWXA 5J40A 3TE6A 3JZMA 4P5PA 2HLPA 4B7ZA 5B3LA 5KU1A 3B1ZA 1DSSG 4RH3A 1WB6A 2D00A 4C9BA 5C8DA 2BBSA 2P91A 2ZAMA 3BSYA 3EPHA 2M6KA 2FPKA 4C2AA 3H0KA 4X1IA 3CLTC 4LV6A 1AS2A 1M7GA 2HLDA 4OQNA 1E1NA 2D1FA 2OKCA 4Q82A 4EW6A 1U0NA 3U16A 1E32A 4OQQA 4XEUA 1PN3A 1E4YA 1K2WA 2H2IA 4AZSA 2H4HA 4V0LA 4IDEA 1MH9A 5DOVA 4YGXB 4XUDA 2GVZC 4A1OA 4MWTA 1SVSA 4BB6A 1Q15A 4GPAA 3AEUB 1JLLB 4IIJB 2JS7A 2C59A 4K86A 3RW9A 4S04A 4YQYA 3W8FA 1S0UA 4LBVA 2O8CB 1QYRA 2YJ5A 4JKOA 3KXLA 3QELA 3D0KA 3GVPA 5EMNA 2Y0BA 3KE8A 1AQNA 3RVQA 1PJ4A 1Y6ZA 3F3MA 1TJYA 5CLGA 5DTQA 4HRAA 4P82A 1N1EA 2GYVA 2PVSA 4Y6SA 1Q0TA 1R3UA 1BEUB 3S55A 1BS1A 2C5AA 4FGUA 5EMKA 2G83A 4RVGA 4RJKA 4R9RA 4UJ3A 3L4KA 5DYWA 2ZI6A 3IDOA 2YOFA 4FINA 1NQUA 4HYQA 1NIPA 4RSHA 4TL7A 2ODEA 4KWCA 8MHTA 2XDQB 1U8EA 2HH9A 3GARA 4YN3A 3GRCA 4K28A 3KHTA 5JCJD 3AONB 1OZHA 3K09A 3CC8A 3LC1O 2W9XA 1TZBA 3QWFA 4B79A 2RIRA 4CMJA 3O9ZA 5JMWA 2J9YB 3OCYA 4PLYA 1G9TA 2H0RA 1KQ3A 3C6MA 1T43A 1TLFA 3DL4A 4N0EA 4B7UA 2QEQA 3BORA 2M6SA 4TL8A 4XDGA 1O58A 5C34B 4C30A 3DZIA 3Q0TA 2VHXA 4XM0A 1ZFNA 3U3XA 4JWKA 3S44A 3AILA 4A3SA 3CCFA 1LI4A 5A7FA 2JJ2A 2QAJA 1IMJA 2GS9A 4DIKA 2I6XA 2IZ6A 2F8TA 2ZUBA 5K0BA 3B36A 4RHEA 1TUBA 4JI3B 4ZFNA 3V5NA 3C4QA 3QITA 1SUAA 1WXFA 4W5OA 5B2FA 3QKRA 4ND3A 4BFSA 2QU8A 3GLHA 3TSOA 1ISGA 4Q3NA 2P2CA 2NTNA 5SICE 2F3SA 3VYVA 1NBOA 1R64A 1ZKMA 2J41A 3ABOB 3QBEA 3C3MA 3HZOA 3ETJA 3CH7A 1PGJA 3HO8A 3PI7A 2X22A 3B7PA 3Q0IA 4KDFA 4FHCA 4D9BA 5IM5A 3QK7A 2Z43A 4BO1A 3C6ZA 3M4JA 5EKSA 2P6PA 1FPQA 2XQJA 4FYJA 5IJZA 1GZ4A 1XZAA 2AZDA 1Y1RA 2CNKA 1G7TA 2REOA 3H2BA 5GQSA 1XNGA 2CHUA 3DOFA 2HA3A 3AQ4A 1S9HA 3SKYA 5B1EA 3NBUA 4REQB 2WTAA 1VI2A 1WF3A 4EPWA 1JG3A 3QVGA 1OROA 4CQMD 4CQNA 4Z99A 1W7AA 1JSCA 2OZPA 4E51A 5GVSA 2QD1A 2B1QA 5HYVA 4MCAA 4CT5A 2A94A 4HZUA 3ZW7A 2YDYA 3N2KA 3ISJA 4PNEA 1VJGA 3PDHA 1JLMA 1Q74A 1XCGB 3GEEA 3KALA 3RUIA 2OBYA 3WA7A 3PQ6A 3DR3A 2X4IA 2JIBA 3K4PA 4MW1A 2Z5GA 4JBGA 3ZBQA 2RK6A 3TCXB 4BRZA 3HGMA 4M99A 3GX1A 4UEKA 5FI1B 2BISA 4LZJA 4AZ0A 4F96A 4YCCA 2YOGA 4ZOQI 1FFXB 4ZHSA 3STYA 2V9ZA 1C81A 1RYYA 4JR2A 5J2UB 1R0SA 4PCUA 3EBPA 4H3VA 4QPDA 3WGTA 4PGGA 3H2JA 1P39A 1ZUIA 1PFKA 2DULA 1Q3HA 2HSEA 4NK5A 2OFWA 1DPFA 2L42A 1J22A 2ZVDA 1YZQA 3F4LA 5F4ZA 4XWWA 4JJ7A 5DI9A 3L0BA 2C03A 1MV5A 2OCIA 3KEOA 3QVJA 4LUCA 2Q9BA 2AC2A 3MA0A 1YSCA 3IERA 1L7QA 4C5CA 2Z9DA 3TEJA 1IUPA 4NOKA 5FPYA 1YZ3A 3DO8A 4N40A 5EUBA 1AKNA 2P1DA 2X5JO 4PF1A 2FPIA 4URHA 1NL3A 3QE0A 1PFYA 4POAA 4J75A 3SYMA 5C4GB 2XCLA 2C7VA 3PXGA 1PR4A 4Q9AA 3GUVA 5CBKA 4W5NA 1SRQA 3W06A 4IJQA 3VX3A 4AZ3B 4BFYA 4MYRA 4Y9DA 1WO8A 2C5FA 2R62A 1USIA 3CZPA 3P0RA 2C4UA 5AESA 1E0KA 1HT0A 1NVWQ 2FWAA 3FDZA 4WT7A 3ACCA 1BGVA 3A0RB 3PR2B 3PE4A 1TYAE 4IKPA 1I4WA 2BP7A 4TXMA 5HKLA 1G38A 3H83A 1JU3A 1X80A 1XE3A 2O8VA 3RU3A 1DC3A 1WA5A 4RK6A 2JZNA 2DWQA 1YNSA 2I0FA 4J90A 3NH9A 1NKVA 4LCBA 3K1YA 3BF7A 3JW8A 1OLOA 1CRLA 3VPXA 1O96B 4BX2A 3K1AB 2R85A 1RJFA 4JP8A 1I7PA 1O08A 1FVHA 2EZUA 2ZB4A 4H3SA 2C7QA 4R2KA 5TMEA 5HQTA 3K6SA 1DTWA 4EM6A 4HFNA 2IBSA 4YJHB 1H93A 3DKIA 2RGRA 5SY9A 3F6RA 5AHRA 1U5BA 5G41A 1GSAA 5HOEA 3E2PA 4I5GA 4INAA 3HO1A 3ROZA 3HR8A 4J1TA 2ILTA 5DHSA 2EBHX 1MAHA 4TT3A 2A9FA 2Y9MB 4JU9A 1Z0DA 4MS4B 5D85A 4ZYTA 1TPYA 4I0WB 3ZI4A 2FSFA 1RHMA 2ADMA 2HUNA 2W93A 2IDZA 3IS3A 1QS0B 3P2KA 2R5FA 2WZDA 1WAMA 4LQLA 3VTKA 3WGQA 1Y5RA 2ZKLA 5J4LA 2XKKA 5IJXA 2JLRA 4P0TA 4BE4A 1HMYA 3K35A 2DLNA 1KQNA 1GLVA 1FQKA 1Z06A 1SA0B 2JI7A 4I1VA 4UDOA 5M5BA 3IR5A 4ODIA 3AEQA 2OHHA 2FPPA 1SWWA 3KJIA 1XWWA 3FWKA 3JD3A 3VGPA 2VWPA 2FQYA 4F4DA 2II6A 2JCVA 4WVFA 1DS6A 4PBTA 4M37A 1JIJA 4EG7A 1OUMA 1JEYA 1VRWA 4D3SA 1M2FA 2IF2A 3G7SA 3WFIA 3N86A 5CT8A 5JEDA 3RC9A 2E4WA 1W0JA 4N7BA 5DBHX 1WXWA 4BEJA 4NBNA 1UBGA 2JPDA 1OJLA 3KBBA 3NTOA 1YVUA 5D7NA 1ZD8A 1BVHA 4GYJA 3KB8A 4YRIA 3JRWA 4KMMA 3V7NA 1KK1A 1NF2A 2PY6A 3NHSA 3TGLA 3EZ9A 1P1CA 5JRDS 1JTEA 1P7ZA 2AX3A 3EVCA 5ESXA 2XW6A 4RFLA 3PXXA 3AVTA 3B8HA 2XUJA 1ID1A 1G5QA 1XQYA 3KOWA 3L7KA 5K3OA 1YCGA 4EB8A 1ZU4A 3IPRA 1JB1A 3U4QB 1BXGA 5FRDA 1WP9A 5I7SA 2JIZD 1A1VA 2DQSA 3MD0A 2D2VA 2RB5A 1G21B 4PQRA 2XKJE 1AE1A 2YNMA 5CX4A 3JYOA 4Q34A 1YFKA 1ZVVA 4BVLA 3K3PA 4WLUA 1K5PA 1IXYA 1BOFA 2GZ3A 4GR5A 3R0QA 4K6KA 2IPXA 4PG7A 5EIOA 2YYAA 2V55B 1TM1E 4GPEA 1WNFA 2CXSA 3EGDB 2ZIZA 4HQRA 4O2AB 3IV7A 4G67A 3EQZA 3GJZA 5CA0B 5G4KA 4GE0A 4AKHA 1XMJA 3EGVA 4Z4FA 2HMAA 2N1BA 5CMLA 1U5AA 1XMPA 1B1CA 1O9HA 4I1UA 4V0QA 5FR1A 4KIUA 1L3IA 2Z5VA 1X7YB 4ND1A 1PO7A 4GMDA 3HFJA 1SQ6A 3RVRA 4RIEA 4X1YB 3ZWBA 4JCCA 4F9TA 1NMEA 2YMQA 4ZZ3A 3PZRA 1NE7A 4N6NA 2P9BA 3DHEA 2DLCX 1X15A 4D6PA 1MC1A 3H5VA 4Y7DA 1OT5A 2HEIA 3F8WA 5E7QA 1RJ9B 2RHWA 2GCOA 4HWKA 2D3TA 1W46A 3HXTA 1L7EA 4M46A 4Z51A 4XRGA 5C32A 5IHPA 1BDMA 4NYJR 1KJIA 1RRGA 1Z4PX 1SU7A 3R7WA 3LDGA 5AI9A 3WNCA 4BVFA 4BVKA 1ECBA 4QM6A 2G1UA 3I76A 4W5WA 1KZ4A 2O4CA 4PPFA 4XVQA 1AU9A 1BG6A 5FOWA 1KEEB 4P3PA 2HMYB 3GVXA 3P9SA 3FYDA 3KKOA 4KU4A 4QBFA 4YQEA 2O0JA 4M0CA 2GF0A 4QEKA 1T4CA 2GI4A 2NU8A 2VZ8A 1DAIA 3OX2A 3K0CC 3NMUF 1YTUA 1BN6A 5IAKA 2E5WA 5IMSA 4OBEA 1MRZA 4C6TA 3O82A 4O4JA 2XR1A 1CY2A 4QOJA 3T3GA 5IJ0A 2J5RA 3G2HA 1T8SA 3NHFA 4NR0A 3SF8A 2O05A 4XM1A 1M9NA 1EIWA 2NQTA 3GQBB 1KZGB 4C1BA 3JQGB 1KBQA 3DZGA 2VEOA 2CDAA 4RTPA 4LF4B 5DNYB 1T2CA 4OHCA 3L4SO 3OZIA 2MR5A 4JOQA 2JGDA 1GKUB 3UMGA 3VNAA 5CCEA 1MH1A 2PUTA 2W6ZA 2ZT7A 4M0MA 4XIIA 3UO8B 4ECEA 1XROA 3EG9A