4QKXB

Structure of beta2 adrenoceptor bound to a covalent agonist and an engineered nanobody
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGSIFALNIMGWYRQAPGKQRELVAAIHSGGTTNYANSVKGRFTISRDNAANTVYLQMNSLKPEDTAVYYCNVKDFGAIIYDYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Covalent agonists for studying G protein-coupled receptor activation.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Membrane protein/immune system
molecule keywords Beta-2 adrenergic receptor
total genus 28
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2014-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qkxB00
3RBSA 1QRNA 1ZMYA 2PYFA 1ZK9A 3GBNL 4LLVB 32C2A 3KXFA 1VGKA 2VLLB 5FA3B 3Q1SH 3QIUB 3BPCB 5I74B 3MGTA 2PW2A 1CXLA 5GRJL 4I9WD 1EERB 4Z7VB 1IL1A 1RFDL 2QADD 2EDQA 4IM8A 1EA9C 1DBAH 2JJTA 3I75B 3VXOA 2W0LA 4IOFC 4LP5A 5F1KC 3RWJB 1R3IL 2YBRB 2B4CH 3BDYL 3BZFA 3DRTB 2PO6A 1LHZA 2FR4A 4HCRH 1N5AA 4YPGB 3ULUL 5E2WL 1JYNA 1AGCB 5JW4N 4XHJD 3N1FC 1YN7B 4EXKA 2AJ3A 4U7KA 4L3ED 5JHLH 4CVUA 3IU4H 3F62A 1IC5L 5CJ8A 5I1JH 1FPTL 2W9DH 5DMGC 3MLTA 4RMSA 2R56H 2OK0H 1IILE 4AJ0A 3B9EA 1OB1B 2H2PD 2VC2L 1MFAH 4RFNB 2NTSP 4JAMA 4RX4A 3MRPA 5IM7A 1N5YL 4JREB 1JI2A 2ADGB 5IMLB 4LHUA 1RUAH 1OHQA 4DFIA 5I1GL 1E27A 4P2QE 3MRJA 3JWNC 5SX5H 3V7MA 2BVOA 1MWAH 4NQCB 4NWTL 5T1MB 1UJTA 4JB9H 2WIIB 3MFGB 4GSDL 5KSAB 3SBWC 4PRBB 3HUJB 4JG1H 4TVPE 3UTQA 4HUKB 2AI0H 2IAMA 1BM3L 2Z92B 1KJ2L 4QXGH 3KPLB 3CFCL 3EFDL 4MD5B 3IU3A 4DTGL 4PY7A 5IMKA 2R2BA 2B4CL 4GW1A 1ORQB 4U3HA 3PHOB 2WSKA 3UZVB 1R3KA 2IQAA 2B1AH 5HYQA 5EBLB 2ZUWA 1SJVA 3FTGB 5FOBA 4I0CC 1HINL 3WNMA 4TTDC 1FGNH 1TJHL 2ZPKL 2J8UB 3QULB 4WFFD 3T0XA 3EYFA 1QPXA 1QVOB 2F58L 3IGAA 2O5XH 4XCEB 3CDCA 1ZLWK 5DMYA 3QFJB 2NY5H 2ERJB 3R06B 2FO1A 4FZ8L 1I85C 4PB9L 1RZIB 3QCVH 4CJ0A 2DWEA 1F58L 4LLYA 1S5HB 3O4OB 5L2KA 2VDMH 4LSSL 4U1JA 1WTGT 4JDTL 5FKAB 5EPMB 1OP5K 5GS0L 3QDJE 3T65B 3VD4A 3WUWG 1F6AB 3TWCL 3U30B 3VDAA 3VXME 4CMHC 3RVUD 4M8QA 1DUYB 4D2NA 4TRPH 2LVCA 3MXVH 1IEBA 4HFUH 3FAXA 1NPUA 5EU3A 2LFGA 3N50A 3EO0A 3TNMB 1GHFL 5E99L 1A8JH 2J3SA 4GG8A 2VRAA 3L3JA 1EFXD 1MY7A 4X7CC 1DBJL 3BKMH 4MCYA 1KIUA 2DQDL 1RY7B 4P3DB 4JM2F 4Y5YC 3W11D 1BZ9A 2VDKH 1U58A 4F7PA 5E56A 3QIWB 3DV6B 5KVDL 4YDLB 2IALA 1NL0H 4XP9L 1OARL 1I8LA 1G7HB 2KKQA 3TO4A 3NOIA 1I3VA 4HDIA 4JFDD 4MAYC 2XTJC 4NJAH 1G0DA 4PJCA 5C07D 4M48H 4UNUA 5DR5H 1G6RA 1SHMA 3FO9A 4PRHD 4XXCA 2VL5A 4HEME 5IW1A 4R96A 5D7IA 3CDFA 3GSUB 1TCRA 5IBUG 1FIGL 4R90L 3U9UB 5I71C 5C6TL 3C6LC 3K1KC 2RBLA 4LIQH 4ELME 5FHBH 4QTHA 4EUPH 2IPKA 3HPLB 1ND0A 3AUVA 4UDTA 5GGQL 5K9QI 4OTXH 2Z91A 2BNUA 1RZ8A 1S9YB 4XP5L 4LHUD 4NZDA 1BQLH 1NMBL 4MX7B 4NM8H 3WNPA 3U0WH 4MAYD 4U49A 4YHLL 4M6AA 3KPSE 4F2MB 1NAMH 3GKWL 1I4FB 4U7MA 1UKTA 3T77B 2YZ8A 3IDIA 4AT6B 1I7TB 2YXMA 2EE3A 1UB6B 2R56L 4DN3H 1BPVA 2VLMD 3S6CA 4G8IA 1TITA 3CMGA 1OAQH 1NAMB 4AEHH 3UO1L 2A77H 1L0QA 4HMEA 1CLOL 4OF5A 3MZTA 3DV4B 3MV8A 1MJ8L 4NRZB 1FV1B 2WW8A 4X6BA 3V5HA 1PQZB 2EEDA 2W9EL 5E6YA 3H3KA 4FXKA 3LDBC 4Z8FL 2R69L 1U3HA 1FIGH 4HCRL 5EZIH 4JQXA 1QLEL 4PRDA 3IDJA 5DQ9B 2BVQA 5HHMD 3EYQD 5D8JL 5ENWA 1X4ZA 1WFOA 4ZPTB 4DAGL 4U6XA 4N1HB 4RDQG 4LEOB 1RZ7H 3CD4A 4LPXA 4KJYB 3WO4B 5HYIA 2CIKA 4ZAKD 4LSPL 2XNAB 3KNBA 5BVJB 1T6WA 2DOCA 1D5MB 3PG2A 5TH2B 4K7PH 3RWDA 1AD9B 5LVEA 1DANU 1NLBH 5L7XH 3ORJA 1MHPH 5CWSA 5JR1H 4WWKA 3RGHA 1IC7H 5JMOC 1CGWA 4YXHH 3F7QA 4KQ3L 2WBJD 2Y07H 1XF5A 3BZFB 1EEZA 2DI7A 4XB8A 1T1WA 5F9JA 2NCMA 4I48A 1YNLL 3LKOA 5KN5B 5HYQB 4M7JH 3S4SG 2W0KA 1VGKB 3Q48A 1JIBA 4NNYA 3VH8B 2IQ9L 1WGOA 3VFSB 4NQEB 2GJ6B 5F6HJ 1BAFL 5CJOH 4JVPA 1OD9A 1ADQH 2Y5TB 2EIZB 3TVMA 1WFNA 1L7IH 3WNKA 5F7HA 1T5WA 3GMPA 4OF0A 5HHVH 4MWFB 3MRDA 3VXQB 4B7IA 1GC1C 1JYWA 1KBGL 1QSZA 3UBXA 5HPMB 1X4XA 4PJIA 3VXSA 5DVKA 3ZHLA 4XX1G 3CU1A 3GSVA 1RIVH 5FK9B 1AGBA 4X6FB 1WC7A 3ZKMD 1JHLL 4W68A 1YMHB 3IFNH 3DETD 2DQHH 3MRLB 4NJ9H 4HFWB 4PJAA 3TIEB 4KKAC 4B53A 5FYKE 3MRHA 4GRLA 2VR9A 1BFVH 4RWYH 4S1RL 5JO5B 4Y4HA 1ORSB 2QQKL 1RHFA 3VJ6A 4KAQH 2E27H 4WJ5A 2C3XA 1E0OB 2XZCH 4UQ3A 3SDDB 4WCYL 1DUZA 3VFMA 2GK2A 1MIMH 3KVQA 4C4KT 5F9OH 1J05A 1R6VA 5DXWA 7FABH 1NCWL 3DJ9A 3W9DB 5JIHA 5E9DA 4G7VH 2PW1A 2ZUSA 4G6ML 5IFJA 4R7NA 5GSRB 3DX6A 2OJZH 1NCCH 1IGFL 2DRUA 3BWAB 3LEVH 5ESAA 5BZWA 4XPTH 1H3PL 1S7VB 3M17B 1GPOL 3BQUB 1KTLB 1WQVT 4AH2A 4LOUD 1NQBA 3CSYB 3BN3B 1QRNB 2PYFB 4GQ9H 3RY6A 4Q0XH 2X1OA 2ARJQ 3P9LA 4PTUA 3TO2A 4EZMA 4PREB 5T3XH 2HLFC 1CE1H 1OAUL 5GRYA 3O3UN 4XC3H 1CLOH 1L7TH 2FWOA 4NQVB 4OLYL 5DT1L 4PJIF 4PJ9D 1Y18B 3RVVD 1RZGB 4L1DA 1EFQA 1Q9LA 5CEXB 5I1EL 3BWUC 3FOLA 4P5KB 2VLKA 3DROA 1J1OH 4GMSH 3NA9H 5I0DA 4MA3B 4JY6B 2Q76A 3QEGL 4PTTB 1A9EA 3LQAH 2BXZA 1YEEH 1BBJA 3UAJD 4ZS6D 1KPRB 3QNZA 2EH7H 3BGFB 3I50L 2QL1A 4HG4K 2Q8BL 1JPST 3AY4C 5SWZD 3V95A 4X5XB 4OGXH 2EE2A 4HGWA 4OZHA 5ALCL 4P2QD 4RGOH 4LDOB 1ZV5A 1QSED 4FQCL 1UFUA 4ODUA 3MBEB 4MJ5B 1NGXA 3DO3A 3SDXA 3HRZB 1TZIB 3L5IA 4LIQL 4YE4L 3ULUH 2VIRA 3QEQA 5AZEH 1MJ8H 2WWMD 1HSAA 4LAQH 1U8IB 2DQCL 3L3KB 1LE9B 2DYPD 3HAEG 3BP5A 5FV2A 1A02N 3LHPL 4JG0L 2IG2H 5JHDD 5EZJA 5I16A 4S11A 5IVZB 1W0YT 4PJ8C 3BGMA 3MLRH 1I8LC 3FRUB 2NXZD 4BK4A 3AB0C 3HTLX 3B9VA 2FEEI 3MBED 2CRZA 4LGSB 3LV3A 5FM5O 5EBMA 1XGRA 1QFPA 4HWZB 3NCBB 3ZYJA 4G8IB 3GM8A 3D2UB 4ZOBA 3BOVA 1JWMB 2BVPA 5E24E 1FZJB 4WFGD 4WW2F 1N64L 4ZO9A 3ZL4L 3HAEA 4JFPA 4MDJB 3W9EA 5B38G 4BKLA 5K9JH 1UZ6E 4XBPB 3FQUB 5EO9B 1WIUA 4TNVK 2VE6A 3T4AB 4Z78B 3HB3C 3IXTB 4C56B 4Z9KB 3RPIA 1ZGLM 5D72H 5IR1A 1CFNA 2UVEA 4OLXL 4KTDH 5F7YC 4JM2C 3WFBL 2VL4A 2PO6B 4F33A 4DKDC 5C0CA 3LSOB 1ACYL 3VRLF 2GAZB 4PG2C 2W92A 5H94A 4NM8L 3HI5H 3GSNA 1V3KA 5DRNA 4X7DC 4B0MM 3GJEA 1QLFA 4KAQL 1IAKB 4JFFD 3M8OH 4LRIC 4LF3B 2QADC 2VLRB 1JNHB 5GISL 1KUMA 1JPGB 2VZUA 4NWUH 1M05B 1CBVL 1XGYH 4LQ1A 5DMIL 7FABL 4KROD 3I9GL 3ARGD 2DMKA 1IKNC 3FHQA 1JWSA 2P4AB 3UJJL 5HGBB 2FX7H 5IMKB 1MREL 1KG0A 3GMLB 3LZFL 4I48B 3MV9B 4YAQA 5HHPB 5J4MA 3BSZH 1ED3B 3L3DA 4LVNB 3VA2C 3KPRD 2AJXL 4X8XA 2E7BA 3D39B 5DA0B 1DJSA 5KAQF 5CJQL 3OG4B 1NCDL 5FYJH 3MCKB 4XI5C 2CK2A 2EE9A 1IGMH 3OKEB 2H2SC 3TO4B 1HHGB 5EZLB 2J5LB 3O3DB 3T0ED 1IQDA 3LD8B 4HMDA 3SCMC 1GGIL 2A9ML 3H2WA 4I13B 2Q6WA 1TDQA 2XFXA 4EI5B 4QXUL 1KN4H 3F6LA 4WHDA 1KJ2A 1QSEB 1QO3B 3RDTC 1ZSDB 1UB5B 3RWCA 5E2UH 4CDGC 2IH3A 4HIJA 4ZNEE 4JRXA 5D7LE 1NCBL 1ULVA 4OLVL 1DVFC 3S9DB 1YEGH 2OK0L 3OKEA 4U1LA 1MLCA 1GOGA 3V4UL 1WBZB 4ZMAT 4G43B 3VWJD 4KVCH 1HQRB 4X6CF 1CYGA 3OAUH 4P46D 5I8OH 3P77B 5SWQB 3AS1A 4GRWE 4JRXB 1I9RL 3GI8H 1MCKA 5I1AA 4MNQB 1LD9B 5F9OL 4KTYA 1HSAB 4I0KA 4EBQH 3QG6A 2P43B 4PJHB 5D70H 1RFDH 1F90H 5FGCE 3KLAA 9CGTA 3FKUS 5FF6A 1FL3B 1DCLA 1F8TL 5EA0L 3LKQB 3Q5TA 5LWYH 4IDJH 5J6GA 1HINH 3K3QA 1EGJH 1KEMH 4MNHA 2KUTA 1U8OA 4M61B 4ZFZA 4Z5RB 3GMMB 1I8MA 4KK6D 2IPKB 1MVUB 3VD7A 1UADC 4YHKH 3L7EA 1BWWA 3V4PL 2D31B 1NBQA 5EO9A 2BVEA 5HGDB 5DJDA 2IBBA 2NW2A 1S5IL 5JMRA 4FABL 5TPWH 3U4EB 3U1SH 4GS7B 1RZKC 2Z31D 2V2XB 4EN3D 1LEIA 1G7MB 2VDNH 4OZGE 4X80L 1FZJA 5FAAA 2ICEA 3ARFB 2HG5A 4XZUB 2DBLL 4GMTL 5CD5C 2R0LL 3AAZB 1QFWH 3EUUA 3H9ZA 1I3UA 3LRGA 3U0WL 1KIRB 4XMKH 4JFDB 1S7TB 3SKMB 3BT2H 1PLGL 3RPIB 3UCRA 1JZ8A 3HR5A 3OGOE 4PRHB 2YBRA 4DGVH 1D5ZB 3ECBA 5BW7C 5HYSG 5I18L 1N64H 5A2LH 3T2QA 3W5MA 4X9GA 5DJAA 2BMKA 3TIDA 1IFHH 3NZHL 4M5ZL 5IB2A 5I8KH 12E8H 2A83B 1IGCH 4ZUWB 2VERN 3L7FA 4OZIE 3IETB 3MODH 4PJFE 3UJIL 4OCNC 1WV7T 4OF6A 3CLEL 1FYHB 1S3KL 4IHOA 4HKZA 5CAYB 4AQOA 4M4PA 5F8QC 2VXSL 3ARDD 5DJCA 1P7HL 3GSOB 1BD2E 1N6QH 3H42L 1URLA 3KPQA 2K7QA 1K3ZA 4OUOA 1D9KC 3KYNB 3RIFF 3PQYE 3QCUL 2BDNH 1INDL 1UKQA 3L9RB 4JKMA 1XR9A 1BQUA 1SMAA 5EC2A 5CEYB 1X5HA 2VLRA 1UT9A 2RCSL 8FABB 4FZEH 1PLGH 3UTQB 4NN5C 3IVKA 2ARWA 4Y1AE 3HI6H 1C08A 5CFHA 4YXLL 4L29B 4CMHB 4DKFL 2VC2H 4APQC 3NCYP 1U92B 2UYLA 1JGEB 4I0PB 2AXFB 3WXWL 5J13B 4KQ4L 5C0BD 1I9IL 4NQEA 4EN3C 2F54D 1CG9A 2D7QA 3BP5B 4WFHD 3B3IA 1XF4B 5DEFA 5C0GA 2VXUH 3D1MC 3MLTB 1SY6L 3GI8L 3G5YB 4Z7VA 4X6CB 4JGUA 4U1LB 3RWGB 1A6AB 3MLVH 3KAAA 5HDQH 2G75B 4XTRD 2XY2A 4LSQH 4QCIB 3LV3B 2VNCA 2FCBA 2RHEA 3SOBL 4YH6A 1F4HA 4NO0D 1JWMA 3OKMB 5K93A 5ALBL 5DEGB 5BS0D 1ETZA 5T3ZE 5F3BB 3FB5A 3LKSA 2OP4L 4NFDA 4UV7H 3FT3B 2DQFA 2DLTA 5JLZB 5JPMB 1DBBL 25C8H 4WUUD 1ZWIB 4HUNB 2FGWL 2AI0L 3HE6C 4NHUA 5DHVH 2OX5A 2YD1A 1IKFL 3OPZL 3MRHB 3IRZA 4NC0B 1AO7B 3AS2A 2JELL 4JKKA 5A2JH 4CKVX 4ONFL 1CGTA 4NKOA 3MLSL 3DO7A 1F3DJ 4P2YA 2XZCL 5FYKL 3MO1B 3PV6A 4XX1E 1VGEH 3WD5H 4JHAH 2GKIA 4NQSB 4EDWL 2HKFH 3TWCH 5JDSA 5I1HL 2UZYB 4L3CA 3GMOB 1R3JB 3OHXA 5F7DA 1MUJA 4QRSA 5E5RB 4WI7A 4HUMB 1G6RL 2I9LB 3WFDH 3DHJA 5B39A 4POUB 5C92A 2IJ0C 2EDOA 4V1DA 3MV7A 4LIQE 5EIIA 3GK8H 1UM4H 3C6LA 2AQ2A 1N3NB 1JTPA 2ZPKH 1MFBH 2P8MB 5I18H 3TCXA 2CLVB 3A67L 5KSVB 4JFPB 2FB4H 3W9EB 4H26A 3AMLA 1GC1L 2R2HB 4XXCC 4MQ7A 4X83A 3JWOL 4YZFE 2BY3A 4B5EA 2A0LC 5DLMH 4HV8B 3SCMD 2G2RA 3V6FB 3O4LA 2FH6A 3T0EC 3OXSA 2VL5B 1XCQA 2NXYD 5I76A 3RWEB 1CF8L 3JSSA 4PGJA 1GRWA 2Y5EA 4Y5YA 4UINH 5I75C 3L5HA 4PBWD 5ICXA 4N9GB 4UILL 3RIAF 1F97A 1W0VA 3KYOA 1J1PL 4PJ8B 1FL5A 2HJFB 4LSDA 1GZPB 4XMPL 2YPKB 3QJFA 4NO0A 4ORGA 3B83A 1T0MA 4E5XA 5DZLA 1LEIB 3QAZC 3O41A 3F6IA 4NQXB 4Q6IC 5KVMC 1WFUA 1NCNA 3BH9B 5TDOB 1EHAA 1EAPB 1QBLL 3BUYB 4AIZA 3B5GA 2Q87A 4MGXA 1IM9A 2FBJL 5D7IE 4G5ZL 4MJ6B 3S8WA 4OZGB 4QRPB 1FIEA 1I85A 3O6KH 3ZE1E 4OB5L 5D71L 3T0DA 1BX2A 3MYJA 1IAIM 3IDIB 4AT6A 5I1DB 1S78C 4U6VL 4Q9CA 3OKOB 2X4OB 3NN8B 3UTSA 5H37G 1JL8A 3BT2L 4W6WB 4Y4HD 4YFEA 3KLHD 3SDAA 1GYAA 5KTEH 2WBWB 2YUZA 3GMMA 4WVRA 2AJZA 5A16A 4TULH 5DYOA 3MGOA 4Z7WA 5T1KB 4IDLA 3FB5B 3LKSB 4HIEB 3HNSH 3ALPA 2Y5TA 3MFFA 3NZHH 4YHMH 3ET9F 4KKLC 3VD5A 4BM7A 3K4ZA 4GAFB 1KXVC 5GZOD 1B2WL 2P7TB 5L2KD 4ZDHA 2CMRL 3GIZL 5DUMH 1CWVA 3RVWD 3SBWA 1MF2L 3OJDB 1DLHA 3GUTB 5I2IA 2ATPA 5IJKC 4QT5B 1JNNH 1L9MA 1FNHA 4LARH 1J0ZA 3RP1A 3QHFH 5L2JA 4E41E 3U0PA 3JTTB 5MENA 2JE8A 5EG6C 1SY6H 2DI8A 5BXFB 2Y1VA 4HBCH 3CLFL 4QNPF 2XOTA 1D5MA 5D6CB 2ORBH 1EO5A 5JLZA 1CFQB 2VTFA 5T1LB 5CSBA 4MAUL 4IRZH 5CWSB 1A1MB 3T3PF 4YDVB 1JV5B 1G7IA 2FYYB 2PTUA 1FNSH 1L7IL 1GGTA 2NY2B 1BOGB 4P99A 2BVQB 4MXWH 3O9WD 4H0IA 4FMKA 4HHAB 4O5LL 3UAJC 2QV2A 2F8OA 2WWKO 5EIIB 4ODHL 2AJ3B 4FRWA 4JM4L 4P5TD 1MCFA 2D9QB 1MCWM 1MI5A 1D5IL 5TQ2L 1UM6H 3ES6A 1WZKA 1DQQB 2H26A 3OHXB 4C57C 1N0LA 3WE6A 1A2YB 2GJZA 1DQLL 1X5ZA 4DUXA 3EKCA 1S7UB 1U8PB 2R29L 1NEZA 1HILB 3GSUA 4UOJA 4IRJA 3I6GA 4WFED 2K1MA 4LBEB 4M7KL 4XVTL 5JXEA 4U1MB 1HHHB 2X9YA 1FH5L 1SM3L 2D9CA 3X14A 3GSRB 2V5RA 3L9RA 4Y16D 1F6AA 2AK4E 1UZ8A 4I77L 4D3CL 4XGZA 1Y6KR 3TN0B 3EFFB 1FJ1A 4XCCL 4QY8A 1U8KB 2WNGA 4DK3A 1WAAA 3O3AB 1AKJB 1QG3A 3VI3E 3TPUA 3NACH 2K3TA 4UQ2A 3NMEA 1DZBA 1A7RL 5C0FB 4N5EC 4M6MH 4NN6C 4HZAA 5DJZA 4DUVA 1PEWA 1XF5B 1KT2B 1S7QB 4N1CA 3B9KB 4IRJB 1UWEH 3MX0A 3TZVD 4PJGF 5KN5A 4NRXB 1II4E 5BVPL 1HYSD 1XGTB 3C60C 4QTHB 4OCRH 5AYUL 3T3PE 4K8RL 4ZOEA 3X17A 1NBZA 4NOBA 1XGQB 5F72S 1NCBH 3RGVB 3PABA 3UTTE 1J5OH 3QXVA 3QSKB 1KB9K 1P5VA 3T0VA 4HFUL 4ELMA 2KZWA 1BMGA 1VGEL 4R0LA 2MCPH 1LEGB 5DO2D 4Y5VB 5C9JB 1L0YA 1UM6L 2NTFB 3QXWA 2X40A 5MHSE 1OWRM 4KJPC 4KJWC 3Q6FB 2CR3A 3MOAH 3CNKA 2I26N 4NQCD 4KKAD 4PIRF 4E41D 1Q9KA 1JTTA 1H3PH 4KQ3H 3VXNA 4TVPL 4DZ8A 3D0VB 3WO4C 4G6JL 3D3VE 4MCYB 1HYSC 4OLYH 1BIIA 2GFBB 5GS1C 2LAAA 5EOQL 1U91A 2R1WB 1KYOJ 5C0CD 5H8DA 4EI5D 5E4EC 2LV4A 4MAYB 5HHMB 4P3CL 5KSBB 2DQHL 4HIXH 1X6LA 3QXDA 1JJUA 3P3YA 1F4XH 5KS9A 3QQ9D 2BOBB 1CGUA 3O0RL 3D0VA 5AUMB 4IDJL 2APFA 4M62H 4M6OL 2DKMA 2PYED 5LBSL 5JOPE 5GRUH 1JHTA 3MRKB 3AREB 4P23B 4Y2OA 2A73A 3QFJE 4K94H 2C1OA 1P4LB 5C0IB 5GIRB 3VXRA 2APWA 4MDIA 3KPRE 3CPLB 1LK2A 4PJCF 4D9LL 4W70A 1DLFL 1IARB 5EU7C 1C5BL 3IAPA 4F57H 1EBPA 4F37F 2B5IB 5DUBB 3ARED 1GAFL 5DJ0A 4BZ1L 5HJ3A 2RGSA 2CDFA 1EVTC 1OGTA 2FJHB 2BOCB 3BVNA 3EOYG 1FNSL 3S3SA 5E95B 3FQTA 2VLKB 3DROB 3NABH 2VLLA 3ZLQC 4NBYB 3BH9A 5TDOA 2MKLC 3RA7H 5F9WC 4HPOL 2XG5A 4Z7NE 5CLWA 1KFAL 1RUQL 2SEBA 4KUZH 1J8KA 4O2CB 1TQBC 4ZPVA 2R4SH 3TJEL 2P46B 1M05A 5B4MC 4OGYH 4G6MH 4O51B 5FCSH 1IGTB 3G9AB 1NGQH 1H3TA 3SGKA 1AH1A 1AKJD 4NZRH 3TH3T 1KCKA 1YYMH 1P7QA 5DGRA 1HE7A 3OJVC 4M48L 5B38B 3ZDYF 5GS1B 1IAOA 3SGJC 4X6DA 1HWGB 2EXYC 1DL7L 1VFAA 3BHBA 2ZSVA 1F4WL 1UJ3C 3L3KA 2IBGA 5TQ0L 2OM5A 4UV4H 4EOWL 3S34L 1LK3L 2YPLA 3I6LE 3K8LA 3RX8A 3BGAA 4GRMB 3B2UD 1G6VK 4X0KA 1KLUA 3V2AR 2A1WL 1CICC 2YD8A 1RZKL 4LPYA 1B0GA 1S9XB 1U8MA 4O58H 3K81A 4ODUB 4QT5A 3HLAB 4M43L 2Y07L 4MB5A 5HGHB 1QACA 3C60B 3LRSA 5KVGL 3EDDA 4XB7A 4NM4L 4NRXA 2ZCHL 4IRJC 3ZKXB 4NPYB 5ID1B 1MLBB 1JYXA 1KIQB 4NN6B 1S9WA 3UBXG 3ZYOA 2CKBH 1F00I 5EZJB 4H26B 4QRTA 1FZOB 4AEHL 4OFIA 2CLZA 3GEWB 1BGXL 1SEQL 2FHCA 1KPVB 4PJAB 5F7MC 5INCA 1JNJA 4KDTC 1GCFA 2ATPB 1N0XL 3O6FC 4HCRA 2YD2A 2FX9L 4YAQB 1AXSB 4L9LC 2E3VA 4JFYA 4U1MA 2ZZUT 2GCYA 5ITFB 5KJRH 4J6RH 3BIKA 3UYPA 4ORZC 5KSAA 5IQ7H 1CT8B 2R1YA 1I8KB 3W11C 4PGEB 1UQSB 4OLEA 2DDQH 4MA1B 3D18A 3WJJC 5BMFH 2CRIA 5E5MA 2AAVA 4MWFA 1FAIL 3OQ3B 4RMQA 1R5IB 3CSPA 2XRAH 4JFZH 4F33B 3O6FD 4NSKA 4WU5B 1MCLA 3RL2B 1MCCA 2XKNB 3U0PB 4P2OC 4AEEA 3EJJX 2K9UA 3U82B 3N1PC 3WFHA 5I17B 1EX0A 1TVBB 2NY2C 35C8H 3BQUD 4WRLA 1QA9B 1MIML 2HT3C 3A6OA 2EIEA 5HDOA 4CU6A 3BUYA 5DTFA 4AIZB 5C0EA 5FKPA 1TVHA 1YEDA 5EU5B 4ZSOB 2F54E 4MA7L 2HP4A 5ID0B 3FL7A 4S0SD 3O3DA 3S37L 4DJMA 2EKSA 3REVA 4HV8A 4LLQB 1CXEA 3RU8L 4ZYKA 1WISA 3OAUL 1CXIA 4ZUUB 1XCQB 1U93A 4DOHE 3DIFA 3EYVA 2A9NH 3QJHA 3M1BB 4RAUB 4KMLB 3MJ7B 1V3MA 2FNBA 4JY6A 5F7KC 3HZMA 1MAKA 4HZLA 3A67H 1A7PH 3OAZH 2AGJL 3ESUF 4HQQH 4CMMB 3MC0A 1BP3B 1HXMA 2XACC 4ZYKB 1G9EA 4NNXB 4ZUSB 2FWOB 3KPTA 2OMBA 4MNQE 2FECI 2N1KA 2W60B 4JZNA 2WBJB 4KKNA 3LS5H 2ESVE 3BMVA 3L1OL 1T0MB 4Z7UF 1OP9A 5F89A 3MOBH 1WTLA 2WZPD 3SE3A 1LO5B 3O45B 4KKBD 4J4PD 2MQ0A 2OTPA 3BH8B 1GVIA 3TT1L 5HXMA 1U3HD 3WUWA 1P9MC 1QSEE 4QRPA 1EXUA 1XIWD 4R3SB 4ZUSA 1AGEA 5HHOD 4NQVA 3WKML 2BVYA 3QZWB 5I1DA 1RJCA 3VD9A 1X5XA 2I07A 5CEZD 3CH8A 1MFBL 4QHKI 1OTUD 1K8IB 1LDSA 3PWJA 1TQCB 2DWDA 4M62L 2YA1A 3CUPB 2GW5A 4PP1D 1MRDL 1EAPA 1VEMA 2AQ1A 5FUCE 3GBML 5JW5B 1J18A 5C0CE 5KSUB 3SKUD 3T0EA 1KJMA 4HT1H 5K9KA 1T04A 5DD6A 3MUY1 3PP4H 4EUPB 1KLUB 1TJIH 3OB0K 3BPNB 3IJYA 3SKNB 1Z3GH 1QRND 4DVBA 3RKDC 1FVCA 3MODL 1NGPL 2FATH 3QI9A 5C09D 4WV1C 1TTFA 4U6VH 5HVWA 4J3TA 4GKZA 1E6OH 3VDBA 2B39A 2WK2A 2NY1B 1IGIH 3P0YH 2D7OA 3DX9A 1WWAX 2I5YH 3VXRE 5CP3A 2BP3A 4RMTA 5BS0A 3KPRA 4F7PB 2FHFA 3RVWC 4ZXBB 5GS0H 4WI8A 1MJ7H 2HG5B 3AU1A 1INEH 2JB5H 1QBLH 1KEGL 3QNYA 4WO4A 3T0EB 1Q1JL 4JN2B 4PJXA 4OJFL 4XNYH 2EDJA 4OLUL 4JQVC 2ICWI 5JHDB 1MELA 1EAJA 2G60H 3GSXB 5IHUH 3ULVF 4Y2DB 3CFKA 2YZ1A 4KU1A 2JJVA 3MLZL 4P2RB 4XNUH 2JCCA 4PRNB 3MLUH 4KZEH 3OKDA 1I1FB 1WZMA 3ZE2E 3FB6B 5JQ6L 3L3HA 4N0FB 1TMCB 1I9EA 2E6JA 4NYLA 4HT1L 5L0QC 1C5CL 1MHCA 2VH5L 1IGYB 1KACB 4OCWH 3RGVA 5DWUH 1OSZA 1FZOA 4ZFGH 2UWEB 5I30L 4LAQL 4WUUA 1ZOXA 4LU5L 4U6TA 4JPVH 1FNEA 5INDB 4MD0B 3K2UH 5JXAH 3HE6A 1EMTH 1ZT7A 1Q38A 1RURL 1KELL 3UMTA 3BIBX 1FVDA 4FQJL 1AXSA 5CMAB 3IFOA 2ILLA 4O2EB 4XNQA 3OKMA 4NKOB 3DO7B 2E7CA 3WXWH 1UZ6F 2IQAB 2GJ6A 1FBIL 1ZT4B 1VFBA 3HZVA 5LG1A 3ARGC 4PJDE 1SJHA 3C8DA 3H3BC 1HOCA 4JFXA 5DTFB 2VQTA 4GRMA 2P5EB 3A6BH 5HI3D 4Z18A 4JRWA 5K9QG 4Y16C 2X4TB 5INCB 4JO2L 5E7BA 1RZJL 4M1CC 4EN3A 4JHWL 5SWZB 4NSKB 4ZUUA 4QOKA 1XCTA 1WT5C 1X3DA 4U1HB 1OAZH 3QUZD 3C08L 3R1GH 2V5YA 3HC3H 5D2NA 2B2XL 4FQXC 3WIHH 1A6TA 3OAZK 5GSVA 2IPTH 5FYKH 2VXTH 1BD2B 5JORA 2CLRA 4ODSH 5ID0A 4R0LB 3UDWC 4ODBD 5I1HH 1T2XA 4FXGB 2A9NL 2QEJA 4FFZL 1JGLH 3RVTC 3NPZB 2D4DA 1F45A 4L8DA 2X89A 4IEFB 2XFXB 4JJ5A 1CIUA 4LCCA 1IGFH 1NCCL 1U2CA 4LVOB 4AIOA 2FJHA 5J8OA 3VRIA 3E6FA 2J8OA 4I9WE 5KVEH 3B6SB 1DQDH 4IRSB 3HG1E 2J8UA 3SDXE 1KIPB 3QUZC 4YDKH 1DN2A 4X7SH 2FEEL 5DMKB 4NRYB 4LMQI 3QA3B 3VGGA 4O2CA 3MCLH 5D93B 2CRYA 2DLIA 2OI9C 1MCPL 1A21A 2XZAL 3HNTH 5DI8B 3BP6B 3NPSC 3TNNA 3DMMB 4Y4KA 1EZVX 4BFIB 4GW1B 2P5ED 1NC4A 3FO0L 5HDQL 2YD7A 5FO7A 5HHXH 5T5NG 4HULB 5C86A 4NKDA 2VR4A 5BVPH 4I2XE 5I0ZA 5I1JL 1U8OB 4K9EC 1I8MB 3QIBC 3EO9H 4FQ2L 2OR7A 3BKJH 4GSDH 1IT9H 5BV7H 3DV6A 1EJOH 2R4RL 1JHKL 1VA9A 3HZMB 4MS8D 5D1XC 3BJ91 4AY0A 1U8LB 1D5BB 2VLJD 1DVFD 5F71A 1M7XA 1MFCL 4F8QA 4YUEH 1LNUA 1DN0B 1SYSB 2ED8A 4QYOA 3WS3A 4PP2A 3NN8A 3UTSB 3QQ4B 4N1EA 1HK6A 3BYYA 4W4NA 5MEOB 3WFEL 4LSUH 2R2CA 4X4YB 4U31A 2Z8VC 5F6IB 2VN7A 4LEOA 2YXFA 3D2UD 1KCVL 3HR6A 3V5DA 2J1KA 2JIXB 2VUOA 1HHKB 2YD4A 5EO0A 4HLJA 4KVNH 5E0QA 5HHNB 1G7HA 4AYFA 1YQVL 5GGTL 1BQHB 3PWVA 4OGAD 3C5ZC 3HE7C 1MHEB 4ZTPL 5E8EA 3BDYH 1S7WB 1JTOA 3EYSL 1ZHLA 3QFDB 4PRPE 1MSPA 3VW3L 4PJHE 4NFBA 4OFVA 3U7AA 5CBAA 1L6ZA 2F58H 4L8BB 3WSQH 1UM5L 3DMMD 1UH4A 2XN9A 4K3JH 4WFEE 5SX4I 1KCSL 2LABA 4H8WL 5IHUL 1QQDB 5DURD 3G5XB 1REIA 5CGTA 3D0LB 5KW9H 4OM0L 1ONQB 1AE6H 4LMQE 5CKAA 1D9KD 4M1GL 1QNZL 4JRYA 2NXYC 3SY0A 4LLWA 3GJFK 5GGTA 1JNLH 3EBAA 3VFTA 3H42H 5D6DA 4PLKD 1W2KT 1CDGA 1CXHA 1WZ1L 2V6HA 4IRJD 2VABB 3DUSA 3WKMH 3UTSE 4UIMA 2ADIB 1E6JL 4ODWB 4M6NL 4MD0A 3T3ME 1JPSL 4MXVE 3I50H 3LIZH 2FSEA 2IPTL 3IDXL 3OKOA 3SE8L 3ZT6A 3F7PC 3VGFA 5C7XL 5HGBA 1DVFA 1U3JA 4XVJH 2DF3A 2XKSA 2AK1H 3O41B 3HPJA 2HYMA 1I1FA 1NANH 3S36L 3FZUD 5IMMB 5IWLA 2EYSA 3R8QA 3BX7C 1Q1JH 1NMBH 2BHZA 4XAKE 4ONGL 1MI5B 4YIQB 1AR1D 1YMMA 4G6KH 4PRPB 3ZTJG 4D0BA 3QWRD 3K2UL 4R90H 4G5ZH 1RZKH 2AEPL 3VFWA 4XRCA 4E41A 3M45A 4X6DE 2HMIC 4ZFGL 2CD0A 5I30H 2X42A 3BKYL 4KRNA 4M1GH 4M6OH 4PJBF 5T3ZD 2XZAH 3HNTL 3M17A 4RISH 4EDXA 1JGVL 4DUWA 4PJFF 3OKDB 3SOBH 5JQ6H 2XWTB 1FNFA 1JF1B 2GQHA 2ZJSL 3T65A 4PS4H 3QPQD 1IKNA 2Z31B 4QY8B 5EWIH 4WTZG 4JPVL 2CLRB 3G5ZB 4KMTH 1LO3L 3EW3B 2WUCH 4FQHB 3IKCA 5E6IA 2FEDC 3BKML 5H2BB 4GRLB 1OF2B 5J1AA 4M7ZC 4KDVA 1HILA 4JZJC 1N59B 5D7LD 1NBVH 3SDCC 3VJ6B 3WFCH 4U1HA 2KZ1B 5H94B 2V7NB 3G6DH 5HVHB 4J8RA 4K3DH 1U8KA 4G8GD 3P0VH 1GZQA 2IQ9H 4Z95L 3WHE1 4ZQKA 4UQ2B 5JW3H 5ELIA 5K9KB 1ZXQA 1DQMH 3DMMA 4S1QH 4Y4KB 4P2CG 3MYJB 5IB3B 4QHLB 3RL1B 3HC0B 3LN4B 1Y18A 4RQQA 3TF7C 5ILTL 2P48B 3LOWA 4Z0XA 1J10A 3B2VL 5LGJA 1HDMB 4HWZA 5DJYB 2AJZB 3B6SA 3QRGL 4BH7A 3OAYH 4F7MB 3DTXA 5ALBH 2NR6C 1F4YH 1FAIH 3PP4L 3UYOD 4OI7A 2HTLD 5TE6H 5I16B 1H8OA 4KV5F 3TBTA 5GSRA 1IGML 5DJ2B 4FXGA 4S0TD 3DXAB 4YFDB 4XP6H 2QQKH 2X1PA 5EOTB 3HG1A 3TFKC 1CFBA 3IAQA 1ZHNB 3CU7A 4KK5C 4JPWL 1G1CA 2VXUL 3MV01 3MROA 1T5XB 5D2NB 3M07A 4YPGA 4NQXA 3QWOA 4YDKL 5C07E 1BD2A 3MXWL 4P4RA 1OWWA 5KZCD 5IVZA 4Z7VF 2XI9A 2VDPH 2A2QT 3O4LB 2NR6D 1MRFH 5F96H 4M8VA 3NZ8A 1MFAL 2WAHA 1S7VA 4FTVE 3ECBB 1K2DB 2XWBB 4S1SH 3X3FL 1UACL 4PGCA 4HJ0C 3KYMA 4XP1L 1H3VA 3U0TB 1KG0B 2FHBA 4KXZI 5A3ID 4K71C 4FQPA 4GQ9L 5FYLD 32C2B 3KXFB 4L4JA 1CE6A 3QBTB 2CDEB 4BQ6A 2R8SH 3OKKB 4QF1B 4OQTH 1SJHB 1IEHA 1JPGA 3BW9A 1OAUH 4F9PC 3L6FA 4F7EB 1HHIA 2P7TA 3O6KL 2GTWA 2ESVA 3W0WD 3QUKA 4OZFA 4FMFA 1XR8A 1D6EB 1J88A 1AQKL 2FATL 4WU7B 5T3XD 3UYRH 1S8DA 5JTWA 4GJTB 3OKLA 1I3RB 4BK5A 2Q76B 4URTB 1V3LA 3QEUA 4RRPA 3W0WB 4P5TA 1AXIB 5C8JA 3DYMA 1XAUA 5GGRA 4UIMB 1MRFL 5F96L 4ZD3L 5EU6A 4HJGB 2I60L 3TBYA 5IEHA 5IV2B 5DUBA 1T5WB 3GMPB 2DQDH 4JVWA 3FJTA 4NO3B 5T1LD 4UDUB 4U0RC 1FE8H 3MOAL 1MI5E 2ZKHL 3LKRB 4OCXH 4QLRA 1ZHBB 1WCBB 2XN9E 3WXVL 2E9JA 2GCYB 5ITFA 1NAKL 3PWUB 4L9LA 3VG9B 4NQDB 2PKDA 5SWSB 5GGSY 5CIPA 1I75A 4NQTA 2XY1A 3U36B 1UVQA 4EOWH 5C09E 2J8UF 4FTVB 2NY6C 1Z3GL 1KTDB 4G6FD 1DBMH 4NN7B 1UCBH 5EORH 2FL5A 1RJYA 4FABH 2JK5B 2LU3A 4KFZC 1AQKH 5EZIL 3IS0X 3CSBA 2X09A 4L4TD 3QDGA 4Z76A 1MCQA 5DVNA 3ILQC 3V7AG 1RZFH 3VGAB 4ZUWA 4ZS7H 5HI5C 1CT8A 4CN4A 4YIQA 2CKBB 3RA7L 4RX4D 4MVBD 1TVHB 4X7TA 1UA6H 3RAJL 1XGPB 3VA6A 2F53E 3U7YL 3HRPA 3V6OA 3ZTNL 3RDTD 4Y4FD 1FVEB 4H1LG 3ULUC 1BQHG 4XPTL 1TQBB 1EEYB 1UJ3A 4H88H 3DXAA 3I3EA 2XKNA 5J6HB 4X6DB 1GOFA 3LCYA 3TFKD 5TDPA 4Z7UB 4IIQB 4D8PA 3LHPH 2H2SD 1MVUA 5IQ7L 3RTQD 3EYFB 3MMEB 2D7TL 4CBPA 5GJTL 4LASH 1JF5A 4Y4FB 4HWUA 2BSRB 2FRGP 1EEUA 3IKCB 1YDPB 5C0FA 3CFEB 5IB4B 4J4PA 2IH1A 5GHWL 1N0XH 5E08L 3HC0A 4RQQB 3K7UA 4P9HH 3DGCR 3UPAA 1KOAA 4OI9A 1IVLA 3P9WB 5C6PB 2J6EA 3NFSH 3MNVB 3VD3A 4L8BA 2B2XH 2F5BL 3VXRD 4MNGB 1J5OL 2YA0A 3L7FB 2AV7A 4MA7H 3NACL 2XN9D 4XRCB 5E6IB 3V5HB 3FQXB 4JHWH 4XNZC 4QRRE 4YXKH 1OM3L 3T2PA 3NH7L 4PP1C 3GSQA 1KJ2B 4U1KA 2GFBA 1JHTB 3S36X 4LQFH 5H35B 5D2LF 1MCSA 5AD0B 1LD9A 2B0SL 5IHLB 2F9BT 2R2EA 2RFXA 4NQDD 4BFEA 3U2SB 4D94A 1CLZH 1O5DT 4I77H 1PX4A 1PQZA 1CDJA 3BP7B 3INUH 1MREH 3LZFH 4Y5VC 3RZCD 2NMSA 1YEGL 5IF0A 4JFDA 5F7FA 3MRIA 4LEXH 1QLEH 1ZVYA 4OQ1A 5DJ0B 2DL2A 5DJCB 1QFUH 1RIVL 1N6VA 5GS1A 2IADB 2VLRD 2ZG1A 1RHHB 1X5AA 2UYLB 1S7XB 3CVIL 4I0PA 5EOQH 4ESKA 2WM0A 3GJFB 3LKPA 1E4KA 5HHME 4ZFOL 5EU3B 1XF3A 3O2DL 5GIRA 1T3FB 5B3JE 2W1NA 3RWHB 5I1CL 4JB9L 3MGTB 4N8VG 2ZUYA 1E4XH 4O2FB 1J11A 3PQYD 4R0LC 3P4OB 1KC5L 1V7NL 1EK3A 4HEPG 1R3HA 3ARDA 4XVJL 4YQXL 2EDBA 3FCTA 4UBDC 4KUCD 5DD5L 5F88B 5C07A 3O8XD 1TXKA 1G9MH 3S5LA 4LLMA 2R0ZH 3WFDL 4PJEE 5EBLA 5EU7E 4EUPG 3LMJH 1YPZA 4Q9RH 4IMLA 1NGWA 3VXPA 1IC5H 5D7JB 1QKZL 2VZOA 1OTSD 1S9WB 1AD9A 1XGYL 1W72L 3GHBL 1YN6B 1CFTA 3G5ZA 4YX2L 3PWPA 4E0RA 5ISZA 4QNPE 1G0YR 4S2SA 5D1ZC 4GAJL 4BZ1H 2GYSA 4RIRB 4R97B 2HT3D 4K8RH 3HLAA 4J3OC 4H25B 1GGCH 4XP4L 2DIJA 2BMKB 4WI4A 3ZYZA 3TZVB 5FKAA 5JOPD 1VFAB 3NFNA 1LO0L 4QOKE 1M71B 1AQDA 2AP2A 1SYVB 1EJ6A 2HLAB 2RIKA 3DOSA 5DD3L 1LO3H 4Y5XC 1JV5A 1NAML 3QJFB 4WDIA 2VAJA 4HF5L 1HHGA 3ARXA 5EUKA 1C08B 1FE8L 4XWGH 3U30C 5ETUB 1XCTB 4JN1H 3JTTA 4UT7H 4CL7A 4NQDA 3EIFA 1W72A 1R3KB 1ZT4A 4J1UB 4O5LH 5IVXE 2ID5A 1ERNA 5IQ9A 5E2VH 3O8XB 3ZTNH 3WIHA 4GXUM 1T04B 4EUPA 5DRXA 1G7IB 4OIIH 2BRRH 5IEHB 2OJEB 1JPSH 1L9NA 3O81A 2J8UE 4N90D 2IH1B 2A0LD 3NA4A 1ZT1A 4AG4L 3RNKA 2MHAB 1WZLA 5HGAB 3ARRA 1I3RA 3FOLB 4OFYD 4PJGB 5C6TH 5H37H 2HH0H 3O6LL 3DX8A 3QDMB 3L3IB 1BVLA 1N6QL 1H5BC 1A9BA 3D3VA 5B8CA 4KVNL 3V5KA 4ZFOA 1ZS8A 5F7EL 4NN7C 3DVGA 4WV1B 1AY1L 4YNYB 3LEXA 3AS0A 4FFWC 3O3AA 4I8DA 5E99H 1XGPA 3T09A 2H32H 5TDNA 4MS8C 5D1XD 2J8HA 4EQ2A 1B2WH 1EEYA 5DD0H 5FO9B 4X5XA 3EGSB 4MNGE 4PJIB 1FCGA 1T83A 1WIOA 3QDMD 4I3RL 5CZVH 3RVXC 3VXSB 4YO0A 1MAJA 2F53B 2XICA 1IGCL 4JGMA 4PB0L 5DJ8B 3R1GL 4LARL 3E6FB 3O4LD 3I2CH 3WIFA 4BZ2L 5CHNA 5CD5D 2R0WH 3KPPB 4HIIA 4HWBA 3VFNB 4JANB 1S3KH 1W0VB 4C83B 2OZ4H 1ZLSH 2NW3B 3NIFF 4TOYL 1X5LA 4KI5F 1GZPA 2X4TA 3KJ4C 1A6VL 4YC2C 3MV7D 5C0AE 4L8DB 3RHWF 2ENYA 2Y36L 2BY0A 3B9AA 3CFCH 1VADB 5FYLH 1JGDB 2XRAL 4JFZL 3BAEL 2WP3O 4Q6IA 1Q72H 3X3GH 2W65A 4E5XB 5D8JH 4HWEH 5C0JA 2Y25A 1KTRL 5F3BA 4FZEL 2O61A 3TO2B 2X4PA 5DUPL 3N9GH 4X7EC 4JFOA 3CLFH 1CR9L 4LGPB 4RGNB 5D7JA 3QDAA 5E2WH 4F9LA 5EU5A 3TT3H 2COQA 4LCYA 1YEKL 4MJIB 5LXGH 4BQ8A 4XT1C 1EFXB 1V05A 5CUSH 2DLHA 3QIUC 3ULUF 2OLDA 5F44A 3MRRA 4HAFA 1R3IH 2X4OA 3EYQC 3VG0H 2EYRB 2QKIA 4I18A 3S36H 2YK1H 3MRBA 3ZDZF 4PD4K 2NY5C 2HMID 1I1AC 2VLKD 1J05B 3P0VL 4Z95H 5EUOA 2MSPA 4WW2B 5FA3A 3UTZB 2E7HA 5F1NA 4LF3A 3WIHL 1PG7H 4PBVC 3KPMB 3PHQB 3KPOB 4NNPL 4P46C 3OB8A 1FNEB 5A3IC 4NNXA 1N2RA 3C6SA 5FYJE 1OAXL 4OGZA 4HS6A 3VRIB 4HF5H 3MRFB 4RGMB 3GK8L 2VN4A 3P9LB 2CJUL 2H2PC 1D3CA 4O4YH 2FGWH 2BNRD 1CU4H 4L4TA 5I8EA 5L9DL 4OV5A 4QXWA 3E8UL 1MHCB 3KLHC 2V17L 3JVGC 3RUGE 4MJ6A 3S5LG 2E8YA 3TGXA 2HVKB 3IDMB 4KDWA 1VPOH 3QUKB 2O5ZL 1FG9C 3MBEA 4MJ5A 3ARZA 5HVGB 5C08D 5TE4L 1I9RH 2LE9A 3WD5L 1ITCA 2FR4B 4EXPX 2BHUA 4XBGB 1GIGH 2CGRL 5ENWB 4NC1E 5CD3A 5BXFA 2N4IA 5HD8D 4J1UA 4OQTA 4UILH 5BOPA 2VOTA 1RQ5A 1AGFA 1MEXH 3QNZB 2APBA 3C2AL 3GMQA 1NKRA 3BKJL 5BV7L 1T7WA 2EH8L 5FUCC 3HI1A 4R26H 3O6MH 2ICES 4G8GA 3IJYB 3SKNA 1DEDA 4LLUA 3I02A 5IFJB 1K3IA 2C9AA 3C09C 5HY9A 4IMKA 1FO0A 5FM4A 3T0EE 5IB5A 4QKXB 3PWUA 3WIFB 3MJ9A 1WAAF 4APQB 5KG9A 3EOBB 4K94L 3H7LA 4WUKH 4G8EB 4RMUA 1LVEA 3LEXB 1MCRA 1S5IH 2LAGB 2GITB 1MRDH 3GZKA 2GI7A 4OZHF 2BNRB 4WUUB 5EFIA 1T1YA 3GJFH 2XQYG 3K46A 3TJHD 2Z8SA 1JPFA 1Q9OA 2FBJH 3OGCB 4QHKJ 1MCHA 4A6YH 3JWOC 1P4BL 1WAAE 3E0GA 1UJ3B 1ZT1B 2IBZX 4U1SB 5E8OB 5C0RL 4HK0A 3K4AA 1U8JB 1YY9D 4PV8A 4FQ1H 4POZD 1FLTX 4X5LA 4Y19A 1PD6A 4LCIL 4OT1H 1NGWB 4X99B 4ZFZB 2HKFL 4OAWB 4IMKC 1R5VB 1A5FH 5DHYB 4U1NA 3JUYA 3GM0A 4PGEA 4KC3B 3QEGH 3FONB 3PL6A 5E2TL 1EH9A 1H3WM 5JDSB 1U95A 2DD8L 5DGQA 1BQLL 1NJ9A 1OF2A 1VSCA 4YPJA 1DBJH 4OLUH 1X5IA 4BSVA 2W91A 5F97E 1RZJH 1JGDA 1Z9SA 4PJDF 5D1QB 1KEML 1VEPA 2FX8H 3DX8B 4KHTH 4MB3A 3TA3A 2FDBP 1BFTA 2LU7A 5T3XL 1U8IA 4GMTH 4QXTA 5K59E 4I2XA 1BQSA 4TSBH 2ITCA 3V6ZA 4XC1H 3BRFA 2Z8RA 1FYTE 1QFOA 3DI2B 3HE7B 5I1KH 1G84A 4LHUG 5C0DA 4ZUVB 4LSQL 2OTWB 3C5JB 4PBXA 1EMTL 4XCFL 5I76B 3G08B 1OCWL 3C08H 3MLWH 1T4KA 3VFGH 2D3VA 3MROB 2NXYB 1NEZG 4R2GD 4L4TB 3DVGB 4JANA 1T0NA 3SKOA 4ZQKB 3DXAE 1Z5LA 2N7BA 2ZOKB 3QFJA 2CR6A 5TDNB 4ODSL 4JG0H 4XTRC 4Y8AA 3U79A 3WDIA 1VKXA 1QZ1A 2FIKA 4I4WA 3RVVC 2GJJA 2V17H 3ZKND 3T77A 3QDJA 1RVFH 4GG6E 1NDGB 3BDBA 4G9FB 3K1DA 3QO0A 4ZSOE 5EO1A 5JW4Q 1LEKA 5J6GB 3GBNH 2F19H 3JV6B 3V52H 3G6DL 3FB8A 5ERWB 2XQYK 4M61A 4Z5RA 4M1CD 5KVGH 3ARTA 1C7TA 2GSGB 4M8QB 1BF2A 1QKZH 2R1YB 4LHQB 3MRNB 1INDH 2JIXD 3QIUA 2NY7H 3SQOL 4FNLL 1QRNE 1AKJA 2AV1B 4MB4A 4BUGA 2OI9B 43CAB 1EHXA 5EBWA 2P47B 4JFFB 5E5UB 4LLUB 3MRRB 4OCLC 3CX2A 5JUEH 1OGTB 3IDJB 5F8RC 2H1PH 1N8ZA 1JGVH 4J8RB 1DFBL 4XPHH 4KI1A 4JRYE 5LKNA 4DGYL 1NFIA 1FLRH 1PG7X 2DICA 1XT5A 4MDIB 3EO0B 5CJQH 4JFHD 4Q6YA 3V4VL 4BQCA 1CE1L 3SGEI 2Q3AA 3L3JB 3LN9A 5GGUA 4ZG1A 1OT2A 3KPLA 4PRHA 3U4EA 3H9HB 3VWJB 3HG1B 1QBMH 3GMRB 3HZKB 5FCUL 4DCQA 3JBG7 3U4AA 4U6XB 5IHZB 2BVPB 3RGVD 1NFIB 5L9DH 4PJBE 4JFDE 1HQ4A 3MV8B 4UV7L 4OFYA 2YPLD 4GW5B 2CJUH 3NPSB 3B5TA 4FHBD 1CFQA 1MJJB 1IL1B 4FN0A 4GRWF 1NFKA 5HPMA 1U6AL 5A43C 1H5BA 1EDQA 4OBRA 3UJTL 4DZBB 4TPRL 1WIPA 4G6AD 3PHOA 2F53A 4JFYB 5D1QA 3BEVA 3UPCA 1A7PL 3KYNA 4RNRA 2OR8A 3TPKA 1AO7E 2VQ1B 2SEBB 5IQ9B 8FABA 1LO0H 2OXHA 4JPKL 2I9TB 4BFBD 1JK8B 4RCAA 2P8LA 2IG2L 4MMZC 2VYRE 2XZQH 5KSAD 4NCC1 5HDBE 1FFNA 2VZTA 3PP3H 4PJDB 2MWCA 3LEVL 4MHHG 4LCWA 1ZVSB 1U8HB 3JV4B 5AAMA 2HN7B 4RNRB 3OTTA 4ZUTA 5I1EH 3C2AH 4NHCL 5E1HB 4G7YL 4KUZL 3NGBB 4OLWL 1EUTA 4AEIL 1BZQK 4WIQA 2D03L 4JFQB 2GSIB 2HT2C 5CJBA 4KUCF 5CP7A 1M7DB 1HYRC 4NKIL 1F2XK 4TYUA 3RY5A 3MV8D 4L8SC 4V2CB 5CINH 5GRUL 5K9OB 5FYLL 4XVSH 4RGND 1CVSC 4HPYH 1KCVH 5DK3A 4ZO8A 4F7TA 3VGAC 4GLRI 3JV6A 3ZO0A 4CRPA 4PJFB 2X7LA 3QG7L 2CXGA 2WWKT 4IIQA 3S96B 4TUOA 5IROA 1ACYH 4UU9A 5IGXL 4JM2A 4OD2B 1ADQA 1CS6A 4PLJD 1GC1H 1NUNB 3GBMH 5D1ZA 2AEQH 4NUJA 3I84A 3RVXD 5J9PA 4YWGL 3SDYL 1K6QL 4NP4L 1T80A 5GZOC 5GS3A 3TNMA 4JLRB 4LNRA 5IW6B 1HHJB 5BQ7A 4BSVB 4GKNA 5L0QB 2X2YA 4NO2B 1I7TA 3CXHK 4FFWD 1HNGA 1TZGL 5T5FL 4DGIH 1DEEA 4HPOH 1MJ7L 2NYYD 3GSRA 3VFMB 1K8IA 2HA1A 3GBLA 4U3CA 5D9SB 2WQRA 3ARDC 1YEEL 3C09B 2DBLH 1BBJB 5D5MA 2VLJA 2YSSA 1KJ3H 5E94A 5LQBH 5CILH 5LJYH 5INDA 2QBWA 2XT1B 5JZ7C 2OZ4L 4R9HA 3SHSA 1IGJA 3J8F7 5JW4R 4ONHB 4GRLD 1SBBA 5FFLA 1JWUA 2AJYL 1RZGA 2YRLA 2G5RA 3O3EB 2ATKB 5DHXB 4TSCL 1OGAD 2DQCH 3ZYIA 5B39B 3P73B 2PYEB 2RJMA 4Z7UA 5IMOA 4X6CE 5ITBH 5HGGS 4YWGH 2VDRL 2ZUUA 4BELD 5M95B 2D7TH 3O45A 4PREA 5FYJU 3SKOB 3SE8H 5JOEA 1QYGH 1F42A 1X5KA 3KPMA 3PHQA 3QDJB 3EO1A 3TBYB 4V1DE 1Q0XL 3AM8A 4DGIL 2FJGA 4F58L 3DARA 1ZLVH 5EO1B 2EC8A 3H9SA 5TFSH 4WWID 1XIWB 3VE0B 3VWKA 3TBVA 3QQ3B 5BS0B 1P84J 3NCYS 4LQFL 4RAUA 1JRHH 4QHNA 2R2EB 2RFXB 1KLGA 3ILPA 4O00A 4XVUD 1VFOA 3PV7A 4IS6B 2J6EL 3D25A 5BZDA 2HT2D 2VE6B 3D85B 1X7QB 3PF2A 2EKSB 5HI4C 1A1MA 2C3HA 1HSBB 3STZB 3IDGB 1FL6A 5DVOA 5JUEL 2I24N 1G7JB 3C5JA 2E8ZA 4PJ5A 1C5DA 1RJYB 1EO7A 1VERA 5F1IB 4DQOL 3GSQB 5ESQA 3WDJA 3CSYA 1CXKA 1U3YA 1FP5A 2YD9A 3BUTA 4TTDD 3SDAD 4J4PC 3FHAA 2NY0B 3CXDH 2AV7B 1LDPH 4U1NB 5JNYA 1OSZB 2VMFA 4KHXH 1R3LB 4XAWL 2BY1A 1OAKH 5D96C 4ZDHB 2NX5D 2B8OT 2CDGA 4FXKB 1T21A 2HFTA 4WHTB 2BSTB 1DE4A 2O5XL 3VCLB 5D1XA 5I2IB 4UDUA 1T7ZA 4JKWA 5ICZB 3CFJB 3QIBA 4P5KA 1Y6NR 2JCCB 1I1RA 1IC7L 4LHJB 4LLVA 3I6GB 1FH5H 3DBXA 3SPVB 3FO2A 1LO5A 3CFBA 4JO4H 3DVIA 5FO8B 1AGDB 5DS8A 1D7FA 2YUVA 2X1QA 3VXTA 4D0CB 3O6FB 2AJSL 3AMKA 4Y4KC 1JNHA 2F74B 3UTPE 3JTSB 1JE6A 5EU6B 1AO7D 2YPKA 1BX2B 1DLFH 4AIXA 3MRIB 1U0QA 4PJEF 3O2WL 3WEXB 3RHWK 3QUZA 4LLDA 4WU7A 1DQJA 2DQTH 4H0GA 3DX9B 4XVTH 2UY7A 4P2OB 5E1AB 2YC1A 3QXAA 4L4VD 4ZXBD 3QEHB 3SDCB 2AXJA 2IEPA 4R4NC 4K7PL 2PCPB 1L4IA 1XGUA 4GH7B 3BD5A 5GSVB 4XBPA 4FQLL 1K4CA 2AEIT 2DKUA 2FLRT 4RMWA 4X4MA 4GQPH 5IJVA 4MD4B 4NZUL 4BSWA 4NN5B 3FRUA 2A6KA 4J3VA 4YR6B 3FQXA 3WFEH 4LSRL 2HFEA 4YHIA 5IBLD 2OJZL 5JO5A 1L7TL 4FQXA 5EBMB 3KXFD 4ETQB 1JZ6A 3A6CL 3NTCL 3VFGL 5TF0A 2AQ3A 1JF1A 1M6OA 2YKLH 3BPCA 2DYPB 3PHSA 1IAII 4XP5H 3MREB 2BNQE 2A6DA 4JY5L 3TH4T 5IJVB 4C83A 3PE9A 4KROC 3MRLA 43C9B 3HMXH 1GOHA 5DK0A 4PG9B 1O7SA 1EGJL 1IJ9A 1YDPA 3EGSA 3KWWA 3G5VB 2Q3ZA 2OTUA 5C2BL 1KYOK 4WJ5B 3QHFL 4X6DF 1HKLL 3TVMD 1KENH 5HYSA 3WFCL 1TETL 1V7MH 4G3YH 5CSZB 5DO2C 1JGUL 4ISVB 3SQOH 3ILPB 1KLGB 2NLJB 3C5SA 3R8BB 3TBSB 3HB3D 4OZGA 2DWEB 4Q2ZB 1KB9J 4NKMB 1CF8H 3F5WB 3P40A 3ULSB 2AK4A 4O02L 2OTUB 5IKCB 3U7WL 4F15B 4QRRB 3QO1A 3IRPX 5F9AC 4P23C 4YHZL 2AJVH 2YR3A 2X4PB 2FECL 5CEZL 3RX7A 1Q8MA 2VSDA 1LO2L 4OBSA 2Y4SA 4LSTH 3GSNL 5DK2B 5JXAL 2HJFA 4F57L 5KSBA 3LN5B 3F12B 1LP9A 5TJWK 5C71A 1JPTL 2ZCKL 3HNVL 2CDGB 3P0GB 2F8XC 5F9WB 2QKIB 2NY6D 1CK0L 2MHAA 2L7JA 2R1XA 1KXQE 1X5JA 1PKOA 3HKFA 1X5FA 1YC8A 4P2RD 2FD6H 2CO6B 1SVCP 5CHNB 5B4MD 4IRSA 2WLYA 3QH3B 3EZJB 3MQIA 4FFYH 5IFHH 4JFEA 3NFNB 4PV9B 1BQHA 3KGRA 3D85A 3KXFE 3D0LA 3ZE0F 3LPWA 3UEZA 2JB6A 5EZOH 4NO2A 4O58L 1Q9KB 4DZ8B 1OY3B 2X1XR 1A7NL 4ZS7L 4PYGA 3GSWA 3OR6A 5E00B 2PYEA 3FQTB 3AREC 2AVGA 4LCWD 2DMBA 1T89A 1J0KA 1MRCL 1RZ8B 1S9YA 4NWUL 1EBAA 1NMAH 1YPZB 4XPHL 3G6AB 4QEGA 1LILA 1DSFH 4PJEB 3ARBB 2BCKA 1E4XI 2ED9A 3V79C 4X7SL 3LKQA 1NUDA 5L6YL 5HYJE 4YBHA 1RUAL 3MLUL 4H88L 3SE3C 1DVFB 4Z7VE 2XQBH 2R2BB 5LGJB 1FO0L 5HHPA 5AYUH 3WL9B 5C1MB 4BZYA 3SO5A 1HHHA 3RY4A 1AD0A 4PJGA 1OPGL 3ARYA 7CGTA 2X05A 4XCYB 3LMJL 2VABA 2UZIH 1BVZA 2XN9B 5JHLL 3N9GL 5JNYB 4P2QA 3QDGE 4K9EL 5E6IC 5DSCB 5D93C 5SWSE 5F9DC 2ADIA 1KF9B 3CH1B 3FFCA 1KPVA 1AJ7H 4MXWL 1IAIH 1T1WB 2OP4H 3RUGA 1DEEB 1FBIH 4LVOC 4KTEL 1KCUL 2CIKB 4TSAH 2V5TA 2PUQT 2IH3B 4HIJB 5DFVC 3BRDA 2EC9T 4XNMA 1MEXL 1DUYA 3CVIH 4RFNC 1QPPA 1K6QH 3NAAL 4WHYH 5DURB 1MHEA 1QBBA 2QJDA 1S9XA 3WN5A 4YDVA 2NW3A 3CFKB 4WDIB 3LH2L 3H7BA 1U6AH 3BVNB 4Q9BA 3S98A 1B0RA 4QOKB 4KI5E 1U8HA 3JV4A 2YPLE 4M4RA 2BHYA 4HX1B 3MLPA 4G8GE 1QR4A 4GKSB 4MNHB 4P4KD 1K4DB 4JKLA 1CLCA 1QSVA 3TT1H 3RIAK 1MH5B 1AQDB 5DA4A 1UWGL 2VDPL 2KDGA 3MV7E 4Y16B 2IGFL 4AEIH 3WJJA 2VDQH 1OTTC 3KDMA 1CGXA 2AJYH 3ARGB 3QQNA 3X13B 3EOTL 4LLYB 4Z7NF 3QFJD 4NQEE 4KTEH 1V7ML 2DM7A 3QNXA 2JJWA 5D6DC 5I66A 4I18B 3T4YB 5C0AA 1MCIA 3MA7A 4PYHA 5LBSH 4GG6A 3VFUB 1MHHB 4KGJA 3QIUD 4HC1H 2W07A 4WTZA 1A5FL 1A9BB 1UXWB 1QRKA 4KDTA 4ZFFB 4LPCA 2HTKC 5HYJD 3SGDI 2IAMB 1QVOA 3IGAB 4OIAA 3ZDYE 4Z77A 1T03L 1OP3H 1I7ZA 2Q86A 1IE5A 5MEPB 1JYVA 1Z9MA 3L5XH 4JAMB 1U8NA 4G9FA 4EEEA 4YK4C 1QR1B 1RIHH 2ZSWA 1CGSH 3MRJB 4MXVF 1IQWL 3FRPG 4Q6IB 1T4KB 4S1DC 4LRNH 4EI6B 1WUNT 4XCFH 4ZO7A 4WEMB 4WFHE 3QIWA 3CSGA 3WS6A 4HWBH 1RUMH 5D2LB 2X5PA 5J1TC 4HG4J 2B4CC 4MCZB 1MJUL 4PY8J 1AC0A 4Q97A 1TJGH 3HE7A 3BW9B 2IGFH 5D71H 4YBLB 2JK5A 1M7IA 1G7PB 1P7KB 2D0GA 3IDYB 3VXMD 5CZVL 1V3JA 3FO1B 4N0UA 2OS7A 5HTSA 3QDGB 4Z76B 4AH2B 5E8PA 1ZTXH 5JW4M 4HKBB 1VFUA 4XNXL 3SJVA 3MNVA 4AZ8A 1EV2E 2F54B 2P5WE 5DEZA 3V8OA 1NGYA 2JB5L 5FA4A 4JRXD 3DLQR 3ARPA 4X7TB 1A3LH 1OL0A 3RZCC 3HS0B 4L5FH 2X9XA 2AV1A 5ACZA 2UVFA 4ZNCD 5BJTA 1A3RL 1CGSL 1NC4B 1X4YA 3TV3H 2XTJE 1NGXB 1WEJH 5HJ3B 3SDXB 5DD0L 4K71B 3EOAA 5D5ME 4RGMC 3T0AA 1CQKA 4AK1A 3CUPA 1BECA 1TVBA 3X12B 3BQUC 1OLZA 1YUHB 3G6AA 1FORL 3CFIC 5I15H 2X70A 1INQB 2ZG3A 5GGRB 2C1PA 5MENE 1MUJB 4TUKH 3LN5A 1JNNL 4XI5D 5EFIB 1AGEB 5IIEB 5MERA 3B43A 1D6EA 2VLRE 3TYGH 3LQAC 1ZHBA 2ADFL 1Y0LA 1S8DB 4RA0C 4RFEB 2EDNA 4CNIA 4DN4H 3OWEA 3Q1SL 1G9NC 3DBXB 1CU4L 1J9CT 2BVTA 3W2DL 1S7RA 2Q7NA 3MGAA 1KULA 4AL8L 3IDUA 1NDGA 1WEJL 3MRMA 4NO0B 1T21B 1RV6X 1H0DB 5D7IF 2WV3A 5M7QA 2VISB 2IAND 5GGSB 1MCWW 3W81A 3MRPB 1JRHL 3GIVB 1ZGLA 2EO9A 3ARWA 4J6RL 4ONFH 4N9GA 1ZA6B 4R4ND 3E1F1 2UZIL 4FQQB 3STLB 1WBYA 5GS0C 2XWJA 5EZOL 5T1LA 4GXVH 1GGIH 2A9MH 3KJ4B 1CFTB 3OPZH 4R2GC 2FEDD 1GGUA 2HVKA 1FZMA 4P59H 5HDLA 1NGZA 3QR2A 1CDYA 2IANB 1YNKL 2XQBL 1C1EL 4GKZB 3QPQC 1UACH 3ULSA 1MRCH 4WO4D 2L4OA 1AJ7L 2YOCA 2YN5A 4OZIA 4HK0B 5J13C 1OGAA 2Q8AH 3NCJL 4FFVC 5SWSA 4K07A 3OKNB 2OYPA 1AGBB 2F15A 4PJ8D 3EFFA 3UC0L 1CVRA 3WLWC 2LVEA 3OG6B 3I9GH 1YEKH 1P6FA 1CICB 3S97C 1OOAA 2AGJH 4OZFB 2YUWA 3NAAH 4QRSB 3WDHA 4L29A 2VLJE 2CPCA 5SX4H 3KWWB 3SDAB 5F70A 1ORSA 3IFOB 2AJXH 5IESL 1LEKB 3IFPB 4JCLA 2KQMA 3DUHA 3ISWA 1KCUH 4TSAL 2DJUA 5D7KE 3P4MA 5TDPB 2FB4L 3BIKB 5TGBA 4X99A 1N3NA 1A4KA 3E3QE 3L3OA 3VGEA 2YA2A 3ULVE 1F8TH 2EZ0D 3GB7B 2UWEA 4LCWE 1I1CA 1FN4B 2H9GB 4GUPB 1RIHL 4POZC 3T1FB 4ONHA 3D85D 4HUWB 1RAMA 5BRZE 5CEZE 2EE6A 1CK0H 1UWXK 5GQBA 3IFPA 2QLVB 1BZ7B 4XHJC 2EO1A 4PLKC 4Z0XB 4HH9B 3EOAB 3VFUA 3QJHB 5C0AB 4PJ9C 1J8HD 3GO1L 1OQOA 3D9AL 3MXVL 2EH7L 3MO1A 3PV6B 5I1LA 3GGWA 3H9SD 3VWKD 5D6CA 1A47A 4YX2H 1J1XH 1S9VA 4X9IA 3MLYH 5DJXB 1H3GA 4Q0XL 3QDHA 3KDMB 3SDXF 3WNLA 2YD6A 1FFPB 1MAML 1PYWB 5DJ2A 2ZKHH 4APQD 1A1NB 2QHRH 3QYCA 2JLLA 5FECA 3H9SB 3VE0A 3VWKB 1KCRH 1V8HA 4HKBA 1IGIL 5FK9A 1UWGH 1VFBB 3B8YA 4FTVD 1R24B 1PJ9A 2WINB 4PS4L 2NY1D 3MRQA 1J0IA 5DFWH 3MRGB 4HIEA 3OJMB 4MQ7B 1QSFD 4PRAB 5EC1B 1S7RB 1DBML 4WI2A 5C9KA 3PJSB 2P8PB 1C16A 3MUJA 1JI1A 1HXYB 3Q6FA 4XWGL 3TM6A 4F7CA 2GTZB 2BC4B 2DQUL 5E4EB 1AP2B 4J3UA 4HK3J 4YFLF 2YD5A 4JPIB 2V2WB 3TEUA 4V1DD 3CX5K 5MP6H 1J1OL 4GMSL 4UT7L 2R4SL 3TJEH 4I5BA 1XGQA 1CCZA 1K8DA 3DGGA 4F15C 3FB6A 1ZS8B 4G6KL 4Q58C 1BLNA 3CXHJ 5ISZD 35C8L 4G7YH 3BH8A 2CK0L 1BJ1J 3PJSA 1EEQA 4RFOL 3C5ZB 4U7SA 3EO1B 4H1LH 4M7LH 3JXAA 4Z7WE 1G6RB 3FO9B 4KTDL 5IW1B 1N2RB 1E6OL 2E7MA 1NBYB 1VHPA 2HRPL 4M5YL 1XR8B 3NA9L 3TA3C 4MSWB 1Q0YH 3HZYA 3L3GB 4HXAL 2A83A 1WZ1H 4Y89A 3F7RA 3V0VB 4GG6F 2YUXA 3BN9D 3CAFA 3H9SE 4DKAA 5A2FA 2V9RA 3PL6C 4HKZB 4MA8L 2LTQC 2VXSH 3BZ4A 4R6UA 2XWBA 4DVBB 4Q9QH 3RRQA 1C5DB 4M00A 3PDGA 4M43H 5EUKB 2HT4D 4KQ4H 5GRVL 1BIIB 5E8PB 4K23L 4LLWB 4X9BA 1M1SA 2WMPA 4BZ2H 2F5AL 4ELKB 5GRJH 5F1SA 1QOKA 5IMMA 4LKXB 3F58L 1HHKA 2YEZA 3PWPD 3D25B 3B8SA 3BIAX 5C0AD 3STLA 1FFRA 4JO4L 2EXWD 5DJDB 2ARJB 3ZE2F 1OAKL 3V0AC 5IVXA 4MQTB 3MRMB 3QUXB 5IIEA 1A7NH 3VFWB 4E41B 4NT6B 4QYOB 3QUZB 3MBXH 1JUFB 3N85H 2VISA 5KSAC 2PETA 4UBDD 4KKBC 4K7PY 5I15L 3IDNA 3UP1A 4CNIB 3S35H 1QFUL 1AGDA 5IVOA 4HUXA 4U1GB 3VXTB 4D0CA 4XXDA 3MV9E 4N0CD 4R4BB 3D48R 1IEAB 3OL2A 3QULA 4QRRD 3GO1H 3D18B 3S7GA 1VB9A 1E4XL 5DRXB 4JRXE 3NH7H 5MERB 2NZ9D 5FYJD 5CP7B 1PSKL 5GRVK 1FL3A 4EKXA 5CUSL 2CDFB 4ACPA 4OKVA 4U1JB 3MLXL 3TO4D 1IM3A 1QUNA 4HBCL 5HGAA 1PEZA 3HUJE 1BBDH 2FGZA 4EI5C 4JGJA 3QDMA 1MHHA 4N5UA 3SO3B 1IEAA 3WO3B 4FNLH 1TVDA 4YDIH 5HDBF 3LD8C 1TIUA 5J89A 3NCFB 1OAYH 4IHOB 4KJWD 1OGAE 4XP1H 1P7QB 1CFNB 3JVGA 5J1AB 4OKVB 4S1RH 1EPFA 1R5WA 3VXNB 1ORQA 1HCFX 3VMPA 1HIMH 4JJ5B 1ZHNA 4LVNC 1U58B 4OZFH 4YBQD 3S88L 1KJVA 3WFHB 1MCOH 1JHLH 4MNQA 4DFHA 1UC6A 1B3JA 1KENL 4PRBA 1P6AB 3DVFA 3VI4E 5JORB 2W0FB 1NLBL 1LQSR 3O9WA 2M26A 2C7UA 3WJLC 5E6ID 3DURA 2DLEA 4MLSA 5J56B 1ZHLB 3DRQB 3VG9C 3W39B 5DR5L 1I1AA 3T8XB 1QHOA 1CI5A 1M6OB 5KS9E 2DIAA 3KHOA 3KJ6H 4EI6A 3PGCA 3HZYB 4G8FB 2PNDA 1YPZF 3C8KB 1A4JB 5C0IA 4Y2DC 1IEBB 4BQ9A 3BP4B 5CS7A 1FJ1B 3E2HB 5A2KH 1S9VB 1I8IB 2BVUA 4F2MA 5ESVA 4OGAC 1OAYL 1UA6L 3HUJF 2NW2B 1QEWA 4LL9A 4F9LC 3RVUC 4YHLH 1WFTA 1KBGH 2BOBA 4KV5E 5J57B 4PP2B 4EIGB 3GIZH 1PG7W 2DMCA 3P77A 3QT2A 4NDMB 1C8PA 2BK8A 1ZHKB 4RBPK 5C0BB 1D5XB 2GSGA 5F7LB 5IBTH 2A6JA 4LGRB 2NLJA 2ZOKA 4PPTA 4WW1B 2C3VA 2W9LA 1FC1A 5GZNC 4FQIL 4LSVL 5EBWB 5ACZB 4L4TE 4X5WA 2YN3A 4F7CB 2EC9U 4CVXA 1AY1H 5A1AA 4RDQF 4ODVL 4YHNA 3R4DA 3LH2H 3VMNA 3E2HC 4O02H 5C0RH 3H3PH 2O93L 1D5ZA 1P4BH 2BNQB 4C55A 4PGBA 4H20L 5E00A 3HG1D 4YE4H 2FO4B 4IJ3B 5FHBL 3NFPA 3VI4F 3QXUA 3WIIH 1JRHI 1YYLH 1C7SA 4ZAKB 4OCYL 4I2XB 4HIXL 1FL5B 2Q1EA 3ARBA 3JZ7A 1AE6L 1QYGL 4WHYG 4CMMA 1YMMB 1WSST 3BGFC 8CGTA 4MJID 1OT1A 1KN2L 3BYTA 4KZEL 4O51A 2HJLB 3SJVE 4Q74A 5T1DL 2HRPH 4M5YH 5I8CB 3GMRA 2F53D 4PGZA 5CJXA 3UZEA 4PGCB 4YHIB 5C0NC 5MHSD 1B4RA 5F3HA 2VIRB 3B4NA 2X4RA 3QEQB 4CADB 4ELKA 1MOEA 2WBJC 3D5OF 1CFSB 1IC4L 4I18C 3SDDC 3BISA 1A3LL 1PX3A 1ETZB 3ZL4H 3UC0H 1UVQB 1EJOL 4P4RB 3OAYK 4NOFA 2E9WA 5JW3L 1J8HE 3LQZB 5L7XL 2PYEE 2ZNXA 1ZT7B 2H9GA 2BSSA 3QZWA 4XP6L 5BV7C 4LLDB 1RVFL 1YECH 5GGSA 5IHBA 1IM3B 4GT7A 2HT4C 1Q0YL 1A0QH 3OKLB 2YK1L 2OBGA 3DX7B 1UWEL 4DW2H 2RB8A 3WMSA 1NMAL 1H3UA 1FCCA 2ESVD 3W0WA 4YHML 2J4WH 4JQIL 1DSFL 5HYJA 4ZOCA 4KRPC 5ECJE 4GLRH 4X9HA 5KVEL 1UCTA 4G8EA 3K8MA 2ARJA 5LXGL 4XAWH 5IEKA 1HHIB 2J88L 1BWMA 3KR3L 1JPFB 1Q9OB 4E42A 1R0AL 3IFNL 5EULV 3GMNB 5L8KB 2WUBL 4ORGB 3BXNB 3QISA 4PRNA 4WNQB 4XBEL 5HVHC 1ZE3C 3LN4A 4JJHA 1ROWA 1ZLVK 1QFWM 4O9HH 2NY4B 4Y19B 4HUXB 3AU1B 2X4UA 3MJ7A 1BF8A 4PJXB 1T66C 3AXLA 2DQFB 3MACL 1RU9H 5E9DB 3WN5B 2P5WD 2BSED 2DLGA 4M93B 3GSXA 2NNAA 3F12A 5JZ7D 1FPTH 2BC4A 4P2RA 5AWNL 4OI8A 4UQ3B 3SDDA 4WENB 4JFHE 3DXAD 4TNWF 4PTUB 1XGUB 2GY7B 1FGNL 1MNUH 3V9FA 5CJXC 5DHYA 3OMZA 3MBXL 4PJIE 4HJGA 3VXSE 5FKPB 2ITCB 2EEBA 4PFEA 3TP4A 2QTEA 2EH8H 4X98A 3ILQD 3B2UC 2GIYA 3GUTA 3ARBC 4MZ3A 4UNTA 5EIQA 4HKJB 4B7LA 3NZ8B 3S35L 4U1GC 3ZKXC 1Q9LB 4PLJC 5E2UL 3RU8H 4I0PC 3MV7B 4UU9B 4HH9A 1IFHL 2J2ZA 5DEGA 1WWCA 5ANME 2AS5M 2DWDB 1WC7B 4JVUA 3MJGX 1CL7I 5KSVA 1FNLA 1KPRA 2R0KL 4G42A 1U95B 1HH9B 4Y5XA 1OW0A 5FO9A 5IUSA 1U3ZA 3UBXB 5T3XE 4PUBH 1FVDB 1H8SA 2QQLH 5T33H 4S1DD 2AK4B 5AG8A 1KTLA 5CEXA 3BESR 2PXYD 4QRPE 2V2WA 1FNGA 2X1WL 5HYSB 3RVTD 3QUYA 3BZDA 4P57A 2A6JB 4DEPC 1QTYT 4BH7B 1RUML 3L95A 1W0WA 1MNUL 4BKLB 1T7VA 1NCAH 2XTJB 2IC2A 2PXYC 2NPLX 3D69A 2PXYB 2EDDA 4KMTL 4XMPH 1MIEH 1KGCD 1V5JA 2M8XA 4Z7OF 5IT2L 2W59A 4G6JH 5DQJA 1PKQB 2X44D 4Y2DA 3FN0H 4JY4A 1U93B 3WV0A 2OR9H 5E8NA 3BQUA 5I9QB 1MVFA 3U0TA 4HBQA 4CN1A 5FUOL 4QHMB 2F54A 1NUFA 3O3BA 3RX5A 3DX7A 3MUZ1 1J1XL 3CDGB 1YECL 3MNWB 4HXBL 2CIIA 4FQLH 4XWOD 5I8KL 4QGYA 1Q94B 2NX5A 3WJLA 4PJ8A 3U6RB 5DRWA 3QRFM 1E6JH 4PJGE 3RKPA 2JJUA 4K2UL 4NO5B 4C56D 4ONGH 1FL6B 4UAOC 5C09B 3FO1A 4N0UB 4UT9L 3EOTH 3QUMB 4UINL 3QQ3A 1SQ2N 2FO4A 1H3XA 2HRLA 2VQUA 5CMAA 3S34H 1Z0MA 2DM2A 2CKNA 2AEQL 5DYOB 4LPUA 1LP9E 1OCWH 1YJDH 4KJYA 2O5YH 1MWAA 5F1NB 5B22A 3BMWA 2H6PA 3OZ9H 4DN4L 4GBXB 3SGDH 3P2TA 5D7KD 4Y5VA 5C9JA 1EXUB 4YHNB 2OR9L 1G9NH 1JWUB 1YYML 1U3HB 1IQDB 1MCEA 4Q9QL 5CBEB 1N6UA 4OZ4B 3P73A 3QIWC 5FM5M 1FG2B 1UGNA 3DPBA 1RK1A 3RDTB 2NYYC 1VEOA 2VUYA 2E9IA 4IMLB 3FT2B 3PWLB 3CMOL 1QSFB 1JCKA 2HFFA 1X5YA 4C4KO 1G7LB 1NMCC 4ZTOH 1ONQA 4UZGA 3EJZC 2Z92A 4NNPH 4WHTA 2OJEA 3U7WH 4WTXA 5AUMA 15C8H 3IXAA 4QRPD 5M94B 3IF1A 4PY7B 1UKSA 1NEUA 5HGHA 3SEPA 1IAIL 1U8NB 1UYWH 1YC7A 2VXVL 3DRQA 3W39A 2F5AH 4LBEA 1ZA3A 1CN4A 2YHGA 5BO1L 3BO8B 4QHNB 4P49A 4U6HB 2ZSVB 4Z7QF 2W9DL 1F4AA 5CGYC 4XNYL 1I1AD 1YUHA 2RCSH 3LQMA 5FYLE 2YPLB 1DQDL 5HVFB 1KIPA 2MJWA 5J9PB 5D5MB 5LCVL 1NFDE 1MJJA 3ES6B 5FXCH 2P44B 1DBBH 1HSBA 3STZA 3VXMA 1CD9B 1ZGLP 3KG5A 2EDEA 5B39G 3FB7B 3Q2CA 5FHAH 1Q0XH 5FB8A 2ZUTA 1OTUC 1A7BA 5L6YH 1ZGLB 4O9HL 4M9OA 3PGDB 1P69B 1W72B 1UB5A 3RWCB 1ZA6A 3HAEB 4MDJA 1B88A 1KJVB 3W82A 5H35A 4XPBL 1CZ8L 4JM2B 1T1ZB 3VFNA 5F6HI 2ADJB 3MLVL 3V6OC 4OD1L 3WN5C 3KS0H 5FGBC 5ISZB 4R4FL 3AS3A 4TVPH 3V6ZB 1QLRA 1IGJB 5D70L 2FX9H 1P7KA 1CDIA 1SVZA 2J12B 5I74C 5DJ6A 3VG0L 5SWZA 2V5SA 4GW4B 3MV9A 5C3LD 1D9KA 3HPJB 3WLBA 2FH8A 2NY4C 5DJ8A 2VXVH 4PJCE 2V2XA 4N68A 4QHUA 4WUUE 1ZSDA 3NFPB 1MCNA 1FFQA 2EYSB 2VQ1A 4CU8A 1PY4A 4HC1A 1N4XH 4ZFOB 1HOCB 4JFXB 1GZQB 4FXLA 2I9TA 3VXRB 3RWHA 2ZUQB 5HGDA 3UTSD 1OARH 2QADB 4LNRB 4MD5A 3CFEA 2GJZB 2VDOL 5DJ6B 4E9LA 5FHAL 3S3PA 5FM8A 4P23D 4I3SH 1AFVL 1WJ3A 2XG4A 4LK4A 2BVOB 3L5WA 4Y8DC 2VZ3A 3D39A 3PXJA 4MXQC 4N8VA 1XF2A 3BEWB 1K85A 3U46A 1TJHH 1BJMA 4EBQL 2A6IA 3NCEB 3IB4A 3WBDA 1PY9A 3VGBA 3U2SA 3EO9L 4FQ2H 3KLAB 2JKXA 3P9MB 4QOKD 3LAFA 5HHVL 1XH3A 5ESVB 1HH6B 5IW6A 3QXDB 5C6WH 3IU3B 1FRGL 1AP2A 4XVSL 4BFIA 3WNOA 5JQHC 4HPYL 4EDXB 4P3DA 1XZ0A 2H3NA 3K2MC 4KVCL 1I7UA 1AC6A 3VU2A 1NDMB 2EYTB 3OB0H 2D0HA 3VFPB 2GAZA 2R1WA 4OF7A 2WINA 2O26U 3KPPA 4HIIB 4IRSD 3OXRB 4LVHB 3W5NA 3AB0B 4JQXC 4OLWH 3IDYC 5F7EH 4K2UH 4ELMB 3N0PB 4HS3A 4XCEA 3JV5A 4PLNC 4FZ8H 4PB9H 1LE9A 1PZ5B 1VACA 1BEYH 4YC2B 2I60H 3BP7A 2NZIA 5IVNA 1EO8H 1AFVH 2YS4A 5E8EB 5GGUB 2HVJA 4I3RH 1UB6A 3IF1B 2VDNL 3ARDB 2EDLA 3GI9H 1IT9L 4MSWA 3HZKA 3FQRB 4BH8B 4CDHA 3O3BB 4Z7OE 4RGNE 1PKQE 4KXZH 1NBZB 3C9NA 4JN1L 4FQJH 4JY5H 2IAMD 3MGOB 1RIUH 2HFFB 2DLFL 1YEHL 2NY3B 5EU4B 1T3FA 4QO1A 4OUUB 1DANT 3DUUB 4PR5A 2H8PB 4QRTB 3JUZA 3EYOB 2M2DA 3HAEH 4YHKL 3HN3A 5IBUB 3VXSD 5GJSL 3REWA 5IR1B 5I75B 2H32A 5DHVB 2Q8BH 1NC4D 3P4NA 1XFPA 3LRSB 4P23A 3BPLB 3OV6A 2L0DA 1K8DB 3BEVB 2CKBL 2O5YL 3ABZA 2B0SH 4WGVB 5ACMA 1IAMA 3Q5OA 4X80H 5DRZB 3HUJA 4TOYH 3FQNB 4KI5C 4KRMB 4X0KB 4YFLI 5C0ND 1E4JA 1U41A 1H8NA 4K9EH 1DDHA 5DK0B 3U48A 4A6YB 1P1ZB 3FB7A 2Q7YB 1S9KC 2RR3A 3NGBC 1FO0B 1Z9LA 5HHQA 1JPTH 2ZCKH 3HNVH 4ONOA 1T7XA 3BKCL 4OD3H 1JZ3A 1HWHB 4RZCB 4ZXBA 5C0CB 4RAVA 2ICEB 2NY4D 4XZUA 2HFGL 2YPVL 4YHYC 3LPFA 2L7UA