4QKXB

Structure of beta2 adrenoceptor bound to a covalent agonist and an engineered nanobody
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGSIFALNIMGWYRQAPGKQRELVAAIHSGGTTNYANSVKGRFTISRDNAANTVYLQMNSLKPEDTAVYYCNVKDFGAIIYDYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2 adrenergic receptor
publication title Covalent agonists for studying G protein-coupled receptor activation.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Membrane protein/immune system
total genus 28
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2014-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qkxB00
4YDKH 3NPZB 5F1IA 3SJVE 4P4RA 4NBZB 1MHPH 3KPRA 5C0RL 1IAOA 3KLSA 4LP4A 3I6KB 1HHKB 2VDOH 4YX2L 1C8PA 4LSDA 2FDBP 3G5XA 4M6MH 4P3DA 5GGSB 3PDOB 1YMHB 4IIQB 5DWUH 3BWUC 3KLAB 4JY6A 5FAAA 4JFHE 1RU9H 1IC1A 3NFNA 2RFXB 3BMWA 3R06B 4TSBH 5J11C 2O5YH 4YDKL 1OQXA 3P0GB 3QDJA 5KSBE 2X4TB 3NCCB 1D5MB 2AGJL 5A3ID 1QHPA 4M62H 1OSZB 1Q0XL 2E9IA 2VDOL 1MLBB 5EB9A 1U8IA 5B39G 5KS9E 4WU5B 3KAAA 5FYJE 5I15L 1EZVY 2GJ6B 3FQTA 3F12A 4LL9A 5GXBB 1EBAA 1T7XA 4BH8A 4LGPB 3F7RA 5EU3A 5HHOB 3WNLA 3OKDB 3GO1H 2R1YB 1A64A 2W0KA 1QACA 5CKAA 4TSBL 5IROC 2DYPB 1K4DA 2O5YL 3HMXA 3MNWB 4KK8C 4BSVB 2EICA 3CVIH 4YZFE 5C0AB 3BVNA 2UV3A 4N0FB 1AKJB 4FXKB 5LAXA 4NHUB 3N1GC 4X6BA 5INCB 1JWMB 2Q1EA 5DT1L 5FYJH 1YQVL 2L7UA 4RFEB 4WNQB 4JPKL 4EI6B 3CX5K 5C08A 4GRWF 2GI7A 1N6UA 2W9DL 2YD1A 1Q9LA 4YQXH 3QWOB 4ZFFB 4K71B 1YPZE 1VKXB 3GRWH 2IANB 2BOBB 4YHPA 4L4JA 3QCUH 2DLHA 3B9KB 5EOCJ 5C8JA 3KYAA 3MLSH 1DVFB 3JTTB 3GFUA 4MJID 3RI5F 1JWSB 2XPGA 5KBNC 3D0LB 5IFJB 3RWHB 1JFQH 4AK1A 5IFAH 3LKQA 3G08A 3U9UB 1Q0YH 2NXYC 4EOWL 4O9HL 4OFYD 1BQHA 5SV3A 3DHMA 3UZVB 1E4XH 3O3EA 4Z7WE 4L9LC 2ZP0T 1WLHA 2G75A 3DX9B 4OIAA 5JA8B 2VLLB 4MD0B 3GRWL 4PJAA 2VWEE 4JZOA 4XCCH 3SGEI 1DLHB 1W0VB 2ZCHH 1F90L 5GS1C 2DQFA 4LLVB 3EYOA 1RJLA 5J6GA 4OF5A 1PY9A 5D1ZC 1CZ8H 1JFQL 2YPLE 1Q0YL 4QXGL 3V6OE 4JDVA 1XH3A 4OGXH 1JNHA 1BHGA 2D03L 3IT8D 3L5XL 4P4KC 4XVJL 2EKSB 3A67H 2Z31A 2F54A 3VXMA 4KTYA 3MNVA 4X9IA 4PG9B 3CFDA 4AQ1B 2ZCHL 5C09A 3HI1A 3SOBL 1MFBH 2CUMA 4Z18A 4YHNB 4O58H 5DD1L 2HT4C 2X7LB 4ODXB 3UO1L 4EN3A 2PYFA 1C5CH 1BQLH 1C7SA 1UWXH 3C5SA 1OW0A 1OPGL 4I77L 4RGOH 2ESVA 1GC1H 4YEFA 4KUZH 4C56A 3P11H 4ZPVA 3BH8B 1T4KB 3NFPA 1BOGA 3A67L 1JVKA 5IB1B 2ITDB 1RK0B 3GSRB 43C9B 5K9KB 5EO1B 2A6DA 5C0BD 1JZ8A 1MFBL 2FGWL 5GJSH 1TXKA 1CK0H 3O3BA 2F9BT 4B7LA 2UZXB 2XFXA 5D2NC 1L0XA 5MERB 1AIFA 4LIQE 3H9SE 1ADQH 2YOCA 1HXMB 1YA5A 4RGOL 1AR1D 1MI5A 1IGYA 5KW9H 1GC1L 4Q2ZA 5TDNB 3AUVA 2YPKB 3T8XA 4KUZL 3ZHDA 4NRXB 1UB5B 4N8VB 1P5VA 2HKHH 3LIZH 3QG7H 4XPHH 5C3LD 1WBZB 4FG6C 3PWPE 2EDLA 2GUOA 5B3JE 1OAKH 5F3HB 5B38G 1CK0L 4ZO9A 4OZIA 4HK3N 4KKCC 5E70A 4TUOB 1XT5A 3DRQA 3X11B 3MFGB 2AJUH 3VFSA 3M45A 3BEWB 1ADQL 4PLKD 3ZMRA 3W5NA 4NN7C 3IXAB 5KW9L 3VXTB 1XGUA 1G7IA 4LIQH 3T0ED 1UWEL 1XR9A 1NC2D 5F7LB 4QRRB 2A2QT 3NCYP 4XBGA 2Z93A 3DPBA 4UDTB 2E5EA 2HKHL 2RBLA 4XPHL 4Y16B 4WHCA 1DBBH 2DDQH 1OAKL 4X5XB 3QUZA 3EJZD 1Z5LA 4PRID 4ZXBD 4F7EB 3F5WB 3NZ8B 2VLKE 4PJ7E 2PTVA 5FGBA 1SEBA 3ZTJG 2DQDH 1KTLA 4L29A 4G9FD 1TZHA 1AJ7L 2R0LH 2A73B 3UTPD 1P4IH 3LPFA 1JGDB 3O3AB 1MVFA 3QIBA 3RI5K 1WT5C 3H3KA 3VU2A 1AO7D 2H2SD 5C0JA 1WZKA 4QNPF 1VHPA 5DRXB 1IKFL 4WV1A 4QRTB 3AC0A 4GAYB 1EO5A 3C6SA 5JHDE 2DQDL 5IF0A 2VZVA 3JV6B 2R0LL 4HIJA 5HYQA 1OT1A 1MCPH 5DFVC 3QHTC 1KIQB 1P4IL 2FB4H 2AI0H 3STZB 3B5HA 4D9LL 5E9DD 3D0VA 4ZUVB 2D7PA 3DNKA 2X1XR 4F2MB 4RCAA 2VJXA 3HI6H 5I74B 5FK9B 3TVMB 2C1PA 2FZ3B 3RJDA 3HMXL 4C55A 5GZND 4LSVL 1OM3H 5D8JH 4JO2H 3PV6B 5IW1B 5FB8B 4Q9QH 2E3VA 4BZYA 4LASH 5E2TH 2AI0L 5E56A 3LQZA 4LLMB 2KDGA 1DEEB 4GG8A 4LBEA 4MHHG 1T03H 4ODUA 4Z7VF 4J3WA 3AMLA 5GSRA 4X7CC 3HI6L 1UJ3C 1NEZB 4BZ2L 2ADGA 3N1MC 2Z4QA 2HJLB 1TDQA 3MRRA 4QHMA 5TPWL 2I5YL 4QTHA 1U8OA 3VGBA 3TJEH 2NY6C 1LDPL 4P2QA 3LEYH 4F9PA 9CGTA 5T1MA 4L4VA 1HKLH 1A6WH 3MRCA 2ZPKL 3QXAA 5KSBB 2P24A 1OAYH 5E2TL 4G8IB 1MJUL 4B7IA 3EO1B 1AC0A 3SE8L 1KJ2H 2Y1VA 5KS9B 4QWWC 1T03L 4G9DA 2J4WH 4PLNC 3PIQB 2VR5A 2QR0A 3QISA 5I1JH 4M1CC 3MPCA 2EYRA 1B6UA 1A7QH 4QEGA 5CJBA 5GRVK 5JLZA 3MV9E 3KXFE 1KEMH 4OCNC 4XTRD 1CXFA 2Y06L 5SWSD 3RDTA 3HZVA 1CDIA 1MIEH 3LEYL 4HIXH 4P57B 4X6CF 5K9OA 2IBZX 4KVCL 1CE6A 3U7YH 1H8OA 1KPVB 5CGYD 2WINA 1B0GB 4NZUL 5ALCH 3LN9A 3DRTA 3PP3H 2HRPH 1MIML 3QDMD 4LLWA 1IM3A 4G8GE 1A7QL 4KDWA 3DETC 1EK3A 5BVPH 1X4YA 5I76B 1KEML 1H5BC 5HYSG 1J0ZA 1A22B 3VGEA 2CDFB 4HIXL 2O5ZL 4K3HA 5DRWB 4CW1A 3U7YL 1X5JA 5LGJB 2MHAB 1LEGB 3VFVA 3VFGL 2ICWI 3VFOB 2OK0L 4LCCB 1MJ8H 3MRFA 3C5ZB 4PB9H 2WIMA 4FQXD 1U42A 2FYYA 2NZ9C 5C9JA 4DJMA 1EERB 4QY8B 1FV1B 5B3NA 3QI9C 5I8KH 5KSUB 3S4SG 4OI9A 5DQDH 5HVWA 5K33A 4F80A 1E6OH 4G42B 2A6JB 1JN6B 1SEQH 3CDFA 3ILPA 4HLZG 4R8WL 4ZUWB 4LPUA 4URTB 4W81A 5TF1H 1RZIB 3DWTA 3SGKA 1D5ZB 4GBXA 1LO2L 4N0RA 5DRNB 1FLRH 3OAUH 2COQA 3F7PC 4TULH 2NXZD 2GSGB 3P9MA 1OTSC 2P4AB 4OLUL 4WHYH 4R7DB 4XP4H 4HWEL 4P2CG 4PB9L 4JKMA 4MLSA 2D7MA 3VRLF 4LAJH 2DBLL 3CLFH 4PRPE 3HN3A 4K9EC 3RL2B 5BXFA 5D96C 5I8KL 3VCLA 1NBZA 2HFGH 1E6OL 3I50L 4JO1L 4O2CB 3ZYJA 2OLDA 5KSAD 4TQEL 5TJWK 3V6FA 3VFTB 5TF1L 5E08H 5JXEA 1YC8A 3VXPB 1UADC 4PJEA 2EXWC 1A9EA 3WO4B 4XP4L 4FQHB 3N85H 4X4YB 3IDGA 1ZVSB 3TN0C 1AP2B 4XAKD 1IL1A 1U6AH 4UT9H 5GGQH 2HJKB 3V4UL 2HFGL 1FG2A 4X9FA 5DVNA 4Z78A 3VXUB 4PREB 3P3YA 4N0UE 3MCLL 3O4LD 5I17A 1WBXB 4OZGE 4P9HC 3MLRL 3Q1SL 4AEHH 2ZUQB 3U4EB 3BQUC 5D7LB 1VPOH 1I3VA 5AYQA 3JVGA 1EAPA 1NCCL 4FXLA 1FZOA 4FTVD 4D94A 5F1IB 4P4RB 1N8ZA 1OAUH 3KPRB 3U0PA 4QHKI 3RVTC 1IAOB 2DICA 3EOBA 1NMCB 5HYJE 1PG7W 1EAJA 1VA9A 5GGQL 1FGNL 3SY0A 4I8DA 2GITB 3G5XB 4P3DB 1F3DH 1GL4B 2C1OA 5L2KE 4X99A 4KI5C 4XMLL 1BIIB 4AEHL 4XPAL 4JY6B 3BZDA 5AZEL 3T3MF 3NFNB 3ARSA 4GSDL 4DVBA 1HHIA 4J1UB 2EE3A 2CRIA 2W9EL 4KY1H 2ERJC 3QDJB 4EI5C 1D9KC 5LQBL 2A0LD 5CBEA 4JFDA 3RWDA 2O61A 4U1IA 4NOFA 4WWID 4AL8H 2XQYK 1IGTA 2PYEA 3FQTB 1KG0B 1PYWB 3SDAB 4BH8B 4PRNB 5EU3B 4HEPG 2ADIA 2WM0A 3GGWA 3I3DA 4TOYL 2D0FA 3OB8A 2MOVA 1IAIL 3MCKA 3TA3D 4UIMA 3W9DA 1F3JA 2OL3H 4UNVA 5JIPA 4YBLC 4ZOBA 4YXKL 1RUQH 3C6LB 1I8MB 1H0DA 1IJ9A 5D1XC 5LAXB 2XTJD 4HCRA 3ARFC 4HH9B 4X6BB 3RWFB 2YXMA 5JZ7D 4HC1H 4I5BA 5LKNA 5J7CC 3DMMA 1RUMH 5D2LA 1PG7L 3BRGC 3B5TA 1CBVH 2XQYG 3LHPL 5DMIH 3NFSL 2ZZUT 4JM4H 4JGJA 1JPTH 1YYLH 4LAQH 1A7NH 3X3FH 2W59A 4PJFE 3FRUA 4ZOAA 5IV2A 5BW7C 4YHPB 3T2NH 1I8KA 5K59F 1MSPA 1RD6A 5C8JB 5EWIH 4M7ZB 3HRPA 5DGRA 5C7XL 2XPGB 1S5HB 4KRLB 3RIAF 1QA9A 4AH2A 2FLBT 3HNTH 2Q6WB 2NY4C 5E2JA 3CXDL 4L3CA 5IEHA 2YD5A 1YQ2A 1CBVL 1JBJA 1CGXA 4XNXL 1BQHB 4BK5A 5H8DA 2WNGA 2Y36L 5DZNA 1MHCB 1YYLL 2X4OA 5FM5O 5E4EB 4PJAB 1RJYA 1K3ZA 4WUUA 5HGHA 1LO3H 4JJ5A 1G7HA 1J12A 2DQFB 4LEXH 1YDPA 5BV7C 1KJ2B 4KK6D 2DTSA 5HHVH 5L8KB 1GZQA 1F45A 2M2DA 2WP3T 3HNTL 3R8QA 3GI9H 4LCIH 2V7NA 2DWEA 4GKNA 4R90H 3U0WH 3IF1A 4N1HB 1WWBX 1JNHB 2VLJE 1F02I 1DQJB 4HWUA 3IFNH 1OF2A 2F54B 1HXYA 1MRFL 3VXMB 3KHQA 5IROA 3V0AC 4DAGL 4KFZC 3QIUD 3CFDB 3S3PA 4PRDA 1JUFA 5C09B 3HI1B 3RBSA 4WFFD 2XA8L 3NCYS 3QQ3A 4MD5A 3GSWA 1DBKL 4UQ3A 2ZSVA 4LOUD 2DKSA 4EN3B 3KNBA 2PYFB 3F58L 3TWCH 4POYA 4LCIL 3C5SB 4D9QD 3U0WL 2ESVB 1UA6H 1IEBA 4ZPVB 4OCWH 1ZTXH 5T5NF 3IFNL 1W72A 3WFEH 1BOGB 4JGMA 1WBYB 3QUXC 4PJIE 3VMPA 5IKCA 2A6DB 5IBLC 3VWKC 2B5IC 5DJZA 2OXHA 5H37H 4ZDHA 1WCBA 4YR6B 3O3BB 2AABH 1UM5H 4NPYB 4FQIL 3TWCL 4NKMA 1HI6A 3CFBA 2AXFA 4LPVA 1MI5B 4EDXA 4OZHE 1DTUA 4OCWL 4JHAL 2DIJA 2ILLA 4AM0A 5J8OA 5CINH 4U1MA 5EUOF 1MOEA 1NC4B 2JB6A 2MQCA 3K7UA 4NNYB 4CGTA 2GUOB 3X13B 2X09A 4HFWA 3RL1B 4HLJA 4OZIB 3S3SA 1NMBL 5TF0A 4R7NA 2Q20A 3DRQB 5F7FA 1QSEA 2X10A 1JL8A 5F6IC 3VFSB 1CDJA 1R3JA 3CSYA 5T3XE 5D1ZA 4KTDH 2NY2D 5I73B 1XGUB 5AYUH 2J3SA 2NYYC 1G7IB 2YC1A 2IG2L 5IMKA 1XR9B 4ZUSA 4ALAH 4LSUH 1D6VL 1YN6A 5DI8A 5I1EH 4I0PC 4XBGB 4U1NA 2Z93B 4P4KA 4TNWF 1MAKA 3KPTA 4KI1A 3GHBH 4IRJB 5ICYA 3QUZB 2XXCB 3QXVA 5F7WC 1OGAA 1T20A 5IHLB 1SYSA 2I9TA 1SEBB 4YHIB 3ULUH 4L8CA 2MSPA 1CD8A 1DBMH 2LVEA 1KTLB 2VKWA 1XF4A 4PGCB 1TZHB 5AYUL 3ECBB 2L4OA 3MREA 2V2TA 4PRPB 4QT5A 4ALAL 4G3YH 1MCRA 4LSUL 4AIOA 3LQAC 4QGYA 1Z9LA 3QIBB 3GHBL 5IVXE 3FN9A 1BFSA 3RIAK 5C0JB 3MYZA 3MACH 2AK1H 1J88A 3S5LA 5HPOA 3UJIL 3KLHC 4JVWA 3NCJH 4WV1B 4GXVH 3ULUL 1A1MA 3ETBF 4GOSA 3OQ3B 5D2NA 4IBLT 5IF0B 4HIJB 5IGXL 3KYKL 4Y19E 2APBA 1NSNL 5J57B 5KG9A 3ALWA 1J0JA 4LSTH 3D3VE 1QVOB 4Y4FB 2EEDA 1RIVH 4E42A 4NQXA 3FCTB 4HCRH 3D0VB 4DW2H 3VFRA 4Y4KD 3QQ9D 4XXDA 5DR5H 5D7IE 5BRZE 1UQSB 1I8IA 3Q0HA 4AIXA 2C1PB 3RIFF 4F7MA 3NCJL 3GMMA 1FLTX 1P4BH 2AQ1A 1OTUC 3WJLA 4DOHE 4FABH 4LHUG 5HVGB 1CD0A 2XYCA 4K3JL 2QL1A 43CAB 4UQ2A 2MQ3A 1WZ1H 3ULVF 4MB3A 3DROA 3IJYA 5HYJB 5C0CB 1FNGB 3LQZB 1RIVL 2GTWA 1AFVH 2DYPD 4GG8B 4HCRL 4WHTA 5HI3D 4LBEB 2WUCL 4ODUB 1TFHA 1OTTC 5L2KB 5C0AD 5GSRB 4YHOH 2AJZA 2IADA 2ADGB 3BP5B 2Z4QB 1G0YR 4X9HA 4QHMB 4TSAH 2OL3B 4MDIA 3MGTB 1WFNA 1MWAH 1U8OB 4FABL 2DQIH 2E9JA 1NAKH 4I4WA 3MLXH 4L4VB 4ZTOH 2LV4A 3MRCB 1ETZA 1G0XA 5ALBL 1LE5A 2P24B 2J12B 3KPMA 1SM3H 5DHVA 3QPXH 4DGYH 1FVDB 5J0BA 3IDNA 4G9DB 3FB7A 1BJ1J 1VENA 2ICES 1CF8H 1EMTL 1T1ZA 2QR0B 4YHOL 2Q8AH 5I71B 1WT5A 2V9QA 2EC9U 4X6DF 1WFTA 2EYRB 1DVFD 3QZWB 4TSAL 5IJKC 3RDTB 2AS5M 3IVKA 2VISA 2K1MA 2K7QA 3V7MA 3MLXL 4ZTOL 3BZ4A 1CE6B 1MPAH 1NUNB 3MJ6A 3RUGA 1ND0A 3GJFA 2IBZY 1YJDC 2VXSH 1IGIH 2FL5A 2XT1B 1QBLL 5JXAL 1VSCA 1SM3L 3MRJA 3WNKA 2WINB 1ZVHA 2J1KA 3UZEA 1CDYA 1Q9OA 5EBLA 5HYEA 5SX4I 2BERA 2BC4A 4LLWB 2B0SL 2Q8AL 3NIGF 3KDMA 3C87A 3LEVH 2D7TL 4JO3H 4PP1D 3UXFA 1W72H 2H2SC 4JKPL 1MCCA 3P73B 1MPAL 4JB9H 4TNWK 1FORL 3VFVB 4Z7WA 2R1XA 3MRFB 5BS0A 2AJYH 5DK0B 2DM2A 1RULH 4LPXA 1FYTE 2IGFH 2VABA 4K8RD 3RWGA 2EEAA 1GGIH 1MRCH 1KEGH 5T1LD 3LN4A 5JHLH 4LNVA 4E5XB 2R0KH 4KMQA 3IGAA 3ILPB 3X14A 1W72L 4LLDA 3DBXB 2BNUA 2R4RH 5FA3A 5IB5B 4OCSL 1AXIB 3TC9A 3O41A 1FNFA 4LF3A 4EUPA 3QEQE 5FIEA 1U36A 2AJYL 1LNUA 1J87A 2IGFL 2EDYA 3B9EA 4R9HA 5JNYA 1GGIL 1PLGH 2JELH 4KMTH 5FHBH 1NBZB 2R0KL 1MY5A 3GZKA 1ZHNA 2OR8A 5F9AC 1D5IH 2R4RL 4HK3J 1F42A 3V6FB 2VRAA 4KMLB 4MLIA 4F3FA 3SGJC 1R5VA 4PP2A 1X5YA 4PJEB 4XC1H 1A9EB 3IDGB 5MHSE 5TDPB 3RIFK 5F7NC 5FYLH 1IE5A 3V79C 4F7TA 3OKLA 1PLGL 2JELL 4KMTL 4X7SH 4V1DE 1IL1B 4JFOA 1EGJA 1UCBH 4XBPA 4YLQT 4FFZL 4HAFA 4Z78B 1MCDA 3PDDA 4HUWB 1HN1A 4NJAL 5DTFA 1QBBA 5DYOA 2YUWA 1D5IL 3KJ4C 4KK5D 1H5BA 5SWQA 1S9YB 4RIRA 3HCVA 3P4OB 4O4YH 3REVA 4PJIB 4XC1L 4XTRC 2RAMA 5TE4L 3HMWH 2E7LC 1EAPB 3CC5A 2BNQE 4N9GB 4QRRD 1FDLH 5FYLL 1N8ZB 4XP6H 2E7HA 5JPNA 1UEYA 1G7MA 4X7SL 4EIGB 4KUCF 1KC5H 3MLTA 3RY6C 1RZGA 3EFFA 1UCBL 3ZO0A 4R96B 3SY0B 1S3KH 3KPNB 2EDTA 2C1OB 4OZHB 4GRLB 4AG4H 5KTEL 4JR9L 5FEBA 1KV3A 2ARWA 2B7DT 2VO5A 4K7FA 2VZ1A 3BX7C 2VXUH 1GVIA 2E27H 4HS8H 4NBXB 4DVBB 4EXKA 1HHIB 4JZJC 4FQ1L 1G9NC 2IQAB 4U7MA 3B2VH 3O45A 5JIKA 4DN3L 3BJLA 4Y1AD 1C12A 3SKJL 2JF1A 4XP6L 4AQOA 2C4FU 2FD6L 1BZ7B 2YZ1A 4JFDB 3RWDB 5CBAB 4U1IB 4PJ7A 2VLKA 2RIKA 2VXVL 3RWJA 1IGTB 1LGVA 2PYEB 3GNMH 4XNYL 1XF3A 3BEVA 1E4WL 4NO0A 5FYKL 3T04D 3VG0H 2ADIB 3GGWB 3KR3H 2E27L 4JPWL 2FJGA 3CMOL 3MCKB 4W70A 5T3ZL 3TIEA 3TNMA 2WWKO 3W9DB 5F9OH 1CGSL 1EXUA 1Z2KA 1OP3H 1F3JB 4I18C 1IEAA 1B4JL 1D5XA 3B8SA 1S7VA 2FEDD 4RZCA 1IMHC 3QDAA 3TYFB 4ZNCD 3TN0A 1H0DB 4M02A 3JV5A 2EYTA 3LRHA 4AZ8A 3FO0H 3ZSTA 3TFKD 3TVMD 3QFJA 1ZV5A 1GGUA 4BQ8A 2ZUWA 2KH2B 1FVEA 4NO5B 5DHVH 2PO6C 3DMMB 5HI4D 3VG0L 3NIDE 3RY4A 3FHQA 2J8UE 3BQUA 3OAYH 3S98A 3U1SH 4M5ZH 1VACB 2P45B 4OD2A 3S96A 5MEQB 5IW6A 2QQKH 5IV2B 3OKEA 3DURA 1I8KB 5LGHH 4I9WE 1W0WA 1AH1A 2ATPA 1P7QA 3FO9A 3GJFH 5DC4B 2DQCL 4I2XE 1QA9B 3CDYA 1NCBH 1VEMA 1YYMH 1I7UA 3BE1L 4RGNE 3KYNA 2PNDA 5IEHB 3UTQB 1NGXA 5I0ZA 1BWMA 2OR7A 4PJHA 4U1JA 4YDIH 3ROOA 3U1SL 4M5ZL 4ZUTA 5IHZA 1RZKH 1MJ7H 2X4OB 4ELMA 3ARRA 4XWOC 5HPMA 3BPNC 3OV6A 5J11B 4WUUB 1ZS8A 1N7MH 4EI5A 5HGHB 1D9KA 3MRIA 5INDB 4JJ5B 5L0QC 1G7HB 4D0BA 3O2WL 1YDPB 1ZLWK 3V7AG 4OM1H 4LVHC 3KWWA 3BKJL 1IM9D 4WFED 1NCBL 1YMME 3GMLB 2WBJC 4JRXA 2V7NB 4GKNB 5E6ID 1N59B 3IF1B 5B4MD 3EYFA 3MR9B 5EU7C 3LKSA 5EO0A 1MFNA 1NFDE 1OF2B 1A6VH 4LVOC 2VZSA 1HXYB 1A5FH 4RFOH 1M7DA 1E4XI 5C2BL 4H1LA 4HXAL 4KWUA 4HZAA 4TPRH 4PRDB 1JUFB 4GLRH 1JGUL 3QQ3B 4UQ3B 2ZSVB 3KNBB 4EUPH 1K4CA 4GMSL 1H3VA 4WO4D 4Z7UF 3ARFA 4PPTA 3FONA 5DLMH 2D9CA 3U83A 4GG6E 4KQ4L 3U46A 1A1NA 1IEBB 1FSKC 1JNNL 4M5YH 1W72B 1YUHA 3PE9A 1HDMA 1F58L 1U8KB 2MNUA 3OJMB 1A5FL 3TCXA 3SDDC 5IKCB 3TA3C 1NGQH 1WCBB 4KGLA 4ZFGH 3RKDD 1KLGA 5GGTH 4U7SA 2VL4A 3M17B 4FHBD 4NGHH 1HI6B 3CFBB 4MJ6A 2AXFB 5CJOL 2F19L 5DLML 5ENWA 1T2JA 4ZOEA 2NXYB 4APQC 1I4FA 3L6FA 1EGJH 4M5YL 4AM0B 4N68A 5CP7A 4JM2F 4MXVF 3H3PL 4HKJA 4L5FL 1P1ZB 2Y07L 4L9LB 2JB6B 2HFEA 1LP9F 5DQ9A 1X6NA 4HFWB 5KSVA 1U2CA 2ZUYA 5GS1B 4R7NB 5ANMA 1FJ1A 2F15A 1QSEB 3MLYH 4NGHL 2V9RA 1HSBA 1R3JB 1TZGH 1PEZA 2E7MA 3TO4C 3WLWC 3NIFF 2FX8H 3GKZA 4M9PA 4OLEA 5EZJA 4ODTH 3K8MA 2I60L 1XCTA 4UIKH 3WFBL 3BDXA 3GBML 1JGEB 5IMKB 1EGJL 4ZUSB 2DLFL 5HY9A 1ORQB 5ITBH 4U1NB 4IMKC 4P4KB 1YEIH 1MCQA 2R0WH 4KJYA 5ICYB 2GT9B 1AGDA 3DIFB 1OGAB 1T20B 1FVCA 1SYSB 2I9TB 1TJHL 4L8CB 1KCRL 3VXUD 1HZHL 4YPJA 3QEQB 4G43B 2IH3A 1U3YA 3MREB 4XCNA 3V52H 1U3HC 2V2TB 5D7LD 2A9NH 4QT5B 2AEIT 4K9EH 3EHBC 3J8F7 5ITBL 3L3KA 3H0TB 4QNPE 1T21A 1JF5A 3GMRA 3HTLX 1IC7L 1XCQA 3MRQA 3NCEB 3KPRD 2R0WL 3QUXA 5HHXL 3KPSA 3VWKA 3RWEA 4MA7H 1E6JH 4CN4A 1NANH 1S7UB 5D2NB 2B1HL 4BK4A 1VFMA 5E8OA 2X4SA 1LILA 3SCMC 5FGCE 1A7OL 3FTGA 3G6DL 2HTKD 4Q58C 5KG9B 3VRIA 4V1DB 4K9EL 1N6QH 4LP5A 1JHTB 3C2AH 4E42B 3RNQA 4NQXB 4YIQB 1QFWH 2ID5A 3VFRB 3T0BA 3QDJD 4BH7A 1AXSA 4QHNA 4XXDB 3K80A 1I8IB 3Q5YA 4MA7L 4P5TB 1E6JL 3GMMB 5TFSL 2A74A 5F88A 3IDMB 4F7PA 1CXIA 4KK9C 2BNQB 3UP1A 4JFYA 2GK0A 4UQ2B 5L6YH 4NN7B 1AGCA 3P0VH 3FAWA 4HDIA 5E5RB 3DROB 5HI5D 1PJ9A 4B50A 4L8DA 3O6MH 2YZ8A 2A1WH 4YXHH 1JZ7A 4WHTB 3KPQA 5DVLA 4I0PA 1Q8MA 4P9MH 4AEIH 5EU4A 3G04A 4MQTB 2C4XA 4JFPA 2VLRE 3WNNA 2AJZB 3NACH 4P9HL 2IADB 4DKFH 1SYVA 3FN0H 5J4MA 4R2GD 4FQ2L 5D7JC 2IPUK 4PJCA 4I4WB 4NCC2 5DSCA 3QDGA 4UUJB 5GS0H 2APXA 1DN0A 1LE5B 1PSKH 5J1AA 1A02N 3P0VL 3HZMA 1BJ8A 4MVBD 5C08D 2NY2C 2EE6A 2B1AL 3O6ML 5DHVB 3RBGA 4YXHL 3TBYB 2HT3C 4LARL 3ZLQC 3N1QC 4AEIL 3FB7B 2ZSWA 4G7VH 3HAEH 3O3DA 4NKQB 1T1ZB 2P5WA 3U82B 2HWZH 3NACL 4OGAD 1P5UA 2GSIA 3QEHA 3FN0L 5J6HA 3BISA 1UJTA 3BKCH 2NTSP 5JPMA 1OLLA 2VISB 1IGJA 3EGSB 3SDXE 3BZ4B 2NNAB 3BGFC 2D31A 3RUGB 1ND0B 3GJFB 4UDUA 2BVOA 1ZANH 4JE4B 3I9GH 3MROA 2PKDA 2GQHA 4P23C 4XNZC 2QLVB 4WIQA 3MRNA 3MRJB 2DMCA 5EBLB 1Q9OB 4WVRA 4IOIA 4LCUA 4YUEH 5JA9A 2PF6A 3BRFA 2CKNA 2BC4B 3AY4C 2JJVA 2X40A 4HS6B 3KDMB 2W07A 1X44A 2O26U 5D5MA 3V9FA 4AT6A 5IHUL 3RVXC 1VADB 2J8UB 4XP1H 5IOPA 3BKCL 5CJXC 1P2CA 1WGOA 3IFLL 4OAWA 5HDBE 3QXDA 1ZANL 4QHLA 4OCLC 5KN5A 5ACLA 5BS0B 1CI5A 1JP5A 3BO8A 4B5EA 3QEGH 4Q9RH 3CPLA 2Z31D 2F54D 3KS0H 1X9QA 2VABB 4NN6C 3RWGB 2R1WA 5T1KA 5I30L 5CJQH 5CEZL 4WU7A 3LN4B 1A6AB 3MBXL 5C09D 5C6PB 4E41A 1UJ3B 3IGAB 4OKDA 3X14B 3SGDI 4LLDB 4CU7A 3PUCA 3L3JA 2BNUB 4EN3D 1ZA3B 5FA3B 2NY6B 3DX7A 4H8WC 2FECL 4OBSA 1P84K 2ESVD 3O41B 4RGMC 2DI9A 3ZTNH 4U6HB 4C4KO 4EUPB 5EU6A 2JLLA 4ZSOE 4C56D 3QEGL 2NX5B 1KCUH 3CX2A 1S78D 3U79A 5DQJA 4DGIH 5JNYB 3GEWB 1CG9A 1P6FA 2HFTA 2DQGL 3DV6A 4NO2A 4ODSH 1NFIA 1J8HA 1I7TA 1ZHNB 4M7JL 2XN9A 3GJEA 5I19L 5IJKA 1T5XA 5CWSB 3HS0A 4F3FB 1R5VB 3ILQD 4PP2B 4G6FB 1GYAA 5DA0B 1N2RA 3CCHA 3ZTNL 3T65B 3S34H 1S7QA 35C8H 3PGFH 1XF5A 4BSWA 4U7KA 4PRHA 1U3JA 5BV7L 4F7TB 4NBYB 4DGIL 4NFDA 4L1DA 2JKXA 1JMZA 4R97C 2JJSC 3LD8C 2HT2D 5DYOB 5F97E 5FO8A 4S2SA 2OXGA 4F57H 1DL7L 5SWQB 4RIRB 3HCVB 3IYLW 3REVB 1AXTL 2JCCA 4P59H 2UY6A 3MGAA 2XG4A 4KRMB 1XIWC 3S34L 2Y72A 5C07A 2AW2A 3CC5B 1MEXH 1ED3B 1P7KA 3HC3L 5J13C 1D3CA 3DX8A 3GIVA 4MJIE 1DQTA 5ACMA 2R29L 5JPNB 4N90D 2X4UA 1G7MB 4RX4D 4DKAA 4RMRA 3TYGL 2NY1C 3D48R 3DXAA 3MLTB 2YPVL 2BHZA 4HJJL 4S11A 1RZGB 3EFFB 3OWEA 3QI9B 3QUZD 4LCYA 5GJTH 4XNUH 3BXNA 4UOW0 4F57L 1QTYT 1EFQA 3BSZL 3PP4H 1T1YB 4P59L 4GKSB 4JHBA 3S35X 5GGVH 3C08H 5HHQA 3UTSA 5FHAH 5GGVY 5KSBF 3FHAA 3O45B 3CK0L 1C12B 3O3UN 2X4RA 4KJWC 4ETYA 3BPOB 3MXWL 1FH5H 2IFFH 3QIBD 4MSWB 1NEUA 5KS9F 2FCBA 3WFZA 1BJMA 1I3GH 4JQIL 5D70H 4PRBA 1PAMA 3VRJA 5JOPD 1PD6A 5D96B 2BNRA 4K8RC 4IRZH 4HULB 5IFHH 1NUFA 3RWJB 2WBWB 4OGYH 4YH6A 3BEVB 5LCVL 1RUAH 4DK6A 4HWZA 4NO0B 4HUUB 4U1SA 3D9AL 2FJGB 5GGVL 3C08L 3SGJA 5DMYA 5F93C 4NWTH 1NDMA 4ZS6D 3VD3A 3TNMB 2MTPA 4OLZH 4KROC 1X7QA 1EXUB 3S88H 1BD2A 2IAMC 1IEAB 3HI5H 4QHUA 1D5XB 2IFFL 4X9GA 1G9MC 1S7VB 5HHNA 4AMKL 2VR9A 5C86A 5D70L 3TN0B 3DSFH 2EYTB 1IQWL 1WWAX 2XQBL 5EO9A 4ELKA 3WFCL 3VXOA 1FVEB 2DQUL 1RUAL 4NQEA 4ZMAT 3LQAH 3QHZL 2K3TA 1OWRM 1GOFA 3BQUB 1INEL 4M9OA 4NWTL 1QLEL 5K59E 1J1PL 3VI4F 4YHLL 4PGDA 1V3KA 2V17H 5C0BE 1IFHL 4OD2B 4OLZL 1QZ1A 2E7LA 4GXUM 1SVCP 5TDOA 3DURB 4YE4L 1KBGH 4WCYL 4DTGL 5CD3A 1X5GA 3O6LH 1GAFL 4MCYA 1K8DA 2ATPB 1P7QB 3T2PA 4BFIA 3RVWC 1UXWB 3NBNA 4ETQA 3T0WA 3RY6A 3MUZ1 1I7UB 3KYNB 2FIKA 1BF8A 4HIIA 4P2QD 1N5AA 4L4VD 3LQAL 4M48L 4NP4H 1WC7A 2P1YA 3PWVA 4KKBD 4KKNA 4I0KA 4PJHB 4U1JB 3ROOB 5C0DA 5B39A 5ESAA 4JZJA 5D1QC 3KPOA 1CFQB 3QEUA 5HPMB 4TTGA 3TESA 1KBGL 3ARBB 5C70A 2ERJB 2AJ3A 4YBHA 4EI5B 1D9KB 4PJDE 4QXWA 4D0BB 5FCUH 4K55A 4PJBA 5IUSA 2WSKA 5KVEH 5HGBA 4NYLA 3JV0A 3T0EE 3HAEB 3B2UD 3RDTD 4JRXB 3P77B 3EYFB 1CFTA 5D72H 5I8EB 1BIHA 1D5BA 1XGYL 3NCBB 5DZOA 1KENL 3LKSB 4NQVA 5EO0B 3T3PE 1BFVL 4M43H 15C8H 2C3HA 3IS0X 4PRIE 1M7DB 4H1LB 4I18A 1UWGH 4XPFH 4YBLB 4QF1A 2FWOA 2Z92B 3MJ8A 4ZS7L 4AYFA 4G9FE 4HX1A 1M7IA 1IAKA 5KVEL 5D1XB 5IVZB 1VEPA 3CZJA 4FFWD 1K4CB 3UTPE 4AJ0A 3ARFB 1A9BA 4RMTA 3FONB 4X4ZA 4ODBD 3F7QA 4QXUL 2PO6A 1A1NB 5DJXA 5F1NA 1YUHB 2Q7NA 1AO7E 1HDMB 3FB8A 1BLNA 4WFGD 1OP5K 3NZHH 1A6ZB 1YEEH 3V8CA 4N0YL 4H0IA 2ORBH 4AENA 1KLFA 1ROWA 1HQRA 4S0TD 3G5VA 3LEXA 4J6RH 1XFPA 1YJDH 2X2YA 4RISH 4H25B 2QHRH 4MJ6B 3EYSL 2VXTH 3OB0H 4YFDB 2NY4B 3IFPB 1WV7T 5E9DE 4OCYH 4GBXD 1I4FB 4XPBH 3L6FB 5CHNA 5ID0A 5CP7B 2FATH 4HKJB 3TM6A 3H9HA 1RUPH 4WI7A 2HFEB 4NC0B 4G6ML 8CGTA 1CU4H 2ORBL 3MNZA 4U1KA 2JIXA 2CIIA 3MBEC 5DQ9B 4OZFH 4Y5YC 3N0PB 4JFQA 4X7FC 3OGCA 3OR6A 1YEHH 4J6RL 5ANMB 5DZLA 1YJDL 4RISL 1G7LA 5K93A 1WK0A 1HSBB 2QHRL 3MRPA 1NEZG 3PGCA 3REWB 2CMRH 2YBRA 2WBJA 1MAMH 4OCYL 5JXED 5HY9B 4P49A 2BRRL 1H3XA 2FATL 1Y18B 4P2OC 4Y89A 1GRWA 3FT3A 5IBUG 1ZLVH 1EX0A 2NW2A 4KJYB 3S7GA 2MFNA 1AGBA 1AGDB 1RUKH 4JFEA 1GGCH 1YEHL 2X4QA 1EV2E 1DUZA 5L2JA 4WUKL 3MLUH 4H0GA 2IH3B 1MAML 5MP6L 5HHMD 4Q6IC 2C3VA 3X12A 1VGEH 1JNLH 3VH8G 2W65A 3DUSA 3L3KB 4CAGA 5I0DA 1T89C 1T21B 4EDWL 5BJTA 1XCQB 3MRQB 1IGCH 1QPPA 2BSRA 5E24E 3S36X 3QUXB 1M1SA 1RUKL 3SDDA 1X5HA 5SWSE 1GGCL 5EFIA 3VWKB 2B5IB 3WKML 2YA1A 3KYMA 3MJGX 2HP4A 4F8QA 5ADOH 3TBVA 5HYFA 5IWLC 3L5WB 2X4SB 5DRZA 5I16A 1I7ZA 3BGMB 3FJTA 3FTGB 2CJUL 5B38A 1UWXK 4WO4C 3VRIB 3QDME 4WI3A 3I75A 1VGEL 1JNLL 3ULUD 4APQA 2AJVH 2J6EA 5JQHC 4MQXD 1KB9J 3UAJD 5HHPB 4RMUA 3CH1A 5F44A 4BH7B 2J2ZA 1AXSB 4QHNB 5AZ2H 4PJAF 4JFDD 4D9RD 2VZTA 2OBGA 2ICEB 3MOBL 5C92A 2A74B 5F88B 3MRGA 1Z3GL 3TBWA 1NCAH 4F7PB 3IDXH 1KIUA 5ADOL 2PYED 3QJHB 1ORSB 5F6IB 4JFYB 2GK0B 1V7NH 3TO4A 4HQQL 1AGCB 1QLRB 1MUJA 2HN7A 2X70A 3AS0A 3H42H 1AHWA 1FZMA 4XCFH 3MOAH 1DLFL 4BSJA 4FOMA 2AJVL 2QTEA 2EDRA 1Q72L 3KPQB 4I0PB 5EU4B 5ITFA 1EJOH 4MZ2A 5KVFH 1GPOH 2B20A 4J3VA 4NZTH 5AZ2L 4G7YL 5TGBA 5CUSL 1SYVB 3SEPA 5FUZL 1G9EA 1S7RB 1LVEA 1ZT1A 1NMAL 4PJCB 1GGBL 5HXMA 1G9NH 1MJJA 1FNSH 3MV7E 3DMMD 3INUL 4POZD 5J1AB 3H42L 1FIGL 1RFDL 3HZMB 2KZWA 2KQMA 2IALA 1U3HA 1FN4A 1WJ3A 4A6YA 5DJYA 4X6DE 5CZKA 4ZO6A 1B0WA 3ZSSA 3ARXA 3BN9D 3G6JE 1EJOL 3O3DB 5KVFL 1GPOL 3WLBA 1WZMA 5ESVA 5IMOA 2GSIB 5T1DH 4R26L 1I9EA 1K85A 3QEHB 2LFGA 2BXZA 1HILA 4PV8A 5J6HB 1I9JH 5JPMB 1H8NA 1RURH 1IGJB 1G9NL 3U6RA 3PL6C 1Q94A 1I1RA 4UDUB 2BVOB 4LCWA 3SCMA 4S1SL 3MJ9H 4U1GB 3MROB 5E5UB 3O6FC 3MRNB 4ZUUB 4XAKE 1YEKL 2X1OA 2FHBA 3BKYL 5JMRA 1JHKL 4BQ6A 4WUUD 2H6PA 3F7YA 1CWVA 3O4LE 5D5MB 4AT6B 2WUBH 4GXUN 4C4KT 5E1AB 4JPIA 4Y5XC 4PJ5D 2E6QA 5IOPB 4YWGH 1S9KC 4OZIF 5T5FH 1RURL 2VN4A 5K9JH 5CGMA 2DTMH 4BFGA 1P2CB 4FTVE 1FG9C 4M8VA 2YEZA 3QXDB 1A7RH 3TO2B 4QHLB 3DX6A 1BREA 5E2UL 4MJ5B 5KN5B 3BO8B 3RX7A 4KZEH 2H9GA 3CPLB 3EOAA 1A3RH 2R0ZH 2R1WB 5T1KB 5BOZG 2RCSH 5I8OL 2FEEI 4PJXE 1G0DA 2H32H 3CSPA 1EPFA 3ZYOA 2XWTA 4MMXC 3N1FC 5DUBA 5I1KL 3RFZC 2WUBL 3AU1B 1QHOA 1WQVT 2BVPA 4X6EA 4MX7A 5CD5C 2GKIA 2HLFC 1TVHA 4HUXA 5D7JA 2DM3A 4WJ5A 3DX7B 3OPZH 2IBBA 1A7RL 1A7BA 4XVUC 4FN0A 3BD4A 1KB9K 5EU6B 3IDUA 3PWNA 5EOQL 3STBA 2R0ZL 5EULV 1AE6L 5DQJB 2RCSL 1CG9B 3U4BH 3HE6C 4R0LA 4J23A 1RHFA 4NO2B 3QUYC 1J8HB 1I7TB 2XN9B 3GJEB 3O8XC 4NT6A 1I1YB 1T83C 1T5XB 3LPWA 4KKLC 3HS0B 2EDWA 1T04A 4TUJB 3PQYA 3W11C 2VXQL 2GFBA 4YDLC 1N2RB 3PG2A 3CCHB 3LSOA 2NXYD 2IF7A 1S7QB 1LO5A 4BSWB 2L0DA 4P23A 5HYSA 1T2XA 4XH2A 2EXYD 4PRHB 1AGFA 2XKNA 2XTJE 1X4XA 1PKOA 3AY4A 4Y0GA 1HCVA 1UZ8A 2A6IA 2VDKH 1LEKA 4HS3B 2QEJA 2FH8A 1CIDA 4YO0B 4OZGF 5FO8B 2L7JA 1QSED 1JPFA 5D1ZD 5CJXA 3CD4A 3BD3A 1T7YA 3S9DB 3NN8A 3S4SA 3OAZH 5MENA 1V7MH 4XAWH 4HPYH 4I48A 3I02A 5C07B 3WEXB 3SE4C 3C5JB 3HUJA 3DX8B 4P4KD 2X4UB 2WWMC 3DXAB 1LK3H 5JDJA 3A6CL 4J4PC 1LMKA 2VDKL 2CQVA 2AEPH 3PP3K 3ULVC 1OGAD 4GAGH 4LCYB 5E9DB 3WMSA 1HINH 1QRNA 5FYLD 2J6EH 1QRKA 3HR6A 2FSEA 3FB5A 2OJEA 2VIRA 3S35H 1TLKA 3DLQR 5GISH 5HHQB 4U4BA 3UTSB 2W1NA 4XAWL 3OG4B 4HPYL 3T77A 2JJTC 4KJPC 2YD9A 3P9WB 2X4RB 4X4ME 5KAQF 4B53A 5D9SA 2MCPH 2MKLC 4ONFH 1LK3L 1R5IA 4PRBB 4KXZI 1TIUA 1X3DA 2Z31C 1FO0H 1CLZH 4GAGL 3OZ9H 3ZDZF 1C1EH 1XF2A 1NGYA 4YFEA 2J6EL 4HWZB 4KTEH 1HHGB 4U1SB 2J88H 4G6AD 4XPGL 3PWJA 3GKWL 5GISL 1BGXH 1NDMB 1PFCA 1JTOA 2JK5A 5ISZA 4JREC 1BD2B 4WFFE 4QHUB 3V8OA 5FYKD 1KB5A 3ZZ1A 4PTUA 2NTFA 2VDMH 2YWZA 3B43A 4FG6D 4MGXA 3QJFA 3V4PL 1YNLL 1CLZL 3HZKB 4D9QE 1DANT 5T3ZD 2JJSA 5EO9B 4OFVA 1C1EL 4ELKB 5F89A 1EFXA 2QKIA 3VXOB 2ZG3A 4NQEB 5EOCH 3ZYZA 3WE6A 1U8QA 3HE7C 3PNWA 3KJ4B 2Q86B 1W2KT 4CUCA 1J86A 4RA0C 4OTXH 4QTIH 5FKAA 1G7JA 1BGXL 5IVOA 4F33A 4PJFF 4PGDB 1UM4H 5F9JA 1XIWA 2FX9L 3N50A 4PGBB 5TDOB 5HDQH 2YHGA 5CD3B 1R3HA 3AS1A 4ZFOB 1K8DB 2VDML 4BFIB 3G5ZA 3D25A 4R3SA 5I1IH 1ZHBA 4ETQB 4U33A 4RWHA 3WFDH 2P42B 2Z91B 3QDMB 4MAUH 4A6YL 5EOCL 2FIKB 3UMTA 4YK4C 4G6KL 4HIIB 1N5AB 2DI8A 2X41A 5E2WL 1UH3A 2HFFA 1WC7B 4OTXL 1KFAH 4K07A 4Z7VA 2V9TA 4L3EA 5B39B 5ESAB 3NPSB 1FYHB 4JZJB 3CFEA 3KPOB 3QEUB 1NLDL 4XBEH 3DO7A 2Y9RT 3I2CH 3BH9A 2OJZL 1F6AA 1INDL 4PJBB 1JTTA 4ZFZB 5I1IL 2Y7QA 5HGBB 4FQXB 4GAJH 1UGNA 4NYLB 4EBQL 4QLRA 3E8UH 4O5LH 4MAUL 5CCKL 2R69H 1SHMA 5AD0A 1SY6L 5D6DC 3QO1A 3E3QC 4NQDA 5MI0C 3UJJL 1H9VA 1CFTB 5FGBC 1KFAL 1B4RA 5HVHC 2H3NB 1CFSB 3VXRA 1B9ZA 1U8LA 4NQVB 1MFEL 3FOMB 1MFCH 4OF8A 3ZL4L 1C5BL 1H3TA 5EU5A 1C16A 3HZYA 4XBEL 5I8CA 4BYHA 4P3WA 1JRHH 3RWIA 5ABDE 3DTXB 4I18B 2VQTA 2IAMA 2Y25A 4HD9A 4X6CA 4Z7UE 4EZMA 1PX4A 5FFLA 2FWOB 3MJ8B 5LJYH 3C60C 4HX1B 3Q5TA 1IAKB 1WICA 2XWBA 2AEQL 4GAJL 4U0QB 2AXJA 3E8UL 2EE2A 1WAAE 4WENB 1A9BB 5CP3H 2PO6B 1FCCA 2DLEA 4L4TA 4DN4H 3G6JB 1U8JA 4X83A 3ZKMC 5F1NB 2PCPA 1MFCL 4PJIF 5BMFH 5CEXA 4R4NC 4M6OH 3FB8B 3K1DA 3PHOB 4K2UL 1BLNB 5BS0D 4C58B 4LSPH 5ILTH 2KPNA 4W6XB 4AENB 5GRJH 3EYVA 3RVUC 1FGVH 2LU7A 3MODH 4OLXH 4U6YA 1HQRB 1KIPA 2AJXH 3TF7C 3IKCA 4AEEA 1ODAA 4HFUH 3G5VB 3LEXB 5JR1H 3GMNA 1JYNA 4OZHF 2H32B 4GLRI 3QIWC 4MXVE 1KCVH 2AAVA 1KIRA 2NY6D 4NWUH 2GAZA 5IT2L 3MYJB 2CKBA 5ID0B 3QUKB 1OB1A 3ULUF 3H9HB 4QOKA 4OFPA 3QRGL 3DVIA 4YHYC 1TJIL 5D1QA 3SQOH 3FAXA 1RZ7H 3NA9H 5J12C 3MNZB 4U1KB 1FNAA 1OHQA 1FGVL 2JIXB 3OTTA 5JQ6H 3NIFE 4QWWD 5BVJA 4OLXL 4JFQB 4HSQA 5DUPH 4MAYC 3OGCB 3OR6B 1H3UA 5L0QB 3N9GH 5JR1L 3D39A 3WD5L 1NCWL 4M1CD 4PG2C 1G7LB 3MJ7B 3MRPB 3PGCB 4K7PL 4WI5A 1X5LA 4HLZH 1Q9KA 4NC1E 2PXYC 4MXQD 2WBJB 1ACZA 4ONGL 3PXJA 4NWUL 3RAJH 4G6FD 4RRPG 1EO7A 4ZSOA 5GRVL 4PJXB 5JORA 5A2LH 5C0AE 5L8LB 3FT3B 4F9PC 5D71H 1UKSA 2PUQT 3FMGL 2FIRT 5A16A 3QWRA 3O0RH 3SQOL 5KAQG 4HKXA 4UAOC 2UZIH 1AGBB 4JFEB 4NSKA 1EO8L 1N4XL 2GIYA 2X44D 3LZFH 5DEZA 2P48B 2EDJA 2X4QB 3N9GL 4BUHA 5L2JB 4Y1AA 1JPST 4H8WH 4NO3B 4MD4A 3CDGA 4TNVF 3AM8C 5BZDA 4Y2DC 3MLPA 1UZ6F 1GIGL 1RV6X 1ZHKA 3QZWG 4ZNEA 5DMKA 4JDZB 5K9QI 3DHJA 3DVNB 2JB5H 5I1GH 1JZ4A 2C3VB 4NRZA 5IMMA 1BVLA 2W65B 3DUSB 1FSKB 4JY4A 1L9MA 2QQNL 5TE6H 1G6RA 2DD8L 2BSRB 2UZIL 2I24N 3S36H 3SDDB 3TA3B 5EFIB 2NZ9D 1NLBH 2CK0H 1F8TH 3D87B 4PJ8C 3WHXA 4H8WL 4YBQC 3KYMB 4XHJC 2BMKA 2X1WL 4Z0BH 3TBVB 4K94H 1RAMA 5DRZB 1L7TH 2OS7A 2XZCL 5I16B 1I7ZB 5DEGB 5I1GL 4H88L 4WY7L 6CGTA 2XTJB 2R56L 4IJ3C 3I75B 4GJTB 4X7TA 4APQB 1T6VN 3RGHA 4R4BA 4ISVA 1A2YA 1OTSD 1J9CT 3CH1B 3ZKQD 5EOTA 5F7YC 1YZZA 4CU8A 2CK0L 1KJVB 1NKRA 4LKXA 4D0DA 4DWHA 2VLKD 3MBEA 5DMJB 4OF7A 4Y5YA 1HH9A 3TBWB 4ONOA 4HKBA 4L3AA 1AR2A 1N0XH 4BKLB 1L7TL 4YDJA 4NO0D 4HJ0C 3TO4B 1EEQA 1KB5L 1MUJB 1FO0B 2X70B 1FZMB 4QRQA 2XXMB 2NY0C 1SJHA 3QNYA 3O9WC 2ZCKL 4ERSH 4HGMA 3AVEA 3L3OA 4TVPL 5L7XH 5EC2A 1YECH 2BDNH 2EXWD 1FFRA 2XY1A 4JVUA 4P2OA 1CLCA 4WDIA 1E0OB 1K2DA 5TGBB 1XGRA 3WJJC 3TN0D 1QFWI 4XPTL 3MLZL 5F7HA 1FL5A 3QFJD 4LFHD 1N0XL 2VITB 4M1DL 3GMQA 4NQCA 1MJJB 1SBBA 5ESQA 2IQ9L 1WWWX 3U7WH 2CPCA 3L7FB 5A43C 3QXUA 2F53A 5H37G 4IHOA 4JFFA 5FF6B 3BYTA 4ERSL 1CL7H 1FN4B 1U3HB 3BQUD 2YR3A 4Q6IA 5DJYB 4KRPC 5D6CA 4LQ1A 3ZE2F 4DUVA 5JXEC 4K8RH 1GOGA 2DBJA 5E8EB 3DYPA 2W0PA 5IMOB 3MA7A 3RVTD 1P7QD 1VERA 2FHCA 2G2RA 1QO3A 1HILB 4PV8B 5ERWB 3MRMA 4JY5H 4ENEC 4Z7NE 3SQBA 3W0WA 2DLIA 4OT1L 3U6RB 1WWCA 3MUJA 3RQ3A 1CXLA 1Q94B 3FT2A 4KI5D 5IWLA 3LRSA 3U7WL 4LCWB 5FGRA 3S37L 3SCMB 4CMHB 4BZ1L 3D5OF 1G9MH 1T22A 1E4KC 4PBWD 2MPAH 4LHUA 2ITCA 4U6VH 1CT8B 1JV5A 4GKOA 1P69B 1UH2A 2H6PB 3DUHA 4OLVL 3F7YB 4EI5D 4ESKA 1D9KD 5D93C 1QSFA 5J3HC 4JPIB 2XWJB 1OWWA 4JM2C 4FQLL 4FXGA 4JY5L 1ZLSH 2NPLX 3EYQC 3Q6GL 3WNOA 4DZBB 2C3GA 4JRXD 1CLOL 4QRRE 3EOTH 3WFHA 1HQ4A 3DX6B 2W0LA 2E6JA 1G9ML 2YSSA 3VE0A 1ES0A 3E1F1 2MPAL 2H9GB 1G1CA 3EOAB 4U6VL 4JPVL 5FXCH 4X6FA 3TBSA 2XWTB 3GM8A 5DUBB 2BCKA 2XIDA 2J5LC 2BVPB 1U92A 2CKBH 3CX5J 4MNGA 1ZLSL 4MX7B 2E9BA 2YMXH 5JW5A 1TVHB 4HUXB 5D7JB 2W0FA 3QNXA 5CEZD 3ARFD 4QYOB 4WJ5B 5CFHA 3VGHA 5FA4B 5DEFA 5CZVL 3EOTL 4XHQA 5T33L 1RZJC 1MCEA 3FFDA 4KC3B 2NY7H 4JFZH 3SO5A 2VAAA 5HYIA 3CLEH 4IRSC 1J5OH 3VA2C 2NY2B 3Q2CA 1R3IH 4IMLA 2CXKA 3O2VL 2UZYB 3FQUB 4M6NL 3AB0C 2BX5A 1NUDA 2DIAA 5IB3A 1TETL 3WUWB 1IVLA 1IC4H 2CKBL 3ZHKA 4RBPK 1DBJH 2YMXL 3JXAA 4NT6B 5C0RH 4QKXB 2NY4D 3PL6A 5GQBA 3BGFB 4YX2H 5E8PA 3B9KC 2NY7L 3WV0A 4G8EA 1LO5B 4XNZB 1T0NA 4NQSA 4BQBA 3O6FA 4QRSA 1IAIM 4XH2B 5HYSB 4NHCL 3BD5A 1OVZA 1PW3A 4D8PA 2OCFD 3RWCA 3GDBA 1UZ8B 3BP7A 4UV7L 2UY7A 1LEKB 2D0HA 3PHQA 1QBML 2VTFA 5F70A 5E99H 2X5PA 4JKLA 4M4RA 4Y5XA 3VWJC 3JWOC 2R4SL 3VXQA 5EUOA 2AGJH 1JPFB 1Q0XH 4H5SA 3NN8B 3WUZA 3S4SB 4PY8I 2C3XA 4UBDC 4YAQA 5MENB 4I48B 3I02B 5I15H 5F9WC 4QRPA 3HUJB 4XP9L 4ZO7A 1TNMA 4W4OC 4NN6B 3VFWA 4BM7A 2EH8L 1T7WA 4RMSA 4P2RA 5C0GA 4MDJA 4XC3L 5JDSA 3FRPG 3IAQA 3K1KC 5E99L 3C8HA 1QRNB 3ULSA 4Y4KB 2R8SH 3C8KA 1DQQA 1BEYL 2FSEB 4HWBA 4HW6A 1G6RL 3VD7A 4RAUB 3FB5B 5JUEL 2OJEB 2QADC 2VIRB 2OYPA 3ALPA 4RGMB 3VI3E 5DK3A 3C09C 4PUBL 3BP4A 5AWNH 4DVRH 1T1WA 4HT1L 4XMKH 3DI3B 5FYKU 4WFEE 5DT1H 1PG7X 1ZSDA 1YQVH 1JNJA 3QUXD 4HKZA 4JPKH 3KPSD 3HE6A 4ONHA 3P9LA 5DC9B 3VWKD 1L0QA 5IBLD 1JYWA 2W9DH 1CXKA 3T08A 1XF2B 3Q48A 3HRZA 3QUYA 2R8SL 1AQDB 1T6WA 2CDEA 3O8XA 2RQ8A 2ZUXA 3VD5A 1T83A 5F7DA 3RA7H 1PKQE 1DQMH 3QH3A 3RUGF 3JTSA 2JK5B 4OUUA 5ISZB 2EZ0D 5AWNL 4DVRL 4XMKL 1EVUA 4KZDL 3E0GA 2DQJH 4MNQA 4EOWH 4O9HH 2DOCA 3LKRB 3QJFB 4R97B 3V0VA 3UPAA 4JRYA 4ZG1A 1MLCA 2OI9C 5JW4M 3LD8B 5F89B 1EFXB 3NIDF 3VI4E 3U0TA 3WE6B 2O5XH 2J8UF 1YEJH 4K3EL 3UTZA 1GGYA 5BZWB 4CDGC 1WTGT 1F90H 4X98A 5FKAB 3RA7L 2CRYA 1DQML 4F33B 2NYYD 1F97A 1XIWB 4NUJA 4ZTPH 2B2XH 3SE4A 4UOW1 4QXGH 4I0PD 5J13B 1E27A 1TTFA 2DQJL 3NGBC 4PTTA 1I1AA 3G5ZB 2EXYC 2NY1B 2D03H 1SBSL 4QRUA 3L5XH 4J4PA 4XVJH 3UBXI 4OKVB 3K2MC 3L1OH 3SE3C 5A2FA 5I75C 3SKMA 2O5XL 1YEJL 2PN5A 3V6ZA 3UC0H 2ICWA 1QLFA 2HFFB 3QDGD 4Y16C 4JEGB 4Z7VB 3SOBH 1TMCB 1WEJH 5DD1H 4LDLB 2YD7A 2XOTA 4XI5C 3UO1H 4ZTPL 2JJTA 2B2XL 3DO7B 1F4YH 1OPGH 4I77H 3THML 3BIKB 3BZFA 2EDFA 2P5WD 2Y7QB 1M6OA 3L1OL 5AD0B 3EDJA 3KLHD 5DD0H 3QO1B 5FUCC 4NQDB 5T1LB 4NKDA 3UC0L 2DJUA 1NFDF 4OB5L 2FGWH 1U93B 1WEJL 4UNTA 1U8LB 2UUDH 1MFAH 4X6DA 2GJZA 4HF5L 4F9LC 1QKZL 5I8CB 1F4YL 4KROB 3RWIB 2IAMB 4X6CB 2OMNA 3VXUE 5FM4A 1M71A 2FO1A 1U95B 1NKOA 5CMAB 1NCDL 3VXSA 2DM7A 3CH8A 3EDEA 2XWBB 3QO0A 5ADPH 4OCXL 4OQTA 5D7LE 4GG6F 5DD0L 2R2BA 4TSCL 4UB0L 1OTUD 3U48A 1F00I 1JHLL 1F4AA 4OCMC 1RHHA 3HE7A 4L4TB 1HEZA 1GOHA 3WDJA 1EHNA 1MFAL 1EUTA 3KPRE 5CEXB 4KQ3L 3BJ91 2DWDA 4FA8A 4WEUD 1MCFA 3TLRA 4G6AC 1ULVA 3QB7C 3DV4A 4ODHL 5T1KD 5J1SC 3EYVB 2BK8A 2A83A 1OP3K 4U6YB 1OTTD 1KIPB 2EE9A 1UWEH 4OIIL 1IGFH 1MCHA 1WVZA 4E41D 2QQQA 2OP4H 3GMNB 5ADPL 1MCKA 3BP6B 3TJHD 4UU9A 4RWYL 3U2SA 2WLYA 3VDCA 5KZCB 1KIRB 1W8OA 1FL6A 2CR3A 5IB4B 3WJLC 2CKBB 5CJ5A 1C08A 1V3MA 3QDJE 1BVZA 5EU6D 3T1FA 4MA3B 4MWFA 4YDVA 5FM8A 3OAYK 1V3JA 5D1QB 3MLWL 1UB6B 1AJ7H 5BVJB 4G6JH 1XZ0B 1JPSH 4HIEA 4OM0H 1IGFL 2VZ3A 5LWYL 3D39B 3TZVC 2OP4L 1QD0A 1J8HD 2VZUA 3TPUA 2XN9D 1K6QH 4GW1A 4NNPH 4RX4A 1FAKT 1Q9KB 5CSZA 5IMLA 5D6DA 5EC1A 3RGVA 5EORH 1IKFH 3F7VA 5JORB 4F7CA 4K23L 2CLVB 5ID1A 5A16B 5AG9A 5SWZA 4JO4L 2V7HA 4PRHD 1A6TB 4HKXB 4I3RL 4HWBH 4NSKB 1R24A 4G6JL 4R4FH 1JPSL 4TRPH 1XGPB 4OM0L 3UYOD 4Y1AB 1Q9WA 2V5TA 3C60A 3CDGB 5CIPA 4S1QH 2ADFL 4D9LH 1UKQA 1K6QL 4NNPL 1KPUA 1RIUH 3T4YB 3P4LA 1ZHLA 2DJSA 1OAQH 2ARJA 1DDHB 5EORL 5IMMB 1EBPA 4PYHA 4JY4B 5HBBA 5C07D 1KUMA 4Z95L 3RJQB 1G6RB 3HMXH 1A0QH 4LSVH 1A6UL 1VDGA 4HWBL 1DEDA 1UM6L 4R4FL 4TRPL 3DXAD 1FRGH 3WHXB 4MA1C 2GJJA 1DJSA 4S1QL 4PD4K 1LK2B 1RIUL 2K9UA 3CFJB 3CSBA 1IT9H 4PJGA 3QIWA 3OR7A 1OAQL 3B6SA 4BZ2H 4PIRF 3ZE0E 4X7TB 4PJAE 3UTSD 5IEKA 5TPWH 2I5YH 3MGOB 4R4BB 1MCNA 4ISVB 4GFTB 3G6AB 1LDPH 5DF0A 1A0QL 1KXVC 5EOTB 2ZPKH 1TENA 2GTZA 1S8DA 1FRGL 4LKXB 4PRAA 4D0DB 3MBEB 1MJUH 4Y5YB 3SBWC 4CL7A 3CGTA 2BNRD 1HH9B 2VWEC 4MAYA 1CDGA 3SE8H 2ATKB 1T7ZA 4X80H 3BWAA 4PG2A 1AD0A 2ZNXA 2VSDA 2HKFL 1TVBA 1IT9L 2AKRA 2PXYA 3O81A 3PGDA 1I7RA 2F54E 4ODWA 3VXME 1SJHB 3QNYB 3EO9H 3L3OB 1RJZA 2CRMA 3V6OC 5EC2B 2Y06H 2VH5H 3LKPB 4P2OB 5C09E 5SV4A 2FR4A 1BD2D 2F58L 2AV7A 4KVCH 1Y6MR 3GM0A 3OHXA 1K2DB 2D9QB 4UT6L 2ZUUA 2J8HA 1BJ1H 4L8BA 3T2OA 4NZUH 2VLMD 2ESVE 2EO1A 4X80L 3WO4C 3GMQB 4NQCB 1MIMH 3AM8A 4NQED 1NUGA 5ESQB 1OAXH 2VQ1A 4Y2DA 3MSPA 3UTTA 3D2UA 4XCYA 1IM9B 2AERT 3OX8A 1TITA 4IHOB 4JFFB 3EO9L 3VJ6A 4Q6IB 4MXQC 5IJVA 3WN5C 3ULVL 2VH5L 5E6IB 3FQRA 2O5ZH 3WIHA 1D6EB 2ZOKA 4PGZA 3CJJA 1AI1H 1RVFL 3AXLB 3MA7B 4YC2C 3VFGH 2OK0H 2G2RB 1QO3B 1GZPA 5E8DL 3SDXF 1M05A 4PJ8A 1MI5E 3MRMB 1PKQB 2OTWA 2Q8BH 4LQFH 5IM7A 3W0WB 2EH7L 4CMMA 1OAXL 3FT2B 3LRSB 1MNUH 1K9TA 5JW4N 4RDQF 2I25N 2E8YA 4WO4B 3FZUC 3T2QA 4IDJH 2DQHH 1QSZA 4LHUB 1JK8A 2H8PB 4R8WH 5K9QG 1JV5B 2IFGA 4BA8A 1QPXA 5CKGA 4OQTH 3MMEA 4FNLH 4OZIE 5I9QC 1G7QA 3JBG7 4M7KH 1AI1L 1LO2H 1QSFB 1YNKL 4OLUH 1II4E 3HPJB 4HWEH 4FXGB 3E6HB 4OI7A 5HDBF 2Q8BL 4LQFL 1S9VA 2DBLH 1MNUL 3Q3GB 1SJVA 3TCLA 2EEBA 4JN2B 1HQ4B 3WFHB 4N90E 3I50H 2YSSB 4JO1H 3GSQB 3O9WA 2DQHL 4HMDA 4IDJL 5KVDL 4TQEH 3ZKND 4OQTL 3LN5A 4KHTL 2AJSL 4FNLL 2Y6SC 4N1EA 4X6FB 4M7KL 4BUGA 2JE8A 1MHEA 3QWQB 2BCKB 3FQWA 4OCRL 1MHHA 1J0KA 3WJJA 4HUNB 1U92B 2B8OT 1F5WA 2EIEA 5JW5B 5IIEA 2ZJSH 1MELA 3T4AA 2W0FB 4HIHB 5DEFB 3V4UH 2PO6D 2YK1L 1OY3B 3FFDB 2VAAB 2OSLA 2R39A 2NQCA 3SE9H 5CZXD 3MCLH 4X0KA 3MLRH 3Q1SH 3NCMA 1M7XA 2XZZA 4Z7UA 2P47B 2HA1A 5IB3B 1CTOA 2AXGB 4IS6B 4RFNC 1YY8A 4X8JA 1NCCH 4DCQA 1ZWIA 3CFKA 5FO9A 2ZJSL 1U8MA 4JFXA 1ERNA 3TV3L 5LGKA 3SDCC 2IPKA 3VMNA 3OKYA 3PL6B 4PBVC 4QCIA 5E8PB 1FGNH 4NNXB 3EZJB 4IOFC 3P4MB 3QCVL 4NQSB 4QRSB 1F4WH 3SE9L 4M7ZC 4XMLH 4D8PB 1E4KA 3RWCB 4XPAH 3L3HA 4LLYA 4XWOD 4O2EA 3BP7B 5AZEH 5DO2C 3OJ2C 2JIXD 4GSDH 3PHQB 5EIQA 3DJ9A 4IIQA 3DGGA 2W9EH 2WMPA 4JM2A 3VXQB 5EUOB 4HV8A 1BFTA 5LQBH 2RFXA 1CDCA 2O93L 1FE8L 1A21A 1CE1H 4H5SB 2HTLC 5C0CE 2WBJD 3CXHK 2EDOA 4Z8FL 4YAQB 1LP9A 5L88H 1UACH 2BVYA 4MS8C 4QRPB 1F4WL 3UTOA 1DSFH 2VDQH 4WU5A 2GJ6A 4F15C 4TOYH 5B8CC 4PJ9C 4JFED 3L9RA 2PW2A 1DFBL 4P2RB 1IAIH 4MDJB 4PB0L 5JDSB 4L4VE 5HHOA 3CU1A 2AQ3A 2R1YA 3ULSB 3C8KB 4Z7OE 1DQQB 5C6WH 1MCJA 4PJCF 4YXKH 4KH2A 1CE1L 3WIIH 4M93C 3HAEG 4BSVA 1U8IB 5L88L 1UACL 1W0YT 3F12B 1T1WB 1DSFL 5MHSD 1AKJA 4IRSA 4XB7A 2VDQL 3ZDZE 3K2UL 1PG7H 1ZSDB 5INCA 2VYRE 3LHPH 3W81A 3NFSH 3SDDD 4Z0XA 3HE6B 4ONHB 5MEOA 1K4DB 4ZO8A 3HRZB 3QUYB 1FFPA 5H2BA 2N7AA 3MV8A 3L7EA 5I18L 1KCSH 3BVNB 5IHBA 2CDEB 5BO1H 2DN7A 1FFOA 3WIIL 1FZJA 4R2GB 2IANA 3JTSB 4WI9A 4HHAA 5C7XH 4YDLB 4OUUB 3B9KA 4APQD 1TPXC 3CXDH 4XX1E 4MNQB 4XNXH 4D0CA 4JQVC 2BSED 5C08B 2Q87A 2Y36H 3UDWC 3GBLA 1Q9LB 2B4CC 2FJFA 5D5MF 2V5RA 5EG6C 2BY0A 1KCSL 5BO1L 3VWJA 2DS4A 3NTCH 2AVGA 3NABH 5TQ2H 4WFGE 4X98B 3TO4D 3WLWD 4DFIA 3P0YL 4MD0A 5I6XC 2AK4A 4RDQG 1W0VA 6FABL 4NUJB 5LBSH 3LKQB 3G08B 5D7SH 4MYWB 5TE7H 3S3JA 1YEFH 5FOJA 4W4OA 4LLUA 4OD1H 5AAMA 3O3EB 4QRUB 1PY4A 2G75B 1G1YA 1MRFH 1RPQA 3H9YA 3SKMB 2FO4A 4JZOB 4DAGH 3V6ZB 3NTCL 3WIHL 2H2PC 3NABL 3QFDA 4JDTL 5TQ2L 1VFUA 2XA8H 1CFBA 2P5EA 4PJ5A 3EYOB 1DBKH 1RJLB 5J6GB 4PG9A 5CSBA 1U3HD 5LBSL 3F58H 2BHYA 1YY9D 4PJDF 5E94A 4YHNA 5D7SL 3EHBD 5TE7L 2N4IA 4WI4A 3BPCA 4FMKA 4JDVB 1XH3B 1YEFL 1ZGLM 4OD1L 1FIEA 1L7IL 1M6OB 2Z31B 3KGRA 4JHZA 3MNVB 4PJEE 3IU4H 3RX8A 3FFCA 2N7BA 4NKDB 3BH8A 5I1DA 3I6GA 2FGZA 3T3PF 1ONQA 5M94B 1RK0A 2PR4H 4LCWD 3GSRA 3SCMD 5K9KA 4UT7H 4HEME 2UWEA 4FQIH 1Z6JT 1WTLA 3QPQD 5A2IH 4JREB 1INQA 3HG1A 4FZEL 3V2AR 1RIHL 4C56B 5HSFA 4JHAH 4DFHA 3NFPB 4ODVL 4Z77A 4ZOCA 5HHME 2YPKA 1OARL 3IU4L 3F65A 4Y4FC 1UEMA 1UB5A 2AP2A 3HE7B 2X89A 1V8HA 4KK9D 1HEZB 2PR4L 3CVHA 1WBZA 1NMBH 2XFXB 3QDHA 4UT7L 1AIFB 5KJRH 4MCZA 4OF6A 5EZOH 3DV4B 4ZYKA 1IGYB 4LLAA 4Q2ZB 2W9LA 3FO1A 3T8XB 1TVDA 2A83B 2EZ0C 2IG2H 3LH2H 1ZA6A 2QJDA 1D6VH 3IXAA 4N9OB 2YD2A 1JRHI 4YGAB 3VXTA 4HJGA 4LSSL 3VGGA 1VCAA 3U2SB 3ULUE 3SE3A 5D7JD 2EC8A 4YK4B 1CICC 1FL6B 5M7QA 4UDTA 4Y16A 1C08B 4BJLA 5KJRL 3LOWA 3T1FB 4M6AA 1RJCA 4YDVB 1AQKH 4JFDE 3G5YA 5EZOL 3HA0A 5FCSH 3F5WA 2HG5A 2HT3D 1BFOA 3MA9H 2I9LA 2PYEE 1MVUA 4HIEB 5KVGH 3LH2L 3JWDL 3MUHL 4F58L 3TPUB 2RR3A 1HK6A 3DYOA 3FKUS 5EPMA 5CSZB 5GS2D 2HH0H 1NGPL 5EC1B 3B5GA 5MI0B 3UBXG 1Z5LB 3PQYD 3O3AA 3T0DA 3UJIH 5HVHB 4F7CB 5ID1B 1AQKL 2APTA 3CNKA 4OBRA 4P23D 4L29B 5E5MA 5DRXA 2V7HB 4F9LA 4QRTA 4GAYA 2A9ML 5IGXH 3MA9L 3KYKH 1UZ6E 1NSNH 2EDNA 1CGVA 5KVGL 3SO3C 3C60B 3IKKA 4CVZA 5D2LE 1CGTA 7CGTA 4GMTH 1IBGL 3RVXD 5F7EL 2HH0L 4NKIH 1ZHLB 4LDEB 4GQ9H 4D2NA 5DC0A 3R1GH 5MEND 3C6SB 1MF2H 4OSUL 2P44B 3OKKA 4K3JH 4LPTA 4M4PA 4PGEA 5HYQB 4EQ3A 1J8KA 4ZAKC 2M1KA 2YKLL 3IDJA 1A3LL 1XGQA 3PV6A 3SJVA 4GMTL 1RZJL 1OT2A 2BZDA 3ROLA 2WUCH 1QRND 2MMXA 4NKIL 4PJGB 4Y4HC 5F72S 2WW8A 1TQCC 3QIWB 3OR7B 5AEAA 1DEEA 4GQ9L 4OD3L 1N0LA 1NBQA 1SQ2N 2J8OA 4WUUE 3R1GL 4KAQL 1MF2L 1NEZA 4MA8L 3U30C 4YHYB 4YXLL 5ALBH 4YHZL 2GTZB 1FFQA 4Z7QE 5J12B 5H35A 3LVEA 3VGDA 1JPGA 1F3RB 4MAYB 4PJBF 5AAWA 5KSBA 4W6YB 3TZVA 3MX0A 4PLOB 3RRQA 4XRCA 1AD0B 1TVBB 3QQ4A 2F74A 3QULA 2AKRB 1EMTH 3SKUD 5F9DC 3PGDB 1I7RB 4ODWB 5KS9A 2CLRA 3TJHC 3OB0K 3MRRB 2KL6A 3GI8L 4FQPA 4UOJA 4QTHB 1RJZB 3PIQA 1Q38A 5ISZD 3GBNL 4P2QB 5T1MB 2FR4B 2Y23A 3GSOA 3MQIA 4UILH 2AV7B 3QXAB 4RMQA 3OHXB 3JWOL 4UAOB 4KPHL 1QBLH 1G84A 5JXAH 1K8IA 4P57A 4L8BB 2G9HA 3LB6C 2ICWJ 4TVPD 3BW9A 3VH8A 1FNEA 1EFXD 1CTNA 3I6LD 2B0SH 3ZE2E 5A2KH 3D2UB 4XCYB 3OX8B 5JLZB 2NY3C 2ZCLH 3VJ6B 2D7TH 3G6JF 5GZOC 3W39A 3HZVB 3FQRB 4JKPH 5EN2A 1XIWD 3BZEA 3OF6A 4UILL 5K9OB 1QSVA 2ZOKB 2BVTA 5I76A 1FORH 4F8TA 1GZPB 2NY1D 1M05B 4PJ8B 5LGJA 5T5NG 1YPZA 2OTWB 3W9EA 3DRTB 4X7DC 3RNKA 4EIZC 1IM3B 4LCCA 3C5ZA 1KYOJ 3ARTA 3GSUA 1MY7A 2A77L 2ZCLL 4JKKA 3D6GA 4OZFG 3DYMA 4L3ED 1FPTH 1X5ZA 4I3GA 4IJ3B 1CGWA 4WRLA 2DQEL 4CW1B 4G42A 4LVNC 4GRLC 3MMEB 3LY6A 1G7QB 1CL7I 4OCSH 4KJWD 3N1PC 5I1LA 3IAGC 3TEUA 1QSEE 2DMBA 3B83A 3FT4A 1YEGL 3SBWA 2FYYB 1S9VB 5C9JB 3W5MA 3VW3L 3M07A 3NAAH 2DM4A 4NQDD 4G8FA 4N5EC 5C2UB 5FUOL 3TCLB 3VXRD 3G9VA 4N0CC 1FPTL 2NY0B 1L6ZA 2XRAH 2YPLA 5CILH 4PJXF 5GRYA 1P6AB 3V6OA 4E9LA 4KKAC 3LN5B 1OGAE 5DS8A 4KROD 3TT1L 4GBXB 1MHEB 1A7PH 2IAMD 5FYLE 2PW1A 3P9MB 3MC0A 3VFTA 1B88A 1MHHB 3CVHL 3N06B 1OAZL 5F6HI 1ITCA 5DA4A 3VXPA 1SMOA 5IIEB 1Z0MA 3T4AB 2BFVH 3NAAL 4P3CL 1BQUA 2XICA 5BXFB 4QHKJ 5EBMA 3VCLB 1ZVSA 4L4TD 3RZCC 4FFZH 4UNUA 3DO3A 4NJAH 2XRAL 2OSLB 5CILL 5HVFB 5E2VL 1ZGLA 2HJKA 3QRFM 4KRPB 2EIZA 3WN5A 3IDYB 3BN3B 2B39A 1A7PL 3VFPA 3ZHLA 1U8PA 5D2NE 5TE4H 4JRWA 1R5WA 1YY8B 4X8JB 4DCQB 3CFKB 2D4FA 3RVWD 3ZKXC 3MLVH 4JFXB 3CFCL 2BFVL 2VDLL 2IPKB 5KZCD 3BDYH 3J7HA 1FG2B 4QCIB 5E95B 5FYKE 5EDXA 1F11A 4I3SH 1UENA 4D3CH 3H9SA 4Z5RA 5KTEH 4JR9H 5I17B 4OLYL 4QOKD 5T3ZE 3L3HB 4LLYB 2GITA 5HHMB 5D1QD 4H20L 4O2EB 3FOLA 3KPLA 1BIIA 4FQ1H 1T5WA 3DGGB 5D93B 1FZOB 1U91A 1ZE3C 3IJHA 4C59B 3D39D 4DN3H 3SKJH 2E8ZA 3MLVL 3PWPA 1MCLA 4JM2B 5FM5M 3U0PB 4HV8B 1KPRA 4J1UA 2FD6H 3EOBB 4HAGA 5KANI 3TIDA 3BDYL 1YN7A 4XMPH 1MHPL 1LP9B 5CEYA 2VXVH 4I3SL 4X99B 4D3CL 4XNYH 3QWRD 1E4WH 5FYKH 2YRLA 4M6ML 2ZUTA 3Q5OA 3WIFA 1KG0A 1IZJA 1BECA 1PYWA 4JPWH 3L9RB 2PW2B 3R8BB 3CMOH 4QO1A 3SDAA 5T3ZH 5DWUL 4PRNA 1RU9L 2QBWA 3ARVA 1CGSH 5FECA 2J5LB 3H9ZA 1OP5H 1KYOK 1B4JH 2V5SA 3RPIA 1HOCA 5CBEB 1X4ZA 5FO7A 3BESR 4XMPL 2O61B 1CDHA 4FQJH 3ARWA 4M62L 3C6LA 1I8MA 1BBJA 2RGSA 4IRSB 5J56B 1U3ZA 3RWFA 4HH9A 4UINH 4Z0XB 3AB0B 3WL9A 5MEOB 4UIMB 3ZKNC 1RI8A 4P99A 3GO1L 1CFVH 1FFPB 5H2BB 3RUGE 2Z8SA 3ARGC 3MV8B 3L7EB 1I3RA 4WWKC 1FFOB 1FZJB 4FQJL 3CVIL 3SDCA 4HHAB 3KHOA 2DQCH 5JHDA 1A1OA 3EIFA 3BE1H 4I5BB 5D2LB 1S5HA 1EHXA 3JWNC 4D0CB 4UINL 3ZKSD 1VESA 2DB8A 2Q6WA 5CZXC 5FYJL 2FJFB 3MBED 1CFVL 2DL9A 1ITBB 3NMEA 3FRUB 4NUGH 3VGFA 2X6MA 1MHCA 3VWJB 1H3PH 5E6YA 4YQXL 5BS0E 4N1CA 3O2WH 3ZT5A 1J05A 2AK4B 3QCUL 3BKJH 4UTBH 4AH2B 4FFVD 3DSNA 3MLSL 5F9WB 4L3CB 4P2OD 1KJ2A 5GIRA 5IFAL 5EBGA 4LLUB 4X5LA 4PJ9A 5B8CA 4LPYA 3BI9X 1E4XL 4NUGL 5AUMA 1RJYB 2FO4B 1JE6A 5C2BH 4HXAH 1DQJA 4NQCD 4E0RA 3QFDB 1H3PL 5D7KD 1JGUH 2NX5E 2QADB 5GRXG 2P5EB 4PJ5B 3W2DH 4XCCL 3UJTH 2F53D 4JFFD 4UTBL 1GZQB 4GMSH 5E94B 3OAZK 3C09B 2DWEB 4JLRA 3BPCB 4GAFB 1CZ8L 5GGRA 4KQ4H 2UYLA 1CR9H 1JNNH 5L8JB 1PQZA 1F58H 4WFHD 4OGXL 25C8H 2EDQA 3FFCB 5I1DB 3I6GB 3W0WD 2CD0A 1ONQB 3LAFA 3K4AA 1REIA 2WP3O 4CVXA 4MD5B 3MV9A 1WBYA 3GSWB 3KXFA 2D7QA 3W2DL 1HE7A 1CVRA 3UJTL 2J7LA 2UWEB 1SJEA 2VUYA 2VDRH 1J0IA 1INQB 2DRUA 4YR6A 4L1HA 4LHUD 4O58L 3HG1B 5CJOH 1NGWA 2F19H 3O4OC 4NPYA 3LPGA 1C5CL 1BQLL 1CR9L 1DQDH 3P30H 1WAAF 4JQVA 4NM8H 1QSFD 2H45A 3AREC 5GPRA 3H3PH 4L5FH 3UDWA 4Z77B 3R4DA 2EECA 2Y07H 5I1AA 25C8L 2OI9B 3V5HA 3P11L 4LRIC 4G8GA 5DJZB 4NN5C 4ZDHB 1NC4A 3OSKA 3CVHB 3QAZC 4WW2C 4NNYA 1V5JA 3KYOA 2VDRL 4NKMB 4P5TC 3X13A 4Q9BA 4MCZB 3RL1A 5GJSL 4Q74A 3AGVA 4ZYKB 1FC2D 1XR8A 4EDXB 3HUJF 4LU5H 2I60H 3FO1B 3WFBH 3GBMH 1DQDL 3P30L 3NGBB 4Q0XH 2DLFH 1ZA6B 5E6ZA 5C3TA 1VFBA 4NM8L 1CQKA 2BY3A 1U58A 4U1MB 2BRQA 4HJGB 2CIKA 2BVEA 5I75B 2A38A 1QR4A 4U0RC 3LIZL 3QG7L 4K3GA 4HMCA 4C54A 1TJHH 1UXSA 1R6VA 4J3XA 3DVFA 4IRJA 1KCRH 4WW1A 1HZHH 3CSYB 3G5YB 5D1ZB 3TBTA 4CBPA 3VMOA 1TQBC 1AHWC 2VDNH 2HG5B 4LU5L 4YHIA 3BHBA 1BFOB 2AJUL 2I9LB 2YC1B 1HYSC 1MVUB 4PGCA 4Q0XL 1YN6B 5DI8B 2H1PH 3ECBA 4LIQL 1A47A 1IC7H 4PRPA 5EPMB 3VXNA 2EDHA 3VGAC 5HHXH 5HDOA 3PL6D 2YD4A 1DBBL 3MUY1 2DDQL 2UVEA 2VKXA 4OGZA 2VZOA 3E2HC 1XF4B 2B1HH 3O6FD 5E5MB 3PWUA 2VDNL 3HNVH 1A7OH 3QFJE 3G6DH 2BSSA 1LWRA 1YY9C 1TJGH 1L9NA 5JO5A 3JUZA 2H1PL 4CVZB 3WCYA 1BVKA 4P48A 2EDXA 1MH5A 2WLZA 3MO1A 1QVOA 3B3IA 4OF0A 4Y4FA 3ORJA 2R15A 3S5LB 3MRDA 3FCTA 4GW4A 4YPGA 5MEPA 3QYCA 1A1MB 2XACC 5TFSH 2Q7YA 1RZKC 2C5DC 4N0UA 1UQSA 4OZGA 4QRPD 2VC2H 2Y5EA 3OKKB 3HNVL 4PGEB 2VN7A 4CU6A 3BPLC 3QPQC 1O5DT 1TJGL 1P84J 4P2RD 3IDJB 4I1NB 4KI5E 1XGQB 3SJVB 1MCPL 43CAA 3ROLB 2BVQA 3VFMA 2FB4L 3WXVH 5JTWA 3OKMA 4YFLI 4PJHE 5HYJA 5C0CA 1FNGA 5CD5D 2HLFD 4ELME 1JJUA 4HUVA 4P9HH 4F7MB 4RGNC 1CICA 4EKXA 5L2KA 1AD9A 1X5FA 4FQ2H 3JV4A 4DEPC 2BSTA 4XVUD 3PDGA 2VC2L 3BP5A 3V5KA 1EA9C 2OL3A 4XXCA 3MGTA 4LK4A 5H35B 4LPWA 4RRPA 3IJYB 1WISA 1OM3L 5D8JL 4JRXE 4JO2L 3HE6D 1JPGB 1T3FA 2B1AH 4Q9QL 2GTWB 2WQ8A 1TNNA 4LARH 3QQNA 3TZVB 3WXVL 5IBUB 3QUYD 4LASL 4XRCB 1NPUA 1KJ3H 1DE4A 4LKCA 3QQ4B 2F74B 3QULB 4HC1A 1CFNA 3O8XD 4HGKC 4GH7B 4KKLD 2CLRB 1FVDA 3F6LA 5F1KC 5GHWH 1MCBA 1KGCD 4DGVH 3W11D 4MDIB 2D7OA 1CDBA 3GSOB 3QZWA 1ETZB 2P46B 2R23A 4MNQD 3TJEL 1WIUA 3KPMB 1K8IB 1HKLL 4DQOH 1A6WL 4C83A 5CEZE 2G9HB 3VH8B 2Z9TA 3BW9B 4JRYD 1FNEB 1OAYL 3IDNB 4XT1C 1KJ3L 2GEEA 3WUWG 2PTTA 4U3CA 4R0LC 1KJ2L 3OBAA 3UEZA 4DGVL 5DVOA 3ZDXE 5GHWL 1JYVA 4Z9KB 1N26A 5IHUH 3SGDH 2J4WL 5GGRY 3W39B 5I1JL 3O11A 3DUUA 3IVKB 4JKWA 5EN2B 3BZEB 2ZG2A 5EZIH 2CSPA 3WDIA 5HD8D 1IKNC 3IFLH 2YRPA 3V0WH 3HC4H 4H1LH 2Q3AA 2FL5B 1MIEL 1TZIA 3TP4A 1I1AD 2WWMD 3P73A 4DQOL 4Z7NF 2IPUG 4ZAKA 4PJFA 4J4PD 3IXTA 3ULVD 1YPZB 3W9EB 4MA1B 1J10A 4HPOH 5F6HJ 3RNKB 1CDUA 5I30H 3GK8H 5CEZH 5DJDA 4FMFA 5ALCL 5DK0A 4NZJA 3MBXH 3GSUB