4QKXB

Structure of beta2 adrenoceptor bound to a covalent agonist and an engineered nanobody
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGSIFALNIMGWYRQAPGKQRELVAAIHSGGTTNYANSVKGRFTISRDNAANTVYLQMNSLKPEDTAVYYCNVKDFGAIIYDYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Covalent agonists for studying G protein-coupled receptor activation.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Membrane protein/immune system
molecule keywords Beta-2 adrenergic receptor
total genus 28
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2014-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qkxB00
4MVBD 1AJ7L 3MLSH 5ABDE 4NUGL 1Q9WB 5C0GB 4G6JL 4Z76A 4N0FB 4ZODA 3HMXH 4OM1H 2QQLH 1NC2D 4U3CA 4I13B 3JTTB 4HIEB 3HZVB 2DQEL 4Z7VF 1MI5B 1T4KB 3MNVA 5ANMA 4PJDE 3JVGC 4F7PB 2A77H 4YJZL 2AQ2A 2OBGA 1UXWA 1MCBA 3FAWA 5BQ7A 1T22A 3ZDYF 4YUEH 1J0IA 2H26B 1V3KA 4S0TD 3GIZH 2D4FA 4JM2F 1AO7B 4APQB 1CT8A 2PYEE 4XB7A 3IFNH 5LCVH 5KS9A 1QD0A 1WIPA 1HILA 4K2UH 2R69L 4YBLC 1IM3A 5E08L 1ZLVH 4Q9RH 3O11A 4UDTB 4KROB 4IOIB 3D69A 3JVGA 3LDBC 1R3IH 4FNLL 1OTUC 4PJDA 3ILQC 4XPFL 5CZKA 3GHBH 1NFIB 3T08A 4AQOA 2VDML 3UTPD 4NWTH 4LPWA 1G0XA 4JLRB 2F19L 4FFVC 4YWGL 4P4KD 3IFLH 2DQDL 5ADOH 2XTJB 3LKQA 2C1OA 2CK0H 3BRDA 4WNQB 1MPAH 3IYLW 4ZFZA 1KIUA 1S78D 3EYQC 1J05B 4ZG1A 2YD7A 3OB0K 4RMSA 2VXUL 3LEVH 4ODWA 3S97C 4ODHH 2AEQH 5D6DA 2FJFB 1SY6H 5IQ9A 3GMQA 4S1DD 4P2RA 4B41A 4YO0B 4RFOH 2L4OA 3HC3L 1DQLL 4D0BA 4OZGB 2IADB 2VAAB 2XKUA 1A9EA 2NY1D 2AV7A 4NRXB 4ESKA 4RFNC 2ZG1A 1MY5A 4P9HL 4WWKD 1X5LA 2A9MH 2LQRA 4LDLB 5HYJA 3OGOE 5AYQA 2IMNA 2Q76A 1GZQA 5HI3C 3O4LE 3H9SA 2R56L 3T3ME 5HY9A 2R1WB 3OAYH 2J4WH 2YZ1A 4M3JA 1YYML 4V1DD 3OJDA 2NY2B 5ALBH 4PJEA 2BY0A 4JM2B 4JPKH 3H3PH 3SDAD 2HLFC 4MX7B 1Q72H 4Y4HD 1HN1A 4QRUA 1T66C 1FCGA 1MEXH 3DBXB 4XAKE 4G8EB 4MAYA 1VGKA 3TO2A 2CJUL 4JDVB 3C6LB 5ID0A 4XXCC 1U8NB 2BNQA 4U6VH 2BY2A 5I1LA 4NN5C 3P0VL 2DTMH 2XN9B 4Z76B 1IVLA 1XGQA 2H32A 5I1IH 2EH8H 1WZ1L 4YGAB 1W72A 4APQC 1G7HB 3QIWA 5F9AC 3QHTC 2OQJA 1T0MA 4Y0GA 3VCLA 2ORBH 2E9JA 4YHML 2XKNB 3BXNB 3U7WH 3O8XC 3VXRA 3TN0B 4BZ2L 5CJXA 1HXYB 3U30B 4O4YL 3MV11 1UWEL 5IP4A 4XH2B 4L3EA 2QSCH 2CRMA 4XNMB 1MCQA 5I71B 4KJWC 1YPZF 1FORL 3FN0H 4HIIB 1MFAH 2I9LA 1QBML 1A7RL 1U95B 2PTUA 2XPGA 5SX4H 3HG1A 5JOFA 3MNZA 4B53A 1G7QA 4X99B 2Q20A 5HYSB 4QHNA 1MCIA 3ARDB 3P73A 2CR6A 3IETB 5HHPB 1YQ2A 3QCTL 2EE2A 1KIQA 3RHWF 2R39A 3QYCA 3GJFA 1I7RA 1JIBA 1KF9B 4ZFGH 4JZNA 4CMMB 4ALAL 2BCKB 1MCPH 4JFDB 5I9QB 1MFDL 4L9LC 3BPNB 4YXLL 3MBED 4LSRH 4MB3A 1DQML 4AEHL 4KTDL 4R8WH 3TM6A 4F7MA 1NLBH 2GKIA 2VH5H 3TJEH 3H7BB 4KI5F 4H0GA 1EBAA 4GRLD 4Y4KD 4YC2C 2B39A 3UYRL 4PPTA 5E8PB 4PV9A 2DIJA 4RCAA 3U9UB 4PY7A 5L0QB 1EBPA 1TJHH 2ICWA 3N50A 3BIAX 3V0VB 1DCLA 5DJ2B 3CFIC 1B4JL 3GMPA 4NJAH 3EOYG 5BV7C 5DWUH 2HWZL 1MHPH 5K59F 5D6CA 2NY1B 4P23D 1H15A 4PD4K 4R2GD 3BH9A 1AE6L 4LQ1A 3BW9A 4K8RD 4D9RE 3L3GB 5GRUH 2C26A 3CVHH 4JDTH 3C5ZD 3CPLB 3PWUB 1BAFL 3SKJH 1TZIB 2PXYA 2LU3A 2BNUB 1V8HA 1NBZA 1QPXA 4LEXL 5HPOA 1F58H 3QUKA 2NY0D 4V2CB 1ZLWH 2NY1C 2VQ1B 1N2RB 4KRPB 4UUJB 3BAEH 1UM4L 2BMKA 2ICEA 4M93C 4WCYH 4C59B 1EUTA 5FB8B 3MREA 3W0WE 2WLZA 5IFJA 3G6JE 5F8RC 1TVBA 3CSBA 5E4IA 3R0NA 3RVUC 4JFPB 1BBJB 1CLZL 2FD6H 2B2XH 3O4OC 2VXSL 3DX9B 4MLSA 1MLCA 4HW6A 5HHQA 5EC2B 2ZOKB 5DK0A 2F5BH 4I0PB 5FKAA 3LS4L 4FFVD 4AJ0A 1R5VA 2KPNA 4L4TA 4A6YB 5IFHH 3PWPD 1FNLA 1QSEE 1KJVB 2DICA 3V7AE 1YNTB 2IEPA 4JAMB 4K9EL 4RDQF 3T8XA 4K07A 1EMTL 2R2HB 3BISA 3CLEL 5BZWA 5E6IA 2DQTL 1V5JA 1I8IB 3VA2C 1IQDB 1CLZH 5C9JA 2R2HA 3TYFA 2Z9TA 4IRJB 3BDBA 4JVWA 4LOUC 1BD2D 4DKDC 2YUWA 1TITA 1UZ6F 1CGWA 5IVOA 1VFAA 1HOCB 4YPGB 2FHCA 1FNEA 3AREA 4XWGL 4E41E 2JJSC 4NSKB 2I07B 4I18A 5CMAA 5EIVA 1PBYA 3HA0A 4S1SL 4KK9C 3VXPA 2R0ZH 2I07A 5CMAB 1KJ3H 3S3PA 1W2KT 3RU8H 2AJZA 1KULA 1T6WA 2DQJH 5F3BB 4QTIL 1RAMA 1J0YA 2Z31D 3QA3B 4CRPA 3CUPB 4JPVL 3MXVL 2R0KL 4YBQC 5DVOA 4G6MH 1VACA 4OFYD 4FTVE 4KJQC 4YHYB 4X6BB 3H9SE 2WP3O 3WIHH 1GZPA 3CXDL 4RMQA 4LFHG 2VZOA 4JR9L 2IJ0C 4X5LA 2H3NA 2VXSH 5CKGA 5GSRA 3BGFB 1R0AH 3EOAB 5F9WB 2H3NB 5GSRB 1IGCH 4OIIL 4WHTA 4XNYL 3O9WB 4GKSA 3DX8B 3T4YB 4XHJC 3SGEI 5BS0E 5KSAC 4UDTA 3VFMB 1MVUB 2NX5E 3Q3GB 3RWFA 4BQ6A 2EH7H 3H0TA 5D1ZC 2Q86A 4XBGA 3U36A 2RFXA 1EAPB 2XA8H 3OAZK 5J1AA 1VESA 3G5ZB 3PF2A 1SYVB 1IARB 4JKMA 1HEZB 4OD2A 5E2VH 5B39B 3U4AA 5ID1A 2DLIA 2A6JA 3K7UA 3HZKA 3WXWH 3EZ8A 2FZ3B 3QISA 4LLQA 3RWEA 3TIDA 1IGJB 2CIKA 3HFMH 1T04A 4HCRH 2W0PA 4XMPH 3GSOA 4FFZL 4OZHA 5DK3A 3EIFA 4PLKC 4K8RL 1WIUA 4W6WB 4LSUH 4HKXB 5FM4A 4WUUB 3DMMB 2HFTA 5ETUB 3MO1B 4QTHA 2YC1A 5ESAA 1F90L 3Q6FA 4WTZA 3S7GA 3PIQA 4QTHB 4TPRH 4HJGB 3T4AA 2EE6A 4JRXE 3OPZL 2PXYC 3CVHB 1EHXA 4OZ4A 2ZUTA 2VAJA 4J12A 4R7DB 4RBPH 1F2QA 2NTSP 3E6FB 4FQ1H 3UTZA 3EJZC 2R2EB 2AP2A 4KFZC 2OM5A 2AQ1A 1OAYH 3QUMB 1Q1JL 3ES6B 4OGZA 3HB3C 3ILPA 1PYWB 5JXEC 2HVKA 2XICA 1QOKA 4QXUL 3H42H 4TSAH 4EOWH 4QY8B 1MCWW 1WBYB 4KK9D 1JGVL 3NZHH 3VFRB 3VA6A 4MMZC 3D18B 4MD4B 1PD6A 3CXDH 2BNQB 4JRXA 3F12A 4M7LT 3RNKA 4LBEA 3GSWA 1ODAA 5IOPB 2XRAL 1UJTA 4KI5D 4R4FH 4CVUA 2L7UA 3NCEB 3QNZB 3TLRA 1QBLL 2Z93B 4M4RA 1A4KA 3LHPL 4O2CA 4J3TA 4H1LG 3OZ9H 4KI1A 3BP5B 5ANMB 3NN8B 2RHEA 2VRAA 2DYPD 4HWBL 3QXUA 3LRGA 4HSQA 5TPWH 1QRNB 2PO6A 1FNHA 4PJBA 1HSAA 4XX1G 2EC8A 3VD7A 3ZKXB 4CDHA 4GKNA 2BNQD 2APBA 2YKLH 2F74B 2JJWA 1BOGB 3T09A 5I19L 1A0QL 4HFUL 5AYUH 1IGMH 1RVFL 1ZMYA 4QYOB 1E4XL 1YYLH 1LK3L 2YUZA 4NRZB 4JPKL 3SKJL 3TO4B 3MTRA 5C0JB 3P73B 4NQCE 4HUUA 3GHEL 2KH2B 2WK2A 1PKQA 3DX6B 1UWEH 2CKBH 2OJZH 1A22B 4JZNB 1ITCA 4PP1C 3UPCA 4Q6IB 2E9BA 4LMQE 1HH9A 2J2ZA 2PO6C 3GSXA 4UILL 4ODTL 2VSDA 2VSCA 5CZXD 3RZWA 4OFKA 4HGWB 1XGTB 3B9VA 2IMMA 3RVWC 2OSLB 4UZGA 5IROC 3EFDL 1YDPA 2ZUQB 3NAAH 5TQ0H 1C16B 1INQA 1DN0B 1JF1B 5DFWH 1E4JA 4XPAH 1A6UH 1HINL 1KPUB 3OAUH 4NRYB 3GRWA 3R8QA 2NMSA 2G5BB 4KJPD 1RQ5A 3CFKB 5SV4A 2NXZB 4GQ9L 1FN4A 3MRJB 3H9YA 1ZLSH 4HPOH 2ESVD 1P7KA 4Z7WA 2B0SH 3CU1A 4QRPD 1NFDB 4Z95H 1G9MH 4R3SA 2ZUQC 3V6ZB 1Z3GH 2WP3T 3O2WH 7FABH 2FH8A 15C8H 2E7MA 2DQDH 2FJGB 3Q6FB 1T20B 4XI5D 5ADOL 4O2FA 5I1EL 4ZUWB 3KLDA 1LE9B 1U3JA 4D0CA 1N2RA 1UCBL 2P8PA 3P30H 3RJQB 3P0GB 2OJEB 1WVZA 2H41A 5FGSA 4ODBD 4ZFOL 4M7JH 3OX8A 3UTZB 2FBJL 1DTUA 1PKQE 2X4NA 1XCQB 3R4DA 2OK0H 1JPFA 4QRUB 3IFNL 2VLKE 1JPFB 3LD8B 4HZLA 2BDNL 4H1LB 3CX5J 3IKKA 4KPHH 5F96H 3OKLA 3WS3B 5ICYA 1CFNA 4BQ9A 3VXTB 1SBBA 4DKAA 5IWLC 2C3VA 2P7TA 3T65A 5D1QB 3QCTH 2YXMA 5F7EH 5JO5A 1OWRM 3D0LB 3WNKA 1MPAL 1ZWIB 1T0NA 2YD3A 2ZOLB 3HPLA 4JFFA 4OAWB 4P5TD 5E7FA 4NHCH 3TN0A 1Q9LB 4PJIE 4YO0A 3DIFB 1J1OH 4XCFL 5AG8A 2GJ6A 2VZTA 2WM0A 5FUZH 2C3XA 3WIIH 1HH6B 1WAAE 4DVBA 3RNQA 1ULVA 2VZSA 1K8IA 4KDWA 1JUFB 2I26N 1A1MB 4L9LA 3QDGD 3KJ4C 2YBRA 1OM3L 3OR6A 2P43B 4XNMA 1VADA 3GBLA 3FQXB 4MCYB 4ODSH 3OR6B 5E5MB 4M48L 1U95A 1ZA3A 2XPGB 3TV3L 1CD9B 2JIXD 3PGCB 4X8XA 1MNUL 2D31B 3RY5A 1LEGB 4BSWA 3MRRB 3ESVF 1CXKA 3SDAA 3VFOB 2XZQH 3DYMA 5D7JB 3INUL 2ADJA 1FHGA 1RIVH 4X4YA 3RIFK 2C1PB 1Y0LB 4YHOL 2VR5A 3T2PA 3MC0A 2DKUA 1HIMH 1KC5L 2B1AL 2C1OB 1GSMA 2VDLL 5HYJD 5D7KD 3C09B 1ZGLA 3IVKA 5E9DE 5EPMA 4RFNB 5E94A 4G6ML 2D0HA 1N5YL 3H9ZA 5GJSH 5SWZA 3U7YH 4GRWH 5FYKH 4HEME 4L4JA 3V6FA 1CS6A 4OLUL 5DHYB 4N0FA 3LEXB 4FFWD 1TZIA 2VISB 2NY6B 3IF1A 3OKYA 3OKMA 1N6VA 3BXNA 1IGFH 2BZDA 4HIEA 4PJGB 1X5KA 1EAJA 2GAZB 2HG5B 2OTWB 4ZXBC 5IIEB 4S1QH 3D6GA 4OZFA 2C7UB 4POZC 4XZUB 1NBZB 3IDIB 4Q2ZB 1FO0B 1KCSH 5HYJB 2WW8A 3WIFB 4OF5A 2OYPA 3NBNA 5IB2B 2RR3A 2NY6C 2E27L 1FZOB 4JFQB 1UFUA 4YR6B 3ZTNH 1YEJH 3LVEA 4Z7UA 4YHIB 3D2UD 5KJRL 3NCCB 3D0VB 4TVSa 4PGDB 3FT3A 1DBBH 1FCCA 5I15H 1A02N 1YNKL 5ETUA 4JQXA 4HKZA 3I3BA 4ZQKB 2GYSA 5HPMA 3LRSA 2X1QA 2AJUH 2K7PA 1G1YA 4N8CL 1OP9A 1QSZA 4LIQL 1AGEB 1JWSB 1LO2L 3RAJL 2OR9H 3DX7A 3JV6A 5J9PB 1G7PB 1EHLL 3BD3A 2XXMB 4I77L 4NM8H 1ZEAH 2J1KA 5DD3L 1YY9D 4GAJH 3OKDB 1ERNA 4JO4H 4XAWH 8CGTA 3GMPB 3RWIA 1NCNA 1X5HA 5EU6D 5DURD 1BMGA 4AEFA 1UXSB 3WFDL 4AMKL 4JFZL 1RK1A 2GCYB 4X80H 1JFQH 4DN3H 4NQEB 3GMQB 3QP3A 3G6AB 5CD3A 3UTSD 1I1YA 1BFVH 4ZS6D 1WITA 2NR6D 3ZYOA 2Q8BH 1RJLA 1V7MH 4WI5A 1CVSC 3ZT6A 4GRMA 1X4XA 3ULVL 1BJ1J 1RZIB 3JXAA 1HYRC 3GRWL 4DN4L 3IU4H 2H9GB 5HYJE 4P2QD 4AIZB 5K9QI 3SGDI 1TQBB 1P7HL 3VXOA 4NHUA 5KVEL 4KRPD 4TRPL 1BFOB 5JUEL 4P5KA 4NFDA 5B4MD 1K3ZA 2KBGA 2Y5EA 4E0RA 3NA4A 2BCKA 4JFDA 4MA1C 5JLZA 1OP3K 4JM4H 4HH9B 2ITDA 3DETC 4L4TE 1JZ4A 2Y9RT 1NCBH 4NNYA 5IBLD 3A6BH 1WCBA 1OARL 4LP5A 4NOBA 4OJFH 1TPXC 2HTLC 3VDAA 3FHQA 1VFOA 3DHJA 3MRIA 5DJAB 5I6XB 5L2JB 2CJUH 1RUMH 1NUFA 4O5LL 5JR1L 4MS8D 4PP2B 4RMTA 4WU7A 3ARSA 5M7QA 3E8UL 2ZP0T 4JEGB 4XCNB 4K8RC 1C7TA 4JFYB 4XPTH 1U8LA 4Y2DA 4YX2H 3UCRA 1DFBH 1I1CA 4ORZC 4WWKB 2V5YA 3GIVB 2F53A 2HJLB 4XP9H 3QDJA 1OW0A 3GSNB 5KZCD 5I1DB 4YHZH 2WIIA 4X9BA 2FIKA 1K8DB 2APTA 3KG5A 3Q6GL 4JY6A 4Q9RL 2CSPA 4HS3A 5JA8B 3U7WL 4PJIA 2FEDC 1DVFC 2YSSB 3V0WL 5BS0B 1I3UA 3MBEC 3LY6A 4FQHA 3K2MC 3NACL 3KPNB 1ITBB 3VFTB 4QHUB 2X4UA 4KKBC 3SKNA 1C5BH 1JYXA 1I7UA 5I1CH 1XEDA 3GSRA 4NO5B 4GAGH 3FN9A 3LKOA 3IDJA 3L3OB 3VMNA 1U58B 3UTOA 4Z0XB 2DLHA 4GRLB 3I9GH 3CX2A 5D1ZB 1ZT4A 2OMBA 2VDOH 5IV2B 3O9WD 4XPTL 3D3VE 5EZOL 4KMTH 1IGYB 4JFXB 2AJSH 4KK5D 1YJDL 4NO3A 3T04D 1FGVH 1LO3H 3CIQA 3VXRE 5D2LB 4GRWB 5I71C 3N9GH 3S98A 2YPLD 5HGBA 3VFVA 3N1FC 2ZG3A 3ZDZF 4HLZH 5HGBB 1FVEB 3JWDL 1JPGA 1MI5D 5I74C 4G80A 2E9IA 4NO2B 5E6ID 4XTRD 3BH9B 2P45B 2UWEB 5I0ZA 5J4MA 5SX5H 2IQAA 4JQXC 4XPBL 4YBHA 2FBOJ 1T1XA 5IHZA 4GT7A 3MLXH 2VWEE 5EWIL 3PL6D 4NUJA 4R4BA 3SQBA 5AD0A 3UDWA 4FZ8H 4MJ6A 3FO9A 4UV7H 2X9XA 4KDTA 1U91B 3U0PA 4NHCL 4PJ9A 1IAOA 4RNRA 2YD5A 5GS0C 4OCXH 1F11B 4NC2B 5D7IA 2CDFA 3QUXD 4L8SA 2JK5A 3B9DA 3NIGE 3SDDC 5IM7B 5FIEA 4HQQH 3CUPA 5D7SH 2X70A 5KSBB 4F7CB 5KSUB 5ITFB 4XCCH 4ZUVB 3R1GH 2YWZA 2YC1B 5K9QG 3TO4C 1UZ8A 3GEWB 1PAMA 4MD0B 4MMXC 1FAIH 3BPLB 3I3EA 3QUZB 2N1KA 3ZL4H 2J8UA 5IHLB 3BEVB 1NDGA 3KPPB 5HI5D 3LOWA 1CDUA 1S7VB 2VLMD 2J8UB 1WWBX 4FXLA 4MCYA 5FO7B 1S7RA 1IM3B 3GHBL 3QR2A 3REVB 2X4RB 3CU7A 1I85C 4QXTA 5I0DA 1NCDL 4P46C 4Q6IA 3Q6GH 3WFCL 5D4QA 5B8CA 1D5IH 5K9JH 5BMFL 5DJ6A 4Z6AT 3QXTA 2KUTA 1A1NA 2AXHA 3KPRE 4C56E 3TYFB 1PDKA 5L2KA 1L6ZA 5I16B 1VERA 3O4OB 5F6IC 3CFEA 3TJHD 2GK0B 3NFNA 1IGML 4U1NA 3CVIL 3GSNA 2V2XA 3QRGL 1CXFA 1FAIL 3S4SB 1UKSA 1YMME 4LSPH 1T7YA 5AAMA 5DHXB 1N5AB 4X6EA 4MNGB 4GRWE 2E8YA 2GITB 2HJFA 4JPIA 4IHOA 5TE6L 1LO5A 3ULVF 3QJFB 4J1UB 4PBXA 3QNYB 4QF1B 5EOCL 3QNZA 5HVGB 1QYGH 4BFIB 2OL3A 1N26A 2Y7QB 5GSVB 1G9NC 3OTTA 1OB1B 4OCSH 1Q9OA 1N8ZB 1MIMH 5IB1A 3QQ9C 5DD3H 4F80A 1KTKE 3QDGE 4OZFH 5GS1A 3NACH 3ZSTA 4R3SB 1T22B 3CD4A 3SE4C 3FJTA 5CINH 1FIEA 3FOMB 4XGZB 3KPLA 2VO5A 3H9SB 2GJ6D 2A1WL 5CBEA 5EC1A 5FO8B 1N6QH 4M43H 4OCYH 4EI5C 1MWAA 1OTTD 4PJ7B 4OLZL 3N0PB 3I6KA 1FZJB 3MRHB 1KPRA 3UZEA 4XVUD 1PLGL 3TYGH 3HR5B 5I76B 2PW1B 3ULVH 3DVNB 1J1OL 2D0GA 1ED3B 4MA8H 4NKOB 5EOQL 1HWGB 1R3LB 3AAZB 5EU6E 4AT6A 1A7OL 5CGYC 5TE7H 1BEYL 1CDBA 4ODXB 1WBYA 1T89A 1ZS8A 1W72H 3TZVA 3RWCA 2VE6B 4WY7H 3ARYA 2XN9D 1IEHA 3FMGL 1INDL 1B3JA 2Y1VA 1O7VA 2X4QB 4HFWB 2CK2A 1S8DA 1UYWH 2VTFA 1MNUH 1SYVA 4ZAKC 3MXWL 4P46D 3CFKA 4PBWD 4MJ4A 3UXFA 3WD5L 1EZVY 1T0NB 3IKCB 3MJ9L 1TJIL 5CJOH 4PJBF 1NAKL 3BN3B 5EBWA 3C5SB 5TJWK 4ZUVA 4KVCL 1ZVHA 2FJGA 2VLJD 3DMMA 4LASH 4PR5A 5FUZL 1NLDL 2UZXB 4YIQA 3IJHB 4GXVH 3MNZB 1J0ZA 1NCTA 3L1OL 3EOTL 2AJXH 1M7DA 5E2TL 1JV5B 1XGRA 1RZGA 4QWWC 4JFHD 4XP6L 3ROOA 1M7DB 3RTQC 3K81A 1RZ7H 1DBKH 2BVOA 4Q97A 1EK3A 2DAVA 2P42B 3H2WA 5L6YH 3CLFH 1DBJH 1P53A 5D7LE 3VFUB 1T1WB 1SY6A 4HGWA 4PV9B 2FX9L 3KPSD 4X7SH 3ARBC 3IVKB 4N68A 1GL4B 1MJ7H 4UT9L 4QHKJ 1N64H 3KPOB 2ADIA 3HCVA 4XCEA 4U33A 3MRNA 1N5YH 5GGVY 1HI6B 5BRZB 4C58B 1QFWH 3BRGC 3QZWG 1WBXA 4GO6B 1T21A 5IQ9B 1FVCB 4QWWD 5TGBB 3D9AH 5T1DH 5B8CC 1L0QA 2O61B 2BSSB 2D0FA 3TT3H 4QKXB 5DJZB 4P3CL 4NKDB 3RNQB 2QEJA 1NGQH 1B0GB 1W8OA 4M6OH 1FZMB 3QJHA 3PL6C 4PB0L 4PGZA 3GJFK 5I8CA 2I5YH 5JR1H 4PJBE 4D9QE 5BV7H 1H0DA 2W0FA 1LHZA 3JV4A 5C07E 4Q2ZA 4ORGB 4XTRC 1NCAH 5C1MB 3QCUH 4OUOA 3PABB 4YDVA 3HLAB 3MUZ1 3QIUA 1AD9B 3PL6B 5D5MF 5LBSL 3QULA 4PJHF 3EDEA 5MEND 1T1ZA 2CRIA 5DMYA 2ADGB 5F21B 2VDNL 4EZMA 1WIOA 1D3CA 4PJ7F 4ZFFB 2P5EB 3SDXE 4KTEH 3HFML 5IG7B 3CH1A 5SX5K 1QA9A 1ZT1A 3T8XB 3UC0L 1AGDA 1W0WA 1IJ9A 1KEGL 2DM7A 4RAUB 4YHOH 4YDLB 4YZFE 1CK0L 4YXHL 4FABH 2Z31B 2HKFL 1U3ZA 2H8PB 5CBAA 5JW4M 4M7KL 2GCYA 2YXFA 4UQ2B 5DHYA 4NQTA 3P0YH 4BH8A 3MV8D 4KKBD 1GRWA 2EIDA 5DRZA 1FRGH 4HKJA 5KOVC 3RFZC 5I8EA 4LRIA 4HX1B 4XWGH 4GW4A 3S96B 1V05A 2W65A 5E1HB 4NIKB 1RJLB 1NC2B 3MFGB 4DGYH 3U46A 5T3XE 1XF3A 2AAVA 1Q0XL 4HK0A 1EIBA 3SDXA 4TULH 1F2XK 2VDRH 1OM3H 5FV2A 3KPRA 4C56A 2YD6A 4YDJA 4AH2A 1MFEH 3C08L 4D0CB 4FQIL 4M6ML 4NQSB 5D6DC 5EUKA 1QSFA 4KMLB 3RGHA 4GRWF 2OR8A 3BHBA 3ZYJA 4WFEE 1UCBH 2QHRH 1JTOA 4N1EA 4X6BA 5E8OA 5D71L 4F15B 3HR6A 1MFNA 1NEZA 2EYRA 4J4PA 4RZCA 4PJEB 4I5BB 3RWDB 4U1HA 3GI9L 3ET9F 3VH8A 2X5PA 4JRYD 3E3QC 2HT2C 1IZKA 3H42L 5FKAB 2VR4A 4N0YL 3MCG1 1P4LB 3TNNB 5DMGC 2HRPH 4WI4A 1H5BA 1PZ5B 2IBGA 1BD2E 1NUNB 4RWHA 1VCAA 3G08B 4UBDD 4BZYA 2F8VA 2P24A 3BESR 3NAAL 1U8KB 1RHHB 1DBAL 2ZSVA 5IESH 1WF5A 1DVFB 5BVPH 3DUSB 2IWGA 3UEZA 3TBWA 3GSNL 4XXCA 1FDLH 1T0MB 1U3HA 2E7LC 1KENH 2DD8H 3P0YL 3NIFE 3DIFA 3DVGB 3UTSA 1U8LB 5LGHH 3IXAA 2VLKA 5C6TH 5GZOC 3SPVA 2JCCB 5L0QC 3O6FB 1KACB 4JN1L 4FXGB 1LD9A 4KKLD 1YNLL 4U3HA 5HYQA 1G7QB 1Z9SA 5DO2D 4Y8DC 3O6FA 1MQKH 4PRIE 3RWHA 4KVCH 2EDEA 5ALCL 2DL2A 2GT9A 5TF0A 2LVCA 5DGRA 3LKNB 3ZLQC 3DSNA 3TFKD 2X2YA 3PABA 4FTVA 4HJ0C 5DK2B 3Q1SL 4Z7QF 5F97E 1WZ1H 3SJVB 3GSRB 1ZT7A 4NO5A 1U42A 3DRQA 3MX0A 5JOEA 4WHYH 1FFQA 1HHGB 3WLWC 3B43A 4Z7VB 2J88H 3EJYC 3LQMA 4MJ5A 1M1SA 1NMBH 1BD2A 5IG7A 1QBLH 3OV6A 2X1OA 5KTEL 3GI8L 5A2FA 1IBGH 4BQBA 4WHYG 4F58H 4LLDB 1FG2A 1EGJL 4QY8A 1BVKA 2CIIA 2JKXA 5BVJA 1TZHA 3V2AR 1EFXA 4JANA 5IFAL 4P2RB 1G9EA 1CK0H 3UTSE 3G5XB 1JPTH 4UNVA 3BUYA 5IFAH 2MWCA 3DV6B 3WIHA 1YEKH 1I8MA 4JHAL 2PXYB 1X5AA 4J7RA 3FONB 5D7LA 5ADPL 4MJID 3WE6A 1P4BL 4YK4C 4I0PD 1Z5LB 3VD4A 1ZLSL 1QFHA 1YEEL 5SWZD 5KSUA 5FB8A 3B4NA 3ZHDA 2OTUA 3FO1A 4ZNEE 4Z7UF 1FVDB 2BC4B 1HSAB 2VDRL 2FCBA 1P1ZB 3CZJA 4HKXA 3OPZH 4XX1E 1FLRH 3W0WA 4F7EA 4GG8B 5BJTB 3F5WA 5DUML 3FT3B 4U6VL 3IFOB 3QQNA 4H88H 5ACMA 5JORB 2R4SH 3MRGB 3D3VD 3OGCA 2FO1A 5DK0B 4TOYL 3LRSB 2HAZA 1OSPH 2APWA 4KK6C 4XP6H 2CRZA 5DYOB 3OXSA 1HQ4A 2BOCB 1CN4A 4GG6A 3O3DB 2EDYA 1TFHA 4M7ZC 3QXDB 3FFCE 3DGCR 1P9MA 5BRZD 4OD1H 3RX8A 2IPTH 4GKSB 3QEQA 4WU5A 5F72S 4ODUB 4UT6H 1BJMA 4H5SA 1WAAF 1S5HA 3WJJA 2LTQC 1FO0L 3K80A 4UTBL 4QXUH 3QRFM 1WFOA 3SY0B 5CSZB 3WFCH 4G8GB 4FQIH 1K6QH 2FX7L 1JE6A 3FZUD 3TCXA 3OWEA 4Y4KA 1U3HB 4P4KB 5LCVL 1L6XA 5F6HJ 3GSVA 3MACL 4NQEA 1CFTB 5I16A 1I1AC 1HOCA 4YPGA 5JXEA 4LSSL 2X89D 1JZ8A 4KTDH 1RHFA 1U6AL 3OKNB 4YXKH 2B4CL 2HRPL 4JPIB 1E0OB 1XCTB 3LQAC 1B9ZA 2BHYA 1IT9L 3MCLL 3W11C 5H2BA 3WBDA 1MFCL 1LO4L 1TLKA 4WUUA 2VXVH 3F7YB 4M9PA 1C5DB 3PWNB 2YPVH 3GMMA 3B3IA 4HG4J 2J6EA 3ARDD 3WN5C 2WBJA 4PJ8D 1KOAA 4L3ED 1NGWB 1FGNH 4J2XA 4NUGH 1YEKL 2BP3A 2JLLA 5I18H 2G9HB 4R7NB 3CVHA 5GRUL 3STBA 3U4EB 4NQUA 1SYSA 3BUTA 3TVMB 5I8KH 4ORGA 1FFOA 1ED3A 1WFNA 1RZJL 5FGCB 4PFEA 4D2NA 2XWBB 4NQDA 5IF0B 5GXBB 3MUY1 3Q5OA 4L5FH 5GJTL 5IF0A 1BJ8A 1CCZA 3PQYB 3HTLX 4YEFA 3VW3H 5ISZD 5MP6H 2D7QA 5E5RB 4TTDC 4XCNA 5I9QC 2JELL 2UUDK 4WUKH 2ADFH 4U1NB 4XAKD 4X9FA 1FE8H 2R4RH 4ONHB 2VE6A 1YN6B 5CZXC 3F12B 3MV7E 5E95B 1EAPA 4OUUA 5D72L 5TF1L 3ZHLA 4XCYB 4LLQB 3HPLB 3L5XH 1D7FA 4M1GH 1ETZB 2BVYA 3AU1B 4DTGL 2Z8WC 5DSCA 1IQWH 1E6JL 3UYPA 4FP8L 5J13B 3RDTB 4U2ZA 5DC0A 2F19H 4Y4HB 1MJUH 3HZYA 3P9LA 3O4LD 1CDYA 2WSKA 5I8EB 5FDWB 1P5UA 1WWWX 4OFIA 2G60L 2ICWI 5FGRA 3DJ9A 3D2UB 4P57B 5DVNA 1NANI 1CXIA 2P8LA 5DTFB 1XF3B 1GC1H 1ZHBB 5AWNH 4M6MH 2HRLA 2X4OB 3FQWB 4LFHD 5D70L 3C9NB 2V6HA 3P77B 1AGFA 4P5MB 1CGVA 1DANT 3HI1A 4UQ3B 5CLTA 4JZOB 1H3XA 3EO9L 3P77A 3OR7B 4R96B 1KV3A 4NYLA 3EYSL 3ARQA 3HAEA 3HC3H 1JRHI 4H5SB 5A3ID 3VWJC 1LQSR 3ZKNC 2JIXA 3O8XA 1RUQH 5DR5L 4N5ED 4AT6B 3STLA 1RUML 4OLEA 1QBMH 4U1LB 3CLEH 3EGSB 3TIEB 1Y18B 4TSCL 4EN3A 2FSEB 5GQBA 4ONFL 3UTPE 4FQLH 1AE6H 4IRSD 1KJ2B 4RQQA 1Q9WA 4KKNA 2ED9A 3HAEH 4L4VA 3VWJB 5C8JA 2HKHH 3SDXF 5DRNA 5I1GL 1PLGH 2G5BA 1YN7B 2E3VA 4N9GA 3CFJB 1T2QL 3HHRB 4PUBH 3WD5H 4K94H 5EBLA 4BFBD 1AI1H 4UI2A 3T0EE 2B2XL 3NVQA 4ZOAA 3EJZD 1G1CA 4DK6A 2BSSA 3MLUL 1DLHB 1JYVA 3RU8L 3C5SA 1DEDA 5EZLA 3PQYE 4NQVA 3GRWH 1HHJA 3WDIA 4KI5C 4FOMA 4I4WA 1BIIA 5E8NA 1H3PL 1I9RL 3GM0A 1DANU 3KWWA 2GSIA 3S6CA 1CZ8L 2BXZA 3QEQE 3FOLB 3FRUA 4NKDA 1OD9A 4GUPA 3K8KA 1DBML 1QG3A 3HRZB 3ZL4L 1BQLL 4L4VE 5DT1L 3PHQB 3EHBC 5JPNB 4JVPA 4HUUB 1XF1A 5TE6H 1D9KC 3CX5K 4NRZA 3I50L 3VGBA 2CKBA 5GGUA 5GGQL 4LPUA 5JXED 1EEYB 5CILL 4PRNB 3RL1A 1SBSL 2O5YH 4OZGE 2A6IB 1OGAE 3WKMH 4PG2C 4PRNA 3Q3GA 2AABL 4WDIA 1PFCA 4KUCD 5B8CB 1UEYA 3BFOA 4JO4L 4IS6A 4R4NC 4NT6B 2A9ML 4WDIB 5CINL 3RP1A 1MCOH 1QBBA 3U0TA 3FO0L 3WUWG 1F3DH 1SMOA 2EIBA 1A7PH 2MHAB 3B6SB 4X7SL 4UAOC 5BRZA 1UYWL 3MRFB 3F58L 3ARPA 1SY6L 4D0DB 1U0QA 4Q9BA 1CL7L 3FMGH 2DI9A 2GUOB 3JUZA 3NIGF 4NRYA 4EIGB 3G5YA 4LSTH 5EOCH 1D5BB 1CLYH 3GUTA 2DRUA 1ZSDA 4Y19E 2V9TA 3GBMH 4RBPK 1WT5C 3LQZB 3UJIH 4LLUB 1R24B 1NFDA 1LO3L 1ZA6B 5GRJH 3FONA 1OF2B 4KJQD 1A1MA 5C0RH 4I9WE 3TT3L 4QEGA 1A64A 4PRPE 2X7LA 3QUYC 4QCIB 5KG9B 5L2KE 1YC7A 1LP9E 1ZGLP 5FA3A 4N9OB 5E2WL 1E28B 5IGXH 2R2EA 2Z31C 4PJ7A 3O3EA 2YN3A 1ES0A 3D0VA 3WHXB 4PGDA 2EE3A 2FB4H 5DC4B 5BJTA 5EG6C 3MLXL 4J3VA 3NH7H 1BOYA 3I6GB 3KNBB 4FQXD 1MIML 4OB5H 1IL1A 2HMIC 1CR9H 2V7HA 1X6LA 4PJCF 2NX5B 4Z7WF 2LFGA 4GBXB 4C55A 3CZFA 1A6PA 2R23A 4PY8J 2C3VB 1RUAH 1FNSL 3PWLA 4QRSA 5DDHB 4JFFB 2Z31A 3ZTNL 4KROC 1S5HB 4LSPL 1BM3H 3VCLB 3VGDA 2QADB 5JO5B 4FQXB 2B7DT 2PR4L 1UQSB 3BPNC 3QHZH 3L3JB 3DURB 3NFPA 4MD5A 3VXSD 1TCRA 2VDMH 4MAYC 7CGTA 5IWLA 4CN1A 1F97A 3ARRA 3UX9B 2X40A 3MOAH 3S35H 2NY4C 5CP3A 4GRMB 3ALXA 3MRCA 5FUOL 3ZYZA 1M05B 5IMLB 2FRGP 5K9KB 2W59A 5A2IH 3WNMA 4X6FA 3MJ9A 2VLLB 3PP4L 3LKOB 1I1AD 5MEOB 3HUJA 1ZA3B 1LP9B 3PWJA 5CP7B 3RHWK 4L4TD 3E3QE 3FQRA 3JTSB 1E6JH 3MNWB 5D1ZA 1IEAB 3RPIA 5IGXL 2VN4A 4GOSA 4G8IB 4F7MB 5MI0C 3RJDA 3L5XL 3DTXA 1GGCL 2YD4A 4KMTL 1HK6A 1ZLUH 1F13A 4N8VB 1KXTB 2ADJB 4CL7A 2DBLL 4U1IB 1DBKL 3EDKA 1GGCH 1Z9MA 4NN6B 4PRHB 4M03A 5EOCJ 4P3DB 4D8PB 5E8PA 4TNVF 3U9UA 3TCLB 3W11D 1MHEA 3CDGA 5T33L 1FNAA 1T6VN 3MRMB 2ZUUA 5EWIH 3TNMA 1WV7T 1KUMA 5SWZB 5FEBA 2MPAH 4ZFOA 4ONOA 4HKBA 3MRBA 1T21B 1G6VK 2B1HH 3IRZA 4HUWA 4Y2DB 4R97C 3KDMB 5KW9L 5E08H 2F54A 2XQYK 5TGBA 2FHFA 5K59E 4X4MA 4FG6D 4L29A 4X98B 5GRVL 2F54B 4NC0B 1T03H 3C5ZA 5L9DL 5T5FL 3QEUB 4JY6B 3GJEA 1BGXH 1CE6A 4XZUA 3FRPA 3HUJF 2DLGA 3NCBB 5FA3B 4Y2DC 2FEEI 1MJJB 4O5LH 1XCQA 3BQUD 1P9MC 2BVQA 1V7NH 3LKSA 5EFIB 5GRWA 2Y23A 4MXWH 2BVQB 5EIQA 3P4NA 2P8LB 2NY5C 4RGND 4Z7UE 1RZJC 5E9DB 4E0RB 4GRLA 4JO1L 2X6MA 3CVIH 1FSKB 1XZ0A 5ILTL 4F57H 1MCEA 2Q8AH 3GFUA 4P2OC 1AKJD 5TQ0L 2AEPL 3EYSH 4WW1B 1HNGA 1NDMA 4AG4L 1OQXA 4JZOA 4U3XA 5LQBL 4FNLH 5I1LB 1QO3A 3O6LH 5C09B 3F7VB 4NCDA 3PWLB 4QRSB 2LU7A 1NFDE 4QGYA 3NA9H 4F7TB 2VUOA 3HG1D 3QDME 1UENA 3IU4L 3QT2A 4MA7L 3FO0H 1X5YA 4G3YH 4Y4KB 1NC4B 3VGGA 4X6CB 1FBIH 3G6AA 4M7ZB 4PY8I 5HGHB 5FHAH 4UB0L 1FV1B 1U8HB 1AKJB 3BD4A 5I19H 3TFKC 3WN5A 3HMWL 1WFTA 1YJDH 1VDGA 1TPXB 1MSPA 4L3EE 1L9MA 3B9EA 4FTVD 3OXRB 1IAIL 4JB9L 2XY1A 2EKJA 2B8OT 2P1YA 1A7QL 2HA1A 2W60B 3P9MA 2ZNXA 2QV2A 2W9EL 3QXWA 3UDWC 1LP9A 3PWJB 2WBJB 4HG4K 4DKEH 1KIPA 4WWKC 1D5MB 1K4CA 3PWPA 1N4XL 4JO3L 3F7YA 5ENWA 4G3YL 4LQFH 1DN2A 1AXIB 4GLRI 1FLTX 5ACZB 5JW4N 2OK0L 4OLYL 5E8DL 4KDVA 2JJSA 3WFZA 4CKVX 1NCDH 3VFGL 4G9FD 3KJ4B 3PGFH 1JGLL 1HILB 4GLRH 4DUVA 3MJGX 3CDFA 2A0LC 1NBYB 2YEZA 2HLFD 3S36H 4L8DA 3QBTB 5DO2C 3S5LA 3BX7C 3EYVA 1Z3GL 5KVFH 5DMIL 5DA0B 1DBMH 4HH8A 1CG9B 5GZOD 1FNSH 2IH3B 5TE4L 3CDCA 5DQJB 4G7VH 1OSZA 5DFVC 4XXDA 3C2AL 5C7XL 1F6AA 4U1KA 1KTDB 4P2RD 3QNXA 1FO0A 2UY6A 1HZHL 1OGAB 2CR3A 3ARGD 2H6PB 2J8OA 1F4WH 1MCNA 1LEKB 5EBWB 4S1DC 4I77H 4NM8L 3ZE2E 12E8H 1ND0A 1P7KB 1F4XH 1LO2H 3OKEB 4XMPL 3QEHA 1K6QL 2FX7H 1ZHBA 2VL5A 4EKXA 2MPAL 4HGMA 3EYQD 3ZZ1A 1HIML 1KC5H 2B1AH 2IPKB 3MOBL 2DDQL 2F15A 4XP5L 1TMCB 2Q76B 2IAMC 4MAUL 5AAWA 3MBEA 2YPKA 4PGEB 4EN3C 1JHKH 5F6IB 5T3ZL 3C5ZC 1U9KA 5LVEA 1JMZA 1FGVL 3EDDA 4Z95L 3ARBB 4M6NL 2A9NH 2UWEF 3GBML 4NQDB 2FYYB 4DN3L 3V5HA 3MUGA 3HAEB 1I8IA 4MCZA 1H3PH 1I9RH 3I84A 3ILPB 1FJ1B 2YD9A 3E2HC 2MCG1 2Q6WB 3BP4B 4EN3B 4CVWA 3BDYH 2JELH 5IHZB 4KRNA 1KGCE 4NCC1 4WO4C 5J12B 1HHIA 3VW3L 5IB3A 4GRLC 1B90A 2ZCHH 3VGFA 4ZYKB 1FC1A 2ED8A 5H8DA 3OMZA 3WN5B 3DV4A 1FNGA 3GI9H 3IDXH 4OGAC 1WBXB 1CDGA 3ROLB 5HHNB 4X6DB 5E99L 1RZJH 2H32B 2HP4A 5KSBA 1UA6L 3PJSA 1BZ7A 4JN2A 1ZLVK 1YN7A 2PO6B 4HUNB 3VFWB 5EZJA 3GHEH 5LAXB 2FJHA 1Q9KB 4HXAL 5F7KC 4LVNC 3DXAB 3EBAA 1FFRA 1S7WA 4NWUH 3FRUB 3GZKA 3PWNA 2A73B 1ZK9A 2YPVL 4BK5A 4G6FD 1BOGA 1A0QH 4HFUH 4QLRA 1LE5A 3QFJB 4ZUUA 4HC1L 1MH5A 4JKPL 5E00A 4W4NA 1I1FB 3MMEA 4PS4H 5CD5C 4O2EB 4H88L 2OMNA 5DVLA 4EDWH 1U6AH 3VRJA 1JF5A 3KPQB 3OAUL 1RIHL 3KLHD 3DMMC 5IJVB 5IR1A 1S7SB 2DKSA 5HHXH 4LSQL 4E5XB 3BPCB 1MVUA 2ZKHH 4OZFG 1MAML 3LHPH 5CEZE 1NGPH 1CXHA 1ONQB 1KLUA 4J8RB 4ZXBA 1JI1A 4Y5YA 5IW1A 1NGYA 1VEOA 2Q7NA 4K8RH 1MELA 3CC5A 5ITBH 5I8OH 4ONGL 4WWKA 2YA1A 5FGBC 5I2IA 1FGNL 4LSVH 1J05A 1FO0H 4PRPA 4RQQB 1CBVH 4D8PA 1K8DA 3RGVD 1WFUA 5F89B 3P2TA 3C6LD 3UO1H 32C2B 4PJIB 1C16A 4YHNB 4K3HA 1PSKL 1ZSDB 1OP5K 4QOKB 3T0BA 4QHUA 1HKLL 4JM2D 2VWEC 1R24A 1WZKA 4BQ8A 5HTSA 4CADB 5EA0L 4PJGA 1K2DB 1YEFL 3CNKA 1K2DA 3KPLB 1CLCA 3Q5TA 3DMMD 1C5DA 1ZLUK 4F2MB 1CICC 5DRWB 5IROA 4NZTL 1INEH 3TBYB 4WEBL 3ECBA 1GC1L 5FO8A 3R06A 2CO6B 3F6IA 2P4AB 3VXUB 2ZG2A 1T2QH 1FL3A 1IM9A 4ENED 5C0CA 2OR9L 1FVEA 4FFZH 4PJIF 5C3LD 1XH3A 5EBMA 1EJOL 2VITB 3RIAF 1HSBA 2DWEB 3LKRA 1L7TL 5CGYD 4B5EA 1XH3B 4WENB 3V7AG 4LVNB 2XTJE 1F6LL 2P5EA 3QFJE 5DUPL 1U8NA 3N1PC 4WW2A 5D1XA 1MFEL 3M8OL 1A2YB 2DQUH 3MCKA 3FO9B 3BDYL 4G8GE 2BERA 3B5TA 4C83A 3OKKA 4LCUB 4M5YH 5F1NA 4LCCC 5DUBB 3DRTA 2ESVB 1X7QB 2E9WA 4ZFGL 4ZAKD 3MLTB 5DZNA 3GMRB 1C7SA 4DOHB 3VMOA 3I75B 3QWRA 4M7LH 5TDOB 3DSFL 1CTNA 3GK8H 2QQQA 4LLYA 4M6OL 4ZO7A 1F58L 3BRFA 4KAQL 1EGJA 4H1LH 2LV4A 3DURA 2C4FT 1A6AA 2H45A 2GSIB 2ZSWA 1FORH 4U6XA 4PJDF 3WIIL 3C09C 3QFJA 3QHFL 1VA9A 3ULUF 3IDYC 3HRZA 5CEXB 3UC0H 4ERSL 5E0QA 1MAJA 3O0RL 3PGCA 2Q3AA 2IAMD 2JCCF 4LSVL 2X4RA 4UT7L 3QQ4A 2XT1B 3HNSH 4IJ3C 3SJVE 4DTGH 3TT1H 5F7EL 1F8TH 4EVNB 5C0FA 1MJ8H 4OQ1A 4RZCB 1KT2B 1HZHH 4WV1C 1RULL 3KNBA 1RUKL 3GB7B 4EVNA 3FTGA 4LU5H 1NL0L 4KY1H 1GAFH 3IXTB 4P2QB 3N1MC 4RISH 2FR4A 4KRPC 2JB5L 5E6YA 1XGPB 4KPHL 5EO9A 2FECI 2GSGA 2IBBA 3RY6A 3M1BA 4XNUL 4LLDA 1KXQE 4X7CC 2DKMA 3BSZL 2GEEA 5IEKB 5HJ3B 1Q38A 4CN6A 2ADIB 3HCVB 4HMEA 1FRGL 4XCEB 1JWMA 5IHUL 4YLQT 3LD8C 5MEPA 1ZAGA 2YD1A 4JHAH 5DLMH 3OKMB 2P8MB 4OT1L 2JTDA 4N0CD 4WI6A 4K3JH 3L95B 4PJEF 1QR1A 2C3HA 5FYKD 1SVCP 4MJIA 1MCCA 2OP4L 3WMSA 1YNLH 3MZTA 3LN5B 1K4DB 5FUCC 2MKLC 5ERWB 5HI4C 3TJHC 1JGLH 4MJIB 5EUOF 5B3JE 1OSZB 1PEWA 1SJVA 1W0VA 3ZKQD 5KSAA 3IDIA 4FZEL 4Y5YC 3V52L 3ZDXF 3MV8E 1AGCB 3WLBA 1CDJA 5MERB 1A7NH 4PTUB 4G6KH 4MQXD 4BZ1L 2EH7L 4LRNL 5CIPA 1JNNH 1IBGL 4XNQA 3MXVH 3WSQH 5F6HI 1IEBA 4NDMB 1MWAB 4PLNC 4P2OB 5D2LF 1X4ZA 4NQSA 3U1SH 3MUJA 4JY5L 1JMXA 3OX8B 4RSVA 2A6KA 5EFIA 1I9JH 4K3DH 4JFPA 4ZPTA 5HHPA 4FTVB 5DA4A 4HIHA 1J1PL 3O2DL 1BQSA 3SOBH 1CU4H 1KPVB 4IBLT 1R5IB 5HI5C 3PIQB 4GKZA 2QADD 2XIDA 3BMWA 4DGIH 3L3DB 4WGWB 1KYOJ 1SJHA 1HKFA 1ZLWK 3OXSB 3M17B 1B0RA 1JVKA 4KDTC 3CFDB 4BZ1H 2XZZA 4EUPH 4NO3B 1X5FA 2E7CA 1UKQA 4A2LA 5A43C 2DQFB 5D2NC 4KUZL 4GW5B 1CICA 3X14B 4NQXB 4PRDB 3NZ8B 4Y19A 2YD2A 1EMTH 1BFSA 1S8DB 3OHXB 2NY4B 2P24B 1AGDB 4GAYA 1BHGA 3MRMA 3OHXA 3O3AA 1CD1B 4M43L 4M8QB 1HYSD 1QKZL 5DWUL 5E2JA 4OLYH 2EDJA 1I1RA 2VABA 1A9BB 5DD6B 3MA9L 1Q1JH 3MYJA 1Q0XH 1DUYA 2JJVA 5E7BA 5F70A 1U3HD 2Y72A 1YUHB 4WGVB 1A3RH 4FFWC 6FABL 4Z78B 4XC1H 5I17A 4XNZC 5TQ2L 1F11A 5D7IB 4IMLB 5F9JA 1EVUA 1WEJL 3HKFA 4PBVC 2XKSA 1D6VH 2AKRA 4F8TA 1VENA 3WSQL 1MOEA 1PX4A 5JQHC 5IQ7H 1BZQK 3RPIB 5E2TH 1GGIL 2MSPA 4KHXL 5CEYA 2RBLA 4IIQB 5C0AA 1KCVL 1MH5B 3IB4A 4Y2DD 4QXWA 3ORJA 4QO1A 2V2TA 1RJYB 4O2EA 2KZ1B 4QTIH 3VFGH 4M62H 3UTTE 4GG6F 1OPGH 3PWVA 4OFVA 1GGUA 1GJIA 1EA9C 1PX3A 1I7TA 4IIQC 1JWMB 4Y4FB 2XWTB 5K9OB 3C8KB 2FEDD 5KN5A 4G8GA 3RI5F 4MHHI 1FL5B 1ZE3C 1AR2A 5T33H 2Q86B 1AR1D 1QNZH 4ZTPL 3P0VH 4R9HA 4W81A 4KZDL 1MFDH 2JCCA 2WNGA 4RA3A 1DSFL 1QYGL 3LEVL 4ZOCA 3TPUB 4HS3B 1YDPB 3DROB 4UMGA 3MODH 2YS4A 4C4KO 4DZBB 2VZ1A 1OP5H 1BAFH 4KJYB 4UUJA 2ID5A 3V4PH 1JZ2A 2WIIB 1E27B 2FIKB 5D7SL 3HE7D 4FQHB 1A6ZA 1Z5LA 5JHDD 2AW2A 4WFED 3RY6C 2IAMA 5E8EB 4ETQB 4HD9A 2NW2B 3ZKSD 2YSSA 5L8LB 3QA3A 4QHLB 1QRNE 3MRJA 4DQOL 4GFTB 4LKXA 4I3SL 4YHIA 5HDQL 3EJJX 3UPRB 1H8NA 1T04B 2BRRH 5EDXA 3LN9A 3PP3K 3QDGA 4WEMB 4XRCA 4CADA 3HLAA 3SGJA 4KUCF 3TZVC 3LKPA 4JPVH 5EU3B 5IUSA 4OLZH 4DJMA 1I7RB 2V7NB 3WL9B 4B7LA 2YRPA 4NZUH 1DQMH 4AEHH 4P5TA 4K2UL 4B7IA 4QOKE 1QPPA 3VDBA 4X4XB 4OZIA 4M93B 2EDTA 4NQXA 5KVGL 2YPKB 1YY9C 1X5IA 3N9GL 4GAYB 4K3GA 4CJ1A 1J8HE 1RURL 1TVDA 3BZDA 4JZJB 3RL2A 1VKXB 1TETL 3MGAA 3NIDE 1IKNA 3H0TB 4TNWK 4LIQE 5CSBA 4OCWH 4KROD 1X5ZA 3L3IB 5F1OB 5JW5A 2R1XA 4OUUB 5AZEH 4BZ2H 5B38B 2A83A 2NCMA 1YPZB 2ZZUT 5FF6B 4E41A 5DQDL 4ZO6A 4IRSB 5JDJA 2QHRL 5JW3L 2LU4A 4N1HB 4PG9B 2VQ1A 3OKNA 3MV9A 5IOPA 4JN1H 3V7MA 4EI5B 4IRSA 3IDNA 5JQ6L 1E4XI 4EN3D 3LDBB 4F7PA 3STZB 5HSFA 2F9BT 4RGNB 5E9DD 4Y7MA 1LDPL 3VFWA 2E6QA 3LRHA 1Z2KA 1D9KB 1INDH 1P1ZA 3DUHA 1TNNA 2EICA 4WY7L 5EU5B 2BVTA 1I9IL 3WXVL 1OY3B 3O3DA 4ZD3H 1H3UA 1XZ0B 3C6SA 3ARGA 2PW2A 1P4IL 5C0IB 3FQXA 4PRBB 4LNRA 4RGMB 4UNTA 2CKBB 5CKAA 3MV9E 1KLGA 4L8SC 3AGVA 2AK4B 3EFFA 3FN0L 2DQEH 2D03H 2D7PA 3RX5A 4LSDA 2C5DC 4JAMA 1A6WH 3BGMA 5IW1B 3S5LB 3P4LA 1FJ1A 1CR9L 3LPGA 4MZ3A 3IFLL 3CH8A 4MHHG 2B20A 2Z35A 1J8HB 3B9KC 4M02A 2VDQH 4O51A 3PV7A 3EZJB 4JFEE 1OGTB 4PJFB 4BSWB 2NYYD 1DEEB 4XPBH 2AJ3A 5KVDL 1CFTA 2PF6A 3REWB 1I4FA 3G5YB 4X9HA 4KI5E 1GC1C 4N9GB 5CAYB 4P46A 3C2AH 1FPTH 1BVZA 4I48B 3JWDH 5FGCE 4EQ3A 5HYSG 5DJXA 2VISA 3IF1B 4BUHA 1W72L 4OQTA 3GMMB 3DXAA 5DEFB 5GRJL 4DFHA 5DMIH 1KN2H 2UWEE 5TE7L 1T7VA 3UTTA 5IVZA 3UBXA 5MERA 4FRWA 1JK8A 3R1GL 4LHUB 1XIWC 2IANE 1MRDL 4FMFA 2FHBA 4CVXA 2DDQH 4NFCA 1F3JA 2D4DA 4XGZA 1KN4H 3MRPB 1XGUA 1MVFA 4LL9A 3ZT5A 3F58H 4YGVB 4JFFD 3LAFA 1KB9K 3SCMC 3LS4H 3ECBB 4OB5L 1T3FB 4WTWA 2J6EH 5F88B 1AI1L 2B5IB 3O6LL 4JRXD 1RJZB 5EN2B 2CXKA 2EO1A 2ADGA 2YK1L 1RIUL 3SO3C 2HFGH 2UWEA 3R0MA 1VFUA 5CHNA 4LVEA 3H6JA 2DB8A 4MNHA 2JE8A 2OI9B 3HE6B 3TGXA 3RY4A 1ZT1B 3P4MA 2EXYC 3B5HA 4H26B 4POYA 1XGQB 3WFHB 1YPZA 2CKNA 4YNYA 3FB7A 3TA3A 4ONHA 3WNPA 2PR4H 3UBXG 3RZCD 1TTUA 3D3VB 2GUOA 3WO4C 2JCCE 4HV8A 3J7HA 4FQ2H 3PE9A 2NZ9C 2IPUK 4ZUTB 3QI9A 5GGSA 4YDIH 4NKIL 2PKDA 1NLDH 4YC2B 3GBNL 4TUJB 3D85A 2PTTA 4MA7H 2AV7B 4HHAB 4GKNB 5F7MC 3KXFE 4GUPB 3WO4B 1ACYL 1K8IB 1VPOH 2WWKO 5DS8B 5MENE 3RWJA 1B4JH 4YDJB 2GFBA 4AH2B 1CLOH 1S7QB 4LNRB 1KEML 5HHOD 5CP7A 2QR0A 1BJ1H 1B2WH 1QP1A 4YHPB 3RVWD 4N8CH 5E8OB 1MF2H 2XTLA 4AZ8A 2E7LA 3DTXB 4ELKA 1HQRA 3WKML 1ONQA 4J8RA 5EBMB 4ZXBB 2BSTA 1WBZB 2QQNL 3EDFA 2IG2L 4HAFA 2MJWA 4PLJD 4IS6B 5ICYB 4KHTL 4JG1L 3V4VH 1KJ2A 2MTPA 1EEQA 2EDLA 2V2TB 2NY3C 2DI8A 1RMFH 1Y18A 3GSQA 1CL7I 4XVJH 3S4SA 3QFDA 5IMKB 2XZAL 4LARH 4LHQB 1Q94B 1IC4H 3MLSL 4XMLL 2XWTA 1QVOA 2J4WL 3A6BL 4ZUSA 3SJVD 4TTDD 3ULVC 3HAEG 1BZ7B 4JN2B 1JHLL 1QRKA 2VLME 2D2OA 4G43A 3OF6D 4TQEH 5AZ2L 2G2RA 4LK4A 3CAFA 3LN5A 1TJIH 3UTTB 1IMHC 4KC3B 3S37H 2UZIL 3FT2B 2G60H 3PDOB 4DZ8B 3WFEL 4KXZH 4WEUD 4I3SH 5HDQH 1RJCA 3WDHA 1KCLA 3VI3F 3MRPA 4PJHB 1PVHA 5IQ7L 5HD8D 5HYSA 1EEYA 3ALPA 2ITCB 2NXZC 4MXWL 2XWBA 5D2NB 3BZFB 4HUVA 4GQ9H 5KJRH 2BNRE 2XZQL 4MJIE 5DZLA 5EU3A 5KSVB 4RA0C 3W5MA 1PKQB 2DIAA 3DX6A 1JRHL 3CK0L 4TN9A 1NCBL 3ARTA 4IOIA 3DX7B 3BZEA 2AV1B 3R8BB 4X4ME 4W6XB 3UROR 1GIGL 5F7LB 2AV1A 5KBNC 1G7LA 2AI0L 1UJ3B 3V6OE 1AC6A 3CC5B 4GBXA 4Z0BL 1EFQA 4PJ5E 2Z8VC 3RTQB 5D1QA 1IQDA 1BX2A 1CD1A 1UH2A 2EDHA 2I60H 3O2VH 4X7EC 4TNVK 3GUTB 2W1NA 4PG2A 4MWFB 5E2WH 4OLUH 4PJEE 4D0DA 1KN4L 4KK8C 4YHYC 3I75A 1NMCC 3P11H 4IDLA 1AKJA 2VKXA 3QHZL 3U46B 1TCRB 4LIQH 1IGIL 3U9PH 3U48A 3O6KL 4OKVB 4RFOL 1HHHA 1R3HB 3DV6A 1P2CB 4FP8H 4X9IA 5DI8B 5HVWA 3EDJA 1A7QH 3UJIL 5FFLA 5JPMA 1QHPA 1KJ2H 1LNUA 5F7UA 4ZUWA 5EORL 4P23C 3ALWA 1QFWM 4XT1C 5INCB 2NX5D 5J7CC 3RVTC 1WEJH 5D1QC 1UB6A 4RRPA 4PJFE 4YR6A 3IDNB 5CS7A 1MIEL 3TH3T 4LAQL 2OJEA 1YC8A 4QRPE 3HNVL 4PGCB 1DDHB 1FYTA 3MZGB 5JIPA 3W9DB 3WV0A 4JFFE 4DCQB 4PRID 3QWQB 4O02L 3G6JF 4IIQA 3W9DA 5CCKL 4DCQA 2BHUA 4G8EA 4MAYB 4FZ8L 2F54D 1MRFH 2AK1H 2PXYD 4GMTH 5F93C 3BN9C 4TRPH 4URTB 3RAJH 5FYLD 2WUCL 1S9KC 2AEIT 1S7VA 2EZ0D 1JHLH 4X7TA 2Y36H 1XGPA 5FYLH 3MOAL 2EXYD 2B4CC 2RIKA 4P3DA 4DFIA 3QFDB 1JGVH 3VDCA 2NX5A 4JKWA 2VJXA 1G6RB 4XNZB 1XF4B 1R5WA 3K4ZA 3F7PC 1MJUL 5C0GA 3CDYA 3GDBA 3MA7B 4KUZH 3TBSA 4EQ2A 1E4XH 2VDLH 3V5KB 4UOJA 1J5OH 5ISZB 4J4PC 1CDCA 2VUYA 1I3GH 3K8LA 5EIIB 3UZQA 4QGTA 3WEXB 3RZCA 2WINA 3SGJC 1RIVL 3SCMD 4LEOB 2QQNH 3O3UN 1JZ3A 2VDPL 3IFPA 2M26A 3SO5A 2Z8SA 3W81A 3IDMA 1ZOXA 2F53B 3GIVA 5CJ8A 2CDGA 3VD9A 3O2DA 2ZSWB 2LE9A 2KQMA 4OGYL 3GMLB 1H5BC 4QHLA 3OG6B 5DHVA 3H3BC 1C5BL 3ZE2F 1PY9A 2IAMB 5E8EA 5ICXA 2GI7A 4NPYA 4D9LH 4U6HA 5GPRA 3AREC 3JWDC 4IMKA 4JRYE 3SQOL 1VPOL 5MENA 5HDBF 4RMWA 1KIQB 4GMSH 4ONFH 3ARUA 4KK8D 3VI4F 4G8IA 3OKOA 5CFHA 5DJ0B 2Y5TA 5J56B 1S3KL 1NMCB 4YDIL 4M4PA 1IKNC 1LO0L 1CYGA 5I1AA 4WW1A 2X4SB 1BBDH 3QZWA 1KCRH 3BYTA 3T1FB 3VFVB 1GGTA 3O6FC 3MV01 2P46B 3RVXD 1AIFB 5HI3D 5BVJB 4MLIA 3MCLH 4IMKC 2UYLB 4DVRH 1QHOA 3B5GA 3VFRA 1MUJB 3VRIB 3D18A 2YRLA 4MD4A 5DRZB 5IBUB 4FQJL 4OIAA 2VABB 3QUZC 1NCCH 5DD6A 2IH3A 1VKXA 5KVDH 1S9VA 4G6AD 2A83B 2NXZD 3BVNA 4LCIH 2BSRB 2BDNH 2PCPB 4KV5F 1R6VA 3O45B 4UBDC 3MA9H 1M7XA 1A7NL 5D9SB 3SGKA 3JWOL 4Y1AB 3SDYH 3GJEB 3ARGC 3T2QA 3MGOA 5F9JB 1MHCA 3BKCL 1EHAA 4U1MB 4UT6L 5EU4B 3LS5H 2XWJA 5T1LB 4OLVH 4EOWL 1NMAL 2OTUB 2D7NA 3FO1B 3T1WA 5KS9E 5ESAB 3HPJA 5F3HB 5GS0H 1G7JB 2APFA 5C71A 3PGDA 3FB5A 5J12C 5C0BB 4JJ5A 1OGAD 5KVMC 1NGZB 1S7RB 2FGZA 4AEEA 3ZTJH 4X7TB 1IAIM 1QSEB 2DBJA 1G9MC 3GMNB 3F7VA 2ZOKA 5FOJA 5D7JD 2IF7A 1XR8A 2NZIA 5F9OH 5LWYH 4WFHD 3HC4H 4Y19B 3DYOA 3LPFA 1YQVH 2DQHH 3STLB 3VWKB 4RMVA 5HDBE 4LLAA 4FMKA 4X5WB 3CGTA 1YEDA 4OV5B 4X4ZA 5DQJA 2WQRA 2J12B 1Q0YL 5HGHA 3IXAB 3QUXB 1NEZG 5D71H 4GXUM 1I1YB 3QUMH 1SBSH 3TN0D 3FQNB 5E2VL 2DQGL 3WHE1 4W4OC 3BEWA 1GOGA 3MGTA 1JTPA 4GS7C 3BKJH 4NBXB 5T1KD 2EDBA 1A4KB 4MNGA 1EO7A 3VG9B 3BEWB 4YFLF 3V6OA 3GNML 3WJJC 2P47B 4OI7A 3HZVA 2E27H 2WBJD 1S7XA 2FJHB 4P46B 4PJ8A 3LMJH 2AJVH 1OLZA 4NQVB 1KGCD 5E4EC 2NZ9D 3K46A 4WUUD 1LE9A 2Y06L 3LPWA 2FWOA 3BKYH 1KYOK 4I3RL 4HC1H 2CGRL 3HE7C 3X3GH 5FYJU 5TDNB 3T2NH 3VXUA 4J3UA 4R7DA 1VFBB 3BKJL 1A1OA 4W4OA 2XA3A 3F7QA 3D9AL 3TVMA 4WIQA 5J13C 2W91A 1K5NB 5TH2B 3QUMA 3TA3C 1LK2B 2ZCLH 4KQ4H 1BQUA 2XG5A 4BSVA 4XBEH 3H7LA 1R3KB 1WT5A 5CWSB 1L9NA 4KJWD 4JZJA 3C5JB 2A38A 4RX4D 4DEPC 2PYFB 2WBJC 2IANB 1MFCH 3QHFH 3C5JA 3FZUC 4DGVL 1CIUA 4TOYH 1OAQL 5TF1H 2UY7A 3HE7A 1KG0B 1I8MB 3O8XD 2QJDA 3FB7B 3RWCB 3TA3B 1MRCL 4Q6YA 3BQUC 1OAKH 3E0GA 2ESVA 4PD4J 1B88A 1A6UL 1HINH 3S35X 3GSNH 4FFYH 4HIJA 3TVMC 3HI5L 2APXA 3GSOB 4ZO9A 4KTYA 5AUMA 4HBCH 4V1DA 4CW1B 3MGOB 4JFOA 2R2BA 4XPHH 1CWVA 1AQDA 3OKEA 2FZ3A 2ZUYA 4ETQA 3VGAB 4TSBL 5GS2H 1P4BH 5L88L 1WTLA 4FG6C 1NGQL 1L7IL 4OLWL 3QDGB 5BW7C 3OG4B 4M7KH 4O2FB 1WC7A 3O41A 4UDUB 4OTXH 4GXVL 3MLZH 4H0HB 4YXHH 5DTFA 5C0BA 4K9EH 1T66D 3PHOA 3K0WA 5F44A 4CMHC 2IALB 1F3JB 1UB6B 4MA3A 4BSJA 2C3GA 3MMEB 1D5XB 3PV6B 5FA4B 1HXMA 4KHXH 1QO3B 3WS6C 2GY7B 4YHLH 5D2LA 1RZGB 4Y5VA 2JJUA 4AL8L 2C1PA 3VU2A 3NFSL 3SY0A 3QPQC 2EIEA 3A0OA 1VGKB 3TO2B 3LKRB 5C0NC 6FABH 4R0LC 4C4KT 4P4KA 5DURB 1GOFA 4E9LA 4NNPH 3QG7L 5EPMB 5MP6L 3QUXA 5CEZD 3PQYD 3ROLA 4P2YA 4X6DA 4KKCD 4ODSL 4JKPH 4JJHA 4JGJA 2XY2A 4C83B 3GSQB 2G5RA 1FNGB 4TUOB 4WFHE 4HDIB 5GGRB 3QNYA 1BF2A 43CAB 2ICES 3B83A 3V52H 4OAWA 4PJXE 3ZDXE 3WXWL 5IMOA 5EIIA 5EBLB 3CSGA 4WW2C 3IJSB 4X5XA 1FH5H 3G6DL 2IPTL 5CJQH 1AGCA 4PV8B 4P48A 3E2HB 4AENB 2O61A 2EC9U 1IAKB 2YPLB 2HWZH 4YE4H 2W0FB 3KXFB 1RVFH 5I8OL 5E8NB 5ESQA 4DEPB 1FDLL 2IQ9H 4I2XB 2EDOA 3MV7B 4PJ5A 4PRAA 1OAXH 4EI5D 4KZEL 3QCVH 5KAQG 5J3HC 3OF6A 1N59A 2PW1A 3QPXL 1QR4A 1K5NA 3BJ91 4R8WL 5HI4D 5TH2A 4Y2OA 4KY1L 3QCUL 4LGRB 5C0JA 1IEAA 2VDPH 4EI6B 1F02I 3LSOB 4HUVB 2QHLA 4FQXC 4OCLC 1JYNA 2CO7B 1OQOA 4JY4B 4Y5YB 4ELMB 3BIKB 4G6KL 3G6JB 1UWGH 3JZ7A 4HCRL 4G9DB 2V5SA 1MFAL 32C2A 4ZFFA 4JRYB 3MBXL 4JFEB 1KTDA 1YYMH 3ARZA 3OKKB 3CVHL 4ZFZB 5F1NB 3W2DH 3BT2H 4HWZB 1ETZA 3AU1A 1TQBC 2VLRE 5JW4Q 1WZMA 3VJ6A 5FYJE 5I18L 4H25B 2EE9A 4QNPE 4IHOB 4KRLB 3QJFA 2ERJB 1CDIA 2QQKH 4HX1A 2R29L 3S96A 2AXFA 1NAKH 4L3AA 4HKJB 4KVNH 4F2MA 4HMCA 4R2GB 4FQ1L 5T1MA 4OKVA 4EIZC 4OGYH 2JB5H 2DQCH 1MAKA 2DTML 4OCSL 2ERJC 4XNYH 3L5IA 2R1WA 3RVVD 2XFXA 4TPRL 1EV2E 2UUDH 5GZNC 3S9DB 1U92A 4WTXA 5TE4H 2DQTH 2DM2A 2LAAA 1KB5B 1U8QA 5D8JL 4WHDA 4YDVB 3UO1L 4AK1A 3ES6A 3SDCA 4Z7QE 5GGRY 2V2WB 4Z5RB 4BM7A 3X11A 4NQCB 3P4NB 2AJXL 2ARJB 3MV7D 4R26L 4R4ND 2BOBB 1OWWA 5F7WC 4TTGA 1YEIL 2GTZA 2VERN 3IXTA 4Y1AE 5EC2A 4P2QA 3CFDA 1EFXD 2VITA 4U49A 4XPFH 3X13A 1XMWA 5D1QD 5L2JA 4LNVA 1GOHA 3NZ8A 2XXCB 1EGJH 4P9HH 3ZT7A 4I8DA 2X9WA 4LQFL 2DWDB 4P2RE 1Q9LA 5CCKH 4OF6A 5KAQF 4DKEL 4M8QA 2HN7A 3MLTA 1S9XA 5E6ZA 3TJEL 4DVBB 3WNLA 2W9DH 4OF0A 4OZHF 1JHTA 2X9YA 3IDMB 5ICZB 3IAGC 4U6XB 3EO0A 1KNOB 1MCPL 3MRLB 1RULH 2HYMA 4ZUTA 3V5DB 1EZVX 1XF2B 4DKFH 4YDLC 2NYYC 3TF7C 2VOTA 1CF8L 2DOCA 1CT8B 3LKNA 4K94C 3H9HB 2JJTC 4ZTOH 3MFFB 3IJYB 1RSFA 4OIBA 5EUOA 5FHAL 2Q7YB 5IHBA 4OD3L 2VLLA 2ZCKL 1SVZA 5IR1B 1JPTL 1C8PA 2EYSB 3NZHL 3BJLA 4AIOA 3AVEA 3KYMA 2RCSH 3GKWH 3D1MC 3KLSA 1D5MA 3PWPB 2M1KA 3LZFH 3SJVA 2B1HL 4HH9A 1ZT7B 4RAHA 2O5ZH 2YD8A 4HWUA 3KS0J 4OZHE 4N5EC 1F4YL 4K7PX 4CNIA 3BIKA 2WAHA 3GBNH 1U8OA 3CJJA 3VFNB 3QDAA 3CH1B 3B2VH 4ZSOB 2OXGA 4MB4A 3KS0H 2YEZB 1EEZA 1E6OH 2Y07H 4BKLB 1TZGH 3RKDD 1K85A 2YUXA 4Y89A 4JQIL 5ESVB 1EJ6A 1QR1B 3K2UL 4J3OC 1XT5A 4WV1A 1OVZA 2VZUA 3BPOC 3WUZA 1UVQA 5JDSB 2MCPL 4MQ7A 4NO0B 3V6ZA 1MCLA 2EEBA 3LQAL 4HIXL 5JDSA 3IFPB 3QIBC 1CE6B 1OOAA 2GY5A 5J57B 5C9KA 1MLBB 3QQ3B 1F4XL 3WFEH 1WCQA 4FQQA 4GH7B 1TVBB 3KJ6L 1N64L 5FECA 2BC4A 3GSUA 1REIA 5H35B 1XR9A 5BZDB 5I1IL 1WWAX 5LG1A 3O3EB 2HFEA 4U6HB 5GIRA 1UH3A 4U31A 2VYRE 2CDEA 2ZNWA 5I73B 3BO8B 4WO4A 3PGDB 1G6RH 5IVXF 5DD1L 3WFBL 2ITDB 3IDGB 4YHKL 2DQFA 4Q9QL 1DQJA 3JWNC 4JPWL 4UQ3A 5I1JH 2DJ4A 1HHKB 1F4AA 1FAKT 4CU6A 5CLWA 1T7XA 4L3CB 3L7EB 4NYLB 3TBVA 4OCNC 2XN9A 3O3BA 3LS5L 1FG2B 2NR6C 5F7FA 3TZVD 1ADQL 5IVXA 4ODUA 3NCJH 4HZAA 2FGWH 5JXAL 1ORQB 2Z8RA 5D7KE 4HF5L 1MY7A 3PXHA 4EXKA 5JHDB 1A7PL 4OLXH 5IKCB 2GK2A 1VGEH 4XWOD 5JIIA 1EO8H 5I1HL 1RZFH 3QIUD 1P2CA 5DI8A 3RBGA 3LB6D 4TUKH 5F3BA 3FB8A 4QRRB 1NLBL 4TULL 1TIUA 4S1SH 3ISWA 2NXYC 2BJML 3UTQA 4JFHE 1FFPB 5BS0D 2NPLX 1DLHA 5C0RL 4PJGF 4QRPB 5ITFA 1R3JA 3ZSSA 3SDAB 3VFOA 3LKPB 3C60A 5FGBA 3GGWB 4KKCC 3FQUB 4PJAB 1SM3H 5FYLE 2EO9A 5DF0A 4I5BA 4YK4B 4JRWA 3H7BA 3P3YA 5T1DL 2HT3C 4NQDE 4OJFL 1Z6JT 2V5RA 3PHQA 2NY6D 2QL1A 5HYEA 1FL6B 3BWUC 3NTCH 3S3JA 5BMFH 3FKUS 2Y36L 5DFVD 2ENSA 3TO4A 1VFBA 4Z7VE 5HGAA 4YEEA 2PETA 3MYZA 1BP3B 4RAVA 1BECA 4G8GD 4U4BA 5L2KD 2VDQL 4PP2A 2ZCKH 4WU7B 1MCDA 3GM8A 4JLRA 5AZEL 5HGGS 2ILLA 2Q8AL 5C09D 1IAII 2FGWL 5JXAH 4H26A 1OCWH 2HG5A 2O5XL 2OTWA 2IANA 5BW7A 4S11A 5EZIH 5GGQH 5J1AB 5DFTA 2EXWC 3MGTB 4U7KA 2BNRD 5C0AD 1RUQL 4PB0H 1KN2L 4HBQA 2VIRA 4ISVB 1IKFL 5FDWA 3B9KA 1TZGL 1IGTB 2H6PA 5H2BB 4C57C 5JIHA 2VL5B 3RDTA 4QRTB 1Q9OB 1CZ8H 4UV4H 1HDMA 4MDIB 4P9HC 1ZGLM 2KL6A 1P6FA 3BP7A 1CL7H 1J11A 4YIQB 5E9DA 3EOBB 4NZJA 3C9NA 3MLVL 1IGYA 2BSED 5D1XC 4JFXA 5KW9H 2GFBB 1AY1H 1AGEA 2A1WH 1N6QL 2V5MA 1NFDF 2P5WD 3SQOH 5IV2A 4GSDL 4LCCA 1HQ4B 4YHMH 3M07A 4PUBL 4Z7VA 3IGAB 5FCUH 3U2SB 5DQDH 3T1FA 5GS1C 2HVJB 4M5ZH 1SEQL 1T3FA 4NGHL 5K33A 1VHPA 3SE4A 4WI8A 5IVXB 3RDTC 3FFCB 4QXGL 1A6WL 1S7UB 1IAIH 1UEMA 1CF8H 1AHWC 4JB9H 5IB5B 5F7DA 5INDA 3MV8B 3T2OA 1AD0B 4P5TC 2DLTA 4LPCA 1FSKC 1FV1A 3SDDB 1TVHB 2DYPA 4Y19D 1AD0A 1ZANL 5F1SA 2XNAB 1M7IA 2FX8L 1ZTXH 3EGSA 3TBTA 3TIEA 4BFGA 1KSRA 4I18B 4ZYKA 4MNQB 3O6KH 3H3PL 4LAJH 5F9DC 4DW2H 1SEQH 2VC2H 4NGHH 4Y88A 3TH4T 3U82B 1AJ7H 1MCSA 3P11L 3EO1B 3S37L 2Y6SD 3MV9B 2VR9A 1LDPH 1CFQA 3V0WH 2ZJSH 1S9XB 2UV3A 5IW6A 1OPGL 2KDGA 5EU7C 5IB1B 1U8JA 3VXRB 1IC5L 4WHCA 5FO9A 4Z7WE 1EHLH 4U0QB 4DWHA 3C6SB 2AGJH 4MD0A 2X4OA 3FQWA 3MBXH 3EAKA 4UV4L 1Y6KR 2DJSA 5JMOC 4O9HH 1SYSB 4NQCD 5A2JH 4OI8A 2FX8H 3MRHA 2MCPH 3FFDB 5F1KC 3SDCD 1IC7L 3HUJB 3QWOB 3GMOA 5IJVA 1BPVA 3V79C 4LPTA 4XC1L 3RL1B 1CQYA 1N3NA 1JI2A 43C9A 3EYUH 3MRDA 4U05A 1H3WM 3C60C 4N1CA 4NWTL 1U8OB 3PP4H 1YEDB 3RTQA 4W70A 1TTGA 2A6DB 5FM5O 5JUEH 2F8OA 3FB6B 4MS8C 4DOHE 4J1UA 4QF1A 4XCYA 4JKKA 3O2VL 4BFIA 5DRNB 4OCYL 1U41A 1U2CA 2NW3A 4F9PA 5B21A 4OSUL 4I48A 5MHSE 4M7JL 1NUDA 5MEPB 3SE3C 1N0XL 3BT2L 1J1XL 5DEFA 1HHHB 1I3RA 1XGYL 1G0YR 1T20A 2CD0A 5I1EH 3SDCC 1J0HA 2XN9E 3VWKC 3K3QA 4F3FA 1BIIB 1IKFH 2ED7A 2L7JA 1J86A 4X98A 1G9ML 1NBQA 5B4MC 5IEHA 2D7TL 5ESQB 1LVEA 4NKQB 3WIFA 1NGWA 3TBYA 1TETH 2AQ3A 3ZE0E 1HCVA 1TTFA 1S9WB 1T5WA 2IFGA 1O7SA 1D5ZA 2VDOL 1RURH 3HR5A 4S2SA 2VQUA 5D5ME 4F9PC 4DUWA 5I76A 5BO1L 3IGAA 3SDCB 2QQLL 3SE3A 3MJ6A 1D5ZB 3QPXH 4O9HL 3N85L 3AAZA 2CLVB 3RWDA 3QCVL 3PL6A 3W39A 4EI6A 5DD5L 5HPMB 1T03L 5GJTH 2V2WA 4M1DL 3X11B 1T1WA 1RJZA 2V7HB 4EXPX 3NMEA 4PJ5D 3M17A 4U1SA 2W38A 3O81A 2XG4A 4P9MH 1O0VA 2BVEA 4UILH 4HWEL 3IDYB 5AWNL 2AABH 2A0LD 1ZS8B 2VMFA 4LHUG 2CLZB 5KS9F 1DQDL 1ADQH 4MNHB 4UU9B 1ADQA 2ATKA 2VLRA 2EEDA 2R9HC 4PTTA 5DC9B 1DFBL 1A2YA 1IAOB 3GMRA 1OTSC 4R6UA 4ZDHB 2R23B 5GGRA 4H25A 1IAMA 5MHSD 1TNMA 1RY7B 35C8L 5I30H 3DRTB 1BFVL 3D0LA 3WJLA 3JTTA 1TJGH 3D39A 2JJTA 3E6HB 5IKCA 3T0EA 1A6AB 1IT9H 4GW4B 3WO3B 1S7WB 4HBCL 2BY1A 1JZ7A 4YXKL 3C6LC 3D2UA 4P57A 5MEQA 2QLVB 1VADB 3RGVC 5H37H 1GZQB 4L9LB 1I1FA 2NY0B 4ACPA 4IMLA 3MACH 1FFPA 1AGFB 4P5MA 4R4FL 3MRKB 5I1GH 2EDFA 1H8SA 1F6FB 3DRQB 2VXQH 1NPUA 1PW3A 4X4YB 5GZND 1C12B 3NGBB 3T0EC 4S1RH 1MWAL 3LSOA 1KTLB 2ARJA 4X6DE 1WTGT 4KQ4L 2EDDA 4TVPD 3DBXA 2J3SA 4ELKB 2IC2A 3CSYB 3GB7A 2EZ0C 3CFBA 2DN7A 3KVQA 4R26H 4PJXA 3AY4A 1FNFA 5DJ2A 2E5EA 4IOSD 3BN9D 3E8UH 5HJ3A 3VG0H 5E03A 2KQNA 5F89A 4RGMC 4Z7NE 4LDEB 1I4FB 4X80L 1RD6A 3TBSB 3D39E 1U8KA 3CDGB 4NNPL 1A3LL 3MRBB 5I1KL 1PJ9A 5DUMH 4TUOA 4FN0A 2FJFA 3TNMB 2G2RB 1UACH 2O5ZL 4IEFB 4ELMF 5D2LE 1HXYA 1G9NL 4RIRA 4RWYH 2DL9A 1UJ3C 1UB5A 2DQGH 5D7IE 4OGAD 4PYGA 5GHWH 4RGNE 1SHMA 3O6ML 4HK0B 5IB2A 2O26U 4JQVA 5IBUG 1E27A 2YA0A 3Q0HA 1X4YA 1T5XA 2X7LB 4MQTB 4QCIA 1WSST 4LF3B 3TIDB 1MREL 2ICEB 2AXGB 5D2NE 4Y8AA 5CUSH 4F37F 3P9WB 4PJFF 4PGCA 1FZOA 4JFQA 4F9LC 2J8UE 3QIBB 5C2BH 4MDIA 4NKOA 3PDDA 3LKSB 5DLML 1CD8A 2IFFL 4A6YH 3KPMA 4H1LA 4KAQH 1ZT4B 1B0RB 3OKOB 4Y16A 1KFAL 4LLVA 4OF3A 4NN7B 5LXGH 1SJEA 1KCSL 1QA9B 3HC0A 2X4SA 4XVTL 2CXGA 1BZ9B 5EU7E 1SJEB 1YEFH 4IRSC 1P7QD 4L5FL 1X3DA 3RPKA 2VXTL 4BKLA 2VLJB 4KRMB 3TBVB 1MRCH 1IFHH 3HS0B 1F42A 2ZSVB 5DUPH 2EDXA 3SE8L 1BX2B 4G42B 4G8FB 4JVUA 2RCSL 3L3GA 4GS7B 3TBWB 5CD3B 4YHLL 4QT5B 2GW5A 3AREB 4R90L 3U4BL 2VDKL 1YUHA 5IB3B 1PQZB 3QO0A 2R0WH 2AJUL 1XF2A 1DUYB 2FO4A 1FH5L 3G6DH 1ZA6A 2I24N 3ZMRA 1LO4H 3LIZH 1G7IB 3BZ4A 5B22A 1IFHL 3C08H 1U2HA 5H35A 1G7IA 4OLWH 4YAQA 2XFXB 1ROWA 5ICXB 4WFGD 3I02B 1AFVH 1M4KA 4MAYD 3DUUB 3ARVA 3D5OF 2OS7A 2BVUA 4QRPA 3WJLC 5SWSD 1CQKA 4AMKH 5C70A 1UKTA 3FT4B 3FB5B 5B3JF 3RIFF 5HHQB 1QBAA 3TPKA 2F74A 5DQ9B 2K9UA 1GZPB 3VGHA 1IGFL 2VKWA 1QSEA 4WUUE 3PWVB 1XF4A 3QIBD 2CKBL 3LEYL 3RGVA 5C09A 1RJYA 3KPQA 1NJ9A 4H8WL 3ZDZE 3LCYA 3ZE1E 3QDMB 2F5AH 4IJ3B 3HNTH 4LKCA 3MJ7B 3QO1B 2SEBA 2DQIL 3O4LA 5DJYA 1UWGL 3VFMA 4X6CA 3WKNA 1N3NB 2VLJE 3IU3A 2N56A 3QIWB 3IAQA 3EYVB 1X5JA 1XIWA 4JFDE 4O58H 3TO4D 3MODL 2BNUA 2ZKHL 1W0VB 5J06A 5SWSE 3C5ZB 2AJYL 3PDOA 4DZ8A 5FAAA 5J1TC 2FLRT 3VFSB 5L88H 1JNHB 3DSFH 4JDZB 1KPUA 1WAAA 4HWBH 4IRZL 4XPHL 3MSPA 1NC4D 5L6YL 4Y4KC 2Y06H 1QUNA 5KVGH 1YEEH 1CTOA 5EB9A 1AQKL 2R0LH 1XR9B 3DXAE 3RWHB 1NCWH 2XQYG 4NM4L 4ISVA 4LRNH 3RZCC 4XVSH 1LEIA 3BP7B 1AO7E 2EDQA 2QBWA 3BP6A 1D6EA 5SWQB 4RGOL 2DQUL 4UDUA 1UM5L 2V17H 3QULB 4QRTA 1PSKH 3FCTB 4HLZG 3IRPX 4OZ4B 1ZXQA 5FYKL 4LLVB 4Z0XA 3FO2A 4HJGA 3JV6B 3VXUD 1UJ3A 2GHWB 1L0YA 1M6OA 3FHAA 4GW5A 1UT9A 1JGEA 3NPZB 5J1SC 4JQVC 2H1PH 5C0DB 1ZHKA 2JIXB 5E24E 3FFCA 5H94B 5GHWL 4F37K 1GH7A 3QI9C 4WEBH 4U1LA 4EDXB 5M95B 1DQQA 1B6UA 1J1PH 4NN6C 4NZTH 1FLRL 2FSEA 2DF3A 5T1KA 2YUVA 3VXTA 3PUCA 3ZKMD 1RZKC 4Y16D 3W5NA 2IQAB 3G5ZA 4WW2B 4ZS7H 2XZCH 3HN3A 4HFWA 4BH7B 4TVPE 4R4BB 5AD0B 2CDFB 3O45A 4NNXA 1AHWB 1YMMA 2R8SL 3ARFC 3GSWB 2R29H 1NFKA 4E41B 4PJ9B 3U83A 4KU1A 4WO4D 1MQKL 2H9GA 4PJBB 4L9DA 1QEWB 4LLYB 1SEBA 4U1MA 3CCHB 5BQ7B 2NTFA 1KEGH 1KJMB 4PJCB 3WUWB 1IAKA 5FYLL 1GPOL 4U1GC 2FWOB 1MREH 5EU5A 3QEQD 2I60L 1JJUA 5C0AB 5JLZB 1QFWL 3IFOA 3U4BH 2APVA 5JORA 5BOZG 3RVVC 5J6HA 5JPNA 4HMDA