4QKXB

Structure of beta2 adrenoceptor bound to a covalent agonist and an engineered nanobody
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
b'QVQLQESGGGLVQAGGSLRLSCAASGSIFALNIMGWYRQAPGKQRELVAAIHSGGTTNYANSVKGRFTISRDNAANTVYLQMNSLKPEDTAVYYCNVKDFGAIIYDYDYWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2 adrenergic receptor
publication title Covalent agonists for studying G protein-coupled receptor activation.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Membrane protein/immune system
total genus 28
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2014-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qkxB00
4ODTL 1PG7X 1R3IH 1UA6L 5KG9B 4YHNB 3UJIH 4PJEA 4GKZB 1R3JB 3SDAB 1SEQL 4QRPD 3BYYA 3IF1A 5DD6A 1WC7B 4WO4B 2E9IA 4EZMA 4OIIL 1WIUA 2NY2C 4N8PA 1G7PA 3ABZA 1X5HA 1F4WL 3LEYL 4P57B 1F13A 3S96A 5BMFL 1HYRC 2XWTB 1ZHBB 5I1GL 5CD5D 2HMIC 2WQRA 1EJOH 3O0RL 5FO9B 4OGAD 5F6HI 4X5WA 4HIJB 3BDBA 3VFWA 4Y2DB 5E08H 1FPTH 4N0YL 2I60H 1LE5A 1JFQH 3FRUB 5TE6L 4QOKD 2I9TA 1FVCB 1DR9A 1T0MA 4CVXB 1RK0A 4G9FD 2DYPA 4HDIA 1V7NL 3BKML 3HZKA 1T5XB 1FG2A 2X1WL 3QUXD 5DO2C 1BF2A 1MCQA 2OP4H 3MBXH 4HH9B 3CSGA 1G7HA 4MQXC 2FX7L 1G6RB 3VH8B 4D0DA 1MCKA 3HZVB 2CDGB 4MHHI 2PW2A 4Y4KB 1CE1L 4P9HL 3QQ9C 3REVB 4MZ2A 3N85L 4G43B 4HIJA 1OM3L 4LCUB 5E2JA 2F74A 4HJJH 3JXAA 1ZANL 4RDQG 1N5AB 1GGIL 3GBMH 3MBEC 2IPKB 4UOW0 1R3KB 2NPLX 3LZFL 4Z7NE 4JRYE 3FRUA 1DQJA 1U91B 4JFFB 3V4UL 2JB5H 1ADQH 2GEEA 5DEFA 4M6NH 3QNZA 3OXRA 5HHOE 3FFDB 1VPOL 1Z3GH 5JO5B 5FECB 3WIFB 1XGUB 3P0YL 1ED3B 2HKHL 1G9EA 2UYLB 3QDGB 2QKIB 1AO7E 2B1AL 1WCBB 4QTIL 3QUKA 3REVA 1MEXL 4G43A 2P8PB 1TJHL 4TNVF 5BOZG 2YC1B 1U3JA 3A67H 5GZND 1JNNH 4HHAA 3QULA 1FAIH 4CN1A 3W5NA 2ZCHL 1QO3A 1Z5LA 4GLRI 1KPRB 2X4NB 5DK2B 4JN1H 3CFKB 2A6IB 1ACYH 1HINH 5HI3D 4JFEA 3X3FH 5DJ0A 3SEPA 1NDGB 4H88L 2GTWA 4ZUVA 3X13B 5DEZA 3SO3B 4QXGL 3QDGA 2QKIA 1NCDH 3D87B 3LPWA 4N0FB 3OL2A 1DEEA 3QFJB 1JGUH 2ITDA 3AS3A 1NCNA 5TPWH 3QUYC 4Q6IB 4UV7L 4NNYB 3MX0A 1WITA 4WY7L 4MAYC 1II4E 4ZNCD 2ERJB 3HKFA 5LG1A 1MAML 5L2KE 1YPZE 3GKZA 2F54D 4RAUB 3BAEL 3UBXB 3RVUD 1QKZL 1TPXB 3UJJH 1UACH 3X13A 3NABH 3EO9H 2D9CA 4P4KC 3RKDD 4WCYH 3TT1L 3QIUA 2ZNWA 1S7XA 4J4PD 3ZL4H 1IC7L 4S1QL 4KQ3H 1X5LA 4MDJB 4R7NB 2DBJA 1UJTA 1LO5A 1X5ZA 3MRNA 5IJVA 3KHQA 1KLFA 3I2CL 1FQ9C 3DNKA 4UDTA 3L3KB 5C0FA 1Q72L 3MXWL 5C3LD 3N1GC 1PX4A 4PRDB 4ZO9A 1K8DB 1FNAA 1IC5H 1OP5K 1IKFH 2OQJB 2YUWA 3G5VB 4DCQB 3QEQA 4Q9RL 4EIZC 3WE6A 4EEEA 4NP4H 3RZCA 4YHIB 3TN0B 3SKOB 4HLJA 2JCCA 2IAND 2AW2A 4QRQA 1WZMA 1KIQB 1VGEL 4D8PB 3IFNH 1AR1D 3IDYC 3HG1D 3IU4L 3NTCH 2A73B 3V6FB 3CMOL 1EHLL 1UM4H 2IFGA 4TSBH 3TJHC 4LF3B 4ZSOA 2G5BB 3VG9C 1NCBH 5SWQB 1XIWD 1IQDB 4K2UH 4DFIA 4GAYA 3NAAH 4NDMA 5EZIH 2OJEA 5EU4B 4HKBB 4QHLA 4AK1A 3VW3H 3WNPA 3WJLC 3KYNB 4Y1AD 1P4LA 3VMOA 1EBAA 4D8PA 2NY2B 5B3NA 2V5RA 1XCQB 1U2CA 5EO9B 1S9VA 1QFWI 3QCUL 1J86A 2A73A 3LEXB 1ZHLA 2FO4B 2J5LC 4DAGH 1A7BA 1DQDH 4X4XA 1LK2B 3S35L 2Z91B 4BZ1L 4ERSH 1GC1H 1C16A 2DRUA 3GSNA 3P2TA 4OCYH 3SE8L 3W9EB 4U1LA 1MIML 3RQ3A 1QNZL 4CVUA 1FZMB 1FHGA 5BO1H 2WUCL 1N6VA 5HXMA 3E6HB 4YDJB 5DJ8A 4XNYL 5EU4A 1NGWB 5EU6D 5C9JA 4M4RA 1CU4H 2W65B 3RWJB 4UT7L 3VGAC 4ELKB 3CC5B 1DDHA 5EO0A 2UUDK 4X80H 2NLJA 5EO9A 4XVUD 3L7EA 1DE4B 4EI5A 4WU5B 5MENE 3DSFH 3MSPA 4NBYB 3QDMD 4YZFF 4RDQF 4OLWH 5JXED 4U1HB 3C60C 5I1KH 5F96H 1FZMA 2DLIA 3SN6N 5HDOA 2EKSA 4LFHD 4MA7H 5GS2H 3UPRB 3MBEB 4FQIL 3ZKMD 1B90A 5IFJB 2APTA 3LN4A 3BPCB 1GIGL 2W65A 4BELD 3TBVA 3CC5A 1DBAH 4JR9H 1DVFC 1IAIM 2VDQL 3CFIC 4JCLA 3FO2B 1OPGH 3CVHA 1Q0YL 1KGCE 1DE4A 2VXTL 3QDJE 2VUYA 4WU5A 1ZT7A 4WTZA 3OX8B 4PJ8D 4KZDL 5F21B 4JM2C 1ZHNB 2XNAB 4RGMC 1MWAH 3ARFD 4PJ9A 4WEBL 3WN5A 5CD3B 3KS0H 3PHOA 2K7QA 3SDYL 1BBDL 1KJMA 4UT6L 4R3SB 1I1AD 3MBEA 3M17B 1EV2E 32C2B 3C6LC 2Q7NA 2ZUUA 3NFPB 1K6QL 2ZKHH 3KPPA 1KPUB 5E6IC 3VA2C 3D69A 3MJ9L 4LDOB 1QVOB 1CI5A 2OMBA 4PV9B 3HFMH 3S37X 2ZPKL 3IXAB 5CWSA 3NA9L 5IHZB 2XZAH 3SBWA 2HFEA 3U7WH 2GK2A 3JV6B 5CD3A 1L7IL 2P24B 5J3HC 4JKWA 2QQLH 3IAPA 5FOBA 4DN3H 3LDBB 3ULUD 4NQCD 4XPTL 1XGRA 3QUYB 3IJSA 2BXZA 4U0RC 3S88L 4NKIH 3NFPA 2NW2B 4XRCB 4JQIL 4GUPB 4MAYB 2BNQE 3DUSA 3QQ4A 1EFXA 3WIHL 1YEFL 2OLDA 1BZQK 1AQKL 1N64L 4HT1L 4JJHA 3MGOB 1QSED 2AJSL 3IKCB 3IVKB 5F71A 1TJGH 4P4KB 2VLLB 5DVKA 1JK8B 5F89A 3FCTB 2IBBA 2J4WL 3BDYL 4UDUA 2HP4A 2UY7A 2NY1C 3HNVH 3T4YA 3JV4A 3U9PL 3EW3B 1OTUD 1Z9MA 3MV8B 1E4WL 2V7HB 2NW2A 5BV7H 4XRCA 4C56B 5DMGD 1NL0L 4ALAL 5L2JB 2ESVD 5DQ9B 3MOAL 2ZJSH 3O45B 4D0BB 4M62H 5TH2B 1CDGA 1JYNA 5KTEL 5DWUH 2JLLA 3MGOA 3DV4A 3SE9L 5C0AB 3O6KH 4CUCA 5I1HL 4HUVA 1OHQA 1VHPA 2GK0B 4PJEF 1JMZA 4NNXB 5FYJE 4ODUB 4ODSL 1NGPL 2AGJL 2CKBL 3ULVD 3L3JA 3IDYB 3L3GB 1RHHA 3P77A 3KLSA 1XF2B 3T8XB 4C55A 3VG9B 4DZ8A 5DQ9A 4K9EH 5HI5D 3DVNB 3O45A 2OXHA 4OB5H 1LEGB 4PJDB 4QXUL 5EBMA 4PJCB 5C0AA 1E6OH 1G9MH 2D0GA 3EYFA 2XTJE 4D9QE 5J13C 2A6KA 1RSFA 1RIVL 2GCYB 3Q1SL 4KK9C 5D7LB 4B50A 3DXAA 5DQJB 4ZFOA 4PRBB 4TTDD 2HJKB 2Q8BH 4NO2A 5JHDE 1HHIB 3WNLA 2J5LB 1F6LL 1MJ7H 3DYOA 4Y4FC 3T8XA 4E42B 4Z0XA 1CK0L 4ODXA 3VI3F 4AT6A 3LS4H 3DIFA 3DVNA 1A3RH 3PJSB 1INDH 1V5JA 5GGQH 3UO1L 2EYRA 2HT4C 5E7FA 2CO7B 3SGEH 5T1LA 1AGDA 2W9EH 5DR5H 5FYKE 4JRWA 2EH7H 2GCYA 3VGAB 3GO1L 4YJZL 5C08D 2W0FB 4NZDA 4AG4L 2B1HL 2FYYA 4E42A 2ZUVA 3HPJA 3KPTA 3MLSL 3TBYA 3RTQC 3TZVD 3AREA 1BZ9B 1Q9OA 2C5DC 4YBLC 1ZEAL 2E7LA 2VMFA 1T7ZA 1B88A 2FIKB 4KAQL 4RZCA 3FN3A 3WS3A 3SDAD 2JIXD 1YJDC 1M05B 3LMJL 4WTZG 2OM5A 3G5XA 4WO4D 4RAVB 1DVFB 3NH7L 5F9JB 1S9XA 3OAZH 4PRHE 4ZAKA 4RFNB 1O5DT 4PGDB 2AI0L 4ZS6D 1NAMH 1T22B 4PJBA 1I85A 4PP2B 1QFUH 2WNGA 2IWGA 4CU6A 3KNBB 1CZ8L 4LSRH 3C60A 4OCXL 3T2NL 4GMSL 3J7HA 1I7UB 4RGMB 5EULV 1F00I 4MNHB 1NMBH 2J1KA 3M1BB 3FN9A 4H1LB 2QR0A 4LQFL 4NM8L 5LCVH 3V4PL 1EGJH 2FIKA 4Y2DD 1CLOH 5J12C 1BFOA 1OGTA 2D0HA 4M4PA 4UOJA 3T0WA 5IMOB 2FO1A 1FVEA 2W60A 4MXWL 1AHWC 3QCTH 3V5DA 5E6IB 2EDBA 4NRYB 3H0TA 3AUVA 1FZKA 4M48H 3MRJB 5EZLA 4ONGH 2JE8A 3RNQA 4JM2A 2EDYA 2FZ3A 2ZCKL 2VDKL 5ADOH 4IHOA 4KK6C 1KCUH 3QHFH 4QRPE 4LPYA 5B39B 4LLDB 4LCIL 4YDLC 3FB6A 5INDB 4Y5YA 4JDZA 2FJGA 1OB1A 3B2UC 3C6LA 4U0RB 4CBPA 5EBGA 3T04D 5A43C 3TFKD 2NYYD 4OV5B 3NCJL 4PGBA 2X1XR 5E6IA 4JFFD 1JWUB 4M7LT 5FIEA 4JFHD 3OR7A 4Z7VE 1WVZA 3P4OA 3UPCA 1A6UL 2C3VB 1HWHB 1INQB 4XC1L 3MLRL 1AGBB 3FQTA 5B39A 2HWZL 4KDVA 3ARSA 4TTGA 1NGXA 4FFWC 1H3PH 4ZNEE 4G9FE 4LPXA 2C1PA 3D0LA 2JJVA 4RFOL 2DQGL 4PJAE 3MOBH 3QEHB 4QRUB 4QLRA 4ZO6A 3TVMA 3WKNA 1UEYA 2QBWA 1K9TA 1MLBA 3G6AB 4K23L 4R0LC 4DGYL 2VUOA 3VD9A 2YPVL 2QSQA 3O8XB 4ZTOL 3B9KC 4XCFH 5IB5A 4XXDB 2H6PA 4A2LA 4HK0B 3UAJD 3BSZH 1SEBB 2EYSA 3V0VB 2Z0BA 4Z6AT 5H2BA 2BFVL 2FJHA 2P5EA 5FA4A 1L0YA 4JQXA 2O93L 2R2HB 1P4BL 3QFJD 3TYFA 5IEKB 2VLRB 1L4IA 5SX4I 5D8JL 2Y5EA 3IFPB 2HRLA 1FL5B 1BWMA 1TZHB 3AFLA 3I9GL 5SWZB 3TT3H 4K7FB 1AI1H 3FFCD 5E6ZA 3TA3B 5IMKB 5HHPA 2G2RA 1UXWB 3K74B 2DDQH 2PYFB 3WFEL 5C09B 1U93A 5J1SC 5J13B 2A38A 4NWTL 4I8DA 2PYEE 3S4SB 2WBJD 5HGDB 3UC0L 5H35A 2R2HA 2YN3A 3SDCA 3ZKXB 1ORSB 2AQ2A 3SJVA 2VLRA 3D1MC 3RWGA 5FUOH 4K3JL 2FX9H 2WBKA 4G8EA 4MX7B 2E9WA 5ALCL 1QLFB 1QBLL 1NJ9B 4G9DB 4GRWH 3VGGA 1RUAL 3GSOA 3EO0A 2CH8A 4O51A 3HTLX 4ODBD 1QA9B 2DQUL 5SWZA 2R4RH 4K7FA 4C83B 2G60L 3L5XH 5ID1A 5IMKA 4YDIH 3DV6A 3B3IB 3SDXE 4HLZH 5CIPH 3MGAA 3EYQD 4L8CA 5E9DB 2O5YH 4Z7UE 3MNZB 5I8KL 1I8KA 3TN0D 2LU7A 2VR5A 4FFYH 3DUUA 3ECBA 3QZWA 4K3DH 3UP1A 1CWVA 3FB8A 2GSIA 2NZ9D 3TO2B 2X4RB 3B6SA 5MP6L 4Y4FA 2D4DA 2E7HA 3CDCA 1IM9B 2B2XH 1MCWW 4K94H 3AS0A 3V0WL 5CGMA 1G1CA 4U33A 5B4MC 4DZBB 2F8OA 1IRAY 4YBLB 5J6HB 3L6FA 3W2DH 2MKWA 2ZSWB 5C0CD 4NKOB 1MI5D 2M1KA 3HI5L 4YDVB 4LSDA 5JW4N 1RVFH 1T1WB 3MRPB 3R06B 4LLVB 5INCB 2PW1A 1ADQA 4L8SC 5IWLC 4I13B 3GNMH 4JPWL 1K2DA 5GIRA 4GAFB 3B9EA 1HXYB 4H26A 2PKDA 1VADB 4IRJC 2X4RA 3BZEB 5EU3A 4LEOB 4NJAH 3F7PC 2DQEL 4Z77A 3PUCA 1FE8L 1MJ8L 3RTQA 4YE4H 1LP9F 5M95B 3D3VE 1RAMA 2CPCA 2OYPA 4PRNA 3NZHH 5INCA 5DYOB 5C0BE 3WL9B 3A6CH 4KMQA 1HQRB 1CE6B 4LK4A 3K8LA 5AWNH 4M1GH 5ISZB 1NUFA 1WSST 3LKNB 1JGVH 3CSYB 4OZIA 1ZA6A 4MQXD 5CMAA 4HIEA 5FOJA 4OLXL 3ES6B 3RPKA 2A0LC 1SHMA 3QQ9D 5EORH 4YDLB 5IM7B 1HK6A 3RWHB 3QRFM 3GSWB 4ORGA 3HI6H 1FL6B 3K1KC 2DD8L 1NH6A 1EA9C 1AY1H 2DQDL 4K8RL 5FGCB 1AHWA 3P30L 1EERB 2YUZA 5B39G 3L5WB 5IW1A 5C0RL 3ARQA 3JV0A 2DQJL 2P42B 2Y4SA 3CSYA 4MDIA 4FXKA 4E0RA 1BF8A 2NY0C 3CUPB 3HNSL 5HHNA 3DVGB 2XWJA 3P0VH 5CJQH 3UPAA 5JQ6H 1W0YT 1MFBH 1U3HC 3BX7C 3VFPA 2VXSH 3SGEI 4C58B 3QI9C 2OL3L 1KV3A 4LRIA 1P6FA 3MJ7A 4OLZH 1U8NA 2B8OT 2VDML 3QDME 4KKAC 4R0LB 1SVCP 3MRQB 4HK3J 5JUEH 2UVEA 4JHAL 3QEUB 2YPLA 4RA0C 3B9KB 4FQ1L 1G9MC 1PQZB 5J1TC 4G7YH 2FX8H 4M8QB 1GGYA 3ARGC 5L6YH 1TFHA 4JFZL 1A9EB 4QT5A 1KTLB 2XN9B 3MGTA 4X6DE 5M94B 5DFVC 1WWAX 3B4NA 3QPQD 2OX5A 5CBEB 1CIDA 2VLJD 1LO2H 4U6VL 5D5ME 5T3ZH 2R4SH 1KJ2H 3KPRD 5FKPA 1RUPH 4MYWB 5HD8D 2VL5A 4MAYD 4YFEA 4U1GC 3K4ZA 3UEZA 4U1MB 1A6AA 4I5BB 3O2DH 5HI4D 4F7PB 3C8KA 1PVHA 3O3DB 1K8IB 1QHOA 1KTLA 4GW1A 2ADFL 5DFWH 4I0PC 2CSPA 2VJXA 4DWHA 1A14L 1MRDH 2XTLA 4I4WB 1I8IA 1YMMA 3D48R 1MHPL 4XP9L 4WFFE 4PR5A 1Q8MA 3EOTL 5DMIL 3MV8D 2BNRB 5MHSD 4OGYH 2X89D 4ZFZA 2MPAL 5DTFA 3RWFA 5CCKH 2K3TA 3NN8B 3QZWG 4K7PH 1NPUA 1VEPA 2UWEB 2RAMA 2A2QT 2ITCA 1CFNB 4GKSB 1AD0A 1GL4B 5GHWH 3ULUE 3NCMA 4NQCE 4P49A 4NKDB 2EDKA 1NKRA 1U9KA 4KKBD 1QBMH 5GS0D 4X6CE 25C8L 1WBYB 4RBPH 4XVJH 5C8JB 1WFUA 2AXFA 1I4FB 2RB8A 1EVUA 4RWHA 2CLRB 4IJ3B 4JGUA 3ZHLA 1YEEL 3HC0B 4OM0H 1MWAB 1AGEA 5DURB 5I1CL 4PJBF 5A2FA 1BJMA 1DBMH 1I7ZB 3TH2T 3ZYIA 3WXWL 3GRWH 1B2WL 5TE4L 3HC3L 3O4LE 1CFNA 1BVLA 3ZYJA 4ETYA 1JNHB 1XT5A 5TDOB 1IGYB 4NKDA 4Z7WA 1SY6L 3F7QA 5F9OH 3U4BL 5J56B 3BT2L 4OQTH 3ARWA 3ARYA 4GS7C 4IRJB 5D7LD 4TUKL 1I4FA 4NYLA 1F3JA 3SGDI 5DK0A 4WWKA 3GSQB 2D7TL 4U6XA 1N0XL 1MWAA 1QSFA 5D7KD 1ONQB 2IQAA 3VDCA 3RUGA 5HVWA 3U0WH 4FQLH 4YWGH 1T6WA 5GSVB 4TNWF 2Y36L 3OBAA 1RURL 1HEZA 1MQKL 3NCYP 3MA9H 3DSNA 1JNHA 3T3PF 3N1FC 1IGYA 2M2DA 2OTUA 2ZUSA 4M1CD 2VLKA 4L8SA 4OCWH 3BIAX 3VWKC 5L7XL 4Q0XL 3QWQB 3OKDA 3VD3A 4HMDA 1FL3A 3LKPB 4D3CL 1SJHA 3D2UB 5D1XC 1OWRM 3ZDYF 4JG0L 4G8IB 5HHMB 4OF7A 1MPAL 5EC1B 2IPUG 4ONHA 5D2NE 4UT9H 5DD0H 2IQ9L 3D39A 5IGXL 5IF0A 3IT8D 5J4MA 3IFOA 3RU8H 1LNUB 3SKUD 5DUBB 3JUZA 2DN7A 5C0JA 1I9EA 2GUOB 4XXCC 4N8CL 5DJAA 1I9IL 1T21B 2VZSA 3QRGL 5F6HJ 5C2BL 3LKPA 5LBSH 4JLRB 4DK6A 4ISVA 4N8VB 1UCTA 1HKLL 5IW6A 2NY0B 3EDDA 4PUBH 2X1PA 1CQYA 1RJZB 2AXJA 3BD5A 5EC1A 3PWPE 4LU5L 1U3HB 5C08E 2RHEA 2VO5A 1D6VL 1DBKH 2QHRH 3QI9B 1LNUA 2AJZA 5K59E 2IAMC 1EEQA 3TESA 4MJ5A 5DQDH 4U7KA 4YR6B 4QHMB 3GJFH 1X4YA 1V3MA 1F58H 5CS7A 3BIBX 1CGUA 1GZQA 3HCVA 3RGVD 5KSAD 3BGMB 4PJIB 1AKJB 1RJZA 5HDQL 3TLRA 3DPBA 3ILPA 1CFSB 1BQHB 1UKQA 5LXGL 5AG8A 3LN5A 2FL5B 5I16B 2R29L 3GI9H 2A77H 2R2EA 1X5YA 1CLYH 4U1IB 2FD6L 1P2CB 4APQA 3OTTA 2RR3A 5D72L 1HSBB 2DF3A 3L5JA 5ID0B 2KKQA 5C6TH 4BH7B 1JHKL 4U1GB 2W0LA 4MD5B 5IR1B 1I1YB 4XGZA 3L7FA 2I07B 1AGFA 2AS5M 1A8JH 3VCLA 4XBPA 5HBBA 3ZDXF 1UB5A 3ARGA 4LARL 1ITCA 5T1MA 5CJBA 5D1QA 3AAZB 4MNGE 3VXUB 4I0PB 3WKML 4YHOL 1PX3A 1N6QH 4QGTA 4N0UA 4M5YH 1NC2B 5IB2A 5DFTA 1MFAL 2GT9A 4NUGL 2GJ6A 4AIZB 3MUGB 2I07A 5IFAL 2BSRB 3O8XD 1MFDL 1UWGL 1QRNA 4UIMB 5EOCL 3ORJA 3MRKA 4LSTH 4BQ6A 1IEBB 4POZC 1FGNH 5CJOH 4Y16A 5JTWA 3C08L 1K5NA 1OAUH 4WFHE 3THML 5ERWA 4WWID 3CVHL 3B9DA 4FZEL 3RBGA 1SM3H 2YD5A 4PJXB 5BRZB 4PJGE 3T0DA 3NCYS 3EJYC 2FBJH 5IKCB 3HI1B 2XQYG 3QHTC 4HK3N 1JTTA 1OSPH 2F58H 3P73B 4LNRA 3OKOA 5ETUA 1CGXA 3TA3D 3RWDB 5KBNC 4X6EA 4M3JA 3ARPA 4I18C 3JWOH 1IEBA 5C09D 3C5SB 1RUKL 1FRGH 4NT6B 2JB6B 5HGAA 3LH2L 1D6EA 2VZVA 2O5XH 1NAMA 2NY5H 1FO0H 4GS7B 3P4NB 4KK9D 2X4TB 2AJ3B 1RZ8A 2OZ4L 4JFQB 4P5MA 3VFGL 4L3EB 1A4JA 3QXAA 1A0QH 3T65A 1IM3B 1C7TA 5B22A 2P7TB 1I7RB 1IQWH 3ROOB 4ZG1A 4OF8A 2Z4QA 2APFA 2DQFA 2RFXA 3C8HA 3GSUA 1EGJA 1ODAA 3KPOB 4PLJC 4I3RL 4NQDE 3ARBC 3WFHB 1A3LH 2FECI 3MV7B 4Z5RA 3VWKB 4L29A 1KUMA 5AYUL 5HHQB 3QIWC 1LD9B 1IGTA 1YEIL 4XCEB 4LLUA 5D1XB 4NQEA 4RRPA 1A6VH 1JPGB 4MSWA 3FFCE 2MNUA 3NCEB 3WEXB 1IM9D 2AJXL 3C2SA 1PJ9A 4S1DC 3DX6B 5FHBL 3IDJB 4PJ5E 1KACB 4BZYA 1OL0A 2BVUA 4IRSC 1X3DA 5MEPB 4Q2ZB 3MV7A 2FWOA 3VE0A 3VWKA 2XWBB 4KRPC 2PCPB 2W91A 2AEQL 1J0IA 3BH8A 3BP5A 2I26N 3X12B 5DHYA 2HRPL 3D25B 3ALWA 4LSQH 4XMPH 1MVUB 1YPZF 5FGBC 1FBIH 3WEXA 3FQNB 5DJCB 1AQDA 1TMCB 1MCLA 3UTTE 1P7QA 2E6PA 4G8GB 4FNLL 1TVHA 3E8UL 4XZUB 5E8NA 5I2IA 5SWSD 4YPJA 3QUMB 4YEEA 2IAMB 4G80B 5JIPA 4YHYC 2XFXB 1T1YA 3M8OL 1WFNA 1A21A 4CNIA 2DLGA 2VLME 1X5KA 1IGIH 3SQOL 3QXDA 5ISZD 1P9MA 1EZVX 1X6LA 3W11D 1S9KC 5HHVH 5C07B 5I1EL 1BBJA 1T80A 4S2SB 2VZ1A 5C0CE 1MI5E 5BW7A 5JIHA 3BWAB 4JKLA 4TNVK 4K07A 4LOUD 4RMRA 5F1IB 2WIIA 5MERA 4V2BA 3PGCB 1CFTB 3FTGB 4MB3A 1N3NA 2WBWB 5AYQA 4G80A 3CMGA 2NY7H 3LEVL 3RAJL 1BEYH 3ZT6A 5IVXA 5J11C 5AAWA 4ZFOL 1BQHG 4KWUA 2R1XB 2LAGB 3ZTNH 1LILA 2Q6WA 1J9CT 1KJVB 3LB6C 4WUUB 4XC3H 3FO0L 3GUTB 5JMRA 5EUOE 4S1RH 1LO4L 5E8EB 1XZ0B 4YFDB 2MQCA 3HR5B 3FTGA 4UV4H 4PJHA 5KAQF 1W0VA 4JFOA 1WAAF 2HVKA 1BWWA 1JP5A 1UA6H 4HBCH 1DN2A 1ZLSL 1A1NB 3MQIA 4P46C 4KV5E 4WGWB 1OTTD 1TCMA 4L8DB 1YEGL 5CIPA 1DL7H 1U8QB 3LRGA 4ZYKA 3PL6B 3B9KD 5DS8A 4FMKA 4GG6B 2ICEB 2FGWL 5F1NA 5E8EA 1CQKA 3X11B 1BLNB 2NR6D 4HWNA 2XN9D 4Z7WF 2ED7A 1WTLA 4WI5A 1IAIL 1FYTA 4MNQB 4N0CC 4I77L 5J6GA 3TO4C 3O0RH 5MI0B 3ROLB 1M71B 4GW4A 1MCBA 1M7XA 4HF5L 2W0KA 3BE1L 1WZKA 5DI8A 3KYOB 3SKNB 4N0YH 5I8EB 3WLWD 4LBEA 3VRIB 4BKLA 5D7IA 3G08A 1EMTL 2ICEA 5TE6H 5C6PB 2YA2A 2H9GB 3VRLE 1V7NH 5IFHL 1Q38A 4PB0L 2J12B 4BSJA 4KI5E 4PGCB 5ACMA 1UCBH 2YMXH 4MNQA 2IH3B 5JPNB 2VSCA 2GHWB 5E94A 1HHJB 3QIBB 4P9HH 4DKFH 1QTYT 1A4KA 3N85H 4U6HB 1HHGB 4DOHE 5FO7B 2LAAA 2F53D 4ZUUA 5EZOL 4R96B 3T0EC 1RK1B 2CDEA 1MCNA 3ARBB 4I18A 4YGVB 3V4UH 1IILE 2VZOA 5B8CB 4EUPH 2VLJE 5ADPL 5I8CA 4PGCA 3EUUA 1G7MB 4KHXH 4NFDA 1VPOH 4PJ7B 1JE6A 2DJSA 3KPRE 4KJWD 3IJYB 3P0YH 5JPNA 2E8YA 3FHAA 1C12A 3EYVA 1M6OB 1CIUA 1I9RL 1T1ZB 1TJHH 5HGHB 1QFWM 1RUQL 3DUHA 3KPNB 4YBQC 5DURD 5IBUG 3AS2A 5GGTH 3R0MA 5I71C 3DMMD 4BUGA 1RK1A 4OLUH 1P5VA 4IRSB 4WGVB 4LHUB 3U2SB 4YGVA 1DSFL 3G04B 3HC4L 3ZHKA 2QQNH 3BISA 1NCWH 3LKQB 5T33L 3L1OH 3I75B 5JDSA 4X9FA 1G7MA 3QIWA 2X4OB 3LCYA 5TQ2L 1PD6A 2C26A 4H88H 4IRJD 4LKCA 1FGVL 3HB3C 4G42A 1CN4A 2Y5TA 3BJ91 3SPVB 4GJTB 4ELMA 1YQVH 4MZ3A 3U48A 3I6LD 5CSGA 1J1OL 3SDDC 4WY7H 4X7DC 1KJ2B 1GZPA 2BOCB 4HS8H 1KB5B 3I75A 4MVBD 3EBAA 3V0AC 1TZIB 4HWEL 1R3IL 4XCNB 3GMPB 3UJIL 3CXDL 4X98A 4JO4L 1IC1A 2P8LB 4Q97A 2VDNL 1IC7H 3ZE2E 3OKNB 1CL7I 5HHMD 3L9RB 4XT1C 2X4UB 3I2CH 3HZMB 4PRPE 5BXFB 1MCRA 1PSKL 5J11B 3OJ2C 1KJ2A 4WU7B 2XY2A 4NN7C 5GGRB 1QFPA 4PP1C 3P9LA 5FK9A 2I5YH 4KJYA 5D1ZD 4Q9RH 2GKIA 3MRBA 5JPMB 3O2DA 2VISA 3GMPA 3IXTA 3C5ZD 3QXTA 4JRXE 1IL1B 5FYLL 5E08L 2C7UB 2VH5H 1XGPB 1FPTL 1CG9B 2I60L 1ZVSB 1VGEH 1JFQL 5I73C 2BNUB 2XG5A 1GGBH 5FDYA 2OR7A 4HLZG 1U3HD 4FQQB 4DGIH 4BSVB 1PZ5B 3FQUA 3QI9D 4AIOA 4WJ5B 2OP4L 3F8UB 3MBXL 4WW2A 1VFBA 2MHAB 3OKKB 2DMKA 1I3VA 3K2UL 4S0TD 3O3EB 2AKRB 4P46B 5DJ6B 1T66D 1C8PA 2I27N 1HNFA 2PTTA 2W0PA 3AGVA 2IADA 4HJJL 1J10A 4OGXL 1Y18A 3JWOC 3QAZC 4OFIA 5FV2A 2NX5E 4GKNA 2X70A 3UTPD 1AKJD 2BNUA 5DXWA 3RJQB 1RJYB 5DZNA 3HUJE 2NY5C 3ZE0F 3HPLB 4OIBA 1ADQL 4M6NL 4JCMA 1EK3A 5BZWA 3PXJA 4IM8A 5KS9A 3S35H 1CLZL 1Z3GL 2FDBP 3MLWH 5D71H 5CEZE 1UZ6E 3GRWA 3FKUS 1QNZH 5JMOC 1ZOXA 5JHLH 5I1DB 2EEBA 1FAIL 4OQTA 3FJTA 3QO1B 5E8PB 4MA8H 5CHNA 4PTTA 1YJDL 4YH6A 4JN1L 2Q76B 4H8WH 4I0PD 1WIOA 2X40A 5GSRA 5A40E 1BHGA 4WI2A 1S9YA 4L1HA 3T0XA 1ACYL 3CFBA 4LCWD 1JBJA 1HINL 5F9WB 1OF2A 3V7MA 2CKNA 3TO4A 3OHXB 3C09C 1NC2D 5A3IC 1YDPB 5DMJB 1NCDL 3FOMA 2UZYB 4PY7A 2J8UA 2ZSVA 3T0EB 1JGUL 4FQIH 3WUWB 1GIGH 3GSXB 4N9GB 4L4VD 3B5TA 1C5DB 2HT2D 5TPWL 3S3SA 5GRUH 3PQYB 4X0KB 2EYTA 3WHE1 4KZDH 3Q48A 4OGZA 1Y0LB 1OARL 5BVJB 3OHXA 12E8H 3UJJL 1KCSH 3AM8C 4R4ND 4UINH 3S5LA 3EO9L 2UY6A 4WCYL 3HAEH 1BBDH 2CJUH 5D2LB 2VR4A 5L0QC 3KS0J 4UT6H 1JGDA 5I71B 5IIEB 4WI4A 3WMSA 4HWBH 1CFVH 3P11H 2BHUA 1K6QH 5D6DC 3RBSA 4AM0A 3DX7B 4CJ1A 4NC0B 5HVGB 3UTZB 4MHHG 5MEQB 1BM3H 1IC5L 3KYKL 1HYSC 4Y5VC 1IKFL 1EEYB 4LHUG 4Z7VF 3CFCH 3KYMA 4L3ED 1L7IH 4MJIB 5CP7A 4TUJA 2HTKD 1DLHA 4NP4L 2CIKA 5E5RB 3O6FC 3HE7B 3IFNL 1Q9KB 4X6BB 3L3IA 3NTCL 2EDXA 1C08B 3T77A 3UTQA 1WIPA 3SDDB 1JN6A 2R0KH 3GJFA 5DSCA 4TSBL 5FF6B 1NCCH 3IYLW 4J23A 1L9MA 4PS4H 2ILLA 1NCBL 1AQKH 5MEQA 3BW9A 4K2UL 4HT1H 2DLHA 4U6TA 3WUZA 2P47B 4JJ5A 3O3BA 3TPKA 4Y4HC 2Y7QB 5D1XD 3NAAL 5EZIL 5GQBA 4WRLA 4Y19A 3R1GL 3IETB 4FQJH 1MREL 5F7MC 3HMXH 4M7LH 2R0ZL 1QBAA 3O11B 2FR4B 1B6DA 1NL0H 4I48A 4ALAH 1I9JL 4GRWF 4NN7B 4DAGL 1DQDL 4PJHF 4P2RE 2ED8A 2ZZUT 4ERSL 2KZWA 2ZUQC 5M7QA 1NFDE 5FCSH 3STBA 3ZTJG 1ZLVK 1NDMB 3S7GA 5I1AA 3LQMA 5BO1L 4Y5XC 2WWMC 1D5XB 3RVWC 4JDVB 1VKXA 2YPKB 4PGJA 5I73B 2CKBH 4X80L 1DZBA 4P5KB 1KELH 4G8GD 5JA9A 5JIKA 4BK4A 4I9WE 4WHCA 4F7TB 2IAMD 3BKJL 5LQBH 3TYGH 5IG7A 3DSFL 4QRTB 4OLWL 4YIQA 1FIGH 4BA8A 1DQML 5I1KL 4BK5A 4U1JB 2X4PA 3ARVA 1J1PH 2ICWA 4QYOA 3C6SB 4PLOB 1ETZB 4X6FB 3RZCD 3JTTA 3KPSE 2HKFL 5E03A 2V2TB 4K3EL 5DEGB 5C07D 1KLGB 1JPSH 3Q1SH 4ZPVA 4Z7UF 4JREC 1DBAL 3P9MB 4JR9L 1JNJA 4QY8A 2BX5A 4W6WB 2CUMA 3UYPA 1FJ1B 1B9ZA 5SV3A 2IALA 2HAZA 3FB5B 1CK0H 4OFKA 5ENWB 4DGVH 3QBTB 3CPLA 3ULSA 4QRTA 3UO1H 4J3UA 1EVTC 5JOPE 3BP7A 1MWAL 2WINA 1ZMYA 3EDEA 3TNNB 4NKMA 4PY8I 4OF3A 4WUUD 2H41A 4P2QE 5SWSE 4X8JB 1MCEA 3BP6B 4X9HA 4KGLA 2D2OA 2ZKHL 1JF1B 1YA5A 2W92A 4M6OL 1MFEL 5JW5B 3Q5YA 1ND0A 4JFXB 3C09B 5IVZA 3WIIH 5HPOA 2YWZA 3VD4A 1MIEL 2XZAL 4XP1H 3U7WL 2Q3ZA 4YHPA 2VSDA 3WLBB 1ZEAH 4CDGC 3P4MA 4JRYB 4KAQH 2QQLL 4DN3L 4ENEC 4JO3L 3W9DA 3TPUB 1D5BA 2ARJA 5DT1H 2EIZB 3PL6D 2DL9A 2LQRA 5HHOB 4UI2A 4ZXBC 4YGAB 1BIIB 2EDOA 5FHAL 4NKIL 3S5LG 5JORA 1XF5B 1SYVA 4TSCL 2EH8H 1AO7B 1B0WA 5FGCE 3PWVA 5BJTB 1CZ8H 3MREA 2EE3A 1CGWA 4HAFA 4OUOA 3QUZA 4J3SA 1TJGL 2VABB 4Z0BH 5GRVL 2CLZB 3EJYD 2OS7A 4LQFH 2MOVA 1NBQA 1EDQA 3VFRA 2D7NA 3L3HB 4ODWA 3HZYA 4XBGA 4ELMF 1LE9B 1OAZH 4OSUH 5DRWB 2FSEB 1VB9A 4WHTB 3H7LA 4GXVH 3WFCL 2YUXA 4Y5VB 5DUMH 1IC4L 1Q1JL 3FOLB 4M62L 4N5UA 4YNYB 3VMNA 1XEDA 4NUJA 5DWUL 3AM8A 3O6KL 3QIBD 4PJ9D 1OLZA 4LCIH 3QQ3B 1NBYA 3O6FB 1U6AH 4OJFL 2O61A 5L2KB 1YPZB 3ARBD 5JLZB 4HIIA 1QEWB 1H3WM 5K9QI 3WDIA 3MLUH 2FGZA 3PGDA 4KRLB 4OB5L 1MAKA 3C5JA 5EN2B 4AL8L 2EDWA 4Y4HB 5DC0A 5HPMB 3T3MF 3MLRH 4WTWA 2GQHA 3TV3H 1E6OL 2HWZH 3PDOB 1G9ML 2CQVA 1CICC 4LSPH 3TJEL 1BZ7B 4S1DD 4L9LC 3VXMA 4CGTA 1M7DA 1HILB 2ZOKA 4X6DF 3W0WE 2R2BA 1OGAA 1VACB 1ZLUH 4IRSD 3QO0A 4LHUD 5JLZA 1WBXA 1R24B 2EECA 4Z18A 2FH8A 4F7EA 3VFOB 1HH9B 1IAOB 3T4AB 4WW2F 3OAYK 3NVQA 1INDL 2F53E 1UT9A 1ZGLM 1N4XH 3VXSA 3PDOA 5KSVB 2W9EL 1FLRH 5DR5L 4HFWA 5BS0E 4QHNA 3TIEB 2EH7L 3VXRE 1BQUA 2E9JA 1EAJA 2BMKB 5DUPH 1EO7A 4HUUA 3LD8C 3GSRB 3MLTB 1Q9LA 1X7QA 3GJEB 3H7BB 4OD2A 5CSZA 1TETH 2NCMA 4R4BA 3T4AA 2XTJC 5HYQB 3PDGA 4I2XE 3WFEH 1KEGL 4MQTB 1HOCA 4JKMA 4Y5XA 4HV8A 2HTLC 3LY6A 3MRRB 4PRAB 4GFTB 4UNUA 5GGUA 4XNZC 5DRXB 4LLQB 4QRSB 3DETD 3MZTA 1CD0A 4O02H 4PG9B 4H8WC 4JREB 3DLQR 3U4AA 3BIKA 2E7CA 2VZUA 5ALCH 2P1YA 1W0WA 2GJZA 4X6CF 3M07A 1REIA 1A7RH 3MLTA 1WT5C 1OAQL 1AIFA 3HMWH 5E1HB 1QFUL 2ADJA 3I6GB 2R56H 2G60H 2AV1B 3LKRA 1F02I 2Q7YA 1UWXK 2IH1B 5ESVB 3VXQA 1TCRA 4NZJA 5LCVL 2WZPD 1EGJL 1CLOL 1WQVT 5KSBA 5CJ8A 4DUXA 4LKXB 4PG9A 4XNQA 2UV3A 5MENB 3BHBB 1R3LA 3TCLA 4FXLA 4AIXA 5MP6H 3KXFA 2CRZA 5ANME 3V4VL 5JW4R 3V0WH 1QUNA 2AXGB 3EYOB 4RX4D 4X4YB 2AABH 3KLHD 1L0XA 3KPQA 5ADOL 3IDNB 1S78C 1KCUL 4PJFA 3QHFL 3UTSE 1HQ4B 4P46D 3ULUH 5CGYC 3CSBA 4AEHL 5EC2A 2ARJQ 4EUPA 4JPVH 4UQ2A 1FV1B 1SYSB 4MCYB 3AMLA 3QDJB 4JPWH 4ZXBB 1S7QA 1KENL 1F4YH 1JVKA 3KWWA 1A6WH 3CDGB 4TVPL 5EO1B 4NZRH 3LS5H 2DQEH 2PXYC 4N0CD 5GRZA 4LASH 4TUOA 4K3HA 1JGEB 4LDEB 3ARED 3H9HB 5ICXB 3SE4A 4BFIB 5GGTA 1IAKA 3RWEB 5I76A 5F7WC 1TIUA 2EO9A 4F7CB 3MRCB 1RIUH 5LGHH 4XBEL 1H3PL 1SYSA 1QZ1A 3V6ZB 2R15A 4MMXC 3TEUA 3MOBL 4HCRH 1W72B 2EXWC 4G8FB 2FEEL 1GOHA 4ODVL 4Z76B 4OLXH 4PYGA 4YHZL 4JN2A 1PYWA 2ICES 3MO1A 2V9TA 5D6CA 5BQ7A 3ULVH 1IMHC 1XCTB 5EIIB 5L8LB 4JPKH 3EOAB 4ESKA 2BNQB 2DD8H 5TDPB 1U8PA 4P0DA 2R1YB 2DQDH 1NEZB 3GMMB 2N1KA 3QUML 1X5IA 4OUUB 3PQYD 1HDMB 4JY4A 4OLEA 3MFFB 3TT3L 2HFFB 4PJEE 5HVHC 1YEDB 3GMNB 1AI1L 1U0QA 1ZGLB 2Z8RA 3HNSH 4KTEL 3EJZD 4XCYB 3TCXA 1HHKB 2DDQL 4W68A 4YPGB 4MB5A 3FT4B 3PXHA 3U0PB 5FM8A 1P7KB 3T1FA 1HKFA 4FTVA 4L9LB 3QUXC 1E4KC 4QXWA 3O2WH 2WQ8A 2LE9A 1TQBC 1YEHL 3AY4C 2ZCLL 5FUOL 1J5OL 4LCWE 5FKAA 2BOBA 3RWCB 5D70H 4BH8A 3BPNC 2FB4H 5ESAA 3ZSTA 3JTSB 2R4RL 4CAGA 1W8OA 1YEDA 3S34H 3L5XL 3MJ8B 3LV3B 4JFZH 3HB3D 1MVFA 5ICYA 3OJDB 4ZOAA 4KXZH 1CICA 2O5YL 4MJID 3D18B 4L4VE 4AQOA 4FFYL 4GT7A 4K3DL 3HE7D 4U6VH 3LD8B 5E99H 3VI3E 1HCVA 1KYOJ 3SDDD 2XKUA 1B0RB 4NQSB 2B2XL 4K94L 4IOIB 43C9A 5GZNC 3GB7B 4GSDL 2XTJB 4PFEA 1I3RA 4RNRA 3TBTA 2Q20A 4FQXC 1NGZA 4U1SA 3W2DL 1EO8H 4XNZB 5F7YC 1DUZB 2P5ED 2KDGA 2L7JA 1N2RA 4ZFGL 1CBVH 1CGVA 5GS3A 1RVFL 4ZQKA 5JHDB 5HI3C 3N1PC 3BVNB 4R4FH 1U8LB 5L8KB 2X5PA 4XP9H 3GNML 4WNQB 1I1CA 1F90L 1S7RB 1TZGH 2MPAH 3VI4F 1F4XL 4B5EA 4NJAL 2DQTL 4HWZA 1F6AB 4YE4L 4IOSD 5JNYB 2EDQA 3MZGB 1CTNA 5IB3A 1XF3A 3EOYG 1O7VA 3LKSB 2NNAA 3L95B 5DC9B 3DJ9A 4N1EA 5JOFB 6FABL 1A9BA 2BHYA 3I3DA 3NZHL 3EO1B 1AXTL 4H5SB 3MNWB 3WS6A 3A6BL 3GKWH 5C0IB 4XB8A 5AWNL 1S7RA 4JFEE 3GMLA 3OSKA 4Y7MA 4EUPG 1G6RH 1JGVL 2CRIA 4J4PC 1PG7W 1DLFL 3BUYB 3DI2B 2E6QA 5KVGH 2P46B 3HC3H 4GRLA 4HUWA 5DJZA 5JNYA 2AK4A 3DO7B 5J89A 3MODH 2A6DA 5DDHA 3MRHA 5EORL 5DD5H 1SY6H 2F5AL 3BJLA 4PRHB 1EEUA 3HI6L 5FDWB 4CVZB 4S10A 1AY1L 4TUKH 5CEXB 2DQCH 2X4SA 5A16B 1JUFA 1D5ZB 3BDXA 2D7TH 2PXYB 4ZFFA 1N0XH 1GGUA 1P6AB 2Y36H 3HAEA 1RURH 1NC4B 1G7LB 5HYJA 3NIGE 1T1XA 3NIDF 1UVQB 1JIBA 3P0VL 2EXYD 5AZEL 2ATPA 4HWBA 5CJQL 4OBSA 1OW0A 1NGQL 2NXYB 1A2YB 2FJFA 4NN5B 1I7TA 2VXSL 4Q7DA 4PRHA 3EDKA 4MAUH 4CVZA 5L7XH 3NA4A 1T5WA 4OLZL 4YK4C 1WICA 1MCWM 2DWDB 4YXLH 2FBOJ 2G75B 2CRMA 4JG0H 4QRPB 1E4XI 2AJVL 2YEZA 4OZHA 2BC4B 4P2OA 1NC4A 4G7YL 4XPHH 2FX8L 3HA0A 1KCRH 2JCCE 1UVQA 2IQ9H 4QHKI 4XNUL 5F7HA 1A6PA 3EOBA 3QCVH 4MD0B 4G7VH 1JI1A 3BPLB 4JRYD 2MCPH 2WW8A 3OXSA 2VITA 4DUWA 2ZWLT 2P5WD 1FN4A 4O58L 5IMMB 1U8JA 4N8CH 4Z7VB 3BO8A 3W82A 4ZUSB 4ZSOE 1D9KC 4U49A 5HHOD 1U8MB 5T3ZL 4RA3A 2R4SL 1KJ2L 1RUPL 4OZGA 5DJXB 5HVHB 3STZA 1AO7D 3QXVA 5IQ7L 3O2DL 1ZLWH 2JK5B 4G9FB 1EHAA 3HMXA 1NEUA 3B83A 1R5WB 3QUXB 1D6VH 4PJAB 1MRDL 1TQBB 5CLWA 2ADIA 3DGGB 5JXEC 4LLWA 3TBSB 1IGJA 3KLAB 4X7TB 2BVPB 4OGYL 1QBBA 1MJJB 1PY4A 5CCKL 1KTDA 4K7PL 3QJHB 1EUUA 3ZKMC 4KMTH 1OSZA 4YXKH 4PREA 4QOKA 2CIIB 4JVUA 4HS3A 3Q6GH 2YA0A 3G5YA 4G9FA 5EUOF 1E4KA 1QBML 2R29H 5C0GB 3O6FD 2R23B 3VFSB 4GW5A 3AY4A 3K46A 4HJGB 2X7LB 5CEYA 1FFPB 5D72H 1UADC 4EDXB 3IJHB 3U9UB 3ARFC 1T4KA 1N8ZB 5L2KD 2VTFA 4J6RL 3DX8A 4OM0L 1MJJA 5E95B 4OZ4B 5F7DB 3PV6B 1DBML 1UFUA 4CMMB 4G5ZH 3GRWL 4FQXB 4KV5F 2PYEB 2VDPH 3FQWA 5I74C 2H32B 2JJWA 4Y4HD 4FN0A 3HS0A 1YMHB 4HULB 1MHHB 3WKMH 4JY6A 4NSKB 4HSQA 5C0GA 2GITA 4OQTL 5KSBF 2LFGA 2X7LA 4PPTA 1KPVB 5T3XL 4NRXB 3KDMB 4NUGH 5AEAA 1N8ZA 3SDXB 4EN3C 3U0WL 2BCKB 4FQLL 4YWGL 2F8XC 3ULUC 4Z7UB 3S37L 2Z92B 1WWWX 3DBXA 1MFDH 1UWGH 2LTQC 3IGAB 2HJFB 3OKLA 3LQZB 5EUKA 2HN7A 5TF0A 2ICWJ 3CNKA 2HVJB 3RVWD 1MSPA 1S7UB 4RMTA 3BEWA 4OCWL 3THMH 2W9DH 1NCUA 1EFQA 3O6LL 3PF2A 4KI5F 3KPLB 5JQHC 1LP9E 5DD3H 1OP9A 5DJYA 3WO3B 4EI6B 3VFUA 3MRLB 2BK8A 5L88H 4NHUA 4UT9L 1J8HA 1OTUC 3QJFB 2XA3A 5DD0L 2X10A 1KULA 2HLAA 3BKYL 4BFGA 3RU8L 3LH2H 4HC1L 5DMGC 1A6TB 5CJ5A 4NO3A 1HIMH 2F54A 4Z8FH 1RJLA 3UYRH 2OZ4H 4LHQB 1ACZA 8FABA 3TBWB 3KPLA 2DI8A 5HHXH 5GISH 3D3VB 4J4PA 1A02N 3V5KB 4F80A 3BXNA 4M6ML 3ULVC 1YN6A 2AQ1A 5C0BB 1HZHL 4I3RH 1H15B 5IB4A 1MH5A 4WEMB 5DVLA 5F7EH 5IESL 4GRMA 2QHRL 3PIQB 3K0WA 4DTGH 4KJQD 4KXZI 2GSGA 5DQDL 3FO9A 3LSOA 1YEIH 2Z31C 4XPFL 4JZNB 4YK4B 5MEND 3E6FB 4XH2B 4WV1C 5EPMB 1B0GA 2C1OB 1M7IA 1F58L 2XQYK 4WWKD 5EFIB 3RA7H 1F8TH 5D2NC 2AJXH 2IANA 4LPVA 1TVDA 3OB0H 4RMQA 4HIHA 2NY3D 3NCCB 3MRDB 3HG1A 2X2YA 4CW1B 4AYFA 4UUJB 5DLML 1GSMA 5DJ2B 2CXKA 2VLKD 1J0YA 4ENED 3GI9L 3CFEA 1KCKA 1XIWA 2A77L 4NZTH 3CH1A 2AEQH 1CLYL 1LEIB 1D9KB 1KGCD 3QDJD 5I30L 4JANA 4ZXBD 4XH2A 4CU7A 2HRPH 1X9QA 2C1OA 5FCUH 3K2MC 1PEZA 3RFZC 5C6TL 4Y1AA 2GFBA 4P4RB 3VXPA 3N0PB 3PWUB 2W38A 2HT3D 1GPOH 2X05A 5DRNB 4FNLH 3E8UH 3MROA 1AH1A 3RL2A 1UXSB 4GAJL 4YQXH 1DUYA 5DJ2A 3DXAE 3GHEL 2VQTA 1HXMA 3QDMB 2GTZA 2H2SC 3D0VA 2RJMA 4OZFB 3VXTA 4M5YL 3CZFA 5IBLD 3TZVC 4HZLA 5I15L 3N9GL 3SQOH 3VFVA 3RDTC 5EU6A 4KKCC 6CGTA 3SDAC 1NGYB 4X6DB 2XKNB 3I85A 4WO4C 3WHXA 4QXTB 3U30C 4D0CB 5A2IH 5GS0H 1YEKH 2H3NB 5CP3H 4PD4J 5D5MB 5KVEH 1FGNL 5CJOL 1MCSA 1RZIB 4HUXA 1XF4B 1G7IB 5JXEA 4U31A 4XPBH 1OAUL 4ZOEA 5FM5O 4KPHL 3V8OA 5LGHL 5J8OA 2BRRH 2FBJL 1A7PH 4RMVA 4Y2DC 3BMWA 1UH2A 5I74B 2R1WA 5BZDA 1A64A 5ICZA 4IIQA 1LO4H 3WFDL 1O0VA 1C5BL 4QXTA 3JWOL 1CFQA 5DA0B 4F37K 3PG2A 1FRGL 3FZUD 3DX9A 1OP3H 4PJ8A 2O5XL 2NY5L 4APQD 1G7IA 1IEHA 3NBNA 4PJBE 3ARFA 4XP6L 2Y25A 1KXVC 3ZDZF 1A0QL 5F3BB 4EN3B 2BVOB 1YEGH 2MTPA 1U95A 1U3YA 1I1AA 4NQCB 4S0SD 1K4DA 1OAKH 2LTQB 5CLTA 4ZDHB 5AD0B 5FYJD 3VXOB 3O3AB 2XT1B 2NY6B 5D1QD 4X6CB 2NYYC 1B4JL 3IU3A 5IK3A 2XIDA 4KHTH 1GXEA 1IAIH 4MMZC 4LGRB 1VEOA 4X9IA 3C87A 4R26H 4U2ZA 2LV4A 4YXHL 4BQCA 1A6VL 2HG5B 5CZXD 2DKMA 5EZJB 3O4LB 1DBBH 3CD4A 3MRFB 3OR6B 4NQCA 3T3PE 1YN7B 4ZDHA 5AD0A 4D9QD 2XTJD 2IG2H 3O3AA 1T20B 4BFBD 5F7LB 4OFYD 5EOTA 5C0ND 4PB0H 5CSBA 1CF8H 3EFFB 4U1NA 4J3WA 1H5BA 1U36A 3MRGA 5KVDL 5JHDD 1P1ZB 3ZDYE 2AXHA 1QSEA 3UAJC 3PP3H 1D7FA 2DBLH 4LSQL 4XMPL 3SO3C 4L4TA 3UJTH 4GG8B 2X4QB 4L8BB 2ZG2A 3WBDA 4QHUB 5FYKD 4H1LH 4WW1A 3TGXA 3RY6C 4KKLC 1YZZA 4WI8A 1MAJA 5ADPH 3B2VH 4GQPH 1ZHKB 2ESVA 1TXKA 4HCRA 5F7NC 2OR9H 3G6JF 3W81A 3F7VB 4U05A 1U8KB 1VERA 2Z31B 5C0DB 1ZT4B 2XOTA 1P1ZA 2H8PB 5TDNA 4LSUH 3OAZK 3BEVA 1TPXC 4LDLB 5D2NB 1MHEB 1IGIL 3DTXB 4OZGF 4GXUM 4NKQB 3VFTA 4LRNH 5HHVL 2WBJC 4IDLA 5C92A 1CD1B 5I17A 3FT3B 1FVDB 2P5EE 2H1PL 1WFOA 5MEOA 3ARDB 2QADC 1ZSDB 5CGYD 3FB7A 1BD2B 5F93C 1ULVA 4Z7OF 2CLVB 4WV1A 1T04B 5E00A 3T0BA 5D4QA 1FGVH 1FSKC 4F9PC 4P3DB 3ZTNL 1CT8A 3PWPB 1S7WB 2PXYD 3VXNA 4XC3L 5F88B 5C08B 2YBRB 1YUHB 3V5HB 2NZ9C 3S3PA 2A6JB 2OJZH 1JZ3A 3LKOA 1N59B 4XMLH 3SJVE 1XR9B 2XZQL 3GI8L 3MLYL 2EE9A 2NXYD 1IARB 4UV4L 3U46B 43CAA 4HWEH 1S7SA 3CXDH 4HBCL 4JO4H 1JWSB 1AGCA 3RVVD 2EXWD 3FRPA 3ZDXE 3RDTB 3LQAC 2VDNH 3DURA 2JIXB 2V5TA 1DL7L 4MA3B 3FO1B 5F3HA 3MNVA 1NFDF 5E8OB 3CFJB 1HSAB 4OZFG 5IV2A 3PABB 4DEPC 1P7QD 3EYSH 1JZ8A 1YUHA 3QB7C 2EDEA 4YO0B 5B21A 3SCMB 2L4OA 4W6XB 3U30B 2B4CC 2OI9C 3NIFF 4LFHG 1PSKH 2XI9A 1E28A 3NOIA 3WV0A 1KTKE 2D03L 3TZVA 2K1MA 4UNTA 3OG4B 5KG9A 2IPTH 4YHNA 1KIRB 1JWSA 4GKZA 1R3JA 4YAQB 3RGHA 4OAWB 5FYLH 1TVBB 3SDAA 4ACPA 2JIXA 4MNGB 5I66B 5E8OA 5IEHB 1WC7A 4WO4A 3KPMB 4HKZB 1UWEL 5KANG 5FUCE 4XAWL 1FIEA 5AAMA 5JIIA 3OWEA 4YX2H 1DTUA 5EBWB 1A7NH 1R5VB 1AE6L 4P57A 2W07A 1UCBL 4HX1B 3S9DB 1WK0A 2XWTA 2YMXL 1ZHBA 3K2UH 2AEPL 1A7OL 5FO9A 4MQSB 4DKFL 2YS4A 4F3FB 5DHVB 3QFDB 4Y2DA 3MRMB 4DUVA 5I9QC 4OGXH 4KK5D 4MNGA 1XGYH 5I19H 1IGCH 1F11B 3MV9B 3SKMB 3TNMB 1F5WA 1FVCA 4CVXA 2P5WE 3RJDA 2VRAA 1NKOA 1T5XA 4PJGB 5I1IL 2EDRA 1KTRL 4HX1A 4KHXL 1CLZH 4HH9A 3TIDB 3VH8A 1G6RA 5IVNA 3P4LA 5IROC 3HZVA 2CDGA 1KT2B 4Y4KA 4AENB 1KCVH 4EDWL 4LCUA 1X5JA 4NFBA 1SY6A 1FDLL 2EE2A 2XXCB 5GGTL 5EU5B 1N5AA 3CSPA 4RGOH 3VG0L 2IPKA 4FQXD 4OLUL 1R3KA 4QCIB 3TWCL 2PYED 1YJDH 1U91A 4JFFA 1VFMA 2QQNL 4POYA 1JNLH 1QACA 1NCWL 4I0KA 3L1OL 5GGSB 4PJGA 2FIRT 2OTPA 4XHJC 1YY9D 2AEWA 3FFDA 5FECA 5JO5A 3WIFA 1XGUA 2APWA 1ED3A 2UYLA 4LSSH 4D9RE 1WCBA 5GZOD 1FFRA 1OAXH 2KQNA 2P8PA 3I6KB 2XYCA 4NQDB 2YC1A 3VMPA 4OLVH 3LDBC 2Y07H 3QPQC 2DQIH 4XPGL 1YQVL 3V9FA 4FOMA 4P59H 1KPRA 2BXYA 1QFOA 2X4NA 4KRMB 4HG4J 3MA7B 3H3PH 5DK2A 4O4YL 2F5BH 3CFKA 5HD8C 2A6IA 4HS8L 3FFCB 5TGBB 3BRFA 1SJXA 3PWNB 1NDGA 5HI4C 1OARH 1W72L 5FV1L 1T2XA 2YPLE 5HGGS 3O3UN 3QHZH 4KDTC 4N0FA 4PJ5B 5C3TA 1LEKB 1RZJC 2WBJB 4NHCH 3V6OC 3QFJA 1I8MB 4GAGH 2I9LB 1DFBH 3VGHA 2QADB 4U7MA 5HY9B 1IE5A 3GHBH 1M4KA 3RY6A 2BZDA 1RZGB 4LIQH 2O5ZH 5ALBL 3FN0L 5FUZH 4Q6IA 4NNYA 1FLTX 4O2CB 1T2QH 3BMVA 4E41D 3KYKH 3PWNA 1AD9B 2I5YL 4RAUA 3UBXA 1FSKB 4PRID 3UTTB 2EDHA 4OI9A 1GAFH 4NPYB 4LVHC 1ZWIB 1MQ8A 4KKBC 1LEKA 3D3VD 3L5HA 2VH5L 5GS0C 4MDJA 1OCWH 4R7NA 3RNKB 4F2MB 4M6AA 4OF5A 5HJ3B 1GGBL 5C0BD 3V52H 4IOFD 3FRPG 1IKNC 1YMME 3L3KA 4DGIL 4DQOH 4PRDA 5F7UA 1K8DA 3OAUL 1TITA 5C0CB 2OQJA 3GZKA 1MI5B 3G5VA 4DCQA 4F9PA 4NZUL 3U0TB 3OB8A 4YHIA 4O2FB 3MR9B 3TN0A 3SKOA 2C9AA 4DEPB 3R1GH 4IBLT 1MRFH 1MREH 1A47A 1KIQA 3WJJC 2OI9B 4F2MA 1IJ9A 1NUGA 2R0ZH 4ZMAT 2FEDD 5K33A 1WAAE 4XNXL 3V6FA 1TENA 3NACL 1I9JH 4LF3A 1LO0L 2G5BA 5SWQA 1IQDA 4QRRD 3IDIB 4U6YB 4MCZB 3K3QA 3MLWL 5D71L 5ELIA 1D9KD 1QFHA 4ZUTB 2AP2A 3G6DH 5CBAB 1RI8A 5EUOB 4BM7A 4GH7B 5CINL 3U0TA 4M1CC 5JHLL 2IFFH 4HKBA 4O2FA 3MR9A 3KYNA 5FO8B 5E8DL 4HKXB 5D93C 1P84J 4M7KH 3MRIB 4Z7WE 4HJ0D 3S36X 1LO3H 4KVNL 1XCQA 4MA8L 5A2KH 1LWRA 1QSZA 1IZKA 3LEXA 4H8WL 2H45A 2FO4A 2AJYL 4OFDA 2A83B 3BKJH 3FMGL 2VDOH 1LK2A 2Z91A 1QSFE 5D7JC 1DQMH 5KZCB 1KYOK 3SHSA 3W9EA 2YSSB 5CBAA 5I9QB 4ETQB 2X42A 3DHMA 4HGKC 3ZLQC 5J9PB 3E6HA 3OF6A 4J3VA 4YDJA 2HKFH 1NGWA 4K3EH 3VH8G 3RWJA 3NPSC 4ELKA 2VLKE 1PBYA 1KB9K 1J88A 3H42H 1FNSL 4KZEH 2BSTB 4JZJC 4QNPF 5GRUL 4RFNC 1V3JA 3B5GA 3BYTA 4FMFA 4U1HA 3BOVA 12E8L 3V79C 1KCSL 4UINL 1MOEA 5T1KB 2CJUL 5B38B 5J9PA 4KH2A 4OF6A 3D39E 1VCAA 3UPRA 4DVRH 5IFJA 4HWBL 3BPCA 1CFVL 5F1SA 3P11L 4LLYB 3CCHB 2NW3B 3JWNC 2OZ4A 3FO2A 5FM4A 1D5MB 4OLYH 4WFFD 4M6OH 4PBXA 4WI6A 1MFEH 4NFCA 3RGVC 3RVXD 5KSAC 5IROA 4DOHB 2OCFD 4RBPK 1BM3L 3OX8A 1MIEH 1ZHNA 2XNAA 1FFOB 3CFCL 1NCAL 4EN3D 2R9HC 1BOYA 4JO3H 4X4MA 4R3SA 5H94B 2VLJB 1UZ8B 3M17A 1YEJH 4JDTH 32C2A 1F4AA 4JHBA 1PFCA 2NY6D 4QO1A 5FHAH 3KPRB 3CCHA 1DJSA 2R0KL 4TSCH 1D5MA 1KPUA 4Y88A 1NCCL 4OM1H 4PS4L 3MMEB 3RWIB 1NUNB 1QVOA 2BVQB 4QWWD 4PV9A 3S3JA 2SEBB 1CS6A 3IXAA 4RAHA 2WWKO 5IHZA 2IBGA 4KC3B 3JV6A 3VRJB 5F1KC 2P24A 3O4LD 3QXWA 1KIUA 4B53A 4HUMB 3SE3C 1NFIB 1KG0B 2FHFA 4FQJL 2EC9T 3UBXG 1YYLL 3HMXL 1LHZA 4M7LL 4RCAA 3SO5A 3QUYA 4HKJB 4LSVH 3GBNH 3KPRA 4R9HA 1FNEB 1IGML 4FFZH 4PTUB 1UQSB 4GUPA 3CX2A 4MAYA 4S1SH 3WFCH 7FABH 1L7TH 1IC4H 4G6KH 1Q1JH 1FCCA 3RWIA 3O8XC 3HNTL 3IKCA 4LVHB 3IVKA 4KI1A 4P4KA 2VLLA 4KDTA 4H25B 1JK8A 3VJ6B 3FCTA 3V6OA 4PB9H 4ZS7H 1MCDA 1E27B 1OT1A 4OJFH 3X14B 5FB8B 5ABDE 2EC8A 3MV8A 4HKJA 2V7HA 1CDCA 3HHRB 2X89A 4K7PY 3VFMB 1KELL 5LWYL 1FNEA 3LN9A 4N0UE 4C56A 3Q0HA 1A1MB 4JFPB 5L2JA 5LQBL 3TYGL 5I1LB 2Z31D 4D0BA 2GJ6E 5TH2A 4AL8H 1FIGL 3TA3C 2YXMA 4E5XB 5IP4A 2CK0H 4IRZH 1J1PL 2GK0A 4FHBD 4H25A 4NNXA 5K9OB 2IBZX 4ODUA 2B7DT 3TJEH 1QRNE 4V1DD 5CP3A 4PRPB 4B7LA 3X14A 1JPSL 1T0NB 3QNXB 4MXQD 5TQ0H 3ZKXC 3L3GA 1IKNA 3T0VA 3ARDD 1FZOB 5F70A 1XF2A 3JVGC 5EH1A 4OFVA 1BD2D 3O81A 4DGVL 1Q0XL 2CDFB 3BP4B 4JRXB 4X5XB 4YUEH 1JCKA 4MLSA 1LEGA 4PJDA 4DVBB 1JZ7A 1U8HB 3GJFK 4E5XA 4PJCA 3RIAK 4HPYH 2DM4A 4OCNC 4F8TA 3F5WB 3WJLA 1J8KA 3PWPD 4G6AD 5D93B 4Y19D 3ZE0E 4CN6A 5D7LA 4XNMB 5DQJA 4TRPL 1N5YL 4L3CB 4PRBA 1XGTB 2HJKA 1HHIA 1Z6JT 3BP4A 2H2SD 5D7JB 1VESA 1NANH 3E3QE 3PJSA 5DRZB 3WIIL 3ZT5A 5GPRA 4QHKJ 1KEGH 3QWRD 2NX5B 3CFDB 3IDGB 4XP1L 1L6XA 3F5WA 5FYJU 3RDTD 3HUJB 5E5MB 1FFQA 4KKCD 3OPZH 3NPSB 5DT1L 2AV7B 2W0FA 3I50L 3NCFB 2XZCH 4OTXL 4JZJB 3SCMD 4F8QA 3BQUB 4NO5B 1CTOA 3MUY1 1OAQH 1XGTA 4F57H 2EH8L 2R0LL 3IDXH 4URTB 4NQEE 4A2MA 2Y72A 1LMKA 5I1JH 4KUCF 5BCAA 1BZ9A 3CFDA 3IDGA 4Z0BL 4GBXD 5CILH 1M05A 4P23B 1UKSA 4RAVA 1DVFA 2X1OA 1UJ3B 1OAZL 4OSUL 5F9JA 3V4VH 4PGDA 3RGVB 1T22A 5KSAB 4PP2A 3W11C 1EIBA 4RMUA 4GXVL 3KNBA 5DUML 3AXLB 1CYGA 1I7UA 1Q94B 5CZVH 5DMKB 4MNHA 4LOUC 4FABH 4J2XA 1EXUB 3M1BA 4KRNA 4H1LA 4XVTH 1MFCL 3NIGF 4AEHH 5FYKU 4ODHH 1U6AL 5DVNA 1B4RA 5IMOA 4YC2C 1MY5A 1KENH 4U3HA 3D9AH 3MV9D 4TVPH 3RPIB 4M3KB 4WFHD 4NRYA 3CK0L 2WP3O 2YD8A 3MRJA 4NBXB 1AP2B 5KSAA 3MLUL 4LLAA 1RZ7H 1RULH 2DWEB 4IMLB 4X99B 1EEZB 3TV3L 4LLDA 1EXUA 1H3UA 1T0PB 3U83A 4LSPL 4OKVB 3RL1B 5INDA 2JCCF 4XBEH 1PZUB 4C54A 4Z95L 2FHCA 1AJ7H 1H0DB 4LLMB 4OV5A 4P5TB 5IVXE 3VWJB 1S7TB 4JFYB 1OTTC 3NZ8B 4DW2H 1JWUA 5JW4M 4ODVH 1YY8B 4CMHC 4CKVX 1PG7H 3GGWB 4TQEH 2C3VA 4YHZH 4IMKC 3QUZD 2DWEA 4F15C 5ITBH 1MHCB 1INQA 3REWB 1AGBA 1N4XL 2NR6C 1FLRL 3FQXB 1T7XA 4NQDD 3JUYA 3QP3A 1EO5A 5EG6C 5DUPL 4W4NA 4GRWE 4NO0B 3V95A 3QEHA 1H0DA 4PJHE 4QRUA 3QUMH 4KKLD 1YYMH 2D7QA 1Y6KR 1N26A 3BD3A 1WBZB 4JFYA 1P69B 3MFGB 1RIHH 3G6AA 3B8SA 4WFEE 4XWOD 3HE6B 1A22B 3O8XA 1TETL 3WLWC 3KYAA 1ORQB 4KTEH 2D31B 3LIZH 4XXDA 1NBZB 2WWKT 4HK0A 1SEBA 3V0VA 4GMTH 4PJ5D 1NQBA 4XWGH 3STLB 1BQLH 1JPFB 5EBLB 1YEHH 2X6MA 4O02L 5IEKA 2ZCLH 2QADD 1J5OH 4P2RB 1FYTE 1U58B 5K9KB 3IFPA 3GSVB 5A1AA 1A7RL 1FL5A 1TZHA 1NFDB 4L1DA 5J1AB 1ZT1B 3HMWL 3OGCB 4HW6A 1FZJB 1D5IL 4TPRH 2R56L 1U41A 3TA3A 2D31A 5GS1C 1UXWA 4MA1B 5I75C 2PYFA 2EEDA 2VN7A 5C09A 1KIPB 3UTTD 4RIRB 5D7IE 3OKMB 2BSSB 3IDMB 3S4SA 5HGDA 1KN4L 4PGEB 1ORSA 4KJWC 4PD4K 2ID5A 1BJ1H 4MX7A 1U58A 1QLFA 1NJ9A 1S3KL 4G9DA 5K9QG 4FQCH 4IJ3C 2CGRH 4GO6B 4XI5C 1QA9A 4GSDH 2VLMD 4J1UB 4C83A 2AABL 3DMMC 3KPSB 2H26B 1ES0B 3B3IA 1I1FB 3FQRB 2Z93B 3UTOA 1KIPA 3VXSD 3ULUL 2J8OA 5E9DA 3F12B 2PO6B 2WLYA 3KR3L 5TFSL 4ZFGH 3QA3B 3WSQH 3DRQB 3MNZA 1BFTA 5HYSB 4JPVL 1F90H 1F4YL 3TO2A 2WUBL 2MJWA 1A6WL 1MLCB 3TM6A 4E41E 4NZRL 1F4XH 1IM9A 1BP3B 3LS5L 2DQTH 2E7BA 2E7MA 4PRIE 4R7DB 1A7QL 3ISWA 3PWJB 4LASL 4DZBA 2VDLH 4P2QB 5J6HA 2ZSWA 5ITFB 4NKOA 5SWSB 6FABH 3PHQB 4YDVA 4F58H 5DD1L 1RIUL 1RY7B 3C9NB 3E0GA 3R06A 1T1WA 3MRPA 1AXTH 4LLVA 4MVBC 1UENA 1KJ3H 5EWIL 2JJSC 4DJMA 2HFGH 4OD1H 3A6BH 2DJ4A 3X3GH 3F7YB 3ALXA 1HXYA 5LGJB 4HCRL 1VADA 4H1LG 3BZEA 1QLEL 4LEOA 1W2KT 1DLFH 1G6VK 1F4HA 3SGJC 3RX8A 5KZCD 1FG9C 2F5AH 3ULVL 4ELME 3PHSA 4JAMB 3BI9X 1J18A 3C9NA 3DVFA 4JPKL 4UOW1 4YC2B 5DYOA 3WL9A 3I3BA 1HQRA 1GH7A 1F3DJ 3UROR 1CE6A 1RV6X 5D1ZC 3OZ9L 1WV7T 4J7RA 1WLHA 3SKJH 4QRRE 3C5ZC 5ISZA 4LP5A 3LKNA 5LAXB 3CX5J 3GMRB 4FRWA 2IGFH 3DROB 3ES6A 4NRZB 5AZEH 5KN5B 4NC1E 2N7AA 5IM7A 1NGQH 2E6JA 3RWHA 1RFDH 1OLLA 3GSWA 3AU1B 5T1KD 4MXVF 3O2WL 1FL6A 2JTDA 3Q3GB 1U8IB 4KI5D 5T3ZE 2V2XB 3P9WB 5DZOA 4KJPC 1MF2H 1T66C 3L5WA 1A1OB 2BVYA 5D70L 2FB4L 3T3ME 4CMHB 2AJVH 4XHJD 4CL7A 1G7JB 3S34L 2ZUWA 3CUPA 4F15B 4A6YB 4HGWB 4BYHA 4XNUH 3DVGA 4NRZA 4KK8C 1WWBX 2P8MB 5KSUB 3BGAA 1WZ1L 3MV11 4P3WA 3QG7L 1AC0A 4O58H 4HFUL 3ARRA 1EAPB 2VQ1B 3D85B 5E99L 4JE4B 2J7LA 3BZFB 1KB5H 4R0LA 2WP3T 3MRQA 4LQ1A 5C0EB 4GLRH 3QEUA 1OAYH 3O9WD 3QPXH 1RJCA 3B9KA 3B9VA 3BGFC 5IQ7H 1PQZA 3PGFH 1IVLA 4IMKA 4X7CC 5E1AB 3T09A 3OQ3B 3W39B 4M8QA 3GDBA 4WI3A 1EO8L 1YNTB 5DMYA 1A9EA 4NOBA 3K1DA 2P8MA 1VGKB 4PJCF 3W0WB 4DKDC 4YDKH 2XN9A 5KSUA 1OWWA 3ME0A 4L3AA 2EZ0C 1CBVL 2R39A 4PLNC 1IFHL 5CBEA 5JOEA 4R4FL 3HRZB 2VXVL 3S97C 3ZTJH 4BFEA 1PLGH 1GGCL 3BN9D 5KS9E 1TZGL 2OSLB 2F53B 1WGOA 1E4JA 2Q87A 1U8OB 3S4SG 2K7PA 4U1MA 2ZOLB 3VA6A 4I5BA 5GS1B 4F7PA 5I75B 5BS0B 1LVEA 3VXRB 5E2VH 4ZO8A 4AMKH 2HT2C 1H9VA 4KTYA 3PWLB 2DKSA 3O3DA 2V5SA 1K8IA 4UB0H 4AJ0A 3MLXL 4I4WA 2QSVA 3GKWL 2GW5A 4JB9L 2BNRA 1MCOL 3WCYA 3N1MC 4I2XB 4J6RH 4R4NC 4FFVD 3QNYB 1J05B 3LHPL 2XY1A 4QTHB 1G6RL 4AEIH 3NN8A 3DMMB 1KEMH 5KVGL 1YNKH 2UWEA 3IRZA 4OQ1A 5GS1A 3H9SD 2J8UE 1S8DB 3VGFA 4GKSA 3MODL 5DK3A 4Q9BA 3WNNA 5CZKA 2QV2A 5DD5L 1DQQB 1HNGA 4M1DH 4NQVB 3QWOB 4OIAA 5ACZB 1WBYA 4PRPD 4K71C 5C8JA 9CGTA 5T3XH 1AR2A 1AXSB 1EH9A 2DQCL 4TULH 2CLRA 2XPGB 3L5IA 4I2XA 3HC0A 2Y9RT 2HTKC 4MQ7B 3T2OA 5JW3L 3ET9F 4LCYB 5HYSG 3S37H 1I7ZA 2CR6A 1T83C 3DMMA 4JRXD 3RRQA 4JM2F 3U82B 2DLEA 5JZ7D 3K4DA 3CDYA 1WCQA 5EOCJ 5TDOA 3O41B 1UB6B 5IWLA 5I0DA 5ANMB 4MAUL 4FQPA 1VFOA 3O6LH 1G7QB 3MV01 4IRJA 4XAKE 3MUJA 4RFEB 5EU7E 5JXAL 4MJ6B 3TP4A 2DAVA 3GSQA 4YXLL 4V2CB 3UTSB 1ONQA 2XV6B 1KNOB 1CD9B 1QFWH 5GSVA 5D7JD 3MYJB 4XPHL 3RHWF 2PR4H 3ZE1F 1KCRL 4V1DE 3QCVL 2NX5D 5I18L 4G7VL 3BKYH 5IQ9B 2A74B 4HC1H 1UB6A 1SJEB 1HI6B 2MCPL 1MCPL 4YHLH 5D1ZB 4RMSA 2HH0H 1K85A 1BD2E 3C5ZB 4MJ6A 3BQUD 3D2UA 5CEZD 1DN0B 4G8IA 4M6MH 2V2WB 2QTEA 3SGJA 1A5FL 4YHMH 1HZHH 2AK4D 2VXQL 4JVWA 4Y19E 3VFNB 2ADGB 3TC9A 5IESH 3S8WA 4O2EB 3V2AR 5DUBA 1J1XL 4HEPG 5IB1B 4XPFH 4P23D 2GUOA 4HG4K 5CUSH 1XH3B 3G5ZB 4U3CA 5IJKC 1T21A 2OR8A 3C5ZA 4JLRA 1RQ5A 4N8VA 3RZCC 1S5HB 3LRSB 1S5IH 2OL3B 4KMTL 3CLFL 4YXKL 3Q6GL 1XGQB 4HPOH 2ENSA 5DLMH 1TDQA 1U3HA 2ADGA 2VZ3A 2R9HD 3QI9A 2EEAA 4O2EA 4ZOBA 3AROA 1PKQE 3SGKC 3JSSA 5I30H 4YR6A 3KG5A 4QHMA 4PJEB 5KW9L 1JHLH 4KVCH 2DTSA 4N9OB 5HDLA 3IF1B 3BGFB 2DQHH 5DD6B 1UYWH 1Z9LA 3BGMA 4G5ZL 4PJIA 1AKJA 2VC2H 5ESQB 2VDPL 3LQAL 1CFSA 1BQHA 1G7PB 1XGQA 4BZ2H 4X4ZA 4GAJH 3ELAT 2EIBA 2FL5A 3ILQC 3S96B 3GHEH 5I16A 4LCWB 4LP4A 2B4CL 4U1IA 1P2CA 3UDWC 3O2VH 1XR8B 5I15H 3NFSH 4X5WB 8CGTA 4GOSA 3VFWB 3N9GH 1HSBA 4P5TD 1J7VR 5ID0A 4BH7A 4I3SL 3MXVH 2DM7A 1CDYA 4FP8H 4MD5A 3VWJD 5IR1A 1I1YA 4N5EC 5E7BA 1WISA 5IT2L 1LE5B 1G9NC 2M26A 4P99A 5L9DH 4L4VB 2I9TB 3PL6C 1T0MB 5ESQA 1RK0B 2DYPB 4HDIB 3AAZA 4X8XA 3HZKB 3VXUA 1FG2B 1NMAL 4I0PA 2FNBA 4R8WH 4EI5C 4M00A 4LCWA 1G7HB 3MV9E 4D0DB 3VI4E 2PW2B 2W9DL 1NC2A 4KPHH 1XR8A 1MFNA 4NO0D 2F74B 5MI0C 1WTGT 5DD3L 3WYRA 4AIZA 4B0MM 3MUGA 2MWCA 1WFTA 2BSRA 3HE6D 2QSCL 5E4IA 5GJSH 5L88L 4L4VA 1DQJB 3WFDH 2YUVA 4UIMA 1C5BH 1H3GA 1HHHB 3AMKA 4GXUN 5DEFB 2LVCA 5GXBB 3EHBD 3QNZB 3OXRB 1P84K 1C1EH 1SMOA 4K71B 1HIML 4Z8FL 3UYRL 4XP6H 3QUKB 3WN5C 4PJ9C 3QIBC 4P2RD 4PJXA 4OKDA 5BRZA 5HHXL 5GISL 2GIYA 1UM5L 4C59B 4HHAB 5IKCA 3HI1A 2B20A 3QULB 1GJIA 5SX5K 3T2PA 3P73A 1QO3B 1Z5LB 5K93A 4OZIF 5LJYH 2YRPA 2PF6A 3RWDA 2CUIA 1B4JH 1HHHA 5KVFH 2BVTA 3C5SA 4WHDA 5F7EL 5B8CC 4NT6A 2AQ3A 2JB6A 4JFEB 5DJ0B 4DTGL 2GTWB 3P4NA 4J3TA 4ZUVB 4I9WD 4ZD3L 2X4TA 2AJ3A 4JFQA 3PV7A 4YXHH 3SBWC 4L3EA 3EJJX 1DEEB 4B7IA 3RA7L 1IM3A 1F8TL 3NIDE 2DTML 2P7TA 2ITDB 1I7RA 4LAJH 4M5ZH 3ROOA 1T83A 4MS8D 4JFDD 4ZODA 1RPQA 1VA9A 2BHZA 3KPSD 3GBLA 3WXVH 3KPOA 1L6ZA 1XMWA 3O4OC 3WFHA 2NTSP 5KVDH 2PO6D 4NZTL 4EQ2A 5FGRA 1X5GA 4M93B 3WFBH 5HHQA 1LD9A 1OVZA 4XCEA 2A9NH 5D1XA 4MB4A 5FCUL 1JPGA 3QIUB 2LU3A 1S7XB 5JOPD 4XTRC 1LO5B 3MRNB 3DX6A 4EOWL 5IJVB 4PLKD 3IDJA 1J8HD 1GPOL 1RZJL 4UDTB 2G9HB 2JELH 4P2QD 3VXME 5C0FB 4N8VG 4JM4H 3EDJA 3V6BR 4YQXL 5MEPA 1OGAE 4Q2ZA 5IMLB 2XWBA 4XXCA 2PCPA 1AC6A 3QEQB 1UEMA 3WE6B 3K81A 3X12A 1JV5B 5K9JL 3RZCB 1K4CB 3D25A 1MVUA 2JCCB 5HSFA 4QRQB 3FQNA 2DLFH 5DJCA 4M03A 3VXSE 1VSCA 3DETC 2H1PH 3ZMRA 2DM3A 3BPOC 5EA0H 4G8GA 2G9HA 5GS0L 1YEKL 4XZUA 4ZSOB 5KVEL 2F19L 3QUMA 2IAMA 5IHUL 2XFXA 4OFPA 1J0ZA 5IMLA 4NGHL 2MMXA 4XPBL 1GRWA 5IJKA 4KDWA 4GAYB 4NDMB 2HFTA 2OJEB 5CAYB 1JV5A 1XF1A 4QHLB 1K4CA 4JHWH 2BRRL 1A7PL 3RKPA 1P4LB 2CRYA 5C07A 3IFLH 5B3JF 4S2SA 1OD9A 3BWAA 1XFPA 1JI2A 3MJGX 1S9VB 4Q9QL 1J87A 1CXKA 3H8NA 5F1IA 1ZHLB 2XKSA 2XZQH 3PGCA 1CFTA 3GI8H 3MLYH 4X4XB 4RSVA 3SGKA 1QD0A 1F2XK 1I75A 1U3ZA 1C16B 3GSNB 3KLHC 4U1LB 1QR4A 1SQ2N 4Z9KB 4Q74A 2C3GA 1PEWA 2R1XA 5DJ8B 5F9DC 1KJVA 5C9JB 3QEGH 3CDFA 3L3OB 4WUUA 1OAKL 2ZP0T 4KQ4H 4HIXH 1DDHB 5EO0B 3GUTA 2UWEF 2V17H 2NLJB 1M1SA 5I6XC 3TF7C 1XZ0A 3L7EB 5KSBE 4EI5B 3HLAB 3HR5A 3S6CA 4KHTL 15C8H 2D03H 3KXFE 3MUHL 4K55A 4Y8AA 4R26L 3UDWA 3AREC 2W1NA 1TQCC 1ZLUK 5C7XH 3D85D 4I0CC 1A1NA 2EKSB 2E7LC 2C3WA 1DBBL 3DI3B 4L8DA 3RUGF 1J0KA 3L3OA 1U8QA 3LN4B 4PJFE 1OTSD 4NNPH 4GQ9L 3PL6A 3TBVB 1X44A 2B39A 3ZO0A 5FEBA 2IG2L 4GG6A 1UWEH 3Q6FB 4XAWH 3CVHB 2APVA 3E2HC 4ZAKC 4UTBH 3HLAA 3W0WD 1DANT 2VL4A 1AE6H 1BLNA 3X11A 1ZT7B 1CF8L 1I85C 1F6FB 4K7PX 5D7SH 4QF1B 2OK0L 5F9WC 3WN5B 4PJ9B 2AEPH 4K3GA 3V7AE 1A7OH 5CEZL 3PHOB 4LPTA 5GJTH 2VERN 1M71A 3ROLA 1E6JH 1KN2H 2DBLL 3UJTL 1KJMB 3RVTD 5SX4H 2DICA 1AFVH 3KYOA 3SKNA 5I8EA 4Q58C 3VRIA 4UBDD 1RZFL 5BS0D 3Q6FA 2H9GA 3KPPB 4ZUWB 3VXRD 3D69B 4X7SL 4EXPX 3B2VL 2VAJA 5I1IH 2OR9L 2XICA 1LP9B 2IH3A 4QF1A 5CWSB 1EZVY 2HFEB 2AK1H 3EJZC 1HHJA 3QIBA 4LSUL 3LPGA 3SOBL 5FOBB 4EDWH 4U6HA 1HHGA 4XI5D 5FO7A 4Y5YC 4LRNL 3GEWB 1FDLH 4JGJA 4R96A 1XGRB 4AEFA 1INEL 3IJSB 3VG0H 3I3EA 3TWCH 3ARBA 3O4OB 4BUHA 4OT1H 5KOMC 4ZUWA 3DUSB 3QQ4B 1EFXB 5B8CA 1UM6H 4LMQE 1LP9A 3GK8L 4PJ7A 1RZKC 3IJYA 5F89B 3BRDA 3BZ4B 3EYUH 4UDUB 1M6OA 1T1ZA 5HGHA 5TF1L 3KPNA 4HGMA 3UXFA 4KUZL 3T4YB 3JV4B 4F37F 4XPGH 1DANU 3HE7C 4FTVE 3DOSA 4IRSA 5BVPH 1JPTH 3TVMC 4LHUA 3U2SA 3UZEA 3G04A 2OJZL 2ICWI 4O4YH 4XMLL 2KUTA 2HJLB 4FQHB 3KJ4C 3LKQA 1IGFH 3OJVC 2IEPA 5ILTH 4XX1G 2X4OA 2Q8AL 4MJ4A 3WD5H 1EUTA 3DV4B 4HUVB 1W72H 4CADB 2RGSA 1V3LA 3BZ4A 1PKOA 4L4TD 5FGBA 5DVOA 3H9SE 1A6ZB 4JQXC 3L3JB 3SPVA 3UTSD 4KROC 3GMQB 4PJIF 1RHHB 3KLDA 1TNMA 3BPOB 4ONFH 3EYSL 1ZK9A 3TH4T 3P77B 4IDJL 3ALPA 5ALBH 3FN0H 4DZ8B 2P43B 4EBQL 2HJLA 4FQHA 1BOGB 1MNUH 4X9BA 2BOCA 1FH5H 1KB5A 2NY4C 5EBMB 4Y8DC 3QYCA 2M8XA 1ZA3B 1TZIA 4CADA 2IPTL 3EYFB 4XCNA 1CVRA 2A6KB 1JZ4A 4DN4H 2P8LA 1A6ZA 2CO6B 4G6FB 1KC5L 3SDCC 3OKNA 3DXAB 3L9RA 3GMQA 1H3TA 4OCRL 2X4UA 4ZFOB 4JGMA 5F8QC 4NO2B 4K8RD 2FHBA 3HZMA 2FATH 4YX2L 4Z0XB 1A7NL 5BXFA 4ODXB 4AT6B 5GRJL 3DIFB 1BOGA 3ETBF 4WU7A 2EYRB 5GGRA 3OAUH 5DVMA 4KJPD 5T1LB 1ZA3A 1N6UA 4NM4H 2VN4A 2YKLL 5JPMA 1AGDB 4NZUH 5FYJH 1IL1A 3BFOA 3U7YH