4QLCA

Crystal structure of chromatosome at 3.5 angstrom resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (167-mer)
molecule tags Chromatin binding protein/dna
source organism Homo sapiens
publication title Structural Mechanisms of Nucleosome Recognition by Linker Histones.
pubmed doi rcsb
total genus 30
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4qlcA00
5AVCC 3B0CW 3UTBD 5B32A 3KSYA 3C1BC 1M18C 3AV2C 1KX4D 3UTBA 5CPKD 3LJAA 2NZDC 3AZFD 5B1LB 2YFVB 4J8VD 3X1SD 1P34C 1N1JA 5B31A 5AY8D 3X1UA 3AZLC 3AZFA 1AOIC 3W96C 1B67A 3KUYC 3LELA 3MGPA 4R8PD 2F8NA 2HIOC 1P3LC 3UT9D 1M19C 1WWSA 4CAYA 4XUJA 3AZHD 1KX5D 3B6GC 3X1TB 5B1LD 1P3IB 4H9SC 5F99D 5B31D 3W97B 3MGQB 4ZBJB 5B32C 2PYOD 5DNMB 3AZIC 3A6NC 3NQJA 3C1CB 3WAAA 3UT9C 3KXBD 5B0ZA 3AZMD 5AV8C 1P3GA 4KGCC 2HIOD 3B0BA 1M19A 4J8WB 4QLCB 5G49A 3WA9D 4LD9C 3REKC 3VH5W 4ZUXB 4XUJD 5F99C 1AOID 4Z5TA 3AZJB 3TU4C 3LZ0B 1BH8A 4Z5TC 5GSUB 2NZDD 4R8PA 3REIA 3UTAB 4CAYB 4YM6B 3C1BD 2PYOA 3REIB 3UTAA 3UTBC 5FUGA 5B0ZC 4CSRA 3C1BA 1TZYA 2F8NG 4KUDB 5GT0C 3REKA 5B0YD 4YM6D 3C1BB 4JJNC 1M18B 3AZLD 3MGRC 2NZDB 3X1SC 1M18A 3UT9A 1WWIA 5B32G 1P3ID 3MVDB 3AV1C 1P3GB 3X1TD 3MGRA 5B1MA 3REHC 3AZHB 2F8NB 1HQ3D 4WV4B 3MVDA 3X1VD 4WU9A 1S32B 4XZQC 3AZMA 1P3MB 5B1MD 5AVCD 2AROB 3AZMB 5E5AA 1M1AD 3C1CD 3W98A 5DNMD 3W99B 4J8VA 3X1TC 2RVQC 1N1JB 5B31B 5B2JC 4J8VB 1A7WA 3AZFB 3MGQC 4YS3C 3AV2A 5CPKB 1KX4B 2NQBA 1ID3D 4Z2MG 5CHLB 3AZND 4AWLB 5B40D 2NZDA 4KHAA 5C3IC 5AV8B 1B6WA 5AVCA 3X1VC 1HQ3C 2IO5B 2BYKA 5B40A 3MGSB 1P3KC 3B0DC 4ZUXC 4J8XC 1BH8B 4Z5TD 3TU4B 1BH9B 5BNVA 3LZ0C 2AROA 1ULYA 3AN2B 2CV5C 1EQZC 4WNNA 5B0YC 4H9NB 4WZSB 5GT0D 3WAAD 1TZYB 5B0ZD 4KUDA 3UTBB 1TAFB 2HUEC 4JJNB 1P3PD 3RELD 4H9PB 3TU4D 1U35C 3AYWD 3AZGA 1P3BA 3LELB 3MGPB 3AZHA 4H9RA 3AYWC 5B33B 3AZHC 1P3MA 4EO5B 3AZGC 1P3BC 4H9QB 1P3MC 5KDMA 5B24C 3X1UD 1P3LD 3NQUB 1ID3B 4HGAB 4R8PC 3KWQB 5E5AD 1M1AA 4WNNB 3MGQA 5AY8C 1P34D 5CPJA 5F99A 1KX4A 4J8VC 1KX5C 2NQBB 4J8XD 4YS3B 3WKJC 1KX4C 1KX5A 4G91C 4DRBA 4J8WA 5AV8A 1ZLAB 5AVCB 1EQZA 3WTPB 3O62B 1P3PA 1S32D 1HQ3B 2IO5C 3MGSC 3X1VB 4WU9C 3MNNB 4NE3A 1P3KB 2F8ND 5AV5C 3AZEB 1BH9A 5BNVB 4J8XB 3W97A 1P34B 5GT3B 3AV2D 1M18D 1M1AB 3NQJB 3AZED 5GT0A 1Q9CA 2L5AA 1TZYC 5AV6D 3WTPD 5BS7C 3WKJA 1P3GD 3RELA 3TU4A 1P3IC 3AFAA 5B2IA 3MGRD 1F1EA 4WU8A 5B32B 3X1SA 5E5AB 3LJAB 4J8XA 5B24B 4NFTA 5GXQD 3AV1A 4KGCB 3AZIA 4QLCC 3V9RB 1P3OA 3KWQC 3UTAD 5AVBA 3AZKA 3W98D 2F8NH 5F99B 3W97D 3LZ0D 5AVBB 3AZKB 1KX5B 2NQBC 5CP6D 5GSUC 4KHAB 4UUZB 4XUJC 3UTAC 4H9QA 1P3AD 2FJ7A 1ZLAC 3O62A 3REIC 3X1TA 1P3FD 3KXBB 5AV8D 4E45A 3WTPC 3AZEA 3AZNC 4KUDC 2JSSA 1P3OD 2PYOB 1H3OA 3AZID 3MNNC 5BT1D 3REJC 3W99A 4NE6A 4WU8B 3AZLA 2CV5A 1P34A 3X1SB 3MVDC 4WU8D 3AV1B 1P3GC 4KGCA 5AV5D 4XZQB 3B6FA 5AV6C 2AROD 5B1MC 3REHA 3B6FB 2BYKB 5B40B 5JRGC 3W96D 5B2IC 5GXQA 3W99C 5B33A 4X23D 3REJA 3R45B 3LZ1A 3AV1D 5BO0B 5CP6A 5AV9C 1P3PB 5GT3A 4J8UC 3AZFC 4CSRB 5CPKC 3WTPE 5B2ID 1ID3A 4Z2MH 2LY8A 3KUYA 5E5AC 5B1LA 3LJAC 5CPIC 1F66A 5C3IB 3LJAD 4H9OB 3X1UC 1F66B 1P3MD 3VH5A 1P3FA 3LZ1C 5AV6A 5AVBC 1HQ3A 3AZKC 4H9RB 3AZJD 1EQZB 4XUJB 4Z66B 3REKD 1P3PC 3A6NA 1P3KA 1F66D 4Z66A 4KUDD 3NQUA 1JFIA 3REID 1P3FC 5DNNC 5B32D 2PYOC 2HUEB 4E44A 3AV2B 5CPKA 1P3LA 5GT3D 1KX3C 1EQZD 5B1LC 3LELC 3MGPC 1U35D 3W96A 5B2JA 3B6GD 4H9PA 3RELC 5B33C 3MNND 4ZUXD 1AOIB 2FJ7D 2HIOA 3AFAD 3AZGB 1P3BB 1M19D 1ZLAA 3W96B 3W98C 4QLCD 5AV6B 3WA9B 2HIOB 3B6FD 5GXQC 1ZLAD 4HGAC 3WAAC 4R8PB 5BO0A 2CV5D 5KDMB 5B2IB 4H9NA 4DRAA 2NQBD 5AY8B 5BNXA 5AV9B 3KWQA 1P3KD 5DNMC 4G91B 3AZIB 4JJNA 4H9OA 1P3OB 3UT9B 5CPIB 2YFWB 1P3AA 3O62C 3AFAC 5CPIA 4J8WC 5B31G 1F66C 5BS7A 4WU9B 2FJ7C 4LD9B 1P3AB 4XZQD 5B33D 5AV5B 3AZEC 3AZNA 1AOIA 3LZ1B 3WTPA 3R45A 5GSUA 3VH6W 5CP6B 3AZJC 5JA4A 4G92B 5GT3C 4J8UA 1KX3D 3B0CT 5AVBD 3AZKD 5JA4B 3KXBA 4M6BA 5DNND 1M1AC 3VH5T 4YM6C 5CPJD 3X1VA 1TZYD 5B0ZB 5GT0B 1P3FB 2BYMA 5DNNB 4QLCA 4YS3A 3WKJD 1KX3B 3MGRB 1KU5A 1S32A 3AZJA 4J8UD 1R4VA 1KX3A 3RELB 1HTAA 3REHB 3WA9A 3MGSD 1S32C 5JRGD 3W98B 3WA9C 1JFIB 5CPID 5GXQB 2AROC 4KGCD 3AZMC 5FUGB 5B24D 2F8NK 3C1CA 5CPJC 3WAAB 3A6ND 5AY8A 3AN2D 5B24A 5AV9D 5G49B 5B31C 5B2JB 2YFVA 4X23C 3W99D 4ZUXA 4X23A 3REJD 4LD9D 3MGSA 1U35A 1P3OC 4AWLC 3O62D 3KXBC 5AV5A 3AZNB 3AFAB 3AZGD 1P3BD 2FJ7B 1P3AC 3B0DB 3KUYD 3REJB 4WU8C 3MVDD 3AN2A 5BNXB 5CP6C 5AV9A 4G92C 1P3IA 5BT1C 3AZLB 3AN2C 2CV5B 3V9RA 5B0YB 3KUYB 3KWQD 5DNMA 1TAFA 2YFWA 5B0YA 1P3LB 5B1MB 3B6FC 5B40C 4XZQA 1M19B 5JRGB 4UUZA 5GSUD 1BFMA 4H9SA 3B6GB 4YS3D 3AYWA 1U35B 4NE5A 4J8UB 3VH6T 3LELD 3MGPD 5B2JD 3B6GA 3W97C 3AYWB 3MNNA 4ZBJC 3VH6A 4EO5C 1H3OB 3A6NB 3C1CC 4YM6A 3X1UB 2BYMB 5DNNA 1ID3C 5CPJB 4Z66D 3REKB 3MGQD 3REHD 2RVQD 4X23B 4Z5TB 3LZ1D 4Z66C 3WKJB 2CWEA 3LZ0A 5JRGA 4JJND 4J8WD 4LD9A 4WU9D
chains in the Genus database with same CATH superfamily
5AVCC 2UWXA 3B0CW 3UTBD 5B32A 3KSYA 4WJ3C 3C1BC 1M18C 3AV2C 1KX4D 3UTBA 5CPKD 3LJAA 2NZDC 3AZFD 5B1LB 2YFVB 4J8VD 3X1SD 1P34C 1N1JA 5B31A 5AY8D 3X1UA 3AZLC 3AZFA 1AOIC 3W96C 1B67A 3H0RC 3LELA 3MGPA 3KUYC 4R8PD 2F8NA 2HIOC 1P3LC 2JCHA 3UT9D 1M19C 1WWSA 4CAYA 4XUJA 3AZHD 1KX5D 3B6GC 3X1TB 5B1LD 1P3IB 3EPHA 4H9SC 5F99D 5B31D 3W97B 3MGQB 2DQNC 4ZBJB 5B32C 2PYOD 5DNMB 3AZIC 3A6NC 3NQJA 3C1CB 3WAAA 3UT9C 3KXBD 2G5HC 5B0ZA 3AZMD 5AV8C 1P3GA 4KGCC 3EPLA 2HIOD 3B0BA 1M19A 4J8WB 4QLCB 1W2EA 5G49A 3WA9D 4LD9C 3REKC 2ZM5A 3VH5W 4ZUXB 2Y2QA 4XUJD 5F99C 1AOID 4Z5TA 3AZJB 3TU4C 2J8PA 3LZ0B 1BH8A 4Z5TC 1Z2CB 5GSUB 2NZDD 4R8PA 3REIA 3UTAB 4CAYB 4YM6B 3C1BD 3P5JB 2PYOA 2DF4C 3REIB 3UTAA 3UTBC 5FUGA 5B0ZC 4CSRA 3C1BA 1TZYA 2F8NG 4KUDB 5GT0C 3REKA 5B0YD 4YM6D 3C1BB 4JJNC 1M18B 3AZLD 3MGRC 2NZDB 4UPKA 3X1SC 1M18A 3UT9A 1WWIA 5B32G 1P3ID 3MVDB 3AV1C 1P3GB 3X1TD 3MGRA 5B1MA 3REHC 3AZHB 2F8NB 1HQ3D 4WV4B 3MVDA 3X1VD 4WU9A 1S32B 4XZQC 3AZMA 1P3MB 5B1MD 5AVCD 2AROB 3AZMB 5E5AA 1M1AD 3C1CD 3W98A 5DNMD 2ZY3A 3W99B 4J8VA 3X1TC 2RVQC 1N1JB 5B31B 5B2JC 4J8VB 1A7WA 3AZFB 3MGQC 4YS3C 3AV2A 5CPKB 1KX4B 2NQBA 1ID3D 4Z2MG 3FDDA 5CHLB 3AZND 4AWLB 2Y2HA 5B40D 2NZDA 4KHAA 5C3IC 5AV8B 1B6WA 5AVCA 3X1VC 1HQ3C 5B40A 2BYKA 2IO5B 3MGSB 1P3KC 3B0DC 4ZUXC 4J8XC 2ZY5A 1BH8B 4Z5TD 3TU4B 1BH9B 5BNVA 3LZ0C 2AROA 1ULYA 3AN2B 2CV5C 1EQZC 4WNNA 5B0YC 4H9NB 4WZSB 5GT0D 3WAAD 2JE5A 1TZYB 5B0ZD 4KUDA 3UTBB 1TAFB 2HUEC 4JJNB 1P3PD 3RELD 4H9PB 3TU4D 1U35C 3AYWD 3AZGA 1P3BA 3LELB 3MGPB 3EPJA 3AZHA 2Y2OA 3IP4C 4H9RA 3AYWC 5B33B 3EPKA 3AZHC 1P3MA 4EO5B 3AZGC 1P3BC 4H9QB 3A1IA 1P3MC 5KDMA 5B24C 3X1UD 1P3LD 3NQUB 1ID3B 4HGAB 4R8PC 3KWQB 5E5AD 1M1AA 4WNNB 3MGQA 3EG5B 5AY8C 1P34D 5CPJA 5F99A 1KX4A 4J8VC 2VQRA 1KX5C 2NQBB 4J8XD 4YS3B 3WKJC 2Y2PA 1KX4C 1KX5A 4G91C 4DRBA 4J8WA 5AV8A 1ZLAB 5AVCB 1EQZA 3WTPB 3O62B 1P3PA 1S32D 1HQ3B 2IO5C 3MGSC 3X1VB 4WU9C 3MNNB 4NE3A 1P3KB 2F8ND 5AV5C 3AZEB 1BH9A 5BNVB 4J8XB 3W97A 1P34B 5GT3B 3AV2D 1M18D 3H0MC 1M1AB 3NQJB 3AZED 5GT0A 1Q9CA 2L5AA 1TZYC 5AV6D 3WTPD 2Y2NA 5BS7C 3WKJA 1P3GD 3RELA 3TU4A 1P3IC 3AFAA 5B2IA 3MGRD 1F1EA 4WU8A 5B32B 3X1SA 2RIQA 5E5AB 3LJAB 4J8XA 5B24B 2BG1A 4NFTA 5GXQD 3AV1A 4KGCB 3AZIA 4QLCC 3V9RB 1P3OA 3KWQC 3UTAD 5AVBA 3AZKA 3W98D 2Y2JA 2F8NH 5F99B 3W97D 3LZ0D 5AVBB 3AZKB 1KX5B 2NQBC 5CP6D 2G5IC 4KHAB 5GSUC 4XUJC 4UUZB 3KFUG 3UTAC 4H9QA 1P3AD 2FJ7A 1ZLAC 3O62A 3REIC 3X1TA 1P3FD 3KXBB 5AV8D 4E45A 3WTPC 3AZEA 4JJND 3AZNC 4KUDC 2JSSA 1P3OD 2PYOB 2Y2IA 1H3OA 3AZID 3MNNC 5BT1D 3REJC 3W99A 4NE6A 4WU8B 3AZLA 3F6TA 2CV5A 1P34A 3X1SB 4DQYB 3MVDC 4WU8D 3AV1B 1P3GC 4KGCA 5AV5D 4XZQB 3B6FA 5AV6C 2AROD 5B1MC 3REHA 3B6FB 2BYKB 5B40B 5JRGC 3W96D 5B2IC 5GXQA 3W99C 5B33A 4X23D 3REJA 1PZRA 3R45B 3LZ1A 3AV1D 5BO0B 5AV9C 5CP6A 1P3PB 5GT3A 4J8UC 3AZFC 4CSRB 5CPKC 3WTPE 5B2ID 1ID3A 4Z2MH 2LY8A 3KUYA 5E5AC 5B1LA 3LJAC 5CPIC 1F66A 5C3IB 3LJAD 4H9OB 3X1UC 1F66B 1P3MD 3VH5A 1P3FA 3LZ1C 5AV6A 5AVBC 1HQ3A 3AZKC 4H9RB 3AZJD 1EQZB 4XUJB 2XD5A 4Z66B 3REKD 1P3PC 3A6NA 1P3KA 1F66D 4Z66A 4KUDD 3NQUA 1JFIA 3REID 1P3FC 5DNNC 5B32D 2PYOC 2HUEB 4E44A 3AV2B 5CPKA 3H0LC 1P3LA 5GT3D 1KX3C 1EQZD 5B1LC 3LELC 3MGPC 1U35D 3W96A 5B2JA 3B6GD 4H9PA 3RELC 5B33C 3MNND 4ZUXD 1AOIB 2FJ7D 2HIOA 3AFAD 3AZGB 1P3BB 1M19D 1ZLAA 3W96B 3W98C 4QLCD 5AV6B 3WA9B 2HIOB 3B6FD 5GXQC 1ZLAD 4HGAC 3WAAC 4R8PB 5BO0A 2CV5D 5KDMB 5B2IB 4H9NA 4DRAA 2NQBD 5AY8B 5BNXA 5AV9B 3KWQA 1P3KD 2XD1A 5DNMC 4G91B 3AZIB 4JJNA 4H9OA 1P3OB 3UT9B 5CPIB 2YFWB 1P3AA 3O62C 3AFAC 5CPIA 4J8WC 5B31G 1F66C 3A1KA 5BS7A 4WU9B 2FJ7C 1P3AB 4LD9B 4XZQD 5B33D 5AV5B 3AZEC 3AZNA 3AL0C 1AOIA 3R45A 3WTPA 3LZ1B 5GSUA 3VH6W 2ZY4A 5CP6B 3AZJC 5JA4A 4G92B 5GT3C 4J8UA 1KX3D 3B0CT 5AVBD 3AZKD 5JA4B 1T3UA 3KXBA 4M6BA 5DNND 1M1AC 3VH5T 4YM6C 5CPJD 3X1VA 2Y2LA 1TZYD 5B0ZB 2Y2KA 5GT0B 1P3FB 2BYMA 5DNNB 4QLCA 4YS3A 3WKJD 1KX3B 3MGRB 1KU5A 1S32A 3AZJA 2W8SA 4J8UD 1R4VA 1KX3A 3RELB 1HTAA 3REHB 3WA9A 3MGSD 1S32C 5JRGD 3W98B 3WA9C 1JFIB 5CPID 2Y2MA 5GXQB 2AROC 4KGCD 3AZMC 5FUGB 5B24D 2F8NK 3C1CA 5CPJC 3WAAB 3A6ND 5AY8A 3AN2D 5B24A 5AV9D 5G49B 5B31C 5B2JB 2YFVA 3W99D 4X23C 4ZUXA 4X23A 3REJD 4LD9D 3MGSA 1U35A 1P3OC 4AWLC 3O62D 3KXBC 5AV5A 3AZNB 3AFAB 3AZGD 1P3BD 2FJ7B 1P3AC 3B0DB 3KUYD 3REJB 4WU8C 3MVDD 3AN2A 5BNXB 5CP6C 5AV9A 4G92C 1P3IA 5BT1C 3AZLB 3AN2C 2CV5B 3V9RA 5B0YB 3KUYB 3KWQD 5DNMA 1TAFA 2YFWA 5B0YA 1P3LB 2FFFB 5B1MB 3B6FC 5B40C 4XZQA 2Y2GA 1M19B 5JRGB 4UUZA 5GSUD 1BFMA 4H9SA 3B6GB 4YS3D 3AYWA 1U35B 4NE5A 4J8UB 3VH6T 3LELD 3MGPD 5B2JD 3B6GA 3W97C 3AYWB 3MNNA 4ZBJC 3VH6A 4EO5C 1H3OB 3A6NB 3C1CC 4YM6A 3X1UB 2BYMB 5DNNA 1ID3C 5CPJB 4Z66D 3REKB 3MGQD 3REHD 2RVQD 4X23B 4Z5TB 3LZ1D 4Z66C 3WKJB 2CWEA 5JRGA 2ZY2A 2F2AC 3LZ0A 4J8WD 4LD9A 4WU9D
chains in the Genus database with same CATH topology
5AVCC 2UWXA 3B0CW 3UTBD 5B32A 3KSYA 4WJ3C 3C1BC 1M18C 3AV2C 1KX4D 3UTBA 5CPKD 3LJAA 2NZDC 3AZFD 5B1LB 2YFVB 4J8VD 3X1SD 1P34C 1N1JA 5B31A 5AY8D 3X1UA 3AZLC 3AZFA 1AOIC 3W96C 1B67A 3H0RC 3LELA 3MGPA 3KUYC 4R8PD 2F8NA 2HIOC 1P3LC 2JCHA 3UT9D 1M19C 1WWSA 4CAYA 4XUJA 3AZHD 1KX5D 3B6GC 3X1TB 5B1LD 1P3IB 3EPHA 4H9SC 5F99D 5B31D 3W97B 3MGQB 2DQNC 4ZBJB 5B32C 2PYOD 5DNMB 3AZIC 3A6NC 3NQJA 3C1CB 3WAAA 3UT9C 3KXBD 2G5HC 5B0ZA 3AZMD 5AV8C 1P3GA 4KGCC 3EPLA 2HIOD 3B0BA 1M19A 4J8WB 4QLCB 1W2EA 5G49A 3WA9D 4LD9C 3REKC 2ZM5A 3VH5W 4ZUXB 2Y2QA 4XUJD 5F99C 1AOID 4Z5TA 3AZJB 3TU4C 2J8PA 3LZ0B 1BH8A 4Z5TC 1Z2CB 5GSUB 2NZDD 4R8PA 3REIA 3UTAB 4CAYB 4YM6B 3C1BD 3P5JB 2PYOA 2DF4C 3REIB 3UTAA 3UTBC 5FUGA 5B0ZC 4CSRA 3C1BA 1TZYA 2F8NG 4KUDB 5GT0C 3REKA 5B0YD 4YM6D 3C1BB 4JJNC 1M18B 3AZLD 3MGRC 2NZDB 4UPKA 3X1SC 1M18A 3UT9A 1WWIA 5B32G 1P3ID 3MVDB 3AV1C 1P3GB 3X1TD 3MGRA 5B1MA 3REHC 3AZHB 2F8NB 1HQ3D 4WV4B 3MVDA 3X1VD 4WU9A 1S32B 4XZQC 3AZMA 1P3MB 5B1MD 5AVCD 2AROB 3AZMB 5E5AA 1M1AD 3C1CD 3W98A 5DNMD 2ZY3A 3W99B 4J8VA 3X1TC 2RVQC 1N1JB 5B31B 5B2JC 4J8VB 1A7WA 3AZFB 3MGQC 4YS3C 3AV2A 5CPKB 1KX4B 2NQBA 1ID3D 4Z2MG 3FDDA 5CHLB 3AZND 4AWLB 2Y2HA 5B40D 2NZDA 4KHAA 5C3IC 5AV8B 1B6WA 5AVCA 3X1VC 1HQ3C 5B40A 2BYKA 2IO5B 3MGSB 1P3KC 3B0DC 4ZUXC 4J8XC 2ZY5A 1BH8B 4Z5TD 3TU4B 1BH9B 5BNVA 3LZ0C 2AROA 1ULYA 3AN2B 2CV5C 1EQZC 4WNNA 5B0YC 4H9NB 4WZSB 5GT0D 3WAAD 2JE5A 1TZYB 5B0ZD 4KUDA 3UTBB 1TAFB 2HUEC 4JJNB 1P3PD 3RELD 4H9PB 3TU4D 1U35C 3AYWD 3AZGA 1P3BA 3LELB 3MGPB 3EPJA 3AZHA 2Y2OA 3IP4C 4H9RA 3AYWC 5B33B 3EPKA 3AZHC 1P3MA 4EO5B 3AZGC 1P3BC 4H9QB 3A1IA 1P3MC 5KDMA 5B24C 3X1UD 1P3LD 3NQUB 1ID3B 4HGAB 4R8PC 3KWQB 5E5AD 1M1AA 4WNNB 3MGQA 3EG5B 5AY8C 1P34D 5CPJA 5F99A 1KX4A 4J8VC 2VQRA 1KX5C 2NQBB 4J8XD 4YS3B 3WKJC 2Y2PA 1KX4C 1KX5A 4G91C 4DRBA 4J8WA 5AV8A 1ZLAB 5AVCB 1EQZA 3WTPB 3O62B 1P3PA 1S32D 1HQ3B 2IO5C 3MGSC 3X1VB 4WU9C 3MNNB 4NE3A 1P3KB 2F8ND 5AV5C 3AZEB 1BH9A 5BNVB 4J8XB 3W97A 1P34B 5GT3B 3AV2D 1M18D 3H0MC 1M1AB 3NQJB 3AZED 5GT0A 1Q9CA 2L5AA 1TZYC 5AV6D 3WTPD 2Y2NA 5BS7C 3WKJA 1P3GD 3RELA 3TU4A 1P3IC 3AFAA 5B2IA 3MGRD 1F1EA 4WU8A 5B32B 3X1SA 2RIQA 5E5AB 3LJAB 4J8XA 5B24B 2BG1A 4NFTA 5GXQD 3AV1A 4KGCB 3AZIA 4QLCC 3V9RB 1P3OA 3KWQC 3UTAD 5AVBA 3AZKA 3W98D 2Y2JA 2F8NH 5F99B 3W97D 3LZ0D 5AVBB 3AZKB 1KX5B 2NQBC 5CP6D 2G5IC 4KHAB 5GSUC 4XUJC 4UUZB 3KFUG 3UTAC 4H9QA 1P3AD 2FJ7A 1ZLAC 3O62A 3REIC 3X1TA 1P3FD 3KXBB 5AV8D 4E45A 3WTPC 3AZEA 4JJND 3AZNC 4KUDC 2JSSA 1P3OD 2PYOB 2Y2IA 1H3OA 3AZID 3MNNC 5BT1D 3REJC 3W99A 4NE6A 4WU8B 3AZLA 3F6TA 2CV5A 1P34A 3X1SB 4DQYB 3MVDC 4WU8D 3AV1B 1P3GC 4KGCA 5AV5D 4XZQB 3B6FA 5AV6C 2AROD 5B1MC 3REHA 3B6FB 2BYKB 5B40B 5JRGC 3W96D 5B2IC 5GXQA 3W99C 5B33A 4X23D 3REJA 1PZRA 3R45B 3LZ1A 3AV1D 5BO0B 5AV9C 5CP6A 1P3PB 5GT3A 4J8UC 3AZFC 4CSRB 5CPKC 3WTPE 5B2ID 1ID3A 4Z2MH 2LY8A 3KUYA 5E5AC 5B1LA 3LJAC 5CPIC 1F66A 5C3IB 3LJAD 4H9OB 3X1UC 1F66B 1P3MD 3VH5A 1P3FA 3LZ1C 5AV6A 5AVBC 1HQ3A 3AZKC 4H9RB 3AZJD 1EQZB 4XUJB 2XD5A 4Z66B 3REKD 1P3PC 3A6NA 1P3KA 1F66D 4Z66A 4KUDD 3NQUA 1JFIA 3REID 1P3FC 5DNNC 5B32D 2PYOC 2HUEB 4E44A 3AV2B 5CPKA 3H0LC 1P3LA 5GT3D 1KX3C 1EQZD 5B1LC 3LELC 3MGPC 1U35D 3W96A 5B2JA 3B6GD 4H9PA 3RELC 5B33C 3MNND 4ZUXD 1AOIB 2FJ7D 2HIOA 3AFAD 3AZGB 1P3BB 1M19D 1ZLAA 3W96B 3W98C 4QLCD 5AV6B 3WA9B 2HIOB 3B6FD 5GXQC 1ZLAD 4HGAC 3WAAC 4R8PB 5BO0A 2CV5D 5KDMB 5B2IB 4H9NA 4DRAA 2NQBD 5AY8B 5BNXA 5AV9B 3KWQA 1P3KD 2XD1A 5DNMC 4G91B 3AZIB 4JJNA 4H9OA 1P3OB 3UT9B 5CPIB 2YFWB 1P3AA 3O62C 3AFAC 5CPIA 4J8WC 5B31G 1F66C 3A1KA 5BS7A 4WU9B 2FJ7C 1P3AB 4LD9B 4XZQD 5B33D 5AV5B 3AZEC 3AZNA 3AL0C 1AOIA 3R45A 3WTPA 3LZ1B 5GSUA 3VH6W 2ZY4A 5CP6B 3AZJC 5JA4A 4G92B 5GT3C 4J8UA 1KX3D 3B0CT 5AVBD 3AZKD 5JA4B 1T3UA 3KXBA 4M6BA 5DNND 1M1AC 3VH5T 4YM6C 5CPJD 3X1VA 2Y2LA 1TZYD 5B0ZB 2Y2KA 5GT0B 1P3FB 2BYMA 5DNNB 4QLCA 4YS3A 3WKJD 1KX3B 3MGRB 1KU5A 1S32A 3AZJA 2W8SA 4J8UD 1R4VA 1KX3A 3RELB 1HTAA 3REHB 3WA9A 3MGSD 1S32C 5JRGD 3W98B 3WA9C 1JFIB 5CPID 2Y2MA 5GXQB 2AROC 4KGCD 3AZMC 5FUGB 5B24D 2F8NK 3C1CA 5CPJC 3WAAB 3A6ND 5AY8A 3AN2D 5B24A 5AV9D 5G49B 5B31C 5B2JB 2YFVA 3W99D 4X23C 4ZUXA 4X23A 3REJD 4LD9D 3MGSA 1U35A 1P3OC 4AWLC 3O62D 3KXBC 5AV5A 3AZNB 3AFAB 3AZGD 1P3BD 2FJ7B 1P3AC 3B0DB 3KUYD 3REJB 4WU8C 3MVDD 3AN2A 5BNXB 5CP6C 5AV9A 4G92C 1P3IA 5BT1C 3AZLB 3AN2C 2CV5B 3V9RA 5B0YB 3KUYB 3KWQD 5DNMA 1TAFA 2YFWA 5B0YA 1P3LB 2FFFB 5B1MB 3B6FC 5B40C 4XZQA 2Y2GA 1M19B 5JRGB 4UUZA 5GSUD 1BFMA 4H9SA 3B6GB 4YS3D 3AYWA 1U35B 4NE5A 4J8UB 3VH6T 3LELD 3MGPD 5B2JD 3B6GA 3W97C 3AYWB 3MNNA 4ZBJC 3VH6A 4EO5C 1H3OB 3A6NB 3C1CC 4YM6A 3X1UB 2BYMB 5DNNA 1ID3C 5CPJB 4Z66D 3REKB 3MGQD 3REHD 2RVQD 4X23B 4Z5TB 3LZ1D 4Z66C 3WKJB 2CWEA 5JRGA 2ZY2A 2F2AC 3LZ0A 4J8WD 4LD9A 4WU9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVC C;  3B0C W;  3UTB D;  5B32 A;  3KSY A;  3C1B C;  1M18 C;  3AV2 C;  1KX4 D;  3UTB A;  5CPK D;  3LJA A;  2NZD C;  3AZF D;  5B1L B;  2YFV B;  4J8V D;  3X1S D;  1P34 C;  1N1J A;  5B31 A;  5AY8 D;  3X1U A;  3AZL C;  3AZF A;  1AOI C;  3W96 C;  1B67 A;  3KUY C;  3LEL A;  3MGP A;  4R8P D;  2F8N A;  2HIO C;  1P3L C;  3UT9 D;  1M19 C;  1WWS A;  4CAY A;  4XUJ A;  3AZH D;  1KX5 D;  3B6G C;  3X1T B;  5B1L D;  1P3I B;  4H9S C;  5F99 D;  5B31 D;  3W97 B;  3MGQ B;  4ZBJ B;  5B32 C;  2PYO D;  5DNM B;  3AZI C;  3A6N C;  3NQJ A;  3C1C B;  3WAA A;  3UT9 C;  3KXB D;  5B0Z A;  3AZM D;  5AV8 C;  1P3G A;  4KGC C;  2HIO D;  3B0B A;  1M19 A;  4J8W B;  4QLC B;  5G49 A;  3WA9 D;  4LD9 C;  3REK C;  3VH5 W;  4ZUX B;  4XUJ D;  5F99 C;  1AOI D;  4Z5T A;  3AZJ B;  3TU4 C;  3LZ0 B;  1BH8 A;  4Z5T C;  5GSU B;  2NZD D;  4R8P A;  3REI A;  3UTA B;  4CAY B;  4YM6 B;  3C1B D;  2PYO A;  3REI B;  3UTA A;  3UTB C;  5FUG A;  5B0Z C;  4CSR A;  3C1B A;  1TZY A;  2F8N G;  4KUD B;  5GT0 C;  3REK A;  5B0Y D;  4YM6 D;  3C1B B;  4JJN C;  1M18 B;  3AZL D;  3MGR C;  2NZD B;  3X1S C;  1M18 A;  3UT9 A;  1WWI A;  5B32 G;  1P3I D;  3MVD B;  3AV1 C;  1P3G B;  3X1T D;  3MGR A;  5B1M A;  3REH C;  3AZH B;  2F8N B;  1HQ3 D;  4WV4 B;  3MVD A;  3X1V D;  4WU9 A;  1S32 B;  4XZQ C;  3AZM A;  1P3M B;  5B1M D;  5AVC D;  2ARO B;  3AZM B;  5E5A A;  1M1A D;  3C1C D;  3W98 A;  5DNM D;  3W99 B;  4J8V A;  3X1T C;  2RVQ C;  1N1J B;  5B31 B;  5B2J C;  4J8V B;  1A7W A;  3AZF B;  3MGQ C;  4YS3 C;  3AV2 A;  5CPK B;  1KX4 B;  2NQB A;  1ID3 D;  4Z2M G;  5CHL B;  3AZN D;  4AWL B;  5B40 D;  2NZD A;  4KHA A;  5C3I C;  5AV8 B;  1B6W A;  5AVC A;  3X1V C;  1HQ3 C;  2IO5 B;  2BYK A;  5B40 A;  3MGS B;  1P3K C;  3B0D C;  4ZUX C;  4J8X C;  1BH8 B;  4Z5T D;  3TU4 B;  1BH9 B;  5BNV A;  3LZ0 C;  2ARO A;  1ULY A;  3AN2 B;  2CV5 C;  1EQZ C;  4WNN A;  5B0Y C;  4H9N B;  4WZS B;  5GT0 D;  3WAA D;  1TZY B;  5B0Z D;  4KUD A;  3UTB B;  1TAF B;  2HUE C;  4JJN B;  1P3P D;  3REL D;  4H9P B;  3TU4 D;  1U35 C;  3AYW D;  3AZG A;  1P3B A;  3LEL B;  3MGP B;  3AZH A;  4H9R A;  3AYW C;  5B33 B;  3AZH C;  1P3M A;  4EO5 B;  3AZG C;  1P3B C;  4H9Q B;  1P3M C;  5KDM A;  5B24 C;  3X1U D;  1P3L D;  3NQU B;  1ID3 B;  4HGA B;  4R8P C;  3KWQ B;  5E5A D;  1M1A A;  4WNN B;  3MGQ A;  5AY8 C;  1P34 D;  5CPJ A;  5F99 A;  1KX4 A;  4J8V C;  1KX5 C;  2NQB B;  4J8X D;  4YS3 B;  3WKJ C;  1KX4 C;  1KX5 A;  4G91 C;  4DRB A;  4J8W A;  5AV8 A;  1ZLA B;  5AVC B;  1EQZ A;  3WTP B;  3O62 B;  1P3P A;  1S32 D;  1HQ3 B;  2IO5 C;  3MGS C;  3X1V B;  4WU9 C;  3MNN B;  4NE3 A;  1P3K B;  2F8N D;  5AV5 C;  3AZE B;  1BH9 A;  5BNV B;  4J8X B;  3W97 A;  1P34 B;  5GT3 B;  3AV2 D;  1M18 D;  1M1A B;  3NQJ B;  3AZE D;  5GT0 A;  1Q9C A;  2L5A A;  1TZY C;  5AV6 D;  3WTP D;  5BS7 C;  3WKJ A;  1P3G D;  3REL A;  3TU4 A;  1P3I C;  3AFA A;  5B2I A;  3MGR D;  1F1E A;  4WU8 A;  5B32 B;  3X1S A;  5E5A B;  3LJA B;  4J8X A;  5B24 B;  4NFT A;  5GXQ D;  3AV1 A;  4KGC B;  3AZI A;  4QLC C;  3V9R B;  1P3O A;  3KWQ C;  3UTA D;  5AVB A;  3AZK A;  3W98 D;  2F8N H;  5F99 B;  3W97 D;  3LZ0 D;  5AVB B;  3AZK B;  1KX5 B;  2NQB C;  5CP6 D;  5GSU C;  4KHA B;  4UUZ B;  4XUJ C;  3UTA C;  4H9Q A;  1P3A D;  2FJ7 A;  1ZLA C;  3O62 A;  3REI C;  3X1T A;  1P3F D;  3KXB B;  5AV8 D;  4E45 A;  3WTP C;  3AZE A;  3AZN C;  4KUD C;  2JSS A;  1P3O D;  2PYO B;  1H3O A;  3AZI D;  3MNN C;  5BT1 D;  3REJ C;  3W99 A;  4NE6 A;  4WU8 B;  3AZL A;  2CV5 A;  1P34 A;  3X1S B;  3MVD C;  4WU8 D;  3AV1 B;  1P3G C;  4KGC A;  5AV5 D;  4XZQ B;  3B6F A;  5AV6 C;  2ARO D;  5B1M C;  3REH A;  3B6F B;  2BYK B;  5B40 B;  5JRG C;  3W96 D;  5B2I C;  5GXQ A;  3W99 C;  5B33 A;  4X23 D;  3REJ A;  3R45 B;  3LZ1 A;  3AV1 D;  5BO0 B;  5CP6 A;  5AV9 C;  1P3P B;  5GT3 A;  4J8U C;  3AZF C;  4CSR B;  5CPK C;  3WTP E;  5B2I D;  1ID3 A;  4Z2M H;  2LY8 A;  3KUY A;  5E5A C;  5B1L A;  3LJA C;  5CPI C;  1F66 A;  5C3I B;  3LJA D;  4H9O B;  3X1U C;  1F66 B;  1P3M D;  3VH5 A;  1P3F A;  3LZ1 C;  5AV6 A;  5AVB C;  1HQ3 A;  3AZK C;  4H9R B;  3AZJ D;  1EQZ B;  4XUJ B;  4Z66 B;  3REK D;  1P3P C;  3A6N A;  1P3K A;  1F66 D;  4Z66 A;  4KUD D;  3NQU A;  1JFI A;  3REI D;  1P3F C;  5DNN C;  5B32 D;  2PYO C;  2HUE B;  4E44 A;  3AV2 B;  5CPK A;  1P3L A;  5GT3 D;  1KX3 C;  1EQZ D;  5B1L C;  3LEL C;  3MGP C;  1U35 D;  3W96 A;  5B2J A;  3B6G D;  4H9P A;  3REL C;  5B33 C;  3MNN D;  4ZUX D;  1AOI B;  2FJ7 D;  2HIO A;  3AFA D;  3AZG B;  1P3B B;  1M19 D;  1ZLA A;  3W96 B;  3W98 C;  4QLC D;  5AV6 B;  3WA9 B;  2HIO B;  3B6F D;  5GXQ C;  1ZLA D;  4HGA C;  3WAA C;  4R8P B;  5BO0 A;  2CV5 D;  5KDM B;  5B2I B;  4H9N A;  4DRA A;  2NQB D;  5AY8 B;  5BNX A;  5AV9 B;  3KWQ A;  1P3K D;  5DNM C;  4G91 B;  3AZI B;  4JJN A;  4H9O A;  1P3O B;  3UT9 B;  5CPI B;  2YFW B;  1P3A A;  3O62 C;  3AFA C;  5CPI A;  4J8W C;  5B31 G;  1F66 C;  5BS7 A;  4WU9 B;  2FJ7 C;  4LD9 B;  1P3A B;  4XZQ D;  5B33 D;  5AV5 B;  3AZE C;  3AZN A;  1AOI A;  3LZ1 B;  3WTP A;  3R45 A;  5GSU A;  3VH6 W;  5CP6 B;  3AZJ C;  5JA4 A;  4G92 B;  5GT3 C;  4J8U A;  1KX3 D;  3B0C T;  5AVB D;  3AZK D;  5JA4 B;  3KXB A;  4M6B A;  5DNN D;  1M1A C;  3VH5 T;  4YM6 C;  5CPJ D;  3X1V A;  1TZY D;  5B0Z B;  5GT0 B;  1P3F B;  2BYM A;  5DNN B;  4QLC A;  4YS3 A;  3WKJ D;  1KX3 B;  3MGR B;  1KU5 A;  1S32 A;  3AZJ A;  4J8U D;  1R4V A;  1KX3 A;  3REL B;  1HTA A;  3REH B;  3WA9 A;  3MGS D;  1S32 C;  5JRG D;  3W98 B;  3WA9 C;  1JFI B;  5CPI D;  5GXQ B;  2ARO C;  4KGC D;  3AZM C;  5FUG B;  5B24 D;  2F8N K;  3C1C A;  5CPJ C;  3WAA B;  3A6N D;  5AY8 A;  3AN2 D;  5B24 A;  5AV9 D;  5G49 B;  5B31 C;  5B2J B;  2YFV A;  4X23 C;  3W99 D;  4ZUX A;  4X23 A;  3REJ D;  4LD9 D;  3MGS A;  1U35 A;  1P3O C;  4AWL C;  3O62 D;  3KXB C;  5AV5 A;  3AZN B;  3AFA B;  3AZG D;  1P3B D;  2FJ7 B;  1P3A C;  3B0D B;  3KUY D;  3REJ B;  4WU8 C;  3MVD D;  3AN2 A;  5BNX B;  5CP6 C;  5AV9 A;  4G92 C;  1P3I A;  5BT1 C;  3AZL B;  3AN2 C;  2CV5 B;  3V9R A;  5B0Y B;  3KUY B;  3KWQ D;  5DNM A;  1TAF A;  2YFW A;  5B0Y A;  1P3L B;  5B1M B;  3B6F C;  5B40 C;  4XZQ A;  1M19 B;  5JRG B;  4UUZ A;  5GSU D;  1BFM A;  4H9S A;  3B6G B;  4YS3 D;  3AYW A;  1U35 B;  4NE5 A;  4J8U B;  3VH6 T;  3LEL D;  3MGP D;  5B2J D;  3B6G A;  3W97 C;  3AYW B;  3MNN A;  4ZBJ C;  3VH6 A;  4EO5 C;  1H3O B;  3A6N B;  3C1C C;  4YM6 A;  3X1U B;  2BYM B;  5DNN A;  1ID3 C;  5CPJ B;  4Z66 D;  3REK B;  3MGQ D;  3REH D;  2RVQ D;  4X23 B;  4Z5T B;  3LZ1 D;  4Z66 C;  3WKJ B;  2CWE A;  3LZ0 A;  5JRG A;  4JJN D;  4J8W D;  4LD9 A;  4WU9 D; 
#chains in the Genus database with same CATH topology
 5AVC C;  2UWX A;  3B0C W;  3UTB D;  5B32 A;  3KSY A;  4WJ3 C;  3C1B C;  1M18 C;  3AV2 C;  1KX4 D;  3UTB A;  5CPK D;  3LJA A;  2NZD C;  3AZF D;  5B1L B;  2YFV B;  4J8V D;  3X1S D;  1P34 C;  1N1J A;  5B31 A;  5AY8 D;  3X1U A;  3AZL C;  3AZF A;  1AOI C;  3W96 C;  1B67 A;  3H0R C;  3LEL A;  3MGP A;  3KUY C;  4R8P D;  2F8N A;  2HIO C;  1P3L C;  2JCH A;  3UT9 D;  1M19 C;  1WWS A;  4CAY A;  4XUJ A;  3AZH D;  1KX5 D;  3B6G C;  3X1T B;  5B1L D;  1P3I B;  3EPH A;  4H9S C;  5F99 D;  5B31 D;  3W97 B;  3MGQ B;  2DQN C;  4ZBJ B;  5B32 C;  2PYO D;  5DNM B;  3AZI C;  3A6N C;  3NQJ A;  3C1C B;  3WAA A;  3UT9 C;  3KXB D;  2G5H C;  5B0Z A;  3AZM D;  5AV8 C;  1P3G A;  4KGC C;  3EPL A;  2HIO D;  3B0B A;  1M19 A;  4J8W B;  4QLC B;  1W2E A;  5G49 A;  3WA9 D;  4LD9 C;  3REK C;  2ZM5 A;  3VH5 W;  4ZUX B;  2Y2Q A;  4XUJ D;  5F99 C;  1AOI D;  4Z5T A;  3AZJ B;  3TU4 C;  2J8P A;  3LZ0 B;  1BH8 A;  4Z5T C;  1Z2C B;  5GSU B;  2NZD D;  4R8P A;  3REI A;  3UTA B;  4CAY B;  4YM6 B;  3C1B D;  3P5J B;  2PYO A;  2DF4 C;  3REI B;  3UTA A;  3UTB C;  5FUG A;  5B0Z C;  4CSR A;  3C1B A;  1TZY A;  2F8N G;  4KUD B;  5GT0 C;  3REK A;  5B0Y D;  4YM6 D;  3C1B B;  4JJN C;  1M18 B;  3AZL D;  3MGR C;  2NZD B;  4UPK A;  3X1S C;  1M18 A;  3UT9 A;  1WWI A;  5B32 G;  1P3I D;  3MVD B;  3AV1 C;  1P3G B;  3X1T D;  3MGR A;  5B1M A;  3REH C;  3AZH B;  2F8N B;  1HQ3 D;  4WV4 B;  3MVD A;  3X1V D;  4WU9 A;  1S32 B;  4XZQ C;  3AZM A;  1P3M B;  5B1M D;  5AVC D;  2ARO B;  3AZM B;  5E5A A;  1M1A D;  3C1C D;  3W98 A;  5DNM D;  2ZY3 A;  3W99 B;  4J8V A;  3X1T C;  2RVQ C;  1N1J B;  5B31 B;  5B2J C;  4J8V B;  1A7W A;  3AZF B;  3MGQ C;  4YS3 C;  3AV2 A;  5CPK B;  1KX4 B;  2NQB A;  1ID3 D;  4Z2M G;  3FDD A;  5CHL B;  3AZN D;  4AWL B;  2Y2H A;  5B40 D;  2NZD A;  4KHA A;  5C3I C;  5AV8 B;  1B6W A;  5AVC A;  3X1V C;  1HQ3 C;  5B40 A;  2BYK A;  2IO5 B;  3MGS B;  1P3K C;  3B0D C;  4ZUX C;  4J8X C;  2ZY5 A;  1BH8 B;  4Z5T D;  3TU4 B;  1BH9 B;  5BNV A;  3LZ0 C;  2ARO A;  1ULY A;  3AN2 B;  2CV5 C;  1EQZ C;  4WNN A;  5B0Y C;  4H9N B;  4WZS B;  5GT0 D;  3WAA D;  2JE5 A;  1TZY B;  5B0Z D;  4KUD A;  3UTB B;  1TAF B;  2HUE C;  4JJN B;  1P3P D;  3REL D;  4H9P B;  3TU4 D;  1U35 C;  3AYW D;  3AZG A;  1P3B A;  3LEL B;  3MGP B;  3EPJ A;  3AZH A;  2Y2O A;  3IP4 C;  4H9R A;  3AYW C;  5B33 B;  3EPK A;  3AZH C;  1P3M A;  4EO5 B;  3AZG C;  1P3B C;  4H9Q B;  3A1I A;  1P3M C;  5KDM A;  5B24 C;  3X1U D;  1P3L D;  3NQU B;  1ID3 B;  4HGA B;  4R8P C;  3KWQ B;  5E5A D;  1M1A A;  4WNN B;  3MGQ A;  3EG5 B;  5AY8 C;  1P34 D;  5CPJ A;  5F99 A;  1KX4 A;  4J8V C;  2VQR A;  1KX5 C;  2NQB B;  4J8X D;  4YS3 B;  3WKJ C;  2Y2P A;  1KX4 C;  1KX5 A;  4G91 C;  4DRB A;  4J8W A;  5AV8 A;  1ZLA B;  5AVC B;  1EQZ A;  3WTP B;  3O62 B;  1P3P A;  1S32 D;  1HQ3 B;  2IO5 C;  3MGS C;  3X1V B;  4WU9 C;  3MNN B;  4NE3 A;  1P3K B;  2F8N D;  5AV5 C;  3AZE B;  1BH9 A;  5BNV B;  4J8X B;  3W97 A;  1P34 B;  5GT3 B;  3AV2 D;  1M18 D;  3H0M C;  1M1A B;  3NQJ B;  3AZE D;  5GT0 A;  1Q9C A;  2L5A A;  1TZY C;  5AV6 D;  3WTP D;  2Y2N A;  5BS7 C;  3WKJ A;  1P3G D;  3REL A;  3TU4 A;  1P3I C;  3AFA A;  5B2I A;  3MGR D;  1F1E A;  4WU8 A;  5B32 B;  3X1S A;  2RIQ A;  5E5A B;  3LJA B;  4J8X A;  5B24 B;  2BG1 A;  4NFT A;  5GXQ D;  3AV1 A;  4KGC B;  3AZI A;  4QLC C;  3V9R B;  1P3O A;  3KWQ C;  3UTA D;  5AVB A;  3AZK A;  3W98 D;  2Y2J A;  2F8N H;  5F99 B;  3W97 D;  3LZ0 D;  5AVB B;  3AZK B;  1KX5 B;  2NQB C;  5CP6 D;  2G5I C;  4KHA B;  5GSU C;  4XUJ C;  4UUZ B;  3KFU G;  3UTA C;  4H9Q A;  1P3A D;  2FJ7 A;  1ZLA C;  3O62 A;  3REI C;  3X1T A;  1P3F D;  3KXB B;  5AV8 D;  4E45 A;  3WTP C;  3AZE A;  4JJN D;  3AZN C;  4KUD C;  2JSS A;  1P3O D;  2PYO B;  2Y2I A;  1H3O A;  3AZI D;  3MNN C;  5BT1 D;  3REJ C;  3W99 A;  4NE6 A;  4WU8 B;  3AZL A;  3F6T A;  2CV5 A;  1P34 A;  3X1S B;  4DQY B;  3MVD C;  4WU8 D;  3AV1 B;  1P3G C;  4KGC A;  5AV5 D;  4XZQ B;  3B6F A;  5AV6 C;  2ARO D;  5B1M C;  3REH A;  3B6F B;  2BYK B;  5B40 B;  5JRG C;  3W96 D;  5B2I C;  5GXQ A;  3W99 C;  5B33 A;  4X23 D;  3REJ A;  1PZR A;  3R45 B;  3LZ1 A;  3AV1 D;  5BO0 B;  5AV9 C;  5CP6 A;  1P3P B;  5GT3 A;  4J8U C;  3AZF C;  4CSR B;  5CPK C;  3WTP E;  5B2I D;  1ID3 A;  4Z2M H;  2LY8 A;  3KUY A;  5E5A C;  5B1L A;  3LJA C;  5CPI C;  1F66 A;  5C3I B;  3LJA D;  4H9O B;  3X1U C;  1F66 B;  1P3M D;  3VH5 A;  1P3F A;  3LZ1 C;  5AV6 A;  5AVB C;  1HQ3 A;  3AZK C;  4H9R B;  3AZJ D;  1EQZ B;  4XUJ B;  2XD5 A;  4Z66 B;  3REK D;  1P3P C;  3A6N A;  1P3K A;  1F66 D;  4Z66 A;  4KUD D;  3NQU A;  1JFI A;  3REI D;  1P3F C;  5DNN C;  5B32 D;  2PYO C;  2HUE B;  4E44 A;  3AV2 B;  5CPK A;  3H0L C;  1P3L A;  5GT3 D;  1KX3 C;  1EQZ D;  5B1L C;  3LEL C;  3MGP C;  1U35 D;  3W96 A;  5B2J A;  3B6G D;  4H9P A;  3REL C;  5B33 C;  3MNN D;  4ZUX D;  1AOI B;  2FJ7 D;  2HIO A;  3AFA D;  3AZG B;  1P3B B;  1M19 D;  1ZLA A;  3W96 B;  3W98 C;  4QLC D;  5AV6 B;  3WA9 B;  2HIO B;  3B6F D;  5GXQ C;  1ZLA D;  4HGA C;  3WAA C;  4R8P B;  5BO0 A;  2CV5 D;  5KDM B;  5B2I B;  4H9N A;  4DRA A;  2NQB D;  5AY8 B;  5BNX A;  5AV9 B;  3KWQ A;  1P3K D;  2XD1 A;  5DNM C;  4G91 B;  3AZI B;  4JJN A;  4H9O A;  1P3O B;  3UT9 B;  5CPI B;  2YFW B;  1P3A A;  3O62 C;  3AFA C;  5CPI A;  4J8W C;  5B31 G;  1F66 C;  3A1K A;  5BS7 A;  4WU9 B;  2FJ7 C;  1P3A B;  4LD9 B;  4XZQ D;  5B33 D;  5AV5 B;  3AZE C;  3AZN A;  3AL0 C;  1AOI A;  3R45 A;  3WTP A;  3LZ1 B;  5GSU A;  3VH6 W;  2ZY4 A;  5CP6 B;  3AZJ C;  5JA4 A;  4G92 B;  5GT3 C;  4J8U A;  1KX3 D;  3B0C T;  5AVB D;  3AZK D;  5JA4 B;  1T3U A;  3KXB A;  4M6B A;  5DNN D;  1M1A C;  3VH5 T;  4YM6 C;  5CPJ D;  3X1V A;  2Y2L A;  1TZY D;  5B0Z B;  2Y2K A;  5GT0 B;  1P3F B;  2BYM A;  5DNN B;  4QLC A;  4YS3 A;  3WKJ D;  1KX3 B;  3MGR B;  1KU5 A;  1S32 A;  3AZJ A;  2W8S A;  4J8U D;  1R4V A;  1KX3 A;  3REL B;  1HTA A;  3REH B;  3WA9 A;  3MGS D;  1S32 C;  5JRG D;  3W98 B;  3WA9 C;  1JFI B;  5CPI D;  2Y2M A;  5GXQ B;  2ARO C;  4KGC D;  3AZM C;  5FUG B;  5B24 D;  2F8N K;  3C1C A;  5CPJ C;  3WAA B;  3A6N D;  5AY8 A;  3AN2 D;  5B24 A;  5AV9 D;  5G49 B;  5B31 C;  5B2J B;  2YFV A;  3W99 D;  4X23 C;  4ZUX A;  4X23 A;  3REJ D;  4LD9 D;  3MGS A;  1U35 A;  1P3O C;  4AWL C;  3O62 D;  3KXB C;  5AV5 A;  3AZN B;  3AFA B;  3AZG D;  1P3B D;  2FJ7 B;  1P3A C;  3B0D B;  3KUY D;  3REJ B;  4WU8 C;  3MVD D;  3AN2 A;  5BNX B;  5CP6 C;  5AV9 A;  4G92 C;  1P3I A;  5BT1 C;  3AZL B;  3AN2 C;  2CV5 B;  3V9R A;  5B0Y B;  3KUY B;  3KWQ D;  5DNM A;  1TAF A;  2YFW A;  5B0Y A;  1P3L B;  2FFF B;  5B1M B;  3B6F C;  5B40 C;  4XZQ A;  2Y2G A;  1M19 B;  5JRG B;  4UUZ A;  5GSU D;  1BFM A;  4H9S A;  3B6G B;  4YS3 D;  3AYW A;  1U35 B;  4NE5 A;  4J8U B;  3VH6 T;  3LEL D;  3MGP D;  5B2J D;  3B6G A;  3W97 C;  3AYW B;  3MNN A;  4ZBJ C;  3VH6 A;  4EO5 C;  1H3O B;  3A6N B;  3C1C C;  4YM6 A;  3X1U B;  2BYM B;  5DNN A;  1ID3 C;  5CPJ B;  4Z66 D;  3REK B;  3MGQ D;  3REH D;  2RVQ D;  4X23 B;  4Z5T B;  3LZ1 D;  4Z66 C;  3WKJ B;  2CWE A;  5JRG A;  2ZY2 A;  2F2A C;  3LZ0 A;  4J8W D;  4LD9 A;  4WU9 D; 
#chains in the Genus database with same CATH homology
 5AVC C;  2UWX A;  3B0C W;  3UTB D;  5B32 A;  3KSY A;  4WJ3 C;  3C1B C;  1M18 C;  3AV2 C;  1KX4 D;  3UTB A;  5CPK D;  3LJA A;  2NZD C;  3AZF D;  5B1L B;  2YFV B;  4J8V D;  3X1S D;  1P34 C;  1N1J A;  5B31 A;  5AY8 D;  3X1U A;  3AZL C;  3AZF A;  1AOI C;  3W96 C;  1B67 A;  3H0R C;  3LEL A;  3MGP A;  3KUY C;  4R8P D;  2F8N A;  2HIO C;  1P3L C;  2JCH A;  3UT9 D;  1M19 C;  1WWS A;  4CAY A;  4XUJ A;  3AZH D;  1KX5 D;  3B6G C;  3X1T B;  5B1L D;  1P3I B;  3EPH A;  4H9S C;  5F99 D;  5B31 D;  3W97 B;  3MGQ B;  2DQN C;  4ZBJ B;  5B32 C;  2PYO D;  5DNM B;  3AZI C;  3A6N C;  3NQJ A;  3C1C B;  3WAA A;  3UT9 C;  3KXB D;  2G5H C;  5B0Z A;  3AZM D;  5AV8 C;  1P3G A;  4KGC C;  3EPL A;  2HIO D;  3B0B A;  1M19 A;  4J8W B;  4QLC B;  1W2E A;  5G49 A;  3WA9 D;  4LD9 C;  3REK C;  2ZM5 A;  3VH5 W;  4ZUX B;  2Y2Q A;  4XUJ D;  5F99 C;  1AOI D;  4Z5T A;  3AZJ B;  3TU4 C;  2J8P A;  3LZ0 B;  1BH8 A;  4Z5T C;  1Z2C B;  5GSU B;  2NZD D;  4R8P A;  3REI A;  3UTA B;  4CAY B;  4YM6 B;  3C1B D;  3P5J B;  2PYO A;  2DF4 C;  3REI B;  3UTA A;  3UTB C;  5FUG A;  5B0Z C;  4CSR A;  3C1B A;  1TZY A;  2F8N G;  4KUD B;  5GT0 C;  3REK A;  5B0Y D;  4YM6 D;  3C1B B;  4JJN C;  1M18 B;  3AZL D;  3MGR C;  2NZD B;  4UPK A;  3X1S C;  1M18 A;  3UT9 A;  1WWI A;  5B32 G;  1P3I D;  3MVD B;  3AV1 C;  1P3G B;  3X1T D;  3MGR A;  5B1M A;  3REH C;  3AZH B;  2F8N B;  1HQ3 D;  4WV4 B;  3MVD A;  3X1V D;  4WU9 A;  1S32 B;  4XZQ C;  3AZM A;  1P3M B;  5B1M D;  5AVC D;  2ARO B;  3AZM B;  5E5A A;  1M1A D;  3C1C D;  3W98 A;  5DNM D;  2ZY3 A;  3W99 B;  4J8V A;  3X1T C;  2RVQ C;  1N1J B;  5B31 B;  5B2J C;  4J8V B;  1A7W A;  3AZF B;  3MGQ C;  4YS3 C;  3AV2 A;  5CPK B;  1KX4 B;  2NQB A;  1ID3 D;  4Z2M G;  3FDD A;  5CHL B;  3AZN D;  4AWL B;  2Y2H A;  5B40 D;  2NZD A;  4KHA A;  5C3I C;  5AV8 B;  1B6W A;  5AVC A;  3X1V C;  1HQ3 C;  5B40 A;  2BYK A;  2IO5 B;  3MGS B;  1P3K C;  3B0D C;  4ZUX C;  4J8X C;  2ZY5 A;  1BH8 B;  4Z5T D;  3TU4 B;  1BH9 B;  5BNV A;  3LZ0 C;  2ARO A;  1ULY A;  3AN2 B;  2CV5 C;  1EQZ C;  4WNN A;  5B0Y C;  4H9N B;  4WZS B;  5GT0 D;  3WAA D;  2JE5 A;  1TZY B;  5B0Z D;  4KUD A;  3UTB B;  1TAF B;  2HUE C;  4JJN B;  1P3P D;  3REL D;  4H9P B;  3TU4 D;  1U35 C;  3AYW D;  3AZG A;  1P3B A;  3LEL B;  3MGP B;  3EPJ A;  3AZH A;  2Y2O A;  3IP4 C;  4H9R A;  3AYW C;  5B33 B;  3EPK A;  3AZH C;  1P3M A;  4EO5 B;  3AZG C;  1P3B C;  4H9Q B;  3A1I A;  1P3M C;  5KDM A;  5B24 C;  3X1U D;  1P3L D;  3NQU B;  1ID3 B;  4HGA B;  4R8P C;  3KWQ B;  5E5A D;  1M1A A;  4WNN B;  3MGQ A;  3EG5 B;  5AY8 C;  1P34 D;  5CPJ A;  5F99 A;  1KX4 A;  4J8V C;  2VQR A;  1KX5 C;  2NQB B;  4J8X D;  4YS3 B;  3WKJ C;  2Y2P A;  1KX4 C;  1KX5 A;  4G91 C;  4DRB A;  4J8W A;  5AV8 A;  1ZLA B;  5AVC B;  1EQZ A;  3WTP B;  3O62 B;  1P3P A;  1S32 D;  1HQ3 B;  2IO5 C;  3MGS C;  3X1V B;  4WU9 C;  3MNN B;  4NE3 A;  1P3K B;  2F8N D;  5AV5 C;  3AZE B;  1BH9 A;  5BNV B;  4J8X B;  3W97 A;  1P34 B;  5GT3 B;  3AV2 D;  1M18 D;  3H0M C;  1M1A B;  3NQJ B;  3AZE D;  5GT0 A;  1Q9C A;  2L5A A;  1TZY C;  5AV6 D;  3WTP D;  2Y2N A;  5BS7 C;  3WKJ A;  1P3G D;  3REL A;  3TU4 A;  1P3I C;  3AFA A;  5B2I A;  3MGR D;  1F1E A;  4WU8 A;  5B32 B;  3X1S A;  2RIQ A;  5E5A B;  3LJA B;  4J8X A;  5B24 B;  2BG1 A;  4NFT A;  5GXQ D;  3AV1 A;  4KGC B;  3AZI A;  4QLC C;  3V9R B;  1P3O A;  3KWQ C;  3UTA D;  5AVB A;  3AZK A;  3W98 D;  2Y2J A;  2F8N H;  5F99 B;  3W97 D;  3LZ0 D;  5AVB B;  3AZK B;  1KX5 B;  2NQB C;  5CP6 D;  2G5I C;  4KHA B;  5GSU C;  4XUJ C;  4UUZ B;  3KFU G;  3UTA C;  4H9Q A;  1P3A D;  2FJ7 A;  1ZLA C;  3O62 A;  3REI C;  3X1T A;  1P3F D;  3KXB B;  5AV8 D;  4E45 A;  3WTP C;  3AZE A;  4JJN D;  3AZN C;  4KUD C;  2JSS A;  1P3O D;  2PYO B;  2Y2I A;  1H3O A;  3AZI D;  3MNN C;  5BT1 D;  3REJ C;  3W99 A;  4NE6 A;  4WU8 B;  3AZL A;  3F6T A;  2CV5 A;  1P34 A;  3X1S B;  4DQY B;  3MVD C;  4WU8 D;  3AV1 B;  1P3G C;  4KGC A;  5AV5 D;  4XZQ B;  3B6F A;  5AV6 C;  2ARO D;  5B1M C;  3REH A;  3B6F B;  2BYK B;  5B40 B;  5JRG C;  3W96 D;  5B2I C;  5GXQ A;  3W99 C;  5B33 A;  4X23 D;  3REJ A;  1PZR A;  3R45 B;  3LZ1 A;  3AV1 D;  5BO0 B;  5AV9 C;  5CP6 A;  1P3P B;  5GT3 A;  4J8U C;  3AZF C;  4CSR B;  5CPK C;  3WTP E;  5B2I D;  1ID3 A;  4Z2M H;  2LY8 A;  3KUY A;  5E5A C;  5B1L A;  3LJA C;  5CPI C;  1F66 A;  5C3I B;  3LJA D;  4H9O B;  3X1U C;  1F66 B;  1P3M D;  3VH5 A;  1P3F A;  3LZ1 C;  5AV6 A;  5AVB C;  1HQ3 A;  3AZK C;  4H9R B;  3AZJ D;  1EQZ B;  4XUJ B;  2XD5 A;  4Z66 B;  3REK D;  1P3P C;  3A6N A;  1P3K A;  1F66 D;  4Z66 A;  4KUD D;  3NQU A;  1JFI A;  3REI D;  1P3F C;  5DNN C;  5B32 D;  2PYO C;  2HUE B;  4E44 A;  3AV2 B;  5CPK A;  3H0L C;  1P3L A;  5GT3 D;  1KX3 C;  1EQZ D;  5B1L C;  3LEL C;  3MGP C;  1U35 D;  3W96 A;  5B2J A;  3B6G D;  4H9P A;  3REL C;  5B33 C;  3MNN D;  4ZUX D;  1AOI B;  2FJ7 D;  2HIO A;  3AFA D;  3AZG B;  1P3B B;  1M19 D;  1ZLA A;  3W96 B;  3W98 C;  4QLC D;  5AV6 B;  3WA9 B;  2HIO B;  3B6F D;  5GXQ C;  1ZLA D;  4HGA C;  3WAA C;  4R8P B;  5BO0 A;  2CV5 D;  5KDM B;  5B2I B;  4H9N A;  4DRA A;  2NQB D;  5AY8 B;  5BNX A;  5AV9 B;  3KWQ A;  1P3K D;  2XD1 A;  5DNM C;  4G91 B;  3AZI B;  4JJN A;  4H9O A;  1P3O B;  3UT9 B;  5CPI B;  2YFW B;  1P3A A;  3O62 C;  3AFA C;  5CPI A;  4J8W C;  5B31 G;  1F66 C;  3A1K A;  5BS7 A;  4WU9 B;  2FJ7 C;  1P3A B;  4LD9 B;  4XZQ D;  5B33 D;  5AV5 B;  3AZE C;  3AZN A;  3AL0 C;  1AOI A;  3R45 A;  3WTP A;  3LZ1 B;  5GSU A;  3VH6 W;  2ZY4 A;  5CP6 B;  3AZJ C;  5JA4 A;  4G92 B;  5GT3 C;  4J8U A;  1KX3 D;  3B0C T;  5AVB D;  3AZK D;  5JA4 B;  1T3U A;  3KXB A;  4M6B A;  5DNN D;  1M1A C;  3VH5 T;  4YM6 C;  5CPJ D;  3X1V A;  2Y2L A;  1TZY D;  5B0Z B;  2Y2K A;  5GT0 B;  1P3F B;  2BYM A;  5DNN B;  4QLC A;  4YS3 A;  3WKJ D;  1KX3 B;  3MGR B;  1KU5 A;  1S32 A;  3AZJ A;  2W8S A;  4J8U D;  1R4V A;  1KX3 A;  3REL B;  1HTA A;  3REH B;  3WA9 A;  3MGS D;  1S32 C;  5JRG D;  3W98 B;  3WA9 C;  1JFI B;  5CPI D;  2Y2M A;  5GXQ B;  2ARO C;  4KGC D;  3AZM C;  5FUG B;  5B24 D;  2F8N K;  3C1C A;  5CPJ C;  3WAA B;  3A6N D;  5AY8 A;  3AN2 D;  5B24 A;  5AV9 D;  5G49 B;  5B31 C;  5B2J B;  2YFV A;  3W99 D;  4X23 C;  4ZUX A;  4X23 A;  3REJ D;  4LD9 D;  3MGS A;  1U35 A;  1P3O C;  4AWL C;  3O62 D;  3KXB C;  5AV5 A;  3AZN B;  3AFA B;  3AZG D;  1P3B D;  2FJ7 B;  1P3A C;  3B0D B;  3KUY D;  3REJ B;  4WU8 C;  3MVD D;  3AN2 A;  5BNX B;  5CP6 C;  5AV9 A;  4G92 C;  1P3I A;  5BT1 C;  3AZL B;  3AN2 C;  2CV5 B;  3V9R A;  5B0Y B;  3KUY B;  3KWQ D;  5DNM A;  1TAF A;  2YFW A;  5B0Y A;  1P3L B;  2FFF B;  5B1M B;  3B6F C;  5B40 C;  4XZQ A;  2Y2G A;  1M19 B;  5JRG B;  4UUZ A;  5GSU D;  1BFM A;  4H9S A;  3B6G B;  4YS3 D;  3AYW A;  1U35 B;  4NE5 A;  4J8U B;  3VH6 T;  3LEL D;  3MGP D;  5B2J D;  3B6G A;  3W97 C;  3AYW B;  3MNN A;  4ZBJ C;  3VH6 A;  4EO5 C;  1H3O B;  3A6N B;  3C1C C;  4YM6 A;  3X1U B;  2BYM B;  5DNN A;  1ID3 C;  5CPJ B;  4Z66 D;  3REK B;  3MGQ D;  3REH D;  2RVQ D;  4X23 B;  4Z5T B;  3LZ1 D;  4Z66 C;  3WKJ B;  2CWE A;  5JRG A;  2ZY2 A;  2F2A C;  3LZ0 A;  4J8W D;  4LD9 A;  4WU9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...