4QLCA

Crystal structure of chromatosome at 3.5 angstrom resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (167-mer)
publication title Structural Mechanisms of Nucleosome Recognition by Linker Histones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chromatin binding protein/dna
total genus 30
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4qlcA00
5JA4B 5B2ID 1P3OD 3C1BB 3LZ0C 3REHA 2FJ7C 1AOID 3LZ0B 2FJ7B 4HGAC 4ZUXC 3W98D 4ZUXB 3TU4B 1WWIA 5BO0B 4R8PD 5AV5A 1P3KD 3LZ1C 1ULYA 3LZ1B 1B67A 1ZLAA 2F8NB 3WTPE 4H9OA 5AV6D 3REJD 4YS3C 3B6GD 3AYWC 4YS3B 1P3IC 1HQ3D 3AYWB 1P3IB 5AVBC 5DNND 3LJAC 3WA9C 3LJAB 1EQZD 4J8UA 5B0YC 5B0YB 3MGRD 1P3LB 5B24D 3W99C 3W96D 5B31A 3W99B 2YFVB 5CPJA 3X1TA 3KUYC 5CP6A 4G92C 4G91C 4G92B 3AZND 4H9RA 4G91B 3MGSD 2CV5D 4QLCD 4WZSB 4KGCC 3REKA 3AZGC 4JJNB 3AZGB 5JRGD 4Z2MG 5G49B 3C1CC 3C1CB 1KX4A 1BH8A 2YFWA 5B33D 3NQUA 3RELA 5BS7A 4J8XD 5GXQD 5AV8D 5B0ZD 2LY8A 4WU9A 5AVCA 1TAFB 5B40A 1KX3B 2L5AA 1P3GD 1P3FB 3AFAC 5FUGA 4WNNB 1U35A 4KUDD 3AFAB 5CPIB 1KU5A 1H3OB 3MNNA 2HUEC 3REHD 2HUEB 5B1LC 1F66A 5B1LB 3AZIC 5BNXA 3A6NA 2BYKA 3AZIB 5AV5D 3AV2C 4CAYA 1ZLAD 5AY8A 1P34C 2CWEA 1P34B 3MGPB 3KWQD 3O62C 2IO5B 5BNVA 5B2IA 3O62B 1S32A 1M18C 1B6WA 3W98A 4KHAB 3VH6T 4J8UD 1P3KA 5B31D 4DRBA 4H9NB 5CPJD 1M19C 3X1TD 5DNMC 3AN2C 1M19B 4Z5TA 5CP6D 3AN2B 4ZBJB 4NFTA 3KXBC 4LD9C 3AZLC 3KXBB 3AZLB 5GT0D 3B0CW 3REKD 1ID3C 5CHLB 1P3PA 1ID3B 1JFIB 5DNNA 1N1JA 3UTAC 4UUZB 5E5AA 3AV1C 1TZYA 3WAAA 2NZDA 5GSUB 5B32C 3RELD 3WKJC 5CPKC 3AZNA 5GT3A 3REIA 5CPKB 4WU9D 2RVQC 3B6FB 4XZQA 4QLCA 3X1UA 4KGCA 5AVCD 3AZKA 5B40D 5AV9C 2FJ7A 5AV9B 5KDMA 3W97B 3WTPC 5BO0A 3WTPB 4J8VA 3UT9B 1U35D 1BH9B 4Z66C 1P3AC 3MNND 1P3AB 5B2JC 1KX5D 5B2JB 1F66D 5B1MB 5B0ZA 4X23A 3KSYA 1Q9CA 4E45A 4YM6A 1P3OB 2HIOC 4J8WC 1AOIC 2HIOB 4J8WB 1AOIB 5AVBA 3UTBA 3WA9A 1P3GA 5AY8D 5BT1D 4AWLB 3C1BC 1S32D 3KUYA 3TU4C 4CSRA 3R45A 4NE3A 1HQ3B 1P3MC 1F1EA 1P3MB 4E44A 1EQZB 3V9RA 3AZEA 3W96C 4XUJA 5B24C 4Z5TD 3MGRB 3W96B 5B24B 3KWQA 5F99A 1P3PD 4WU8D 2CV5C 3MVDA 2CV5B 1P3LC 5E5AD 5JRGC 1TZYD 3WAAD 5JRGB 2NZDD 2PYOD 3AFAA 5GT3D 4H9PB 3REID 4KGCD 5GT0A 5B33B 3X1UD 4XZQD 4JJNC 3AZFC 4J8XC 3X1VC 5AV8C 3AZKD 4J8XB 3AZFB 3X1VB 5AV8B 2FJ7D 5B1LA 4DRAA 4ZUXD 4J8VD 3AV2A 3LZ1D 3AZMC 3MGQA 3AZMB 4KUDB 3AZHA 3NQJA 4X23D 1M1AC 4YM6D 1M1AB 5B31G 3REHB 1KX3C 1M18A 5AVBD 3LJAD 3UTBD 1P3FC 3WA9D 5B0YD 5AV5B 5CPIC 1ZLAB 5DNMA 4H9OB 3KUYD 1KX5A 2NQBA 3KXBA 4LD9A 3VH5A 3AZGD 1ID3A 4J8UC 4J8UB 3AZED 4XUJD 3MGPC 3UTAA 3AZJA 3AV1A 5B31B 3VH5W 5F99D 2IO5C 3X1TB 4EO5C 5CP6B 4EO5B 5B32A 4H9RB 1WWSA 4WV4B 3MVDD 3WKJA 3REKC 3REKB 4ZBJC 1KX4C 3AFAD 1KX4B 1BH8B 2YFWB 3RELC 3NQUB 5BS7C 3RELB 4Z66A 4H9SC 4WU8A 2AROA 4WU9C 4WU9B 3X1SA 5B1LD 5AVCC 5AVCB 4H9QA 3LELA 3B0CT 3AV2D 5B40B 5GSUC 4J8WA 3MGQD 2BYMA 2PYOA 3AZHD 5FUGB 1U35B 1P3BC 1P34D 3B6FC 1P3BB 5JA4A 1R4VA 2F8NK 3C1BA 3MNNB 1F66B 3LZ0A 1M18D 3W97C 3A6NC 5BNXB 4ZUXA 3A6NB 3UT9C 3TU4A 2BYKB 3LZ1A 4CAYB 2F8NA 5AY8B 5DNMD 5B1MC 1HTAA 2NQBD 5B2IC 3KXBD 1P3OC 4LD9D 5BNVB 5B2IB 4YS3A 1S32B 3AYWA 1P3IA 1ID3D 3W98C 3W98B 3B0BA 4R8PC 3LJAA 1P3KC 4R8PB 5B0YA 1P3LA 4AWLC 3UTAD 3AZJD 3AV1D 1P3KB 3W99A 2YFVA 5B32D 5AV6C 3REJC 5AV6B 3B6GC 3WKJD 3REJB 3B6GB 1HQ3C 2RVQD 1P3PC 4JJNA 5DNNC 5C3IC 3AZGA 1P3PB 5DNNB 5C3IB 2JSSA 1EQZC 1N1JB 5G49A 5E5AC 5AV9D 3MGRC 5E5AB 1TZYB 3WTPD 3C1CA 2NZDB 3AZMA 3AZNC 4Z66D 1P3AD 3AZNB 3MGSC 2AROD 5GT3B 4XZQC 4QLCC 5B2JD 3X1UC 3X1SD 3MGSB 4XZQB 3X1UB 4QLCB 3REIB 3AZKC 4KGCB 1M1AA 3LELD 3AZKB 1TAFA 2HIOD 4J8WD 1KX3A 5KDMB 4HGAB 4J8VC 4NE5A 1A7WA 1P3FA 4WNNA 4J8VB 5B33C 5CPIA 1H3OA 3C1BD 5GXQC 4X23C 5GXQB 5B0ZC 3LZ0D 4X23B 5B0ZB 4YM6C 4YM6B 3TU4D 3AZIA 3UTBC 1P3MD 5AVBB 3UTBB 1P3GC 3WA9B 4KUDC 2F8ND 1P3GB 1P34A 3MGPA 3REHC 3O62A 4YS3D 3KUYB 3AYWD 1P3ID 2F8NH 4KHAA 4CSRB 5AV5C 3R45B 1P3LD 3W99D 1ZLAC 3AZEC 4H9NA 4XUJC 3V9RB 3AZEB 4XUJB 1M19A 3AN2A 3KWQC 3B0DC 5F99C 3KWQB 3B0DB 5F99B 3AZLA 4JJND 3AZFD 1JFIA 3MVDC 3X1VD 3MVDB 4H9SA 4UUZA 5B31C 3C1CD 5CPJC 3X1TC 5CPJB 5CP6C 5GSUA 3AZMD 5GT0C 5CPKA 1P3BA 3B6FA 5GT0B 3VH5T 1M1AD 1KX3D 3VH6A 5AV9A 3W97A 1P3FD 3WTPA 3UT9A 3AV2B 3MGQC 5CPID 3MGQB 1BH9A 3AZHC 3AZHB 1P3AA 3VH6W 3NQJB 5B2JA 5B1MA 1P3OA 3AZID 5B40C 2HIOA 1AOIA 4Z2MH 1M18B 1U35C 5B32G 4R8PA 3MGPD 3MNNC 3O62D 4NE6A 5DNMB 1KX5C 1F66C 2NQBC 1KX5B 2NQBB 5AV6A 4LD9B 3REJA 3B6GA 1HQ3A 1P3MA 5AY8C 5BT1C 1EQZA 1BFMA 3AZJC 1M19D 3MGRA 3W96A 5B24A 3UTAB 3AZJB 3AN2D 3AV1B 1KX4D 3AZLD 1S32C 5B32B 3WKJB 3MGSA 2CV5A 5JRGA 4Z5TC 5GSUD 4Z5TB 4H9PA 5CPKD 1P3BD 3B6FD 5B33A 3AZFA 4Z66B 2AROC 4J8XA 4WU8C 3X1VA 5AV8A 2AROB 4WU8B 5GXQA 3X1SC 2F8NG 3X1SB 1TZYC 3LELC 3A6ND 3WAAC 4H9QB 3W97D 4M6BA 3LELB 3UT9D 3WAAB 2NZDC 2PYOC 2BYMB 2PYOB 4KUDA 5GT3C 3REIC 5B1MD
chains in the Genus database with same CATH superfamily
5JA4B 5B2ID 1P3OD 3C1BB 3LZ0C 3REHA 2FJ7C 1AOID 3LZ0B 1PZRA 2FJ7B 4HGAC 4ZUXC 3W98D 4ZUXB 3TU4B 1WWIA 5BO0B 4R8PD 5AV5A 1P3KD 3LZ1C 2Y2IA 1ULYA 3LZ1B 1B67A 1W2EA 1ZLAA 3WTPE 2F8NB 4H9OA 5AV6D 3REJD 4YS3C 3B6GD 3AYWC 4YS3B 1P3IC 1HQ3D 3AYWB 1P3IB 5AVBC 5DNND 3LJAC 3WA9C 3LJAB 1EQZD 4J8UA 5B0YC 5B0YB 3MGRD 1P3LB 5B24D 3W99C 3W96D 5B31A 3W99B 2YFVB 5CPJA 3X1TA 3KUYC 5CP6A 4G92C 2G5IC 4G91C 4G92B 3AZND 4H9RA 4G91B 3EPHA 3MGSD 2CV5D 4QLCD 4WZSB 4KGCC 3REKA 3AZGC 4JJNB 3AZGB 5JRGD 4Z2MG 5G49B 3C1CC 3C1CB 1KX4A 1BH8A 2Y2OA 2YFWA 5B33D 3NQUA 3EPKA 3RELA 5BS7A 4J8XD 5GXQD 5AV8D 5B0ZD 2LY8A 4WU9A 5AVCA 1TAFB 2RIQA 5B40A 1KX3B 2L5AA 1P3GD 1P3FB 3AFAC 5FUGA 4WNNB 1U35A 4KUDD 3AFAB 5CPIB 1KU5A 1H3OB 3MNNA 2HUEC 3REHD 2FFFB 2HUEB 5B1LC 1F66A 2ZY4A 5B1LB 2XD5A 5BNXA 3A6NA 3AZIC 2BYKA 3AZIB 5AV5D 3AV2C 4CAYA 1ZLAD 5AY8A 1P34C 2CWEA 1P34B 3A1KA 3MGPB 3KWQD 3O62C 2IO5B 5BNVA 5B2IA 3O62B 1S32A 1M18C 1B6WA 3W98A 4KHAB 3VH6T 4J8UD 2XD1A 2VQRA 1P3KA 5B31D 4DRBA 4H9NB 5CPJD 1M19C 3X1TD 5DNMC 3AN2C 1M19B 4Z5TA 5CP6D 3AN2B 4ZBJB 4NFTA 3KXBC 4LD9C 3AZLC 3KXBB 3AZLB 3EPLA 5GT0D 3B0CW 3REKD 2JCHA 1ID3C 5CHLB 1P3PA 1ID3B 1JFIB 5DNNA 1N1JA 3UTAC 4UUZB 5E5AA 3AV1C 1TZYA 3WAAA 2NZDA 5GSUB 3P5JB 5B32C 3RELD 3WKJC 5CPKC 3AZNA 5GT3A 3REIA 5CPKB 4WU9D 2RVQC 3B6FB 4XZQA 4QLCA 3X1UA 4KGCA 5AVCD 2W8SA 3AZKA 5B40D 4WJ3C 5AV9C 4DQYB 2FJ7A 5AV9B 5KDMA 3W97B 3WTPC 2Y2KA 5BO0A 3WTPB 4J8VA 3UT9B 2ZY2A 1U35D 1BH9B 4Z66C 1P3AC 3MNND 1P3AB 5B2JC 1KX5D 5B2JB 1F66D 5B1MB 5B0ZA 4X23A 3KSYA 1Q9CA 4E45A 4YM6A 1P3OB 2HIOC 4J8WC 1AOIC 2HIOB 4J8WB 1AOIB 5AVBA 3UTBA 3WA9A 1P3GA 5AY8D 5BT1D 3H0MC 4AWLB 3C1BC 1S32D 3KUYA 3TU4C 4CSRA 3R45A 4NE3A 1HQ3B 1P3MC 1F1EA 1P3MB 4E44A 1EQZB 3V9RA 3AZEA 3W96C 4XUJA 5B24C 4Z5TD 3MGRB 3W96B 5B24B 2Y2JA 3KWQA 5F99A 1P3PD 3IP4C 4WU8D 2CV5C 3MVDA 2CV5B 1P3LC 5E5AD 5JRGC 1TZYD 3WAAD 5JRGB 2NZDD 2DQNC 2PYOD 3AFAA 5GT3D 4H9PB 3REID 4KGCD 5GT0A 5B33B 3X1UD 4XZQD 4JJNC 3AZFC 4J8XC 3X1VC 5AV8C 3AZKD 4J8XB 3AZFB 3X1VB 5AV8B 2FJ7D 5B1LA 4DRAA 4ZUXD 4J8VD 3AV2A 1T3UA 3LZ1D 3AZMC 3MGQA 3AZMB 4KUDB 3AZHA 3H0RC 3NQJA 4X23D 1M1AC 4YM6D 1M1AB 5B31G 3REHB 1KX3C 1M18A 5AVBD 3LJAD 3UTBD 1P3FC 3WA9D 5B0YD 5AV5B 5CPIC 1ZLAB 5DNMA 4H9OB 3KUYD 1KX5A 2NQBA 3KXBA 4LD9A 3VH5A 3AZGD 2UWXA 1ID3A 4J8UC 4J8UB 3AZED 4XUJD 3MGPC 3UTAA 3AZJA 3AV1A 5B31B 3VH5W 5F99D 2IO5C 3X1TB 4EO5C 2Y2NA 5CP6B 4EO5B 2Y2MA 5B32A 4H9RB 1WWSA 4WV4B 3MVDD 3WKJA 3REKC 3REKB 3KFUG 4ZBJC 1KX4C 3AFAD 1KX4B 1BH8B 2YFWB 3RELC 3NQUB 5BS7C 3RELB 4Z66A 4H9SC 4WU8A 2AROA 4WU9C 4WU9B 3X1SA 5B1LD 5AVCC 5AVCB 4H9QA 3LELA 3B0CT 3AV2D 5B40B 5GSUC 4J8WA 3MGQD 2BYMA 2PYOA 3AZHD 5FUGB 1U35B 1P3BC 1P34D 3B6FC 1P3BB 2Y2PA 5JA4A 1R4VA 2F8NK 3C1BA 3MNNB 2Y2QA 1F66B 3LZ0A 1M18D 3W97C 3A6NC 2JE5A 4ZUXA 5BNXB 3A6NB 3UT9C 2BYKB 3TU4A 3LZ1A 4CAYB 2F8NA 5AY8B 5DNMD 5B1MC 1HTAA 2NQBD 5B2IC 3KXBD 1P3OC 4LD9D 5BNVB 5B2IB 4YS3A 1S32B 3AYWA 1P3IA 1ID3D 3W98C 3W98B 3B0BA 4R8PC 3LJAA 1P3KC 4R8PB 5B0YA 1P3LA 4AWLC 3UTAD 3AZJD 3AV1D 1P3KB 2ZM5A 3W99A 2YFVA 5B32D 5AV6C 3REJC 5AV6B 3B6GC 3WKJD 3REJB 3B6GB 1HQ3C 2RVQD 1P3PC 4JJNA 5DNNC 5C3IC 3AZGA 1P3PB 5DNNB 5C3IB 2JSSA 1EQZC 1N1JB 5G49A 5E5AC 5AV9D 3MGRC 5E5AB 1TZYB 3WTPD 1Z2CB 3C1CA 2NZDB 3AZMA 3AZNC 4Z66D 1P3AD 3AZNB 3MGSC 2AROD 5GT3B 4XZQC 4QLCC 5B2JD 3X1UC 3X1SD 3MGSB 4XZQB 3X1UB 4QLCB 3REIB 3AZKC 4KGCB 2Y2HA 1M1AA 3LELD 3AZKB 1TAFA 2HIOD 4J8WD 1KX3A 5KDMB 4HGAB 4J8VC 4NE5A 1A7WA 1P3FA 4WNNA 4J8VB 5B33C 2G5HC 5CPIA 2DF4C 1H3OA 3C1BD 5GXQC 4X23C 5GXQB 5B0ZC 3LZ0D 4X23B 5B0ZB 4YM6C 3EPJA 4YM6B 3TU4D 3AZIA 3UTBC 1P3MD 5AVBB 3UTBB 1P3GC 3WA9B 4KUDC 2F8ND 1P3GB 2J8PA 1P34A 3MGPA 3FDDA 3REHC 3O62A 4YS3D 3KUYB 3AYWD 1P3ID 2F8NH 4KHAA 4CSRB 5AV5C 3R45B 1P3LD 2Y2LA 3W99D 1ZLAC 3AZEC 4H9NA 4XUJC 3V9RB 3AZEB 4XUJB 1M19A 3AN2A 3KWQC 3B0DC 5F99C 3KWQB 3B0DB 5F99B 3AZLA 4JJND 3AZFD 1JFIA 3MVDC 3X1VD 3MVDB 4H9SA 4UUZA 5B31C 3C1CD 5CPJC 3X1TC 5CPJB 5CP6C 5GSUA 3AZMD 5GT0C 5CPKA 1P3BA 3B6FA 5GT0B 4UPKA 3VH5T 1M1AD 1KX3D 3VH6A 5AV9A 3W97A 1P3FD 3WTPA 3UT9A 2Y2GA 3AV2B 3MGQC 5CPID 3MGQB 1BH9A 3AZHC 3AZHB 1P3AA 3F6TA 3VH6W 3NQJB 5B2JA 5B1MA 1P3OA 3AZID 5B40C 2HIOA 3A1IA 1AOIA 4Z2MH 1M18B 1U35C 5B32G 4R8PA 3MGPD 2BG1A 3MNNC 3O62D 4NE6A 5DNMB 1KX5C 1F66C 2NQBC 1KX5B 2NQBB 5AV6A 4LD9B 3REJA 3B6GA 2F2AC 1HQ3A 1P3MA 2ZY3A 5AY8C 5BT1C 1EQZA 1BFMA 3AZJC 1M19D 3MGRA 3W96A 5B24A 3UTAB 3AZJB 3AN2D 3AV1B 1KX4D 3AZLD 1S32C 5B32B 3WKJB 3MGSA 2CV5A 5JRGA 4Z5TC 5GSUD 4Z5TB 2ZY5A 4H9PA 5CPKD 1P3BD 3B6FD 5B33A 3AL0C 3AZFA 4Z66B 2AROC 4J8XA 4WU8C 3X1VA 5AV8A 2AROB 4WU8B 5GXQA 3X1SC 2F8NG 3EG5B 3X1SB 3H0LC 1TZYC 3LELC 3A6ND 3WAAC 4H9QB 3W97D 4M6BA 3LELB 3UT9D 3WAAB 2NZDC 2PYOC 2BYMB 2PYOB 4KUDA 5GT3C 3REIC 5B1MD
chains in the Genus database with same CATH topology
5JA4B 5B2ID 1P3OD 3C1BB 3LZ0C 3REHA 2FJ7C 1AOID 3LZ0B 1PZRA 2FJ7B 4HGAC 4ZUXC 3W98D 4ZUXB 3TU4B 1WWIA 5BO0B 4R8PD 5AV5A 1P3KD 3LZ1C 2Y2IA 1ULYA 3LZ1B 1B67A 1W2EA 1ZLAA 3WTPE 2F8NB 4H9OA 5AV6D 3REJD 4YS3C 3B6GD 3AYWC 4YS3B 1P3IC 1HQ3D 3AYWB 1P3IB 5AVBC 5DNND 3LJAC 3WA9C 3LJAB 1EQZD 4J8UA 5B0YC 5B0YB 3MGRD 1P3LB 5B24D 3W99C 3W96D 5B31A 3W99B 2YFVB 5CPJA 3X1TA 3KUYC 5CP6A 4G92C 2G5IC 4G91C 4G92B 3AZND 4H9RA 4G91B 3EPHA 3MGSD 2CV5D 4QLCD 4WZSB 4KGCC 3REKA 3AZGC 4JJNB 3AZGB 5JRGD 4Z2MG 5G49B 3C1CC 3C1CB 1KX4A 1BH8A 2Y2OA 2YFWA 5B33D 3NQUA 3EPKA 3RELA 5BS7A 4J8XD 5GXQD 5AV8D 5B0ZD 2LY8A 4WU9A 5AVCA 1TAFB 2RIQA 5B40A 1KX3B 2L5AA 1P3GD 1P3FB 3AFAC 5FUGA 4WNNB 1U35A 4KUDD 3AFAB 5CPIB 1KU5A 1H3OB 3MNNA 2HUEC 3REHD 2FFFB 2HUEB 5B1LC 1F66A 2ZY4A 5B1LB 2XD5A 5BNXA 3A6NA 3AZIC 2BYKA 3AZIB 5AV5D 3AV2C 4CAYA 1ZLAD 5AY8A 1P34C 2CWEA 1P34B 3A1KA 3MGPB 3KWQD 3O62C 2IO5B 5BNVA 5B2IA 3O62B 1S32A 1M18C 1B6WA 3W98A 4KHAB 3VH6T 4J8UD 2XD1A 2VQRA 1P3KA 5B31D 4DRBA 4H9NB 5CPJD 1M19C 3X1TD 5DNMC 3AN2C 1M19B 4Z5TA 5CP6D 3AN2B 4ZBJB 4NFTA 3KXBC 4LD9C 3AZLC 3KXBB 3AZLB 3EPLA 5GT0D 3B0CW 3REKD 2JCHA 1ID3C 5CHLB 1P3PA 1ID3B 1JFIB 5DNNA 1N1JA 3UTAC 4UUZB 5E5AA 3AV1C 1TZYA 3WAAA 2NZDA 5GSUB 3P5JB 5B32C 3RELD 3WKJC 5CPKC 3AZNA 5GT3A 3REIA 5CPKB 4WU9D 2RVQC 3B6FB 4XZQA 4QLCA 3X1UA 4KGCA 5AVCD 2W8SA 3AZKA 5B40D 4WJ3C 5AV9C 4DQYB 2FJ7A 5AV9B 5KDMA 3W97B 3WTPC 2Y2KA 5BO0A 3WTPB 4J8VA 3UT9B 2ZY2A 1U35D 1BH9B 4Z66C 1P3AC 3MNND 1P3AB 5B2JC 1KX5D 5B2JB 1F66D 5B1MB 5B0ZA 4X23A 3KSYA 1Q9CA 4E45A 4YM6A 1P3OB 2HIOC 4J8WC 1AOIC 2HIOB 4J8WB 1AOIB 5AVBA 3UTBA 3WA9A 1P3GA 5AY8D 5BT1D 3H0MC 4AWLB 3C1BC 1S32D 3KUYA 3TU4C 4CSRA 3R45A 4NE3A 1HQ3B 1P3MC 1F1EA 1P3MB 4E44A 1EQZB 3V9RA 3AZEA 3W96C 4XUJA 5B24C 4Z5TD 3MGRB 3W96B 5B24B 2Y2JA 3KWQA 5F99A 1P3PD 3IP4C 4WU8D 2CV5C 3MVDA 2CV5B 1P3LC 5E5AD 5JRGC 1TZYD 3WAAD 5JRGB 2NZDD 2DQNC 2PYOD 3AFAA 5GT3D 4H9PB 3REID 4KGCD 5GT0A 5B33B 3X1UD 4XZQD 4JJNC 3AZFC 4J8XC 3X1VC 5AV8C 3AZKD 4J8XB 3AZFB 3X1VB 5AV8B 2FJ7D 5B1LA 4DRAA 4ZUXD 4J8VD 3AV2A 1T3UA 3LZ1D 3AZMC 3MGQA 3AZMB 4KUDB 3AZHA 3H0RC 3NQJA 4X23D 1M1AC 4YM6D 1M1AB 5B31G 3REHB 1KX3C 1M18A 5AVBD 3LJAD 3UTBD 1P3FC 3WA9D 5B0YD 5AV5B 5CPIC 1ZLAB 5DNMA 4H9OB 3KUYD 1KX5A 2NQBA 3KXBA 4LD9A 3VH5A 3AZGD 2UWXA 1ID3A 4J8UC 4J8UB 3AZED 4XUJD 3MGPC 3UTAA 3AZJA 3AV1A 5B31B 3VH5W 5F99D 2IO5C 3X1TB 4EO5C 2Y2NA 5CP6B 4EO5B 2Y2MA 5B32A 4H9RB 1WWSA 4WV4B 3MVDD 3WKJA 3REKC 3REKB 3KFUG 4ZBJC 1KX4C 3AFAD 1KX4B 1BH8B 2YFWB 3RELC 3NQUB 5BS7C 3RELB 4Z66A 4H9SC 4WU8A 2AROA 4WU9C 4WU9B 3X1SA 5B1LD 5AVCC 5AVCB 4H9QA 3LELA 3B0CT 3AV2D 5B40B 5GSUC 4J8WA 3MGQD 2BYMA 2PYOA 3AZHD 5FUGB 1U35B 1P3BC 1P34D 3B6FC 1P3BB 2Y2PA 5JA4A 1R4VA 2F8NK 3C1BA 3MNNB 2Y2QA 1F66B 3LZ0A 1M18D 3W97C 3A6NC 2JE5A 4ZUXA 5BNXB 3A6NB 3UT9C 2BYKB 3TU4A 3LZ1A 4CAYB 2F8NA 5AY8B 5DNMD 5B1MC 1HTAA 2NQBD 5B2IC 3KXBD 1P3OC 4LD9D 5BNVB 5B2IB 4YS3A 1S32B 3AYWA 1P3IA 1ID3D 3W98C 3W98B 3B0BA 4R8PC 3LJAA 1P3KC 4R8PB 5B0YA 1P3LA 4AWLC 3UTAD 3AZJD 3AV1D 1P3KB 2ZM5A 3W99A 2YFVA 5B32D 5AV6C 3REJC 5AV6B 3B6GC 3WKJD 3REJB 3B6GB 1HQ3C 2RVQD 1P3PC 4JJNA 5DNNC 5C3IC 3AZGA 1P3PB 5DNNB 5C3IB 2JSSA 1EQZC 1N1JB 5G49A 5E5AC 5AV9D 3MGRC 5E5AB 1TZYB 3WTPD 1Z2CB 3C1CA 2NZDB 3AZMA 3AZNC 4Z66D 1P3AD 3AZNB 3MGSC 2AROD 5GT3B 4XZQC 4QLCC 5B2JD 3X1UC 3X1SD 3MGSB 4XZQB 3X1UB 4QLCB 3REIB 3AZKC 4KGCB 2Y2HA 1M1AA 3LELD 3AZKB 1TAFA 2HIOD 4J8WD 1KX3A 5KDMB 4HGAB 4J8VC 4NE5A 1A7WA 1P3FA 4WNNA 4J8VB 5B33C 2G5HC 5CPIA 2DF4C 1H3OA 3C1BD 5GXQC 4X23C 5GXQB 5B0ZC 3LZ0D 4X23B 5B0ZB 4YM6C 3EPJA 4YM6B 3TU4D 3AZIA 3UTBC 1P3MD 5AVBB 3UTBB 1P3GC 3WA9B 4KUDC 2F8ND 1P3GB 2J8PA 1P34A 3MGPA 3FDDA 3REHC 3O62A 4YS3D 3KUYB 3AYWD 1P3ID 2F8NH 4KHAA 4CSRB 5AV5C 3R45B 1P3LD 2Y2LA 3W99D 1ZLAC 3AZEC 4H9NA 4XUJC 3V9RB 3AZEB 4XUJB 1M19A 3AN2A 3KWQC 3B0DC 5F99C 3KWQB 3B0DB 5F99B 3AZLA 4JJND 3AZFD 1JFIA 3MVDC 3X1VD 3MVDB 4H9SA 4UUZA 5B31C 3C1CD 5CPJC 3X1TC 5CPJB 5CP6C 5GSUA 3AZMD 5GT0C 5CPKA 1P3BA 3B6FA 5GT0B 4UPKA 3VH5T 1M1AD 1KX3D 3VH6A 5AV9A 3W97A 1P3FD 3WTPA 3UT9A 2Y2GA 3AV2B 3MGQC 5CPID 3MGQB 1BH9A 3AZHC 3AZHB 1P3AA 3F6TA 3VH6W 3NQJB 5B2JA 5B1MA 1P3OA 3AZID 5B40C 2HIOA 3A1IA 1AOIA 4Z2MH 1M18B 1U35C 5B32G 4R8PA 3MGPD 2BG1A 3MNNC 3O62D 4NE6A 5DNMB 1KX5C 1F66C 2NQBC 1KX5B 2NQBB 5AV6A 4LD9B 3REJA 3B6GA 2F2AC 1HQ3A 1P3MA 2ZY3A 5AY8C 5BT1C 1EQZA 1BFMA 3AZJC 1M19D 3MGRA 3W96A 5B24A 3UTAB 3AZJB 3AN2D 3AV1B 1KX4D 3AZLD 1S32C 5B32B 3WKJB 3MGSA 2CV5A 5JRGA 4Z5TC 5GSUD 4Z5TB 2ZY5A 4H9PA 5CPKD 1P3BD 3B6FD 5B33A 3AL0C 3AZFA 4Z66B 2AROC 4J8XA 4WU8C 3X1VA 5AV8A 2AROB 4WU8B 5GXQA 3X1SC 2F8NG 3EG5B 3X1SB 3H0LC 1TZYC 3LELC 3A6ND 3WAAC 4H9QB 3W97D 4M6BA 3LELB 3UT9D 3WAAB 2NZDC 2PYOC 2BYMB 2PYOB 4KUDA 5GT3C 3REIC 5B1MD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JA4 B;  5B2I D;  1P3O D;  3C1B B;  3LZ0 C;  3REH A;  2FJ7 C;  1AOI D;  3LZ0 B;  2FJ7 B;  4HGA C;  4ZUX C;  3W98 D;  4ZUX B;  3TU4 B;  1WWI A;  5BO0 B;  4R8P D;  5AV5 A;  1P3K D;  3LZ1 C;  1ULY A;  3LZ1 B;  1B67 A;  1ZLA A;  2F8N B;  3WTP E;  4H9O A;  5AV6 D;  3REJ D;  4YS3 C;  3B6G D;  3AYW C;  4YS3 B;  1P3I C;  1HQ3 D;  3AYW B;  1P3I B;  5AVB C;  5DNN D;  3LJA C;  3WA9 C;  3LJA B;  1EQZ D;  4J8U A;  5B0Y C;  5B0Y B;  3MGR D;  1P3L B;  5B24 D;  3W99 C;  3W96 D;  5B31 A;  3W99 B;  2YFV B;  5CPJ A;  3X1T A;  3KUY C;  5CP6 A;  4G92 C;  4G91 C;  4G92 B;  3AZN D;  4H9R A;  4G91 B;  3MGS D;  2CV5 D;  4QLC D;  4WZS B;  4KGC C;  3REK A;  3AZG C;  4JJN B;  3AZG B;  5JRG D;  4Z2M G;  5G49 B;  3C1C C;  3C1C B;  1KX4 A;  1BH8 A;  2YFW A;  5B33 D;  3NQU A;  3REL A;  5BS7 A;  4J8X D;  5GXQ D;  5AV8 D;  5B0Z D;  2LY8 A;  4WU9 A;  5AVC A;  1TAF B;  5B40 A;  1KX3 B;  2L5A A;  1P3G D;  1P3F B;  3AFA C;  5FUG A;  4WNN B;  1U35 A;  4KUD D;  3AFA B;  5CPI B;  1KU5 A;  1H3O B;  3MNN A;  2HUE C;  3REH D;  2HUE B;  5B1L C;  1F66 A;  5B1L B;  3AZI C;  5BNX A;  3A6N A;  2BYK A;  3AZI B;  5AV5 D;  3AV2 C;  4CAY A;  1ZLA D;  5AY8 A;  1P34 C;  2CWE A;  1P34 B;  3MGP B;  3KWQ D;  3O62 C;  2IO5 B;  5BNV A;  5B2I A;  3O62 B;  1S32 A;  1M18 C;  1B6W A;  3W98 A;  4KHA B;  3VH6 T;  4J8U D;  1P3K A;  5B31 D;  4DRB A;  4H9N B;  5CPJ D;  1M19 C;  3X1T D;  5DNM C;  3AN2 C;  1M19 B;  4Z5T A;  5CP6 D;  3AN2 B;  4ZBJ B;  4NFT A;  3KXB C;  4LD9 C;  3AZL C;  3KXB B;  3AZL B;  5GT0 D;  3B0C W;  3REK D;  1ID3 C;  5CHL B;  1P3P A;  1ID3 B;  1JFI B;  5DNN A;  1N1J A;  3UTA C;  4UUZ B;  5E5A A;  3AV1 C;  1TZY A;  3WAA A;  2NZD A;  5GSU B;  5B32 C;  3REL D;  3WKJ C;  5CPK C;  3AZN A;  5GT3 A;  3REI A;  5CPK B;  4WU9 D;  2RVQ C;  3B6F B;  4XZQ A;  4QLC A;  3X1U A;  4KGC A;  5AVC D;  3AZK A;  5B40 D;  5AV9 C;  2FJ7 A;  5AV9 B;  5KDM A;  3W97 B;  3WTP C;  5BO0 A;  3WTP B;  4J8V A;  3UT9 B;  1U35 D;  1BH9 B;  4Z66 C;  1P3A C;  3MNN D;  1P3A B;  5B2J C;  1KX5 D;  5B2J B;  1F66 D;  5B1M B;  5B0Z A;  4X23 A;  3KSY A;  1Q9C A;  4E45 A;  4YM6 A;  1P3O B;  2HIO C;  4J8W C;  1AOI C;  2HIO B;  4J8W B;  1AOI B;  5AVB A;  3UTB A;  3WA9 A;  1P3G A;  5AY8 D;  5BT1 D;  4AWL B;  3C1B C;  1S32 D;  3KUY A;  3TU4 C;  4CSR A;  3R45 A;  4NE3 A;  1HQ3 B;  1P3M C;  1F1E A;  1P3M B;  4E44 A;  1EQZ B;  3V9R A;  3AZE A;  3W96 C;  4XUJ A;  5B24 C;  4Z5T D;  3MGR B;  3W96 B;  5B24 B;  3KWQ A;  5F99 A;  1P3P D;  4WU8 D;  2CV5 C;  3MVD A;  2CV5 B;  1P3L C;  5E5A D;  5JRG C;  1TZY D;  3WAA D;  5JRG B;  2NZD D;  2PYO D;  3AFA A;  5GT3 D;  4H9P B;  3REI D;  4KGC D;  5GT0 A;  5B33 B;  3X1U D;  4XZQ D;  4JJN C;  3AZF C;  4J8X C;  3X1V C;  5AV8 C;  3AZK D;  4J8X B;  3AZF B;  3X1V B;  5AV8 B;  2FJ7 D;  5B1L A;  4DRA A;  4ZUX D;  4J8V D;  3AV2 A;  3LZ1 D;  3AZM C;  3MGQ A;  3AZM B;  4KUD B;  3AZH A;  3NQJ A;  4X23 D;  1M1A C;  4YM6 D;  1M1A B;  5B31 G;  3REH B;  1KX3 C;  1M18 A;  5AVB D;  3LJA D;  3UTB D;  1P3F C;  3WA9 D;  5B0Y D;  5AV5 B;  5CPI C;  1ZLA B;  5DNM A;  4H9O B;  3KUY D;  1KX5 A;  2NQB A;  3KXB A;  4LD9 A;  3VH5 A;  3AZG D;  1ID3 A;  4J8U C;  4J8U B;  3AZE D;  4XUJ D;  3MGP C;  3UTA A;  3AZJ A;  3AV1 A;  5B31 B;  3VH5 W;  5F99 D;  2IO5 C;  3X1T B;  4EO5 C;  5CP6 B;  4EO5 B;  5B32 A;  4H9R B;  1WWS A;  4WV4 B;  3MVD D;  3WKJ A;  3REK C;  3REK B;  4ZBJ C;  1KX4 C;  3AFA D;  1KX4 B;  1BH8 B;  2YFW B;  3REL C;  3NQU B;  5BS7 C;  3REL B;  4Z66 A;  4H9S C;  4WU8 A;  2ARO A;  4WU9 C;  4WU9 B;  3X1S A;  5B1L D;  5AVC C;  5AVC B;  4H9Q A;  3LEL A;  3B0C T;  3AV2 D;  5B40 B;  5GSU C;  4J8W A;  3MGQ D;  2BYM A;  2PYO A;  3AZH D;  5FUG B;  1U35 B;  1P3B C;  1P34 D;  3B6F C;  1P3B B;  5JA4 A;  1R4V A;  2F8N K;  3C1B A;  3MNN B;  1F66 B;  3LZ0 A;  1M18 D;  3W97 C;  3A6N C;  5BNX B;  4ZUX A;  3A6N B;  3UT9 C;  3TU4 A;  2BYK B;  3LZ1 A;  4CAY B;  2F8N A;  5AY8 B;  5DNM D;  5B1M C;  1HTA A;  2NQB D;  5B2I C;  3KXB D;  1P3O C;  4LD9 D;  5BNV B;  5B2I B;  4YS3 A;  1S32 B;  3AYW A;  1P3I A;  1ID3 D;  3W98 C;  3W98 B;  3B0B A;  4R8P C;  3LJA A;  1P3K C;  4R8P B;  5B0Y A;  1P3L A;  4AWL C;  3UTA D;  3AZJ D;  3AV1 D;  1P3K B;  3W99 A;  2YFV A;  5B32 D;  5AV6 C;  3REJ C;  5AV6 B;  3B6G C;  3WKJ D;  3REJ B;  3B6G B;  1HQ3 C;  2RVQ D;  1P3P C;  4JJN A;  5DNN C;  5C3I C;  3AZG A;  1P3P B;  5DNN B;  5C3I B;  2JSS A;  1EQZ C;  1N1J B;  5G49 A;  5E5A C;  5AV9 D;  3MGR C;  5E5A B;  1TZY B;  3WTP D;  3C1C A;  2NZD B;  3AZM A;  3AZN C;  4Z66 D;  1P3A D;  3AZN B;  3MGS C;  2ARO D;  5GT3 B;  4XZQ C;  4QLC C;  5B2J D;  3X1U C;  3X1S D;  3MGS B;  4XZQ B;  3X1U B;  4QLC B;  3REI B;  3AZK C;  4KGC B;  1M1A A;  3LEL D;  3AZK B;  1TAF A;  2HIO D;  4J8W D;  1KX3 A;  5KDM B;  4HGA B;  4J8V C;  4NE5 A;  1A7W A;  1P3F A;  4WNN A;  4J8V B;  5B33 C;  5CPI A;  1H3O A;  3C1B D;  5GXQ C;  4X23 C;  5GXQ B;  5B0Z C;  3LZ0 D;  4X23 B;  5B0Z B;  4YM6 C;  4YM6 B;  3TU4 D;  3AZI A;  3UTB C;  1P3M D;  5AVB B;  3UTB B;  1P3G C;  3WA9 B;  4KUD C;  2F8N D;  1P3G B;  1P34 A;  3MGP A;  3REH C;  3O62 A;  4YS3 D;  3KUY B;  3AYW D;  1P3I D;  2F8N H;  4KHA A;  4CSR B;  5AV5 C;  3R45 B;  1P3L D;  3W99 D;  1ZLA C;  3AZE C;  4H9N A;  4XUJ C;  3V9R B;  3AZE B;  4XUJ B;  1M19 A;  3AN2 A;  3KWQ C;  3B0D C;  5F99 C;  3KWQ B;  3B0D B;  5F99 B;  3AZL A;  4JJN D;  3AZF D;  1JFI A;  3MVD C;  3X1V D;  3MVD B;  4H9S A;  4UUZ A;  5B31 C;  3C1C D;  5CPJ C;  3X1T C;  5CPJ B;  5CP6 C;  5GSU A;  3AZM D;  5GT0 C;  5CPK A;  1P3B A;  3B6F A;  5GT0 B;  3VH5 T;  1M1A D;  1KX3 D;  3VH6 A;  5AV9 A;  3W97 A;  1P3F D;  3WTP A;  3UT9 A;  3AV2 B;  3MGQ C;  5CPI D;  3MGQ B;  1BH9 A;  3AZH C;  3AZH B;  1P3A A;  3VH6 W;  3NQJ B;  5B2J A;  5B1M A;  1P3O A;  3AZI D;  5B40 C;  2HIO A;  1AOI A;  4Z2M H;  1M18 B;  1U35 C;  5B32 G;  4R8P A;  3MGP D;  3MNN C;  3O62 D;  4NE6 A;  5DNM B;  1KX5 C;  1F66 C;  2NQB C;  1KX5 B;  2NQB B;  5AV6 A;  4LD9 B;  3REJ A;  3B6G A;  1HQ3 A;  1P3M A;  5AY8 C;  5BT1 C;  1EQZ A;  1BFM A;  3AZJ C;  1M19 D;  3MGR A;  3W96 A;  5B24 A;  3UTA B;  3AZJ B;  3AN2 D;  3AV1 B;  1KX4 D;  3AZL D;  1S32 C;  5B32 B;  3WKJ B;  3MGS A;  2CV5 A;  5JRG A;  4Z5T C;  5GSU D;  4Z5T B;  4H9P A;  5CPK D;  1P3B D;  3B6F D;  5B33 A;  3AZF A;  4Z66 B;  2ARO C;  4J8X A;  4WU8 C;  3X1V A;  5AV8 A;  2ARO B;  4WU8 B;  5GXQ A;  3X1S C;  2F8N G;  3X1S B;  1TZY C;  3LEL C;  3A6N D;  3WAA C;  4H9Q B;  3W97 D;  4M6B A;  3LEL B;  3UT9 D;  3WAA B;  2NZD C;  2PYO C;  2BYM B;  2PYO B;  4KUD A;  5GT3 C;  3REI C;  5B1M D; 
#chains in the Genus database with same CATH topology
 5JA4 B;  5B2I D;  1P3O D;  3C1B B;  3LZ0 C;  3REH A;  2FJ7 C;  1AOI D;  3LZ0 B;  1PZR A;  2FJ7 B;  4HGA C;  4ZUX C;  3W98 D;  4ZUX B;  3TU4 B;  1WWI A;  5BO0 B;  4R8P D;  5AV5 A;  1P3K D;  3LZ1 C;  2Y2I A;  1ULY A;  3LZ1 B;  1B67 A;  1W2E A;  1ZLA A;  3WTP E;  2F8N B;  4H9O A;  5AV6 D;  3REJ D;  4YS3 C;  3B6G D;  3AYW C;  4YS3 B;  1P3I C;  1HQ3 D;  3AYW B;  1P3I B;  5AVB C;  5DNN D;  3LJA C;  3WA9 C;  3LJA B;  1EQZ D;  4J8U A;  5B0Y C;  5B0Y B;  3MGR D;  1P3L B;  5B24 D;  3W99 C;  3W96 D;  5B31 A;  3W99 B;  2YFV B;  5CPJ A;  3X1T A;  3KUY C;  5CP6 A;  4G92 C;  2G5I C;  4G91 C;  4G92 B;  3AZN D;  4H9R A;  4G91 B;  3EPH A;  3MGS D;  2CV5 D;  4QLC D;  4WZS B;  4KGC C;  3REK A;  3AZG C;  4JJN B;  3AZG B;  5JRG D;  4Z2M G;  5G49 B;  3C1C C;  3C1C B;  1KX4 A;  1BH8 A;  2Y2O A;  2YFW A;  5B33 D;  3NQU A;  3EPK A;  3REL A;  5BS7 A;  4J8X D;  5GXQ D;  5AV8 D;  5B0Z D;  2LY8 A;  4WU9 A;  5AVC A;  1TAF B;  2RIQ A;  5B40 A;  1KX3 B;  2L5A A;  1P3G D;  1P3F B;  3AFA C;  5FUG A;  4WNN B;  1U35 A;  4KUD D;  3AFA B;  5CPI B;  1KU5 A;  1H3O B;  3MNN A;  2HUE C;  3REH D;  2FFF B;  2HUE B;  5B1L C;  1F66 A;  2ZY4 A;  5B1L B;  2XD5 A;  5BNX A;  3A6N A;  3AZI C;  2BYK A;  3AZI B;  5AV5 D;  3AV2 C;  4CAY A;  1ZLA D;  5AY8 A;  1P34 C;  2CWE A;  1P34 B;  3A1K A;  3MGP B;  3KWQ D;  3O62 C;  2IO5 B;  5BNV A;  5B2I A;  3O62 B;  1S32 A;  1M18 C;  1B6W A;  3W98 A;  4KHA B;  3VH6 T;  4J8U D;  2XD1 A;  2VQR A;  1P3K A;  5B31 D;  4DRB A;  4H9N B;  5CPJ D;  1M19 C;  3X1T D;  5DNM C;  3AN2 C;  1M19 B;  4Z5T A;  5CP6 D;  3AN2 B;  4ZBJ B;  4NFT A;  3KXB C;  4LD9 C;  3AZL C;  3KXB B;  3AZL B;  3EPL A;  5GT0 D;  3B0C W;  3REK D;  2JCH A;  1ID3 C;  5CHL B;  1P3P A;  1ID3 B;  1JFI B;  5DNN A;  1N1J A;  3UTA C;  4UUZ B;  5E5A A;  3AV1 C;  1TZY A;  3WAA A;  2NZD A;  5GSU B;  3P5J B;  5B32 C;  3REL D;  3WKJ C;  5CPK C;  3AZN A;  5GT3 A;  3REI A;  5CPK B;  4WU9 D;  2RVQ C;  3B6F B;  4XZQ A;  4QLC A;  3X1U A;  4KGC A;  5AVC D;  2W8S A;  3AZK A;  5B40 D;  4WJ3 C;  5AV9 C;  4DQY B;  2FJ7 A;  5AV9 B;  5KDM A;  3W97 B;  3WTP C;  2Y2K A;  5BO0 A;  3WTP B;  4J8V A;  3UT9 B;  2ZY2 A;  1U35 D;  1BH9 B;  4Z66 C;  1P3A C;  3MNN D;  1P3A B;  5B2J C;  1KX5 D;  5B2J B;  1F66 D;  5B1M B;  5B0Z A;  4X23 A;  3KSY A;  1Q9C A;  4E45 A;  4YM6 A;  1P3O B;  2HIO C;  4J8W C;  1AOI C;  2HIO B;  4J8W B;  1AOI B;  5AVB A;  3UTB A;  3WA9 A;  1P3G A;  5AY8 D;  5BT1 D;  3H0M C;  4AWL B;  3C1B C;  1S32 D;  3KUY A;  3TU4 C;  4CSR A;  3R45 A;  4NE3 A;  1HQ3 B;  1P3M C;  1F1E A;  1P3M B;  4E44 A;  1EQZ B;  3V9R A;  3AZE A;  3W96 C;  4XUJ A;  5B24 C;  4Z5T D;  3MGR B;  3W96 B;  5B24 B;  2Y2J A;  3KWQ A;  5F99 A;  1P3P D;  3IP4 C;  4WU8 D;  2CV5 C;  3MVD A;  2CV5 B;  1P3L C;  5E5A D;  5JRG C;  1TZY D;  3WAA D;  5JRG B;  2NZD D;  2DQN C;  2PYO D;  3AFA A;  5GT3 D;  4H9P B;  3REI D;  4KGC D;  5GT0 A;  5B33 B;  3X1U D;  4XZQ D;  4JJN C;  3AZF C;  4J8X C;  3X1V C;  5AV8 C;  3AZK D;  4J8X B;  3AZF B;  3X1V B;  5AV8 B;  2FJ7 D;  5B1L A;  4DRA A;  4ZUX D;  4J8V D;  3AV2 A;  1T3U A;  3LZ1 D;  3AZM C;  3MGQ A;  3AZM B;  4KUD B;  3AZH A;  3H0R C;  3NQJ A;  4X23 D;  1M1A C;  4YM6 D;  1M1A B;  5B31 G;  3REH B;  1KX3 C;  1M18 A;  5AVB D;  3LJA D;  3UTB D;  1P3F C;  3WA9 D;  5B0Y D;  5AV5 B;  5CPI C;  1ZLA B;  5DNM A;  4H9O B;  3KUY D;  1KX5 A;  2NQB A;  3KXB A;  4LD9 A;  3VH5 A;  3AZG D;  2UWX A;  1ID3 A;  4J8U C;  4J8U B;  3AZE D;  4XUJ D;  3MGP C;  3UTA A;  3AZJ A;  3AV1 A;  5B31 B;  3VH5 W;  5F99 D;  2IO5 C;  3X1T B;  4EO5 C;  2Y2N A;  5CP6 B;  4EO5 B;  2Y2M A;  5B32 A;  4H9R B;  1WWS A;  4WV4 B;  3MVD D;  3WKJ A;  3REK C;  3REK B;  3KFU G;  4ZBJ C;  1KX4 C;  3AFA D;  1KX4 B;  1BH8 B;  2YFW B;  3REL C;  3NQU B;  5BS7 C;  3REL B;  4Z66 A;  4H9S C;  4WU8 A;  2ARO A;  4WU9 C;  4WU9 B;  3X1S A;  5B1L D;  5AVC C;  5AVC B;  4H9Q A;  3LEL A;  3B0C T;  3AV2 D;  5B40 B;  5GSU C;  4J8W A;  3MGQ D;  2BYM A;  2PYO A;  3AZH D;  5FUG B;  1U35 B;  1P3B C;  1P34 D;  3B6F C;  1P3B B;  2Y2P A;  5JA4 A;  1R4V A;  2F8N K;  3C1B A;  3MNN B;  2Y2Q A;  1F66 B;  3LZ0 A;  1M18 D;  3W97 C;  3A6N C;  2JE5 A;  4ZUX A;  5BNX B;  3A6N B;  3UT9 C;  2BYK B;  3TU4 A;  3LZ1 A;  4CAY B;  2F8N A;  5AY8 B;  5DNM D;  5B1M C;  1HTA A;  2NQB D;  5B2I C;  3KXB D;  1P3O C;  4LD9 D;  5BNV B;  5B2I B;  4YS3 A;  1S32 B;  3AYW A;  1P3I A;  1ID3 D;  3W98 C;  3W98 B;  3B0B A;  4R8P C;  3LJA A;  1P3K C;  4R8P B;  5B0Y A;  1P3L A;  4AWL C;  3UTA D;  3AZJ D;  3AV1 D;  1P3K B;  2ZM5 A;  3W99 A;  2YFV A;  5B32 D;  5AV6 C;  3REJ C;  5AV6 B;  3B6G C;  3WKJ D;  3REJ B;  3B6G B;  1HQ3 C;  2RVQ D;  1P3P C;  4JJN A;  5DNN C;  5C3I C;  3AZG A;  1P3P B;  5DNN B;  5C3I B;  2JSS A;  1EQZ C;  1N1J B;  5G49 A;  5E5A C;  5AV9 D;  3MGR C;  5E5A B;  1TZY B;  3WTP D;  1Z2C B;  3C1C A;  2NZD B;  3AZM A;  3AZN C;  4Z66 D;  1P3A D;  3AZN B;  3MGS C;  2ARO D;  5GT3 B;  4XZQ C;  4QLC C;  5B2J D;  3X1U C;  3X1S D;  3MGS B;  4XZQ B;  3X1U B;  4QLC B;  3REI B;  3AZK C;  4KGC B;  2Y2H A;  1M1A A;  3LEL D;  3AZK B;  1TAF A;  2HIO D;  4J8W D;  1KX3 A;  5KDM B;  4HGA B;  4J8V C;  4NE5 A;  1A7W A;  1P3F A;  4WNN A;  4J8V B;  5B33 C;  2G5H C;  5CPI A;  2DF4 C;  1H3O A;  3C1B D;  5GXQ C;  4X23 C;  5GXQ B;  5B0Z C;  3LZ0 D;  4X23 B;  5B0Z B;  4YM6 C;  3EPJ A;  4YM6 B;  3TU4 D;  3AZI A;  3UTB C;  1P3M D;  5AVB B;  3UTB B;  1P3G C;  3WA9 B;  4KUD C;  2F8N D;  1P3G B;  2J8P A;  1P34 A;  3MGP A;  3FDD A;  3REH C;  3O62 A;  4YS3 D;  3KUY B;  3AYW D;  1P3I D;  2F8N H;  4KHA A;  4CSR B;  5AV5 C;  3R45 B;  1P3L D;  2Y2L A;  3W99 D;  1ZLA C;  3AZE C;  4H9N A;  4XUJ C;  3V9R B;  3AZE B;  4XUJ B;  1M19 A;  3AN2 A;  3KWQ C;  3B0D C;  5F99 C;  3KWQ B;  3B0D B;  5F99 B;  3AZL A;  4JJN D;  3AZF D;  1JFI A;  3MVD C;  3X1V D;  3MVD B;  4H9S A;  4UUZ A;  5B31 C;  3C1C D;  5CPJ C;  3X1T C;  5CPJ B;  5CP6 C;  5GSU A;  3AZM D;  5GT0 C;  5CPK A;  1P3B A;  3B6F A;  5GT0 B;  4UPK A;  3VH5 T;  1M1A D;  1KX3 D;  3VH6 A;  5AV9 A;  3W97 A;  1P3F D;  3WTP A;  3UT9 A;  2Y2G A;  3AV2 B;  3MGQ C;  5CPI D;  3MGQ B;  1BH9 A;  3AZH C;  3AZH B;  1P3A A;  3F6T A;  3VH6 W;  3NQJ B;  5B2J A;  5B1M A;  1P3O A;  3AZI D;  5B40 C;  2HIO A;  3A1I A;  1AOI A;  4Z2M H;  1M18 B;  1U35 C;  5B32 G;  4R8P A;  3MGP D;  2BG1 A;  3MNN C;  3O62 D;  4NE6 A;  5DNM B;  1KX5 C;  1F66 C;  2NQB C;  1KX5 B;  2NQB B;  5AV6 A;  4LD9 B;  3REJ A;  3B6G A;  2F2A C;  1HQ3 A;  1P3M A;  2ZY3 A;  5AY8 C;  5BT1 C;  1EQZ A;  1BFM A;  3AZJ C;  1M19 D;  3MGR A;  3W96 A;  5B24 A;  3UTA B;  3AZJ B;  3AN2 D;  3AV1 B;  1KX4 D;  3AZL D;  1S32 C;  5B32 B;  3WKJ B;  3MGS A;  2CV5 A;  5JRG A;  4Z5T C;  5GSU D;  4Z5T B;  2ZY5 A;  4H9P A;  5CPK D;  1P3B D;  3B6F D;  5B33 A;  3AL0 C;  3AZF A;  4Z66 B;  2ARO C;  4J8X A;  4WU8 C;  3X1V A;  5AV8 A;  2ARO B;  4WU8 B;  5GXQ A;  3X1S C;  2F8N G;  3EG5 B;  3X1S B;  3H0L C;  1TZY C;  3LEL C;  3A6N D;  3WAA C;  4H9Q B;  3W97 D;  4M6B A;  3LEL B;  3UT9 D;  3WAA B;  2NZD C;  2PYO C;  2BYM B;  2PYO B;  4KUD A;  5GT3 C;  3REI C;  5B1M D; 
#chains in the Genus database with same CATH homology
 5JA4 B;  5B2I D;  1P3O D;  3C1B B;  3LZ0 C;  3REH A;  2FJ7 C;  1AOI D;  3LZ0 B;  1PZR A;  2FJ7 B;  4HGA C;  4ZUX C;  3W98 D;  4ZUX B;  3TU4 B;  1WWI A;  5BO0 B;  4R8P D;  5AV5 A;  1P3K D;  3LZ1 C;  2Y2I A;  1ULY A;  3LZ1 B;  1B67 A;  1W2E A;  1ZLA A;  3WTP E;  2F8N B;  4H9O A;  5AV6 D;  3REJ D;  4YS3 C;  3B6G D;  3AYW C;  4YS3 B;  1P3I C;  1HQ3 D;  3AYW B;  1P3I B;  5AVB C;  5DNN D;  3LJA C;  3WA9 C;  3LJA B;  1EQZ D;  4J8U A;  5B0Y C;  5B0Y B;  3MGR D;  1P3L B;  5B24 D;  3W99 C;  3W96 D;  5B31 A;  3W99 B;  2YFV B;  5CPJ A;  3X1T A;  3KUY C;  5CP6 A;  4G92 C;  2G5I C;  4G91 C;  4G92 B;  3AZN D;  4H9R A;  4G91 B;  3EPH A;  3MGS D;  2CV5 D;  4QLC D;  4WZS B;  4KGC C;  3REK A;  3AZG C;  4JJN B;  3AZG B;  5JRG D;  4Z2M G;  5G49 B;  3C1C C;  3C1C B;  1KX4 A;  1BH8 A;  2Y2O A;  2YFW A;  5B33 D;  3NQU A;  3EPK A;  3REL A;  5BS7 A;  4J8X D;  5GXQ D;  5AV8 D;  5B0Z D;  2LY8 A;  4WU9 A;  5AVC A;  1TAF B;  2RIQ A;  5B40 A;  1KX3 B;  2L5A A;  1P3G D;  1P3F B;  3AFA C;  5FUG A;  4WNN B;  1U35 A;  4KUD D;  3AFA B;  5CPI B;  1KU5 A;  1H3O B;  3MNN A;  2HUE C;  3REH D;  2FFF B;  2HUE B;  5B1L C;  1F66 A;  2ZY4 A;  5B1L B;  2XD5 A;  5BNX A;  3A6N A;  3AZI C;  2BYK A;  3AZI B;  5AV5 D;  3AV2 C;  4CAY A;  1ZLA D;  5AY8 A;  1P34 C;  2CWE A;  1P34 B;  3A1K A;  3MGP B;  3KWQ D;  3O62 C;  2IO5 B;  5BNV A;  5B2I A;  3O62 B;  1S32 A;  1M18 C;  1B6W A;  3W98 A;  4KHA B;  3VH6 T;  4J8U D;  2XD1 A;  2VQR A;  1P3K A;  5B31 D;  4DRB A;  4H9N B;  5CPJ D;  1M19 C;  3X1T D;  5DNM C;  3AN2 C;  1M19 B;  4Z5T A;  5CP6 D;  3AN2 B;  4ZBJ B;  4NFT A;  3KXB C;  4LD9 C;  3AZL C;  3KXB B;  3AZL B;  3EPL A;  5GT0 D;  3B0C W;  3REK D;  2JCH A;  1ID3 C;  5CHL B;  1P3P A;  1ID3 B;  1JFI B;  5DNN A;  1N1J A;  3UTA C;  4UUZ B;  5E5A A;  3AV1 C;  1TZY A;  3WAA A;  2NZD A;  5GSU B;  3P5J B;  5B32 C;  3REL D;  3WKJ C;  5CPK C;  3AZN A;  5GT3 A;  3REI A;  5CPK B;  4WU9 D;  2RVQ C;  3B6F B;  4XZQ A;  4QLC A;  3X1U A;  4KGC A;  5AVC D;  2W8S A;  3AZK A;  5B40 D;  4WJ3 C;  5AV9 C;  4DQY B;  2FJ7 A;  5AV9 B;  5KDM A;  3W97 B;  3WTP C;  2Y2K A;  5BO0 A;  3WTP B;  4J8V A;  3UT9 B;  2ZY2 A;  1U35 D;  1BH9 B;  4Z66 C;  1P3A C;  3MNN D;  1P3A B;  5B2J C;  1KX5 D;  5B2J B;  1F66 D;  5B1M B;  5B0Z A;  4X23 A;  3KSY A;  1Q9C A;  4E45 A;  4YM6 A;  1P3O B;  2HIO C;  4J8W C;  1AOI C;  2HIO B;  4J8W B;  1AOI B;  5AVB A;  3UTB A;  3WA9 A;  1P3G A;  5AY8 D;  5BT1 D;  3H0M C;  4AWL B;  3C1B C;  1S32 D;  3KUY A;  3TU4 C;  4CSR A;  3R45 A;  4NE3 A;  1HQ3 B;  1P3M C;  1F1E A;  1P3M B;  4E44 A;  1EQZ B;  3V9R A;  3AZE A;  3W96 C;  4XUJ A;  5B24 C;  4Z5T D;  3MGR B;  3W96 B;  5B24 B;  2Y2J A;  3KWQ A;  5F99 A;  1P3P D;  3IP4 C;  4WU8 D;  2CV5 C;  3MVD A;  2CV5 B;  1P3L C;  5E5A D;  5JRG C;  1TZY D;  3WAA D;  5JRG B;  2NZD D;  2DQN C;  2PYO D;  3AFA A;  5GT3 D;  4H9P B;  3REI D;  4KGC D;  5GT0 A;  5B33 B;  3X1U D;  4XZQ D;  4JJN C;  3AZF C;  4J8X C;  3X1V C;  5AV8 C;  3AZK D;  4J8X B;  3AZF B;  3X1V B;  5AV8 B;  2FJ7 D;  5B1L A;  4DRA A;  4ZUX D;  4J8V D;  3AV2 A;  1T3U A;  3LZ1 D;  3AZM C;  3MGQ A;  3AZM B;  4KUD B;  3AZH A;  3H0R C;  3NQJ A;  4X23 D;  1M1A C;  4YM6 D;  1M1A B;  5B31 G;  3REH B;  1KX3 C;  1M18 A;  5AVB D;  3LJA D;  3UTB D;  1P3F C;  3WA9 D;  5B0Y D;  5AV5 B;  5CPI C;  1ZLA B;  5DNM A;  4H9O B;  3KUY D;  1KX5 A;  2NQB A;  3KXB A;  4LD9 A;  3VH5 A;  3AZG D;  2UWX A;  1ID3 A;  4J8U C;  4J8U B;  3AZE D;  4XUJ D;  3MGP C;  3UTA A;  3AZJ A;  3AV1 A;  5B31 B;  3VH5 W;  5F99 D;  2IO5 C;  3X1T B;  4EO5 C;  2Y2N A;  5CP6 B;  4EO5 B;  2Y2M A;  5B32 A;  4H9R B;  1WWS A;  4WV4 B;  3MVD D;  3WKJ A;  3REK C;  3REK B;  3KFU G;  4ZBJ C;  1KX4 C;  3AFA D;  1KX4 B;  1BH8 B;  2YFW B;  3REL C;  3NQU B;  5BS7 C;  3REL B;  4Z66 A;  4H9S C;  4WU8 A;  2ARO A;  4WU9 C;  4WU9 B;  3X1S A;  5B1L D;  5AVC C;  5AVC B;  4H9Q A;  3LEL A;  3B0C T;  3AV2 D;  5B40 B;  5GSU C;  4J8W A;  3MGQ D;  2BYM A;  2PYO A;  3AZH D;  5FUG B;  1U35 B;  1P3B C;  1P34 D;  3B6F C;  1P3B B;  2Y2P A;  5JA4 A;  1R4V A;  2F8N K;  3C1B A;  3MNN B;  2Y2Q A;  1F66 B;  3LZ0 A;  1M18 D;  3W97 C;  3A6N C;  2JE5 A;  4ZUX A;  5BNX B;  3A6N B;  3UT9 C;  2BYK B;  3TU4 A;  3LZ1 A;  4CAY B;  2F8N A;  5AY8 B;  5DNM D;  5B1M C;  1HTA A;  2NQB D;  5B2I C;  3KXB D;  1P3O C;  4LD9 D;  5BNV B;  5B2I B;  4YS3 A;  1S32 B;  3AYW A;  1P3I A;  1ID3 D;  3W98 C;  3W98 B;  3B0B A;  4R8P C;  3LJA A;  1P3K C;  4R8P B;  5B0Y A;  1P3L A;  4AWL C;  3UTA D;  3AZJ D;  3AV1 D;  1P3K B;  2ZM5 A;  3W99 A;  2YFV A;  5B32 D;  5AV6 C;  3REJ C;  5AV6 B;  3B6G C;  3WKJ D;  3REJ B;  3B6G B;  1HQ3 C;  2RVQ D;  1P3P C;  4JJN A;  5DNN C;  5C3I C;  3AZG A;  1P3P B;  5DNN B;  5C3I B;  2JSS A;  1EQZ C;  1N1J B;  5G49 A;  5E5A C;  5AV9 D;  3MGR C;  5E5A B;  1TZY B;  3WTP D;  1Z2C B;  3C1C A;  2NZD B;  3AZM A;  3AZN C;  4Z66 D;  1P3A D;  3AZN B;  3MGS C;  2ARO D;  5GT3 B;  4XZQ C;  4QLC C;  5B2J D;  3X1U C;  3X1S D;  3MGS B;  4XZQ B;  3X1U B;  4QLC B;  3REI B;  3AZK C;  4KGC B;  2Y2H A;  1M1A A;  3LEL D;  3AZK B;  1TAF A;  2HIO D;  4J8W D;  1KX3 A;  5KDM B;  4HGA B;  4J8V C;  4NE5 A;  1A7W A;  1P3F A;  4WNN A;  4J8V B;  5B33 C;  2G5H C;  5CPI A;  2DF4 C;  1H3O A;  3C1B D;  5GXQ C;  4X23 C;  5GXQ B;  5B0Z C;  3LZ0 D;  4X23 B;  5B0Z B;  4YM6 C;  3EPJ A;  4YM6 B;  3TU4 D;  3AZI A;  3UTB C;  1P3M D;  5AVB B;  3UTB B;  1P3G C;  3WA9 B;  4KUD C;  2F8N D;  1P3G B;  2J8P A;  1P34 A;  3MGP A;  3FDD A;  3REH C;  3O62 A;  4YS3 D;  3KUY B;  3AYW D;  1P3I D;  2F8N H;  4KHA A;  4CSR B;  5AV5 C;  3R45 B;  1P3L D;  2Y2L A;  3W99 D;  1ZLA C;  3AZE C;  4H9N A;  4XUJ C;  3V9R B;  3AZE B;  4XUJ B;  1M19 A;  3AN2 A;  3KWQ C;  3B0D C;  5F99 C;  3KWQ B;  3B0D B;  5F99 B;  3AZL A;  4JJN D;  3AZF D;  1JFI A;  3MVD C;  3X1V D;  3MVD B;  4H9S A;  4UUZ A;  5B31 C;  3C1C D;  5CPJ C;  3X1T C;  5CPJ B;  5CP6 C;  5GSU A;  3AZM D;  5GT0 C;  5CPK A;  1P3B A;  3B6F A;  5GT0 B;  4UPK A;  3VH5 T;  1M1A D;  1KX3 D;  3VH6 A;  5AV9 A;  3W97 A;  1P3F D;  3WTP A;  3UT9 A;  2Y2G A;  3AV2 B;  3MGQ C;  5CPI D;  3MGQ B;  1BH9 A;  3AZH C;  3AZH B;  1P3A A;  3F6T A;  3VH6 W;  3NQJ B;  5B2J A;  5B1M A;  1P3O A;  3AZI D;  5B40 C;  2HIO A;  3A1I A;  1AOI A;  4Z2M H;  1M18 B;  1U35 C;  5B32 G;  4R8P A;  3MGP D;  2BG1 A;  3MNN C;  3O62 D;  4NE6 A;  5DNM B;  1KX5 C;  1F66 C;  2NQB C;  1KX5 B;  2NQB B;  5AV6 A;  4LD9 B;  3REJ A;  3B6G A;  2F2A C;  1HQ3 A;  1P3M A;  2ZY3 A;  5AY8 C;  5BT1 C;  1EQZ A;  1BFM A;  3AZJ C;  1M19 D;  3MGR A;  3W96 A;  5B24 A;  3UTA B;  3AZJ B;  3AN2 D;  3AV1 B;  1KX4 D;  3AZL D;  1S32 C;  5B32 B;  3WKJ B;  3MGS A;  2CV5 A;  5JRG A;  4Z5T C;  5GSU D;  4Z5T B;  2ZY5 A;  4H9P A;  5CPK D;  1P3B D;  3B6F D;  5B33 A;  3AL0 C;  3AZF A;  4Z66 B;  2ARO C;  4J8X A;  4WU8 C;  3X1V A;  5AV8 A;  2ARO B;  4WU8 B;  5GXQ A;  3X1S C;  2F8N G;  3EG5 B;  3X1S B;  3H0L C;  1TZY C;  3LEL C;  3A6N D;  3WAA C;  4H9Q B;  3W97 D;  4M6B A;  3LEL B;  3UT9 D;  3WAA B;  2NZD C;  2PYO C;  2BYM B;  2PYO B;  4KUD A;  5GT3 C;  3REI C;  5B1M D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...