4QLCU

Crystal structure of chromatosome at 3.5 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
SASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Mechanisms of Nucleosome Recognition by Linker Histones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chromatin binding protein/dna
molecule keywords DNA (167-mer)
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2014-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4qlcU00
4A6EA 1KYWA 1R7JA 1FBUA 4NB5A 1BBYA 3SFZA 3PQKA 3HRTA 1FX7A 2EA2A 3BJ6A 2COMA 2D2WA 2VC1A 2HQRA 1MJ9A 2PFBA 1STZA 4QLCU 1FYMA 2FXAA 5ERIA 3CUQA 3PFIA 4I2OA 4UNOA 1Z6RA 4YFNF 1HBXG 2XASA 1F4KA 2RV8A 2CG4A 2DI3A 2HQNA 4F7ZA 1BM9A 3M8EA 4RGUA 4IXAA 4Y13A 3FMSA 1HKTA 1AOYA 4M72A 4HX7A 2O03A 3IC7A 2JT1A 2FEZA 1HQCA 3O6BB 3HSRA 1B4AA 4E70A 3F21A 3FZVA 4L5IA 4DNCA 5LRRA 3HYIA 3S2WA 1HSJA 3QP5A 4EM1A 3I53A 3TKYA 1QPMA 3F22A 4K2EA 1IXCA 2ZJ2A 2CW0F 3WTWC 4RGRA 2XAJA 1R36A 1ZGJA 2W57A 1KU9A 3EUHA 3G3ZA 1U5TB 4XLNF 4HV6A 1P4AA 3RPQA 4O5VA 3W6KB 2F2EA 3K9TA 2X4HA 4LLLA 4BHPA 3V4GA 3M7GA 2D45A 1IRFA 4L0YB 1WWXA 1ODDA 2EFNA 3CTAA 3WU0A 1YLFA 2AS5F 1KU2A 1O57A 2ESNA 2IVMA 4ZZDA 2K02A 2FBHA 1P92A 2PJPA 5IT9K 4G6QA 5LLQA 2H09A 3KLOA 2P5LC 3COAC 1IAWA 1WSUA 1TW2A 3HSEA 2MD5A 1SAXA 4ZYHA 2BV6A 3E5UA 2GXBA 3WE3A 3KEOA 1XB4A 4HW0A 5E1XA 3H3ZA 3FX3A 3I59A 3FXQA 1YS7A 2L3DA 3E6BA 3MQ0A 4M9ZA 1JHHA 1TQMA 3CUQB 3C7JA 4OIRF 2M45A 2XHKA 3FF5A 1ONVA 2VOPA 3ZP5A 5H6RA 3ZQ7A 4D0PA 2V79A 4S05A 4LMYA 4EV0A 4CGZA 2M8EA 3REOA 4HBLA 4GYGA 2GIVA 4QWQA 1TW3A 2PMUA 4KIBA 4CXFA 2BE5F 2W84A 2CQKA 5FFZA 2W24A 3ZMDA 3WGIA 2O8XA 3ZMUA 1W7PB 3F23A 3IL2A 5TJJA 3BPXA 4RGXA 3GFLA 1LVAA 4IPAA 2ZBKA 3TDUC 1MZBA 4LLGF 3HRMA 2IRFG 4HA8A 2RC4A 2QM3A 3BJOA 4ESBA 1ZG5A 1S3JA 2Q0OA 3DPLC 1OKRA 4LLNA 1PUEE 4ENJA 1EH8A 2FMYA 5D6FA 3CO6C 3DKWA 3QPHA 2IW5A 1MJBA 2FE3A 2XAGA 3VB2A 4CYDA 3KETA 1OPCA 2HZTA 4R1HA 5LHHA 3GO5A 1K7AA 4MQ9F 2VBWA 3BZ6A 1XGNA 1DUXC 4LG0B 3HHGA 2OD5A 1YIOA 3I71A 4AIJA 3BDDA 3GVAA 1TLHB 2LF8A 3CLOA 2JRTA 3EYYA 3M9AA 1J75A 4Z2YA 3KP5A 4AWXB 1K78B 3HOSA 2XAQA 1UHMA 1T98A 4ENKA 3SQNA 2O61A 1Z9CA 2A6HF 2EV5A 3NRVA 5DD8A 1R1VA 4KICA 2Z3YA 2XAFA 4L9VA 5EEHA 3BPVA 4G9YA 5L3GA 1TTYA 3M8FA 1RZ4A 3JSPA 4WF2A 5FD6A 2YR2A 5H20A 5CVIA 2FOKA 4HOBA 2RDPA 2F5CA 3V8JA 1U8RA 1I6XA 1HSTA 1KU7A 2NAZA 1ZG1A 2H27A 5F1RA 4P55A 1G4DA 4A6DA 4GXOA 4EJVA 1XDUA 3MFKA 1MDMB 1LEBA 2K7LA 1WKMA 4LK0F 2DO7A 4PCQA 5JFRA 3WTXC 2ISYA 2QQAA 1E17A 2HGCA 2DLLA 3RIRA 5K5QA 3L9FA 2ZMEB 5A2QK 4LK1F 4YFKF 2EFQA 3I58A 3CJNA 5FLXZ 3F8CA 3AAFA 2LNBA 4YG2F 4GYIA 5DCFA 2F5DA 2RQPA 1O3TA 2E1CA 4LJZF 1ZRFA 4KA4A 3WTSC 2JTVA 2A5YB 2MBFA 2DU9A 4BQAA 2YU3A 3P9IA 3J81K 3V8LA 2A3SA 2K86A 5HDKA 2Z33A 1O7FA 2D1VA 2DK8A 3E97A 3VEPA 5HS8A 2HKXA 3C3WA 4HYEA 3Q5FA 3GW2A 2VXZA 3I54A 3N4MA 2STWA 4EVIA 3MAJA 4A0YA 4JQFA 4MGRA 2HWVA 5ILVA 5D4RA 5D5VB 1ON1A 5BOXA 3GZ6A 1OYIA 1RI7A 1ZRDA 1IF1A 3Q9VA 1SD4A 4IRIA 3WU1B 2P6SA 4G8XA 2OA4A 3FWEA 1DPUA 2LSOA 2PLYA 3R61A 3GEZA 1SFXA 4GCVA 4BYYA 3WTTC 5ICGA 2M87A 1S7AA 2FF4A 2V9VA 3I4PA 3R0AA 4UV9A 4OMZA 1TBXA 1R58A 1J2XA 3K1MA 3SHFA 1Z7UA 3LFKA 2ZKZA 5ILSA 4HF1A 1PP7U 1J0RA 1FPQA 5E17F 2QBYA 1P6RA 4WXDA 3DEUA 2FU4A 3MEXA 1BC7C 1ZYRF 4EJWA 3O2PE 4I0AA 5LHIA 2V1DA 1MKMA 3W6JB 3LAJA 3WE2A 4CHUA 5D5WB 3QAHA 2QVOA 1YO5C 3BROA 3V7RA 3KLNA 5FFXA 3NQOA 2IJLA 5FGMA 4ZYDA 3G73A 1XCBA 1R1UA 2GA1A 4M74A 1BC8C 3MWMA 3R6SA 1B9NA 5FO5A 2MLKA 5AIQA 4A12A 1AWCA 3FMRA 1YW8A 2VE9A 1SD7A 1U6GA 1YS6A 4KFCA 2PMHA 2UXXA 3RDIA 4EGZA 1O3RA 5HVQC 3LAPA 1X3UA 2EB7A 1P4XA 1JE8A 1R23A 3U1DA 4RB3C 1QBJA 1ZLKA 5DCMB 1RUOA 1F5TA 1JHFA 1IN8A 5HS7A 1TNSA 4BAYA 2FRHA 5D5XB 2FSWA 2CO5A 1DP7P 3JTGA 3ELKA 2EFWA 3LA2A 4PZJA 4O3MA 2VT2A 4O6JA 1IN7A 1EH6A 4EM0B 3U9GA 3RTRA 5K1YA 5A2QZ 1S8NA 4RB1A 2J5PA 2KIMA 1IN6A 2JZYA 1HKQA 3L00A 4BHBA 5HS9A 3ZPLA 5J6XA 3GX4X 5F64A 2HS5A 5LRSA 3HUGA 1ZG3A 3RKWA 3BOQA 1SFEA 5JI6A 4Q48A 3ML6A 2E7WA 4U0VA 2ZMEA 4L9TA 2GAUA 1ZHFA 5JHUA 3HOTA 1D8JA 2DTRA 2QQ9A 1KGSA 3OV8A 4L18B 1Z1DA 2CSOA 2DAOA 4UVBA 3F6OA 2CWEA 4XSZF 1R00A 3HTSB 2STTA 2PQ8A 5E20A 3IRRA 5HOOA 3R0JA 5KVRA 3TDZC 3ULQB 4EQQA 4KT5C 1F1ZA 2HDCA 4U0WA 3RKYA 4IF4A 3VOEA 5LGUA 1MD0A 3MZYA 1ON2A 2WV0A 3KP3A 3J7AO 4CDGA 2H94A 2GZWA 4UXNA 3V8KA 3GFJA 1IUYA 1IW7F 1RNLA 2FMLA 3ZMVA 2DW4A 5AIPA 2XKOA 2QENA 5CVRA 3CUOA 4RAZA 2M30A 1G3WA 2HKOA 3GUDA 1ZAOA 4R8HA 1P4WA 3WGGA 2K4JA 2XGXA 3L2CA 2DPUA 3ZMTA 2YSRA 2JPBA 3MCZA 2H6BA 1LDDA 4L0ZB 2ESHA 5CVJA 4ON0A 1T0FA 4B8XA 1GHCA 5K5OA 4LG0A 3JAMK 3ERED 1IRGA 4HLYA 5D5UB 2BYVE 2R3SA 1XSDA 3CUQC 4A0XA 2HEOA 3DF8A 2LF7A 4ZYEA 4LB6B 3RJPA 4GGGA 5DDGA 1PDNC 3WGHA 1IXRC 3F72A 2LDUA 2A07F 3WG9A 2IT0A 1OMIA 4LD5A 2XV4S 5CYVA 5D8LB 2XROA 4IJAA 2YX7A 2DQLA 3E3VA 4UUVA 2V6CA 4OINF 2Q2EA 1BIAA 4OIOF 4JBAA 2FBIA 3M1EA 2MH2A 1U2WA 1F9NA 1FSEA 5H6QA 2FA5A 4RGSA 1G3YA 1B9MA 4Q4ZF 4UVAA 5IT9Z 4MEXF 5E1WA 2ETHA 3ABTA 1R1TA 5EEGA 2OU2A 1KQ0A 5CVVA 4M6YA 3T5XA 4ZYGA 3KCCA 1GXPA 5E8IA 1J5YA 4FT8A 5CVUA 3KP4A 1J59A 1FYKA 1K78A 1D3YA 4MHGA 4KIFA 1QGPA 3TGNA 4HQEA 4GO1A 3JSOA 5LHGA 2TDXA 2ZNYA 1B59A 1K6OA 1U78A 1TQIA 4UV8A 2NYXA 1FZPB 1U3EM 2ZNZA 3I59B 1W5SA 3QRFF 3DPTA 2MLGA 3F3XA 2CGPA 4M9SA 1WI9A 2ZCWA 4M71A 4IRHA 2L01A 2L4AA 3V7CA 5L3EA 3ABUA 4I01A 3TO9A 1H0MA 3KP6A 1RIOH 3ISPA 4U0YA 1U5TC 5J8CA 4L9JA 4CICA 5ICCA 5ED4A 2FNPA 3LSTA 3VODA 3GFMA 4DQ2A 2FBKA 4ZH4F 4A5MA 1MGTA 3GF2A 4YIFA 2Y48A 5BS6A 2W85A 2EK5A 2AXLA 4M6XA 5JR3A 1W7PD 2P6TA 1BI1A 1Z05A 2XKPA 2UWMA 4HX4A 4AVPA 3WTUC 2HFHA 5HDNA 4HQMA 4LFUA 3QOPA 2BEOA 4IHTA 1YTYA 1U5TA 5HLHA 1BOAA 1T39A 3ZN0A 3Q9SA 2IPQX 1HKSA 1LQ1A 2IA1A 4KN7X 3GWZA 4PGGA 1NHAA 3R4KA 2L02A 2A6EF 3QU3A 2W25A 4P5OA 1XSXA 2HR3A 5F6FA 2NRAC 5HLGA 1R22A 4TV7A 2ADUA 3IWZA 2F5FA 1FNNA 5L3BA 1HXDA 3HTUA 3O3KA 2R7FA 3E5XA 5L3FA 4XBFA 3B73A 4Q47A 1KU3A 4Q5SF 1MJAA 3P9KA 2RGVA 3DFGA 4FHTA 3KZYA 4HX8A 3F8FA 5DV5A 4FX4A 2NNYA 1I5ZA 3SZPA 1LNWA 5FLXK 5J8FA 1ZRCA 3K1NA 4U88A 2J5OA 2A69F 4P9FA 2GWRA 1O3QA 3K0LA 2CFXA 4XLPF 1TQPA 4WX9A 1SD5A 1UFMA 3L7WA 3FHZA 2UZKA 2A68F 1KA8A 2KRFA 3IKTA 4EJOA 5E18F 1D8KA 3J81Z 4NHJA 3BJAA 1IXSB 1OR7A 4MQVA 3LWFA 1ZLJA 4KNYA 2PG4A 3KP7A 5D6EA 2HOEA 2VC0A 1SMTA 2GXGA 5BPIA 4WCGA 5LEKA 1FYLA 1Q1HA 1ZGAA 4KDPA 4EJTA 4UHTA 3R60A 1J7KA 3GFIA 1L0OC 3H3UA 4M73A 4ENNA 4HV5A 4CO8A 3LA7A 4MEYF 1O7LA 3TOBA 1CF7B 1LJ9A 3RYPA 4KUMA 1R5HA 3WTVC 2EA4A 4P9UA 4U7BA 2NNNA 3MZHA 2EFOA 5TRDA 4N9HA 2EJRA 2GA2A 3GXOA 2ZXJA 1XD7A 5FB2A 3P7NA 4OIQF 1IN5A 5ILUA 2OZUA 1BI3A 3KFWX 2RNJA 2P4WA 2EV6A 1JXSA 2MA3A 2M5WA 1BI2A 4WK8F 2RKHA 3ECOA 4FX0A 2C6YA 2VT3A 4S04A 1KYZA 2KJCA 2H6CA 4KIGA 4L9NA 1SMYF 5LGTA 3U2RA 3TOAA 1FC3A 4B09A 3RKXA 4G94A 3CO7C 1YYVA 3P9CA 2P5VA 3VFZA 5L3CA 3C1DA 1S6LA 1Y0UA 3BY6A 1MDMA 2OZ6A 5D8KB 1T2KA 4MNUA 5KK1A 1QQIA 2WC2A 1KQ9A 4LB5A 2XAHA 2XRNA 3WODF 2FQ3A 4BHCA 2GQQA 1UHWA 3QP6A 3KE2A 5DUIA 4G7OF 4WXHA 2VBYA 2ISZA 3EQLF 4LGWA 1UB9A 1Z6TA 2L54A 1T6SA 3ECHA 3C18A 6PAXA 2DQRA 2KIUA 5LGNA 1HW5A 4EGYA 2PEXA 3F6VA 4OIPF 3I5UA 4I98B 4XRFA 1CF7A 4RS8A 3E6DA 3HRSA 2E7XA 2HTSA 4I09A 3E6MA 1XGMA 1XMAA 2FNAA 2O6GE 1LB2A 3GZ5A 4N0BA 5FD5A 2EFPA 1YG2A 5BQTA 4U7DA 2P7CB 4EJUA 2B0LA 2QBYB 1ZN2A 3D0SA 2WWYA 1YQAA 5E1ZB 2YPRA 2ELHA 2DBBA 3JW4A 3V7SA 1S7OA 1O3SA 3DXJF 3E5QA 2XVCA 2XUBA 2Y75A 2PN6A 4ZZLA 4ETSA 4IHSA 2QYOA 2KJBA 2OAZA 3RI4A 4KYWA 2QUFA 2WTEA 5JVTA 2K4BA 2Z9OA 4PGHA 1G3TA 4G6DA 3J80K 1ZARA 1ZREA 1L3LA 4A2UA 1HW1A 1I27A 2VN2A 3WTYC 1FSHA 4HAMA 3FMQA 3JTHA 1OYWA 1HW2A 2ZO4A 2BBYA 2VE8A 4Y15A 2E1NA 1H9GA 2CYYA 3DP7A 1SD6A 4OMYA 2XIGA 5DUKA 1IN4A 3FXUA 5ICEA 1V3FA 3F8BA 3JAMZ 2KIFA 3FM3A 5DYMA 4KMFA 2JPCA 4HDUA 5CLSA 4OU0A 4EM2A 1B6AA 2V1UA 4RAYA 2A61A 2VBZA 2Z99A 2BGCA 3DV8A 2OQGA 4YIIA 3FXRA 4UVCA 4G7HF 2IA0A 1K79A 1G6NA 3HIFA 3HRUA 4ASNA 1FP2A 2HYGD 1B1BA 3HSFA 4YFXF 1LDJA 2VONA 1TNTA 1REPC 1BI0A 2F5EA 1GXQA 3SZTA 4IVNA 1ULYA 1V4RA 2R7DA 3L09A 2YX4A 2D1HA 2QWWA 3PQJA 2RN7A 1YFHA 1I1GA 3IKVA 1QZZA 2G7UA 3T0YA 1BIBA 3IWFA 1FLIA 1W5TA 3TO7A 3QPTA 5DEQA 4CZZA 4MTEA 4MTDA 2VODA 1D5VA 2P8TA 3RPUA 5LBQA 3NEUA 3T1BA 1FT9A 1DDNA 2V1XA 3LA3A 4I0BA 4ESFA 3T8RA 4HLXA 2G9WA 4RB2C 4A5NA 1S29A 2IA2A 3ZN1A 1H9TA 2Z5UA 4XSXF 1YW7A 3HHHA 1FOKA 4HF0A 3K69A 2OBPA 4HZFA 3K2ZA 1J9IA 3IRQA 4AIKA 2K27A 3I64A 2O0YA 4Y17A 2NS0A 2P5KA 2Q8KA 1CGPA 3SXYA 2QQBA 1QNTA 3H92A 4KMUX 5HDGA 1T38A 5AONA 3KP2A 4I02A 1XDSA 1UCRA 5K5RA 2M1BA 3D5LA 1PP8F 3ZMZA 3CDHA 2LKPA 4WXCA 3OOPA 4A0ZA 5CJ9A 5LEJA 1R5GA 3LQRA 2ACJA 1FBSA 4ENMA 2MH9A 4EMSA 1IZ1A 1KQ8A 1ZH5A 1VTNC 2PBIA 5HLIA 1DPRA 2G7HA 1RUNA 3TQNA 1XGSA 1FP1D 2EV0A 3ZMSA 1C0WA 3ROUA 1GVJA 2DPDA 4ESJA 4NQWA 3WTZA 5D4SA 4HF2A 1XGOA 4RB0A 2ZFWA 2X0LA 4IRGA 5IT3A 2IP2A 2DT5A 1LEAA 2QZ8A 3LQQA 2VOOA 3RYRA 1OYYA 1XCVA 1W4MA 1A04A 5L3DA 3I0TA 4OOIA 1FY7A 4KN4X 3E6CC 1WRJA 1EH7A 3KZZA 3J80Z 5E8GA 3TO6A 2EWNA 1XSVA 1FWZA 5BPDA 2P7VB 2HYFA 1YW9A 3IHUA 3EYIA 3GLXA 2UXNA 3EDPA 3N97A 4H0EA 1BJAA 2L4MA 4AIHA 3BWGA 1P2FA 3QU6A 3DQVC 4P96A 1BN5A 1FBQA 1USSA 1WQ2A 1USTA 1JGSA 4PDKA 1Z91A 2VBXA 2HTJA 2RVCA 2DK5A 4R79A 4G7ZF 3F8MA 2OQRA 2QLZA 1QZYA 1LDKB 5ICFA 4BXUA 1G3SA 4M9XA 1XMKA 3T8TA 3BP8A 1E2XA 4N9IA 5BMZA 1XN7A 4I7HA 2O3FA 1I1SA 1EV7A 4WWCA 5DD4A 5DCMA 1SFUA 4BH9A 2MC3A 3F8NA 4AD9A 1QO0D 4JK1X 3KEQA 2Y0MA 3GYHX 4HDVA 2DFIA 3K1PA 3B02A 2JSCA 2KKOA 2PI0A 1W7PA 3EETA 4BNCA 4L5JA 3FM5A
chains in the Genus database with same CATH superfamily
4F55A 3HOVJ 4A6EA 4CH7A 1KYWA 3PUFA 2KIQA 1IC8A 2DTZA 1R7JA 1SVMA 1OCPA 1FBUA 1R9TJ 4NB5A 1AKHA 1BBYA 2GBYA 2M0MA 3SFZA 4QIWN 4UB6C 4CUGA 3PQKA 3HRTA 1FX7A 2EA2A 1B72A 1JKQC 2Q2EB 3BJ6A 2COMA 4NQWB 2H1KA 2D2WA 2VC1A 4G6TB 3U1KA 2R7XA 2HQRA 1MJ9A 2PFBA 3OYLA 2M7AA 1STZA 4QLCU 3CP2A 2N8GA 3ZCOA 1FYMA 2FXAA 1IV8A 3CESA 3MZ8A 1MNEA 2X1EA 2MG4A 5ERIA 2JA6J 2YU9J 3CUQA 4S0HB 3K10A 4BACA 1ZKGA 3PFIA 4IHWA 1Z0XA 4I2OA 4UNOA 2K9MA 4BXFA 1X58A 1Z6RA 2BVLA 2LRDA 3ABKH 1VFCA 4J01A 2K40A 4YFNF 2F48A 4B48A 1HBXG 4FCYA 2XASA 1F4KA 2RV8A 2CG4A 2DI3A 2HQNA 2XRLA 3WHCA 4F7ZA 3LNQA 1BM9A 3M8EA 4A3EJ 4RGUA 1BR2A 4IXAA 3OYBA 4Y13A 2R4GA 3FMSA 1HKTA 3BR1A 1AOYA 4M72A 4HX7A 2O03A 3IC7A 3PO2J 2JT1A 2FEZA 3I4MJ 2LLKA 1I50J 5EEAA 1HQCA 1YOVB 3O6BB 3M4OJ 3HSRA 1B4AA 4E70A 1I3QJ 3F21A 1B8IA 3FZVA 4L5IA 2OC6A 4DNCA 5LRRA 3HYIA 3S2WA 5F0FA 1SANA 1HSJA 1Z3XA 3QP5A 4EM1A 4JX5A 3AL0C 2JVGA 1JUSA 3I53A 1ORKA 3TKYA 1QPMA 2EH3A 3FXJA 3F22A 4K2EA 1IXCA 2ZJ2A 5C3EJ 2CW0F 4X6AJ 3WTWC 4RGRA 2XAJA 3M8JA 1R36A 1ZGJA 1W36C 2W57A 1KU9A 3JRFA 3EUHA 3G3ZA 2HOTA 1U5TB 2K9NA 4XLNF 4HV6A 3S3OA 1P4AA 2O5RA 3RPQA 3BLYA 5GPAA 4Y52J 2DMUA 2HQAA 4O5VA 3W6KB 4BU2A 2F2EA 3K9TA 2X4HA 4LLLA 2DODA 1D1CA 1SVLA 4IKFA 4BHPA 2M34A 5FLMJ 2R92J 3V4GA 4HSRA 3M7GA 2D45A 1IRFA 4L0YB 1WWXA 4UY8I 1ODDA 4A93J 2EFNA 3CTAA 3WU0A 1JUPA 2JMWA 1YLFA 2AS5F 1KU2A 1O57A 2ESNA 4A3MJ 1YITI 2IVMA 4ZZDA 2K02A 2OCEA 1MH3A 1DU6A 2FBHA 1P92A 1GV2A 2HPMA 2LG4A 5IOZA 3S14J 2PJPA 3ZQLA 1VQNI 5IT9K 5C4JJ 4ZDPA 5F0HA 3A0HC 2CW8A 4G6QA 3SDBA 5LLQA 2NVQJ 1N75A 2H09A 3KLOA 2P5LC 3COAC 1IAWA 1ZK8A 1JKPC 3DU6A 1WSUA 1TW2A 2VQCA 3ZGKA 2JRMA 2IS1A 3CF2A 4BL0B 3HSEA 4AM3A 2MD5A 4XN3A 5GADJ 1SAXA 4ZYHA 2QKLB 2BV6A 2E35A 3CCSI 3E5UA 2WY8Q 2W7NA 1BR4A 5CQGA 3KZIC 1IGNA 2GXBA 2K9LA 2VKHA 1RETA 2HNHA 3GZNB 2OV7A 3WE3A 3KEOA 1XB4A 4J00A 2WAEA 4HW0A 4QSHA 5E1XA 5DTDA 2Y2ZA 3H3ZA 3FX3A 2PX9A 3I59A 3FXQA 1YS7A 3BG7A 2L3DA 3E6BA 2E71A 2XPUA 3MQ0A 3TW6A 4M9ZA 5EZGA 1E3PA 1H89C 1ZQ3P 1JHHA 1TQMA 1SFKA 1R5ID 3G71I 1OCOH 1JI8A 3CUQB 2F6CA 5K7HA 3C7JA 4OIRF 3DTIA 3JRHA 3ZQCA 2M45A 1R4MB 2XHKA 3FF5A 1ONVA 1VQ7I 1VF9A 2VOPA 3ZP5A 5H6RA 2L0KA 1Z7LA 2P81A 3ZQ7A 4LITA 3TW7A 4D0PA 2V79A 4S05A 4CCLA 2E1MB 4LMYA 2KRCA 3H5AA 3OL4A 2JWTA 4PJMA 1VQKI 5C4XJ 3L2RA 4BBSJ 2QSGX 3FK6A 4EV0A 2MGQA 2GOMA 3S3MA 1NK3P 2M8EA 3TBIA 4CGZA 3REOA 2WA0A 4HBLA 4GYGA 2GIVA 4QWQA 2ME6A 1TW3A 2ICWG 2PMUA 1ZR4A 4KIBA 3JR9A 4CXFA 2BE5F 2W84A 3SEQA 2CQKA 5FFZA 1P9QC 2W24A 3AG3H 3ZMDA 2OTLI 2JUGA 1MW7A 3WGIA 2O8XA 3ZMUA 1W7PB 3F23A 3IL2A 1SAUA 5TJJA 3BPXA 4RGXA 3GFLA 1LVAA 4IPAA 3S1MJ 4PFOA 1ETYA 3SFIA 2ZBKA 1QHHD 3TDUC 1MZBA 4LLGF 4XORA 3HRMA 1GT0C 1ETKA 2IRFG 3LSRA 4HA8A 2CUZA 2HVQA 3L2WA 3IP4B 3DKXA 2ME0A 4MFDA 1BJZA 2RC4A 2LY1A 2QM3A 5EG0B 4P1WA 4CA0A 3BJOA 4ESBA 1ZG5A 4BEHA 1S3JA 5J47A 2Q0OA 3DPLC 1OKRA 2KT0A 4LLNA 3MKZA 1PUEE 4ENJA 1EH8A 2FMYA 5D6FA 1QU3A 5E3MA 3H35A 3KYLA 3CO6C 2R7WA 4GRIA 3DKWA 3V42A 1YRNB 2XF7A 4XR6A 3QPHA 2VKVA 4V2FA 2AXTC 4ABZA 1EKEA 2P0WA 2IW5A 1MJBA 2FE3A 2CQXA 3EUHC 1WJ5A 2XAGA 3VB2A 4CYDA 3BT9A 1V5EA 2E34A 3KETA 1OPCA 2HZTA 3HOZJ 2AHQA 1VI0A 4R1HA 5LHHA 1VQ4I 3GO5A 1K7AA 4MQ9F 2XGDA 2VBWA 3IH2A 4RM2A 3BZ6A 1MNDA 1XGNA 1DUXC 2EIJH 4CCMA 4RLQA 4LG0B 3HHGA 2OD5A 3PM1A 1LUJB 3IUOA 2X1CA 4BE0A 1RKTA 1YIOA 3ZRGA 3X2QH 5HNHA 3I71A 4AIJA 2CQ7A 4D9JA 2B7EA 3BDDA 3GVAA 5B1AH 2OTJI 1TLHB 3QQAA 4PJNA 2LF8A 4II2A 3CLOA 2JRTA 2L7FP 3EYYA 3H5NA 4ZC3A 3OOUA 3LSKA 2RAEA 4DW6A 4I6ZA 1PUFB 4D7NA 3M9AA 1J75A 4Z2YA 2ZMEC 2WAQN 3KP5A 4AWXB 1K78B 3HOSA 3MN2A 3DTEA 3OYCA 2XAQA 1UHMA 1T98A 2XPWA 4ENKA 4A3JJ 4XLHA 3SQNA 3PJRA 3OL3A 4DYRA 2O61A 1SFOJ 1T08B 1Z9CA 4N4NB 4IOAF 5J3LA 2DDBA 2A6HF 1R6RA 2EV5A 1BR1A 1S9HA 3NRVA 5DD8A 4AVZA 2Y9ZA 1WH7A 1R1VA 3VYTB 4DBQA 1A36A 3L2UA 4KICA 2Z3YA 2XAFA 1WHUA 4L9VA 5K7FA 2NXNB 5EEHA 2LBFB 3BPVA 4G9YA 5L3GA 1JTYA 1TTYA 2I5UA 3QWLA 3M8FA 1OFCX 1RZ4A 5IYBJ 4RBOA 4BEHB 3JSPA 4WF2A 5FD6A 2E36A 4XOPA 2YR2A 3ZQHA 5H20A 5EG0A 5CVIA 2FOKA 4HOBA 1GVDA 2RDPA 2Y9YA 1FOWA 2F5CA 3FXKA 3V8JA 3HUGB 3G6EI 1U8RA 5E3OA 3S2HJ 1TWFJ 3PSFA 2R7VA 1I6XA 3HM5A 1HSTA 2ID6A 4E4HA 1KU7A 2W00A 2NAZA 3QPSA 1ZG1A 2K3FA 5F1RA 2H27A 1MBGA 2Y0SA 1FOXA 3ABLH 1OISA 4P55A 4XLEA 1G4DA 4A6DA 2DA5A 2CRGA 4GXOA 4EJVA 4M6VA 1XDUA 3MFKA 1MDMB 2QKMB 1JT6A 1LEBA 2VJ5A 1WVRA 2K7LA 3B6AA 1WKMA 3HBLA 3CMYA 1DU0A 1E3HA 3MMYB 4E7IA 4LK0F 2DO7A 4PCQA 4Y3OA 2V6EA 2BY1A 5JFRA 3WTXC 2EBIA 1JGGA 2ISYA 1V5GA 2QQAA 1E17A 2HGCA 2DLLA 3RIRA 5K5QA 3L9FA 2ZMEB 5A2QK 4IQ4A 1AHDP 4LK1F 2EZLA 4YFKF 2EFQA 2KFDA 3OYJA 3I58A 3CJNA 4DYQA 3IAS2 5FLXZ 3F8CA 2O7OA 3CF5F 2XB5A 3AAFA 5TGTA 2LNBA 4YG2F 1NH3A 4BJTA 3D5SC 3G1MA 5J1UA 1X4PA 2Z2SB 3DLLF 4GYIA 5DCFA 4XKCA 2F5DA 2RQPA 1O3TA 3BZCA 2E1CA 4LJZF 4CYCA 1ZRFA 2I8DA 1XX5A 4KA4A 3WTSC 2JTVA 3OYHA 1X2NA 1GV5A 2A5YB 2MBFA 2CUEA 5TISC 2NVYJ 2DU9A 4BQAA 2YU3A 3P9IA 3J81K 2VQHA 2ZSIB 3V8LA 2A3SA 2K86A 3G1OA 5HDKA 2Z33A 2VJJA 3QYFA 1O7FA 2D1VA 2DK8A 3E97A 4XRSG 4ZJZA 3BTLA 3VEPA 5HS8A 2DA1A 2EIKH 2HKXA 5IP9J 3C3WA 1JKOC 2NOJB 4HYEA 4A3KJ 2IGKA 3Q5FA 2CQNA 3SYTA 3CCVI 3CD6I 3GW2A 2VXZA 4MO7A 1WI3A 3I54A 4BKXA 3N4MA 2STWA 4EVIA 4XKWA 1JJ8C 4CCJA 3MAJA 3ONQA 2E2HJ 2KHMA 2OUMA 4A0YA 4A3BJ 2JA7J 4JQFA 4MGRA 3D1NI 2HWVA 2XSJC 5ILVA 5D4RA 4XLAA 5D5VB 1ON1A 3QYBA 2DT7B 5BOXA 2HDWA 3GZ6A 1OYIA 1S5LC 1RI7A 2NS7A 1ZRDA 1H88C 1NK2P 3MVPA 1IF1A 3K6GA 1U9OA 4OAYA 3Q9VA 2K3PA 4RLFA 1SD4A 2R5ZA 1FMVA 4IRIA 3K70C 3Q0WA 4E6KG 1SEUA 3S1NJ 3WU1B 2DMNA 2P6SA 4G8XA 2OA4A 2R7SA 4PK4A 3FWEA 1FMWA 1DPUA 1W36D 2LSOA 1HLVA 4H4KC 1V5FA 2PLYA 3R61A 1MBJA 3GEZA 1SFXA 3HL2A 1OCRH 4GCVA 4BYYA 4RDUA 3WTTC 5E3LA 5ICGA 3O8GA 1Y0NA 2E2JJ 3UR3C 2M87A 3OIQA 1S7AA 2XB0X 1UMQA 2FF4A 2RNGA 1MBFA 2V9VA 3I4PA 1D0ZA 2W4SA 3GTGJ 3R0AA 4UV9A 2M7BA 4OMZA 1TBXA 3DPUA 1D5YA 3KYCB 2M4GA 1FEXA 5IY5H 1R58A 1LE8B 2R5YB 3G1LA 1CQTA 3UKGA 3EPZA 1J2XA 5IPAA 4IO9F 5GTHC 5JHFA 2XF6A 3K1MA 5EZHA 1ZGWA 3SHFA 1GUUA 1Z7UA 1QVUA 2NS8A 2DJNA 3LFKA 4I99C 4BQQA 1YHQI 2ZKZA 3KIOA 2ELKA 5ILSA 1QPIA 1EJ9A 3HPGA 1T0FC 4HF1A 3OYAA 2VI6A 4FTHA 1X19A 1PP7U 1R71A 3G4SI 4LG3A 1J0RA 1FPQA 1FJLA 5E17F 2QBYA 2GOXB 3LSMA 1P6RA 1WCMJ 4WXDA 4F91B 3DEUA 1QZEA 3QOEA 3HOUJ 4NUBA 2FU4A 4BDYA 3MEXA 3AG4H 2E5ZA 2W1OA 3OR2C 2PJRA 1BC7C 4XRMA 2DJIA 4EATA 2L5QA 1ZYRF 5FKNA 4EJWA 3O2PE 4I0AA 5LHIA 2R5YA 3GTLJ 1F43A 3BR0A 2V1DA 1MKMA 3W6JB 4LIVA 1DQUA 2E5NA 3LAJA 4BDZA 2EZKA 3WE2A 1MSEC 2H8RA 3Q0VA 5JLXA 4CHUA 5D5WB 1YI2I 3QAHA 2QVOA 1YIJI 5GP9A 2CV0A 1TT5B 4KJZA 1YO5C 3BROA 3V7RA 3KLNA 5FFXA 5HNFA 1Y6IA 3NQOA 2IJLA 5FGMA 4ZYDA 2VJ4A 2JN6A 1XCBA 2GA1A 1R1UA 3G73A 2BZTA 4M74A 3OYDA 1IO2A 1X1PA 1BC8C 3MWMA 3R6SA 2LREA 1B9NA 3BR2A 5FO5A 4AC0A 2MLKA 5AIQA 4A12A 1MMDA 1AWCA 3FMRA 5GPCA 4C2UA 2LKXA 1YW8A 2VE9A 4PSXA 1SD7A 2XGCA 1U6GA 2CV1A 2DA3A 2F5VA 1N78A 1YS6A 2DMTA 4KFCA 2NVXJ 2PMHA 2UXXA 3BQYA 2E2IJ 3RDIA 5EF6A 4EGZA 2LYCA 2IGNA 1O3RA 4NDLA 5HVQC 2JSPA 3OYKA 3LAPA 1X3UA 2EB7A 2L9RA 1FTZA 1P4XA 2RREA 3S1RJ 3PO3J 2VIXA 5B5EC 1JE8A 1R23A 3U1DA 2WB1N 4RB3C 1QBJA 1ZLKA 3JRCA 5DCMB 1RUOA 1G59A 1F5TA 2L9NA 1JHFA 3S2DJ 1WJEA 2M0CA 1IN8A 2VKEA 2YUSA 1P7JA 4IHXA 5HS7A 1TNSA 4BAYA 1T8IA 2LTPA 3OYGA 1GDTA 2FRHA 5D5XB 3IH4A 3J7AY 2FSWA 1OCTC 2CO5A 1DP7P 2V7FA 4RA2A 3JTGA 3ELKA 2R7ZJ 2EFWA 4ZTJA 3LA2A 2VLAA 4PZJA 5LD2C 4O3MA 4XN0A 2VT2A 3A01A 2MFZA 4A3GJ 4O6JA 1IN7A 1EH6A 4M3GA 4EM0B 3U9GA 3RTRA 1XPXA 5K1YA 4BBRJ 1VQ9I 2DMPA 1U8BA 2DOEA 4Y7NJ 5A2QZ 1S8NA 1T33A 3GTMJ 4RB1A 4A3IJ 2J5PA 2KIMA 2M9HA 2GXAA 1ETXA 1IN6A 4XIDA 2JZYA 1HKQA 4B43A 3L00A 2VPRA 3CCRI 2BVMA 3CMAI 2KP6A 4BHBA 5HS9A 3ZPLA 3CC4I 5CKTA 5J6XA 3GX4X 5F64A 2HS5A 2CH0A 5LRSA 2MW8A 1ZG3A 3HUGA 3RKWA 3H1CA 1YX5A 2WV1A 2B63J 3BOQA 4IZZA 1SFEA 1MBKA 2A6TA 5JI6A 4MLOA 2MD0A 4Q48A 4QTRA 2ELJA 3ML6A 2E7WA 4U0VA 4XL9A 2ZMEA 3B6CA 4L9TA 1VQMI 2VQGA 2MABA 2GAUA 2G0EA 2LMDA 2GLOA 3ZQIA 1ZHFA 2CQQA 3BR5A 5JHUA 3HOTA 1D8JA 1WJFA 3S1QJ 5HLTA 2DTRA 2R7RA 2QQ9A 1W5CC 1KGSA 3QPLA 2NVTJ 1A35A 3OV8A 4L18B 3W3CA 3A0BC 3OYEA 1Z1DA 2CSOA 5FLVA 1UHSA 2DAOA 1WJBA 4UVBA 3F6OA 5EDNA 2E19A 2CWEA 1MBHA 4XSZF 2Z16A 4M3EA 3NWSA 1R00A 3MD2A 5HODA 2O8KA 5E20A 2PQ8A 3IRRA 2STTA 3HTSB 4D7MA 5HOOA 3R0JA 5KVRA 3TDZC 2KL4A 3ULQB 4EQQA 4KT5C 3GTOJ 1F1ZA 4LIUA 1TC3C 2KZGA 3CDIA 2H1LA 2HDCA 3KX2A 3JRBA 4LOCA 4U0WA 3RKYA 4IF4A 3VOEA 3BC8A 2K85A 2CUFA 3RSNA 5LGUA 1MD0A 2HZDA 2EZIA 1LFPA 3MZYA 1ON2A 2WV0A 3KP3A 2CV2A 4B3XA 3J7AO 4CDGA 2H94A 4HNTA 1K6YA 2GZWA 1X3WB 4UXNA 3DLAA 3V8KA 3JREA 3GFJA 2DFFA 3DCFA 4BQOA 1Y8QB 1IUYA 1IW7F 1RNLA 2FMLA 3ZMVA 2DW4A 5AIPA 5EGOA 2XKOA 3K2AA 2QENA 5CVRA 3CUOA 3DU5A 4RAZA 5KNLA 1I6HJ 4E7SA 2M30A 3K70D 1G3WA 2HKOA 3GUDA 1ZAOA 3W2WA 4KITB 4V2GA 4DJAA 4R8HA 1AA7A 3RZDJ 4AIDA 1P4WA 4PJLA 2XGEA 2R7UA 1OCCH 3LSGA 1JJ6C 3ASOH 4FISA 3FXLA 2K4JA 4JYKA 3WGGA 4CZCA 3GTQJ 1WJAA 2XGXA 3L2CA 2DPUA 3ZQQA 1Z67A 3ZMTA 2YSRA 1WGXA 3LL7A 3AKZA 4M3BA 2JPBA 3MCZA 2H6BA 3D5RC 1UJ8A 1LDDA 4L0ZB 2ESHA 5CVJA 4ON0A 1T0FA 3F0CA 4B8XA 2E1OA 1TWGJ 2V9PA 1GHCA 5K5OA 4LG0A 3H3VK 3JAMK 1LFBA 2Y0SN 3ERED 3OYFA 4HLYA 1IRGA 4IHVA 3OIPA 5D5UB 2BYVE 5C44J 2R3SA 2X1DA 2QQ8A 1XSDA 1W0UA 3CCJI 3CUQC 4A0XA 5M3FJ 3DF8A 2HEOA 2LF7A 3OS2A 4ZYEA 5J1YA 5IP6A 1E0EA 4NBQA 5FKOA 5F0CA 4LB6B 3RJPA 4CSWA 3GBGA 3ASNH 4GGGA 5DDGA 1PDNC 3H36A 3H5RA 3WGHA 1IXRC 3F72A 2LDUA 2A07F 1BW6A 4KT6A 4E7LA 2MC4A 5KHDA 5J4VA 3WG9A 3FXMA 3LMMA 1OMIA 3ZQGA 2IT0A 4LD5A 3JRAA 2XV4S 3GTJJ 5CYVA 5D8LB 3BTCA 3A4CA 4IJAA 3VPRA 2QF7A 2YX7A 2XROA 2JA8J 2DQLA 3E3VA 4UUVA 2V6CA 4OINF 2Q2EA 1X1BA 2BW3B 1BIAA 2QA4I 4OIOF 4JBAA 2FBIA 1N25A 4MIMA 3M1EA 2FX0A 2MH2A 1U2WA 1F9NA 1FSEA 3GLLA 3J7YJ 1JT0A 3PNTA 1K83J 5H6QA 4BXXJ 2FA5A 4CCNA 4M3FA 4RGSA 1G3YA 3RQIA 2FQ4A 1B9MA 2KRHA 4Q4ZF 4UVAA 4C3JJ 3HG9A 1U0JA 1BA5A 5IT9Z 4MEXF 2FOWA 5E1WA 2ETHA 3ABTA 2JQ7A 1R1TA 4GFBA 1LVKA 5EEGA 2KQRA 2OU2A 1KQ0A 3DBHB 5CVVA 4ITVA 1LPQA 2BY3A 4M6YA 2CMPA 3T5XA 3SZGA 4ZYGA 4C3HJ 3JRDA 1TL8A 3KCCA 1GXPA 5E8IA 1J5YA 3TMOA 1G2HA 1SVOA 4FT8A 5CVUA 3KP4A 2M3AA 4C9YA 1J59A 1FYKA 1K78A 1D3YA 3IAM2 4MHGA 3E1SA 1TP4A 1QGPA 4KIFA 3TGNA 1Z77A 4BJ6C 4HQEA 2WB1A 4GO1A 3DWLE 2HPIA 4IOCF 3JSOA 5LHGA 2TDXA 2ZNYA 1B59A 2X51A 5K7ZA 1K6OA 2R7OA 5CQEA 3GTPJ 5M5WJ 3CDLA 2EILH 4A3FJ 1U78A 2HDDA 1TQIA 4UV8A 2NYXA 3OSFA 1FZPB 2ECBA 4XKBA 4ZYAA 2LK2A 2M8GX 2KPMA 1U3EM 2ZNZA 4B4CA 1X1DA 2OCCH 3I59B 1W5SA 3QRFF 1DGRM 3DPTA 1PYVA 2MLGA 3F3XA 5FKLA 2CGPA 2LD5A 4FASD 3OSGA 4M9SA 4A3DJ 1WI9A 4ZDOA 2ZCWA 4YEJA 4M71A 4IRHA 2L01A 2L4AA 3V7CA 1RRJA 5L3EA 4RMNA 4XLCA 3ABUA 4I01A 3TO9A 3MKLA 4UUTA 3KP6A 3PFYA 3ISPA 1RIOH 1H0MA 4U0YA 2YS9A 3HC7A 4UUSA 1IJWC 5IOYA 1U5TC 4CICA 4L9JA 5J8CA 5ICCA 5J1RA 5ED4A 2ID3A 3I55I 2E1MC 2FNPA 2HI3A 2Y30A 3LSTA 3GFMA 3RCOA 3VODA 2Z1DA 3VSKA 2FBKA 4DQ2A 4XNFA 4A69C 3EUAA 1NTCA 1T56A 4ZH4F 4A5MA 1WFXA 1WJDA 1MGTA 3GF2A 4YIFA 2Y48A 3JRIA 3QYEA 5BS6A 2W85A 2CJJA 2EK5A 4W1UA 3GCMA 2AXLA 1IRXA 2X85A 3A03A 4M6XA 1YJNI 5JR3A 1W7PD 1WH5A 2P6TA 3HOXJ 1A5JA 1BI1A 1OR7C 3I9V2 4XK4A 1Z05A 4XOTA 4Y4RA 2XKPA 2UWMA 3OS0A 4UUSB 3C2BA 4HX4A 4AVPA 3WTUC 2XDVA 2MSYA 2F4OB 1HOMA 2HFHA 5HDNA 3IV5A 4HQMA 2WY7Q 4LFUA 3QOPA 2BEOA 5B1BH 4IHTA 1YTYA 2FJ1A 3OYIA 1U5TA 5HLHA 1ETQA 1BOAA 4B1RA 1T39A 3ZN0A 3TP3A 2DYSH 3OMYA 3Q9SA 2IPQX 1HKSA 4W97A 4AYBN 1LQ1A 2Q1ZB 3ZXSA 2IA1A 4KN7X 3GWZA 4PGGA 1NHAA 2ZJRF 5M5YJ 3R4KA 2KMUA 2L02A 2ZB9A 2A6EF 3DEEA 2W25A 3QU3A 5F04A 4M3DA 1X2MA 4P5OA 1XSXA 2HR3A 5F6FA 2NRAC 4I76A 5HLGA 3FIWA 1R22A 2TCTA 4E7KA 4TV7A 2ADUA 3IWZA 1TT0A 2F5FA 1S72I 2QSHX 2X6YA 1FNNA 4RM3A 4XKVA 4PSWA 5L3BA 1HXDA 2VJIA 4PJ0C 2IXSA 3HTUA 2HVSA 1Y1WJ 3O3KA 2R7FA 2LY9A 1J09A 2QSFX 3E5XA 5L3FA 3HEFA 4XBFA 3S16J 4BE1A 3H9JA 1HC8A 2BHYA 3B73A 4Q47A 1KU3A 3S17J 4Q5SF 1MJAA 4F92B 1M1EB 2W82A 3L2QA 3P9KA 1XG1A 2RGVA 1MH4A 2KDZA 3DFGA 1IV6A 2L7KA 4FHTA 3KZYA 2V26A 4HPQA 3CP8A 3SDGA 2DA2A 4HX8A 1ITYA 1RC9A 9ANTA 1ZR2A 1WJCA 2VASA 3F8FA 2K9QA 3LFUA 5DV5A 4FX4A 2NNYA 1I5ZA 3LSPA 3SZPA 1IG7A 1PJRA 1LNWA 5FLXK 4PJJA 5J8FA 4IX7A 3K1NA 1ZRCA 4U88A 1B72B 2J5OA 2QCOA 2A69F 4P9FA 1TWHJ 5E79C 2GWRA 1O3QA 1MMAA 3CLQA 3K0LA 2CFXA 4XLPF 1TQPA 2AQEA 4WX9A 2GM4A 1SD5A 3RQ4A 1UFMA 3L7WA 4YIRX 3E0JB 5IP7J 3FHZA 2UZKA 3TEDA 3RZOJ 1A6IA 2A68F 4XQFA 3LSHA 4PFPA 1KA8A 3IH3A 1FIPA 4L5EA 2KRFA 3IKTA 4EJOA 2L7MP 5GAHJ 1D8KA 5E18F 3F9KA 3J81Z 2B9SA 1GLNA 3VSLA 4NHJA 3BJAA 1IXSB 3HOWJ 2DXIA 1OR7A 4MQVA 3NARA 3LWFA 1ZLJA 1IDYA 5EJCA 4KNYA 1P7IA 2PG4A 1AU7A 2R0QC 2R7QA 3KP7A 3HB9A 5D6EA 2HOEA 2Y69H 1RPWA 2VC0A 1SMTA 2GXGA 3K4MA 5BPIA 1FOYA 5LEKA 4WCGA 3HOYJ 2X6WA 1FYLA 1FTTA 3A02A 1Q1HA 1QHGA 1W1WE 3BCBA 3TP0A 3W2AA 1ZGAA 1IRZA 4EJTA 4KDPA 4UHTA 3R60A 4X0GA 5JVGF 1J7KA 1I39A 3S93A 4GDFA 3GFIA 5JLWA 1L0OC 3H3UA 4M73A 4ENNA 4HV5A 1MMSA 3PL8A 1A31A 3ZOBA 2PJRB 3CMMA 4CO8A 3LA7A 4MEYF 3CCMI 2IS6A 1O7LA 3TOBA 1CF7B 3N05A 1ETWA 1LJ9A 1IDZA 5FKMA 3RYPA 4KUMA 2L2OA 4U87A 1R5HA 3WTVC 2EA4A 4P9UA 3K4JA 3K4LA 3BCAA 4U7BA 2NNNA 3MZHA 2DFEA 4FQGA 1UZCA 2BY0A 2DOAA 5F1JA 2EFOA 5TRDA 4N9HA 2EJRA 2GA2A 3GXOA 1D1BA 2ZXJA 1XD7A 5FB2A 3P7NA 4OIQF 1IN5A 5ILUA 2OZUA 1BI3A 2D5VA 4XM3A 3KFWX 2E60A 1G8XA 1OQYA 2RNJA 2P4WA 4A3LJ 1RR7A 4OWRB 1LE8A 2EV6A 5FKKA 1JXSA 2MA3A 2M5WA 5FRNA 1BI2A 2UV1A 4WK8F 2RKHA 3ECOA 4FX0A 2M4KA 2WAQA 2C6YA 3C2GA 2VT3A 2VB6A 4S04A 2JA5J 5FRMA 3O8HA 2W48A 1KYZA 2KJCA 2H6CA 3I3LA 4KIGA 2HOAA 4L9NA 3K4NA 3PIOF 1SMYF 1V54H 3KYDB 4DBRA 5J4YA 3U2RA 5LGTA 5EYRA 3TOAA 1FC3A 4B09A 1K61A 4XICA 3RKXA 4G94A 4XONA 2EINH 3CO7C 2K9SA 3KEYA 1YYVA 3P9CA 2P5VA 1N77A 2DA4A 3VFZA 5L3CA 2F4IA 2TRTA 2ZXIA 3C1DA 1S6LA 3GMEA 1Y0UA 3BY6A 1MDMA 2OZ6A 4C2TA 1DGWY 3S15J 5D8KB 3WG7H 5DS9A 1YE9A 3FISA 1JTXA 1T2KA 4MNUA 2JUCA 5KK1A 2AQFA 1QQIA 2WADA 3W6VA 2WC2A 1Y1VJ 1OLTA 5M3MJ 1NG7A 1MBEA 3AG2H 1KQ9A 4LB5A 2XAHA 2XRNA 2LVSA 5B3SH 3WODF 2DA7A 2FQ3A 2XSDC 2I10A 4BHCA 2GQQA 1UHWA 3S8PA 4ZDLA 2DYRH 3QP6A 3KE2A 1R49A 2VXDA 5DUIA 2LC2A 4HG2A 4NC8A 2BOLA 4G7OF 4X1EA 4WXHA 2VBYA 3FBIB 3FDYA 4FE7A 3WU2C 3EQLF 2ISZA 1DP3A 5F08A 1TZLA 4LGWA 2HXOA 2JVHA 1UB9A 1Z6TA 1MIJA 2L54A 1EA3A 1T6SA 2X9DA 4NNJA 5FROA 2KDOA 4A3CJ 3ECHA 1VQ8I 3C18A 6PAXA 4B3AA 2DQRA 3BTJA 2KIUA 5LGNA 3VWBA 1HW5A 4EGYA 2PEXA 1Y56A 1ZTRA 4CCOA 3F6VA 4OIPF 3I5UA 1UG2A 4I98B 1TWAJ 4XRFA 1CF7A 4RS8A 3E6DA 1ACIA 3HRSA 2E7XA 2EZHA 1K4SA 1UELB 3BG6A 2VL8A 2HTSA 4I09A 3A2KA 2BHZA 5KCMA 3E6MA 1XGMA 3L1PA 1XMAA 2FNAA 2O6GE 1D0XA 1LB2A 2VUMJ 3GZ5A 3DKYA 3NAUA 4N0BA 5FD5A 2EFPA 1YG2A 5BQTA 4U7DA 2P7CB 1PVEA 1POGA 2B0LA 3FHNA 3VYRB 4EJUA 2QBYB 1ZN2A 1ENHA 3D0SA 5IYDJ 2WWYA 1YQAA 2OJED 5E1ZB 2YPRA 4E7HA 1Y39A 1VNDA 3BR6A 2ELHA 2UUZA 1UG0A 2DBBA 1JKRC 3SEZA 3JW4A 3V7SA 2BW3A 1S7OA 2BXYA 1O3SA 5EGOB 3DXJF 3HXLA 3E5QA 2XVCA 3OY9A 2XUBA 2Y75A 4IHYA 2PN6A 4ZZLA 4ETSA 1WZ2A 1MMNA 2Y31A 3CMEI 4IHSA 2QYOA 2KJBA 4Z6YA 2OAZA 3UNGC 4ANJA 4JX4A 3RI4A 1MMGA 4QPQA 4KYWA 2DT6A 5J40A 4YELA 1QA6A 2QUFA 2HQ5A 3AG1H 2WTEA 2PMZA 4HNUA 3EUKL 2XF5A 3CCQI 5JVTA 3BQZA 3CJQB 4F52A 2K4BA 2Z9OA 4PGHA 1G3TA 4J19A 4G6DA 3J80K 1ZARA 1HF0A 2L7ZA 1ZREA 1L3LA 4A2UA 1HW1A 2ZJQF 1I27A 3HJEA 4B47A 2VN2A 3WTYC 3RKQA 1YX3A 1LKXA 3BR3A 2JK3A 1FSHA 1S7EA 4HAMA 1D0YA 3FMQA 1OYWA 3JTHA 4BY1J 1HW2A 2ZO4A 2XAUA 2DFHA 2HU9A 2BBYA 4DOZA 3M1CA 1BL0A 2VE8A 4Y15A 1VQ6I 2GIZA 2E1NA 1H9GA 4IQJA 2CYYA 3DP7A 4NC6A 2R5ZB 1SD6A 4OMYA 1I3AA 4B44A 4XRSA 2XIGA 1KONA 3HGGA 4E7JA 1LFUP 5DUKA 4AUXA 1IN4A 3FXUA 5ICEA 2BY2A 2KISA 1V3FA 3CCYA 2X48A 4F93B 1W0TA 3F8BA 2OPTA 3JAMZ 4EEFG 3VYUB 2KIFA 3FM3A 2IS4A 5DYMA 4DZPA 1X3ZB 4BE2A 5CPRB 4KMFA 2JPCA 4F3QA 1ZELA 5CLSA 4HDUA 3G2BA 4OU0A 2XC7A 3WHBA 4C30A 2O9LA 3AFHA 3CZ6A 1B6AA 4EM2A 5DM6F 3PUBA 3W2VA 3BZKA 4JOMA 2V1UA 4FETA 4RAYA 1WPKA 2A61A 2VBZA 2Z99A 2BGCA 3DV8A 3HKZN 2OQGA 4YIIA 2LH9A 3FXRA 1F36A 4UVCA 4IL6C 4DGWB 4G7HF 2IA0A 3S3NA 1K79A 1G6NA 3PIPF 2JJ7A 3HIFA 3MKYB 3HRUA 4ASNA 1X1AA 1FP2A 2HYGD 1B1BA 3FKIJ 3U21A 5GAEJ 3AL0B 1QRYA 1X4OA 2V9KA 3HSFA 2IGMA 1HDPA 3DBLB 4RAGA 4YFXF 1LDJA 1Z21A 1VQPI 2VONA 1TNTA 2QEXI 1ERDA 2IS2A 1REPC 3C2HA 1BI0A 2F5EA 1H8AC 1RESA 2QGUA 2NVUB 3QODA 1GXQA 3SZTA 4IVNA 1ULYA 1V4RA 1FIAA 4BY7J 2R7DA 2YX4A 3L09A 2D1HA 3BG9A 2QWWA 3PQJA 3S32A 5DM7F 2RN7A 2DN0A 2KZVA 4E7ZA 1O4XA 1YFHA 1XTAA 3PNYA 1VQOI 4BGDA 1ETVA 4D5CA 2MYSA 1I1GA 4HEA2 4JX6A 2ZFUA 2EPFA 3IKVA 1QZZA 2G7UA 3VYSB 3T0YA 1BIBA 2CFOA 3IWFA 2R7TA 1FLIA 3H9GA 3ABMH 1W5TA 3TO7A 3QPTA 3JRGA 3BG5A 4DZJA 4RAFA 1U9NA 5DEQA 3Q3SA 4CZZA 2CW7A 4MTEA 4MTDA 2VODA 2RQQA 1D5VA 3CJTB 3PSIA 2P8TA 3RPUA 5LBQA 5E3NA 3NEUA 4II3A 3CCEI 2X6XA 3T1BA 4CCKA 1FT9A 1DDNA 2V1XA 3LA3A 4I0BA 1RR8C 2ZC2A 4ESFA 3LSJA 3T8RA 4DIQA 4HLXA 2G9WA 2WAFA 3HZJA 5GTIC 1OCZH 4RB2C 4A5NA 1S29A 2IA2A 1MNMC 3OWTA 2R93J 3FK7A 3ZN1A 1Y8RB 1H9TA 2LOOA 2COBA 2Z5UA 4XSXF 1YW7A 3HHHA 3ESWB 1FOKA 4HF0A 3K69A 3CC7I 2OBPA 4CYCB 3H9QA 4HZFA 3K2ZA 1JUMA 1J9IA 3IRQA 4AIKA 3PNVA 3H0GJ 2K27A 4AYBA 3I64A 2O0YA 1XMXA 2ZJPF 4Y17A 2DCEA 2NS0A 1E3OC 2P5KA 3A1YA 2Q8KA 1CGPA 5B66C 3K7AJ 3SXYA 1NG6A 2WBMA 2QQBA 5KAIC 2KLOA 1QNTA 3DEWA 3H92A 4KMUX 5HDGA 1T38A 1X1CA 5AONA 3KP2A 4FE4A 2ZXWH 4G12A 4I02A 3ZQFA 2H8WA 1XDSA 4BJ5C 1UCRA 1TWCJ 4OAZA 5K5RA 3D5LA 2IGOA 2M1BA 2F4MB 4HNVA 1PUFA 2OF7A 1V55H 3J7ZI 1PP8F 3ZMZA 1VZ0A 3CDHA 2LKPA 4WXCA 2V4JC 3OOPA 4BS9A 3FXOA 2IBDA 4A0ZA 5CJ9A 5LEJA 1R5GA 1APLC 3LQRA 2ACJA 4HRIA 1FBSA 4Y33A 4ENMA 2MH9A 3H0DA 4EMSA 1IZ1A 1HA8A 1KQ8A 2DMQA 1VTNC 1ZH5A 2VPLA 3E7LA 2PBIA 5HLIA 3DTKA 2LP0A 3BG3A 1DPRA 3CCUI 2G7HA 3NWTA 1OJLA 1RUNA 3K4KA 2IEKA 3TQNA 1XGSA 3CJRB 1FP1D 2DOFA 2EV0A 3ZMSA 1C0WA 1MSFC 3ROUA 2FD5A 2VQLA 1GVJA 2DPDA 3RPUD 4ESJA 4NQWA 3WTZA 5GAGJ 5D4SA 4HF2A 3A01B 1IUFA 2M2EA 5KAFC 3TL4X 1XGOA 4RB0A 1BOBA 2ZFWA 2X0LA 4IRGA 2VKDA 3CQZJ 5IT3A 3OR1C 1YRNA 2IP2A 4C2MJ 2LBFA 2DT5A 1LEAA 2QZ8A 1A6QA 2FUG2 3LQQA 2VOOA 3RYRA 1OYYA 1T95A 1XCVA 2K5CA 1Z3YA 1W4MA 1SC7A 1A04A 2V1NA 2ECCA 3I0TA 5L3DA 3MKWB 2L9VA 5BNGA 4OOIA 1FY7A 5F27A 3OYNA 4KN4X 3GTKJ 3E6CC 2DDAA 1WRJA 1EH7A 4PUSA 3KZZA 4V19K 1QVTA 3HDDA 5M5XJ 3I4NJ 3J80Z 1BW5A 4BUPA 5E8GA 4DYCA 3TO6A 2EWNA 1XSVA 4D1QA 4NC7A 1FWZA 3HKZA 5BPDA 2HVRA 2EQRA 1ETOA 5FJ8J 2P7VB 2HYFA 1YW9A 3IHUA 2A05A 3EYIA 2LKSA 3GLXA 3FKJA 2UXNA 4MFEA 3EDPA 3N97A 4H0EA 4XLFA 1D1AA 1BJAA 2L4MA 4AIHA 3BWGA 2BXZA 1P2FA 3Q0UA 3QU6A 4UB8C 3DQVC 4P96A 1BN5A 2HXIA 3LOCA 1FBQA 4XMYA 1USSA 4QPOA 1WQ2A 4KISA 3L2VA 2HYJA 1Q1VA 2NOGA 1USTA 1JGSA 4PDKA 1Z91A 4ZTFA 2CU7A 2HTJA 2VBXA 4D5FA 2RVCA 2DK5A 4R79A 3K4BA 2IAIA 4G7ZF 3I56I 1VQ5I 3F8MA 2OQRA 2QLZA 2CUJA 4C3IJ 1QZYA 1K4TA 1LDKB 2EIMH 4IEJA 5ICFA 3FBNB 2CS3A 1G3SA 2JA2A 4BXUA 4N4OB 2LFBA 2PMZN 3OIOA 1EF4A 4M9XA 3JCUC 1XMKA 2DA6A 2LY2A 3P5JA 3BTIA 3BP8A 3T8TA 1E2XA 4N9IA 4AU7A 5BMZA 1XN7A 3ERMA 4I7HA 2O3FA 1YJ9I 1I1SA 1HCRA 1XS9A 1EV7A 1AKHB 3K4CA 4WWCA 2XPVA 5DD4A 2ZSHB 5DCMA 1SFUA 3HPHA 3DBRB 4JP0A 1XC5A 4BH9A 2MC3A 2A5WA 3HGYA 3F8NA 2X6OA 4HSTA 1KZHA 5LFAA 2AO9A 4AD9A 1VQLI 1QO0D 4JK1X 3ZR8X 4YRVA 3KEQA 2Y0MA 3GYHX 2ZXHA 3CC2I 1UAAA 3VDXA 1B8IB 3M3YJ 4HDVA 1RKWA 2DFIA 1YJWI 1HDDC 3K1PA 5H2FC 3B02A 3OYMA 2JSCA 2HOSA 2KKOA 3CCLI 2PI0A 1W7PA 3EETA 4BQNA 3KPHA 3SJMA 3LSIA 1R4NB 4BNCA 2L9SA 5IYCJ 3OS1A 4L5JA 3FM5A 2LR8A 3M07A
chains in the Genus database with same CATH topology
4A6EA 1KYWA 1R7JA 1FBUA 4NB5A 1BBYA 3SFZA 3PQKA 3HRTA 1FX7A 2EA2A 3BJ6A 2COMA 2D2WA 2VC1A 2HQRA 1MJ9A 2PFBA 1STZA 4QLCU 1FYMA 2FXAA 5ERIA 3CUQA 3PFIA 4I2OA 4UNOA 1Z6RA 4YFNF 1HBXG 2XASA 1F4KA 2RV8A 2CG4A 2DI3A 2HQNA 4F7ZA 1BM9A 3M8EA 4RGUA 4IXAA 4Y13A 3FMSA 1HKTA 1AOYA 4M72A 4HX7A 2O03A 3IC7A 2JT1A 2FEZA 1HQCA 3O6BB 3HSRA 1B4AA 4E70A 3F21A 3FZVA 4L5IA 4DNCA 5LRRA 3HYIA 3S2WA 1HSJA 3QP5A 4EM1A 3I53A 3TKYA 1QPMA 3F22A 4K2EA 1IXCA 2ZJ2A 2CW0F 3WTWC 4RGRA 2XAJA 1R36A 1ZGJA 2W57A 1KU9A 3EUHA 3G3ZA 1U5TB 4XLNF 4HV6A 1P4AA 3RPQA 4O5VA 3W6KB 2F2EA 3K9TA 2X4HA 4LLLA 4BHPA 3V4GA 3M7GA 2D45A 1IRFA 4L0YB 1WWXA 1ODDA 2EFNA 3CTAA 3WU0A 1YLFA 2AS5F 1KU2A 1O57A 2ESNA 2IVMA 4ZZDA 2K02A 2FBHA 1P92A 2PJPA 5IT9K 4G6QA 5LLQA 2H09A 3KLOA 2P5LC 3COAC 1IAWA 1WSUA 1TW2A 3HSEA 2MD5A 1SAXA 4ZYHA 2BV6A 3E5UA 2GXBA 3WE3A 3KEOA 1XB4A 4HW0A 5E1XA 3H3ZA 3FX3A 3I59A 3FXQA 1YS7A 2L3DA 3E6BA 3MQ0A 4M9ZA 1JHHA 1TQMA 3CUQB 3C7JA 4OIRF 2M45A 2XHKA 3FF5A 1ONVA 2VOPA 3ZP5A 5H6RA 3ZQ7A 4D0PA 2V79A 4S05A 4LMYA 4EV0A 4CGZA 2M8EA 3REOA 4HBLA 4GYGA 2GIVA 4QWQA 1TW3A 2PMUA 4KIBA 4CXFA 2BE5F 2W84A 2CQKA 5FFZA 2W24A 3ZMDA 3WGIA 2O8XA 3ZMUA 1W7PB 3F23A 3IL2A 5TJJA 3BPXA 4RGXA 3GFLA 1LVAA 4IPAA 2ZBKA 3TDUC 1MZBA 4LLGF 3HRMA 2IRFG 4HA8A 2RC4A 2QM3A 3BJOA 4ESBA 1ZG5A 1S3JA 2Q0OA 3DPLC 1OKRA 4LLNA 1PUEE 4ENJA 1EH8A 2FMYA 5D6FA 3CO6C 3DKWA 3QPHA 2IW5A 1MJBA 2FE3A 2XAGA 3VB2A 4CYDA 3KETA 1OPCA 2HZTA 4R1HA 5LHHA 3GO5A 1K7AA 4MQ9F 2VBWA 3BZ6A 1XGNA 1DUXC 4LG0B 3HHGA 2OD5A 1YIOA 3I71A 4AIJA 3BDDA 3GVAA 1TLHB 2LF8A 3CLOA 2JRTA 3EYYA 3M9AA 1J75A 4Z2YA 3KP5A 4AWXB 1K78B 3HOSA 2XAQA 1UHMA 1T98A 4ENKA 3SQNA 2O61A 1Z9CA 2A6HF 2EV5A 3NRVA 5DD8A 1R1VA 4KICA 2Z3YA 2XAFA 4L9VA 5EEHA 3BPVA 4G9YA 5L3GA 1TTYA 3M8FA 1RZ4A 3JSPA 4WF2A 5FD6A 2YR2A 5H20A 5CVIA 2FOKA 4HOBA 2RDPA 2F5CA 3V8JA 1U8RA 1I6XA 1HSTA 1KU7A 2NAZA 1ZG1A 2H27A 5F1RA 4P55A 1G4DA 4A6DA 4GXOA 4EJVA 1XDUA 3MFKA 1MDMB 1LEBA 2K7LA 1WKMA 4LK0F 2DO7A 4PCQA 5JFRA 3WTXC 2ISYA 2QQAA 1E17A 2HGCA 2DLLA 3RIRA 5K5QA 3L9FA 2ZMEB 5A2QK 4LK1F 4YFKF 2EFQA 3I58A 3CJNA 5FLXZ 3F8CA 3AAFA 2LNBA 4YG2F 4GYIA 5DCFA 2F5DA 2RQPA 1O3TA 2E1CA 4LJZF 1ZRFA 4KA4A 3WTSC 2JTVA 2A5YB 2MBFA 2DU9A 4BQAA 2YU3A 3P9IA 3J81K 3V8LA 2A3SA 2K86A 5HDKA 2Z33A 1O7FA 2D1VA 2DK8A 3E97A 3VEPA 5HS8A 2HKXA 3C3WA 4HYEA 3Q5FA 3GW2A 2VXZA 3I54A 3N4MA 2STWA 4EVIA 3MAJA 4A0YA 4JQFA 4MGRA 2HWVA 5ILVA 5D4RA 5D5VB 1ON1A 5BOXA 3GZ6A 1OYIA 1RI7A 1ZRDA 1IF1A 3Q9VA 1SD4A 4IRIA 3WU1B 2P6SA 4G8XA 2OA4A 3FWEA 1DPUA 2LSOA 2PLYA 3R61A 3GEZA 1SFXA 4GCVA 4BYYA 3WTTC 5ICGA 2M87A 1S7AA 2FF4A 2V9VA 3I4PA 3R0AA 4UV9A 4OMZA 1TBXA 1R58A 1J2XA 3K1MA 3SHFA 1Z7UA 3LFKA 2ZKZA 5ILSA 4HF1A 1PP7U 1J0RA 1FPQA 5E17F 2QBYA 1P6RA 4WXDA 3DEUA 2FU4A 3MEXA 1BC7C 1ZYRF 4EJWA 3O2PE 4I0AA 5LHIA 2V1DA 1MKMA 3W6JB 3LAJA 3WE2A 4CHUA 5D5WB 3QAHA 2QVOA 1YO5C 3BROA 3V7RA 3KLNA 5FFXA 3NQOA 2IJLA 5FGMA 4ZYDA 3G73A 1XCBA 1R1UA 2GA1A 4M74A 1BC8C 3MWMA 3R6SA 1B9NA 5FO5A 2MLKA 5AIQA 4A12A 1AWCA 3FMRA 1YW8A 2VE9A 1SD7A 1U6GA 1YS6A 4KFCA 2PMHA 2UXXA 3RDIA 4EGZA 1O3RA 5HVQC 3LAPA 1X3UA 2EB7A 1P4XA 1JE8A 1R23A 3U1DA 4RB3C 1QBJA 1ZLKA 5DCMB 1RUOA 1F5TA 1JHFA 1IN8A 5HS7A 1TNSA 4BAYA 2FRHA 5D5XB 2FSWA 2CO5A 1DP7P 3JTGA 3ELKA 2EFWA 3LA2A 4PZJA 4O3MA 2VT2A 4O6JA 1IN7A 1EH6A 4EM0B 3U9GA 3RTRA 5K1YA 5A2QZ 1S8NA 4RB1A 2J5PA 2KIMA 1IN6A 2JZYA 1HKQA 3L00A 4BHBA 5HS9A 3ZPLA 5J6XA 3GX4X 5F64A 2HS5A 5LRSA 3HUGA 1ZG3A 3RKWA 3BOQA 1SFEA 5JI6A 4Q48A 3ML6A 2E7WA 4U0VA 2ZMEA 4L9TA 2GAUA 1ZHFA 5JHUA 3HOTA 1D8JA 2DTRA 2QQ9A 1KGSA 3OV8A 4L18B 1Z1DA 2CSOA 2DAOA 4UVBA 3F6OA 2CWEA 4XSZF 1R00A 3HTSB 2STTA 2PQ8A 5E20A 3IRRA 5HOOA 3R0JA 5KVRA 3TDZC 3ULQB 4EQQA 4KT5C 1F1ZA 2HDCA 4U0WA 3RKYA 4IF4A 3VOEA 5LGUA 1MD0A 3MZYA 1ON2A 2WV0A 3KP3A 3J7AO 4CDGA 2H94A 2GZWA 4UXNA 3V8KA 3GFJA 1IUYA 1IW7F 1RNLA 2FMLA 3ZMVA 2DW4A 5AIPA 2XKOA 2QENA 5CVRA 3CUOA 4RAZA 2M30A 1G3WA 2HKOA 3GUDA 1ZAOA 4R8HA 1P4WA 3WGGA 2K4JA 2XGXA 3L2CA 2DPUA 3ZMTA 2YSRA 2JPBA 3MCZA 2H6BA 1LDDA 4L0ZB 2ESHA 5CVJA 4ON0A 1T0FA 4B8XA 1GHCA 5K5OA 4LG0A 3JAMK 3ERED 1IRGA 4HLYA 5D5UB 2BYVE 2R3SA 1XSDA 3CUQC 4A0XA 2HEOA 3DF8A 2LF7A 4ZYEA 4LB6B 3RJPA 4GGGA 5DDGA 1PDNC 3WGHA 1IXRC 3F72A 2LDUA 2A07F 3WG9A 2IT0A 1OMIA 4LD5A 2XV4S 5CYVA 5D8LB 2XROA 4IJAA 2YX7A 2DQLA 3E3VA 4UUVA 2V6CA 4OINF 2Q2EA 1BIAA 4OIOF 4JBAA 2FBIA 3M1EA 2MH2A 1U2WA 1F9NA 1FSEA 5H6QA 2FA5A 4RGSA 1G3YA 1B9MA 4Q4ZF 4UVAA 5IT9Z 4MEXF 5E1WA 2ETHA 3ABTA 1R1TA 5EEGA 2OU2A 1KQ0A 5CVVA 4M6YA 3T5XA 4ZYGA 3KCCA 1GXPA 5E8IA 1J5YA 4FT8A 5CVUA 3KP4A 1J59A 1FYKA 1K78A 1D3YA 4MHGA 4KIFA 1QGPA 3TGNA 4HQEA 4GO1A 3JSOA 5LHGA 2TDXA 2ZNYA 1B59A 1K6OA 1U78A 1TQIA 4UV8A 2NYXA 1FZPB 1U3EM 2ZNZA 3I59B 1W5SA 3QRFF 3DPTA 2MLGA 3F3XA 2CGPA 4M9SA 1WI9A 2ZCWA 4M71A 4IRHA 2L01A 2L4AA 3V7CA 5L3EA 3ABUA 4I01A 3TO9A 1H0MA 3KP6A 1RIOH 3ISPA 4U0YA 1U5TC 5J8CA 4L9JA 4CICA 5ICCA 5ED4A 2FNPA 3LSTA 3VODA 3GFMA 4DQ2A 2FBKA 4ZH4F 4A5MA 1MGTA 3GF2A 4YIFA 2Y48A 5BS6A 2W85A 2EK5A 2AXLA 4M6XA 5JR3A 1W7PD 2P6TA 1BI1A 1Z05A 2XKPA 2UWMA 4HX4A 4AVPA 3WTUC 2HFHA 5HDNA 4HQMA 4LFUA 3QOPA 2BEOA 4IHTA 1YTYA 1U5TA 5HLHA 1BOAA 1T39A 3ZN0A 3Q9SA 2IPQX 1HKSA 1LQ1A 2IA1A 4KN7X 3GWZA 4PGGA 1NHAA 3R4KA 2L02A 2A6EF 3QU3A 2W25A 4P5OA 1XSXA 2HR3A 5F6FA 2NRAC 5HLGA 1R22A 4TV7A 2ADUA 3IWZA 2F5FA 1FNNA 5L3BA 1HXDA 3HTUA 3O3KA 2R7FA 3E5XA 5L3FA 4XBFA 3B73A 4Q47A 1KU3A 4Q5SF 1MJAA 3P9KA 2RGVA 3DFGA 4FHTA 3KZYA 4HX8A 3F8FA 5DV5A 4FX4A 2NNYA 1I5ZA 3SZPA 1LNWA 5FLXK 5J8FA 1ZRCA 3K1NA 4U88A 2J5OA 2A69F 4P9FA 2GWRA 1O3QA 3K0LA 2CFXA 4XLPF 1TQPA 4WX9A 1SD5A 1UFMA 3L7WA 3FHZA 2UZKA 2A68F 1KA8A 2KRFA 3IKTA 4EJOA 5E18F 1D8KA 3J81Z 4NHJA 3BJAA 1IXSB 1OR7A 4MQVA 3LWFA 1ZLJA 4KNYA 2PG4A 3KP7A 5D6EA 2HOEA 2VC0A 1SMTA 2GXGA 5BPIA 4WCGA 5LEKA 1FYLA 1Q1HA 1ZGAA 4KDPA 4EJTA 4UHTA 3R60A 1J7KA 3GFIA 1L0OC 3H3UA 4M73A 4ENNA 4HV5A 4CO8A 3LA7A 4MEYF 1O7LA 3TOBA 1CF7B 1LJ9A 3RYPA 4KUMA 1R5HA 3WTVC 2EA4A 4P9UA 4U7BA 2NNNA 3MZHA 2EFOA 5TRDA 4N9HA 2EJRA 2GA2A 3GXOA 2ZXJA 1XD7A 5FB2A 3P7NA 4OIQF 1IN5A 5ILUA 2OZUA 1BI3A 3KFWX 2RNJA 2P4WA 2EV6A 1JXSA 2MA3A 2M5WA 1BI2A 4WK8F 2RKHA 3ECOA 4FX0A 2C6YA 2VT3A 4S04A 1KYZA 2KJCA 2H6CA 4KIGA 4L9NA 1SMYF 5LGTA 3U2RA 3TOAA 1FC3A 4B09A 3RKXA 4G94A 3CO7C 1YYVA 3P9CA 2P5VA 3VFZA 5L3CA 3C1DA 1S6LA 1Y0UA 3BY6A 1MDMA 2OZ6A 5D8KB 1T2KA 4MNUA 5KK1A 1QQIA 2WC2A 1KQ9A 4LB5A 2XAHA 2XRNA 3WODF 2FQ3A 4BHCA 2GQQA 1UHWA 3QP6A 3KE2A 5DUIA 4G7OF 4WXHA 2VBYA 2ISZA 3EQLF 4LGWA 1UB9A 1Z6TA 2L54A 1T6SA 3ECHA 3C18A 6PAXA 2DQRA 2KIUA 5LGNA 1HW5A 4EGYA 2PEXA 3F6VA 4OIPF 3I5UA 4I98B 4XRFA 1CF7A 4RS8A 3E6DA 3HRSA 2E7XA 2HTSA 4I09A 3E6MA 1XGMA 1XMAA 2FNAA 2O6GE 1LB2A 3GZ5A 4N0BA 5FD5A 2EFPA 1YG2A 5BQTA 4U7DA 2P7CB 4EJUA 2B0LA 2QBYB 1ZN2A 3D0SA 2WWYA 1YQAA 5E1ZB 2YPRA 2ELHA 2DBBA 3JW4A 3V7SA 1S7OA 1O3SA 3DXJF 3E5QA 2XVCA 2XUBA 2Y75A 2PN6A 4ZZLA 4ETSA 4IHSA 2QYOA 2KJBA 2OAZA 3RI4A 4KYWA 2QUFA 2WTEA 5JVTA 2K4BA 2Z9OA 4PGHA 1G3TA 4G6DA 3J80K 1ZARA 1ZREA 1L3LA 4A2UA 1HW1A 1I27A 2VN2A 3WTYC 1FSHA 4HAMA 3FMQA 3JTHA 1OYWA 1HW2A 2ZO4A 2BBYA 2VE8A 4Y15A 2E1NA 1H9GA 2CYYA 3DP7A 1SD6A 4OMYA 2XIGA 5DUKA 1IN4A 3FXUA 5ICEA 1V3FA 3F8BA 3JAMZ 2KIFA 3FM3A 5DYMA 4KMFA 2JPCA 4HDUA 5CLSA 4OU0A 4EM2A 1B6AA 2V1UA 4RAYA 2A61A 2VBZA 2Z99A 2BGCA 3DV8A 2OQGA 4YIIA 3FXRA 4UVCA 4G7HF 2IA0A 1K79A 1G6NA 3HIFA 3HRUA 4ASNA 1FP2A 2HYGD 1B1BA 3HSFA 4YFXF 1LDJA 2VONA 1TNTA 1REPC 1BI0A 2F5EA 1GXQA 3SZTA 4IVNA 1ULYA 1V4RA 2R7DA 3L09A 2YX4A 2D1HA 2QWWA 3PQJA 2RN7A 1YFHA 1I1GA 3IKVA 1QZZA 2G7UA 3T0YA 1BIBA 3IWFA 1FLIA 1W5TA 3TO7A 3QPTA 5DEQA 4CZZA 4MTEA 4MTDA 2VODA 1D5VA 2P8TA 3RPUA 5LBQA 3NEUA 3T1BA 1FT9A 1DDNA 2V1XA 3LA3A 4I0BA 4ESFA 3T8RA 4HLXA 2G9WA 4RB2C 4A5NA 1S29A 2IA2A 3ZN1A 1H9TA 2Z5UA 4XSXF 1YW7A 3HHHA 1FOKA 4HF0A 3K69A 2OBPA 4HZFA 3K2ZA 1J9IA 3IRQA 4AIKA 2K27A 3I64A 2O0YA 4Y17A 2NS0A 2P5KA 2Q8KA 1CGPA 3SXYA 2QQBA 1QNTA 3H92A 4KMUX 5HDGA 1T38A 5AONA 3KP2A 4I02A 1XDSA 1UCRA 5K5RA 2M1BA 3D5LA 1PP8F 3ZMZA 3CDHA 2LKPA 4WXCA 3OOPA 4A0ZA 5CJ9A 5LEJA 1R5GA 3LQRA 2ACJA 1FBSA 4ENMA 2MH9A 4EMSA 1IZ1A 1KQ8A 1ZH5A 1VTNC 2PBIA 5HLIA 1DPRA 2G7HA 1RUNA 3TQNA 1XGSA 1FP1D 2EV0A 3ZMSA 1C0WA 3ROUA 1GVJA 2DPDA 4ESJA 4NQWA 3WTZA 5D4SA 4HF2A 1XGOA 4RB0A 2ZFWA 2X0LA 4IRGA 5IT3A 2IP2A 2DT5A 1LEAA 2QZ8A 3LQQA 2VOOA 3RYRA 1OYYA 1XCVA 1W4MA 1A04A 5L3DA 3I0TA 4OOIA 1FY7A 4KN4X 3E6CC 1WRJA 1EH7A 3KZZA 3J80Z 5E8GA 3TO6A 2EWNA 1XSVA 1FWZA 5BPDA 2P7VB 2HYFA 1YW9A 3IHUA 3EYIA 3GLXA 2UXNA 3EDPA 3N97A 4H0EA 1BJAA 2L4MA 4AIHA 3BWGA 1P2FA 3QU6A 3DQVC 4P96A 1BN5A 1FBQA 1USSA 1WQ2A 1USTA 1JGSA 4PDKA 1Z91A 2VBXA 2HTJA 2RVCA 2DK5A 4R79A 4G7ZF 3F8MA 2OQRA 2QLZA 1QZYA 1LDKB 5ICFA 4BXUA 1G3SA 4M9XA 1XMKA 3T8TA 3BP8A 1E2XA 4N9IA 5BMZA 1XN7A 4I7HA 2O3FA 1I1SA 1EV7A 4WWCA 5DD4A 5DCMA 1SFUA 4BH9A 2MC3A 3F8NA 4AD9A 1QO0D 4JK1X 3KEQA 2Y0MA 3GYHX 4HDVA 2DFIA 3K1PA 3B02A 2JSCA 2KKOA 2PI0A 1W7PA 3EETA 4BNCA 4L5JA 3FM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A6E A;  1KYW A;  1R7J A;  1FBU A;  4NB5 A;  1BBY A;  3SFZ A;  3PQK A;  3HRT A;  1FX7 A;  2EA2 A;  3BJ6 A;  2COM A;  2D2W A;  2VC1 A;  2HQR A;  1MJ9 A;  2PFB A;  1STZ A;  4QLC U;  1FYM A;  2FXA A;  5ERI A;  3CUQ A;  3PFI A;  4I2O A;  4UNO A;  1Z6R A;  4YFN F;  1HBX G;  2XAS A;  1F4K A;  2RV8 A;  2CG4 A;  2DI3 A;  2HQN A;  4F7Z A;  1BM9 A;  3M8E A;  4RGU A;  4IXA A;  4Y13 A;  3FMS A;  1HKT A;  1AOY A;  4M72 A;  4HX7 A;  2O03 A;  3IC7 A;  2JT1 A;  2FEZ A;  1HQC A;  3O6B B;  3HSR A;  1B4A A;  4E70 A;  3F21 A;  3FZV A;  4L5I A;  4DNC A;  5LRR A;  3HYI A;  3S2W A;  1HSJ A;  3QP5 A;  4EM1 A;  3I53 A;  3TKY A;  1QPM A;  3F22 A;  4K2E A;  1IXC A;  2ZJ2 A;  2CW0 F;  3WTW C;  4RGR A;  2XAJ A;  1R36 A;  1ZGJ A;  2W57 A;  1KU9 A;  3EUH A;  3G3Z A;  1U5T B;  4XLN F;  4HV6 A;  1P4A A;  3RPQ A;  4O5V A;  3W6K B;  2F2E A;  3K9T A;  2X4H A;  4LLL A;  4BHP A;  3V4G A;  3M7G A;  2D45 A;  1IRF A;  4L0Y B;  1WWX A;  1ODD A;  2EFN A;  3CTA A;  3WU0 A;  1YLF A;  2AS5 F;  1KU2 A;  1O57 A;  2ESN A;  2IVM A;  4ZZD A;  2K02 A;  2FBH A;  1P92 A;  2PJP A;  5IT9 K;  4G6Q A;  5LLQ A;  2H09 A;  3KLO A;  2P5L C;  3COA C;  1IAW A;  1WSU A;  1TW2 A;  3HSE A;  2MD5 A;  1SAX A;  4ZYH A;  2BV6 A;  3E5U A;  2GXB A;  3WE3 A;  3KEO A;  1XB4 A;  4HW0 A;  5E1X A;  3H3Z A;  3FX3 A;  3I59 A;  3FXQ A;  1YS7 A;  2L3D A;  3E6B A;  3MQ0 A;  4M9Z A;  1JHH A;  1TQM A;  3CUQ B;  3C7J A;  4OIR F;  2M45 A;  2XHK A;  3FF5 A;  1ONV A;  2VOP A;  3ZP5 A;  5H6R A;  3ZQ7 A;  4D0P A;  2V79 A;  4S05 A;  4LMY A;  4EV0 A;  4CGZ A;  2M8E A;  3REO A;  4HBL A;  4GYG A;  2GIV A;  4QWQ A;  1TW3 A;  2PMU A;  4KIB A;  4CXF A;  2BE5 F;  2W84 A;  2CQK A;  5FFZ A;  2W24 A;  3ZMD A;  3WGI A;  2O8X A;  3ZMU A;  1W7P B;  3F23 A;  3IL2 A;  5TJJ A;  3BPX A;  4RGX A;  3GFL A;  1LVA A;  4IPA A;  2ZBK A;  3TDU C;  1MZB A;  4LLG F;  3HRM A;  2IRF G;  4HA8 A;  2RC4 A;  2QM3 A;  3BJO A;  4ESB A;  1ZG5 A;  1S3J A;  2Q0O A;  3DPL C;  1OKR A;  4LLN A;  1PUE E;  4ENJ A;  1EH8 A;  2FMY A;  5D6F A;  3CO6 C;  3DKW A;  3QPH A;  2IW5 A;  1MJB A;  2FE3 A;  2XAG A;  3VB2 A;  4CYD A;  3KET A;  1OPC A;  2HZT A;  4R1H A;  5LHH A;  3GO5 A;  1K7A A;  4MQ9 F;  2VBW A;  3BZ6 A;  1XGN A;  1DUX C;  4LG0 B;  3HHG A;  2OD5 A;  1YIO A;  3I71 A;  4AIJ A;  3BDD A;  3GVA A;  1TLH B;  2LF8 A;  3CLO A;  2JRT A;  3EYY A;  3M9A A;  1J75 A;  4Z2Y A;  3KP5 A;  4AWX B;  1K78 B;  3HOS A;  2XAQ A;  1UHM A;  1T98 A;  4ENK A;  3SQN A;  2O61 A;  1Z9C A;  2A6H F;  2EV5 A;  3NRV A;  5DD8 A;  1R1V A;  4KIC A;  2Z3Y A;  2XAF A;  4L9V A;  5EEH A;  3BPV A;  4G9Y A;  5L3G A;  1TTY A;  3M8F A;  1RZ4 A;  3JSP A;  4WF2 A;  5FD6 A;  2YR2 A;  5H20 A;  5CVI A;  2FOK A;  4HOB A;  2RDP A;  2F5C A;  3V8J A;  1U8R A;  1I6X A;  1HST A;  1KU7 A;  2NAZ A;  1ZG1 A;  2H27 A;  5F1R A;  4P55 A;  1G4D A;  4A6D A;  4GXO A;  4EJV A;  1XDU A;  3MFK A;  1MDM B;  1LEB A;  2K7L A;  1WKM A;  4LK0 F;  2DO7 A;  4PCQ A;  5JFR A;  3WTX C;  2ISY A;  2QQA A;  1E17 A;  2HGC A;  2DLL A;  3RIR A;  5K5Q A;  3L9F A;  2ZME B;  5A2Q K;  4LK1 F;  4YFK F;  2EFQ A;  3I58 A;  3CJN A;  5FLX Z;  3F8C A;  3AAF A;  2LNB A;  4YG2 F;  4GYI A;  5DCF A;  2F5D A;  2RQP A;  1O3T A;  2E1C A;  4LJZ F;  1ZRF A;  4KA4 A;  3WTS C;  2JTV A;  2A5Y B;  2MBF A;  2DU9 A;  4BQA A;  2YU3 A;  3P9I A;  3J81 K;  3V8L A;  2A3S A;  2K86 A;  5HDK A;  2Z33 A;  1O7F A;  2D1V A;  2DK8 A;  3E97 A;  3VEP A;  5HS8 A;  2HKX A;  3C3W A;  4HYE A;  3Q5F A;  3GW2 A;  2VXZ A;  3I54 A;  3N4M A;  2STW A;  4EVI A;  3MAJ A;  4A0Y A;  4JQF A;  4MGR A;  2HWV A;  5ILV A;  5D4R A;  5D5V B;  1ON1 A;  5BOX A;  3GZ6 A;  1OYI A;  1RI7 A;  1ZRD A;  1IF1 A;  3Q9V A;  1SD4 A;  4IRI A;  3WU1 B;  2P6S A;  4G8X A;  2OA4 A;  3FWE A;  1DPU A;  2LSO A;  2PLY A;  3R61 A;  3GEZ A;  1SFX A;  4GCV A;  4BYY A;  3WTT C;  5ICG A;  2M87 A;  1S7A A;  2FF4 A;  2V9V A;  3I4P A;  3R0A A;  4UV9 A;  4OMZ A;  1TBX A;  1R58 A;  1J2X A;  3K1M A;  3SHF A;  1Z7U A;  3LFK A;  2ZKZ A;  5ILS A;  4HF1 A;  1PP7 U;  1J0R A;  1FPQ A;  5E17 F;  2QBY A;  1P6R A;  4WXD A;  3DEU A;  2FU4 A;  3MEX A;  1BC7 C;  1ZYR F;  4EJW A;  3O2P E;  4I0A A;  5LHI A;  2V1D A;  1MKM A;  3W6J B;  3LAJ A;  3WE2 A;  4CHU A;  5D5W B;  3QAH A;  2QVO A;  1YO5 C;  3BRO A;  3V7R A;  3KLN A;  5FFX A;  3NQO A;  2IJL A;  5FGM A;  4ZYD A;  3G73 A;  1XCB A;  1R1U A;  2GA1 A;  4M74 A;  1BC8 C;  3MWM A;  3R6S A;  1B9N A;  5FO5 A;  2MLK A;  5AIQ A;  4A12 A;  1AWC A;  3FMR A;  1YW8 A;  2VE9 A;  1SD7 A;  1U6G A;  1YS6 A;  4KFC A;  2PMH A;  2UXX A;  3RDI A;  4EGZ A;  1O3R A;  5HVQ C;  3LAP A;  1X3U A;  2EB7 A;  1P4X A;  1JE8 A;  1R23 A;  3U1D A;  4RB3 C;  1QBJ A;  1ZLK A;  5DCM B;  1RUO A;  1F5T A;  1JHF A;  1IN8 A;  5HS7 A;  1TNS A;  4BAY A;  2FRH A;  5D5X B;  2FSW A;  2CO5 A;  1DP7 P;  3JTG A;  3ELK A;  2EFW A;  3LA2 A;  4PZJ A;  4O3M A;  2VT2 A;  4O6J A;  1IN7 A;  1EH6 A;  4EM0 B;  3U9G A;  3RTR A;  5K1Y A;  5A2Q Z;  1S8N A;  4RB1 A;  2J5P A;  2KIM A;  1IN6 A;  2JZY A;  1HKQ A;  3L00 A;  4BHB A;  5HS9 A;  3ZPL A;  5J6X A;  3GX4 X;  5F64 A;  2HS5 A;  5LRS A;  3HUG A;  1ZG3 A;  3RKW A;  3BOQ A;  1SFE A;  5JI6 A;  4Q48 A;  3ML6 A;  2E7W A;  4U0V A;  2ZME A;  4L9T A;  2GAU A;  1ZHF A;  5JHU A;  3HOT A;  1D8J A;  2DTR A;  2QQ9 A;  1KGS A;  3OV8 A;  4L18 B;  1Z1D A;  2CSO A;  2DAO A;  4UVB A;  3F6O A;  2CWE A;  4XSZ F;  1R00 A;  3HTS B;  2STT A;  2PQ8 A;  5E20 A;  3IRR A;  5HOO A;  3R0J A;  5KVR A;  3TDZ C;  3ULQ B;  4EQQ A;  4KT5 C;  1F1Z A;  2HDC A;  4U0W A;  3RKY A;  4IF4 A;  3VOE A;  5LGU A;  1MD0 A;  3MZY A;  1ON2 A;  2WV0 A;  3KP3 A;  3J7A O;  4CDG A;  2H94 A;  2GZW A;  4UXN A;  3V8K A;  3GFJ A;  1IUY A;  1IW7 F;  1RNL A;  2FML A;  3ZMV A;  2DW4 A;  5AIP A;  2XKO A;  2QEN A;  5CVR A;  3CUO A;  4RAZ A;  2M30 A;  1G3W A;  2HKO A;  3GUD A;  1ZAO A;  4R8H A;  1P4W A;  3WGG A;  2K4J A;  2XGX A;  3L2C A;  2DPU A;  3ZMT A;  2YSR A;  2JPB A;  3MCZ A;  2H6B A;  1LDD A;  4L0Z B;  2ESH A;  5CVJ A;  4ON0 A;  1T0F A;  4B8X A;  1GHC A;  5K5O A;  4LG0 A;  3JAM K;  3ERE D;  1IRG A;  4HLY A;  5D5U B;  2BYV E;  2R3S A;  1XSD A;  3CUQ C;  4A0X A;  2HEO A;  3DF8 A;  2LF7 A;  4ZYE A;  4LB6 B;  3RJP A;  4GGG A;  5DDG A;  1PDN C;  3WGH A;  1IXR C;  3F72 A;  2LDU A;  2A07 F;  3WG9 A;  2IT0 A;  1OMI A;  4LD5 A;  2XV4 S;  5CYV A;  5D8L B;  2XRO A;  4IJA A;  2YX7 A;  2DQL A;  3E3V A;  4UUV A;  2V6C A;  4OIN F;  2Q2E A;  1BIA A;  4OIO F;  4JBA A;  2FBI A;  3M1E A;  2MH2 A;  1U2W A;  1F9N A;  1FSE A;  5H6Q A;  2FA5 A;  4RGS A;  1G3Y A;  1B9M A;  4Q4Z F;  4UVA A;  5IT9 Z;  4MEX F;  5E1W A;  2ETH A;  3ABT A;  1R1T A;  5EEG A;  2OU2 A;  1KQ0 A;  5CVV A;  4M6Y A;  3T5X A;  4ZYG A;  3KCC A;  1GXP A;  5E8I A;  1J5Y A;  4FT8 A;  5CVU A;  3KP4 A;  1J59 A;  1FYK A;  1K78 A;  1D3Y A;  4MHG A;  4KIF A;  1QGP A;  3TGN A;  4HQE A;  4GO1 A;  3JSO A;  5LHG A;  2TDX A;  2ZNY A;  1B59 A;  1K6O A;  1U78 A;  1TQI A;  4UV8 A;  2NYX A;  1FZP B;  1U3E M;  2ZNZ A;  3I59 B;  1W5S A;  3QRF F;  3DPT A;  2MLG A;  3F3X A;  2CGP A;  4M9S A;  1WI9 A;  2ZCW A;  4M71 A;  4IRH A;  2L01 A;  2L4A A;  3V7C A;  5L3E A;  3ABU A;  4I01 A;  3TO9 A;  1H0M A;  3KP6 A;  1RIO H;  3ISP A;  4U0Y A;  1U5T C;  5J8C A;  4L9J A;  4CIC A;  5ICC A;  5ED4 A;  2FNP A;  3LST A;  3VOD A;  3GFM A;  4DQ2 A;  2FBK A;  4ZH4 F;  4A5M A;  1MGT A;  3GF2 A;  4YIF A;  2Y48 A;  5BS6 A;  2W85 A;  2EK5 A;  2AXL A;  4M6X A;  5JR3 A;  1W7P D;  2P6T A;  1BI1 A;  1Z05 A;  2XKP A;  2UWM A;  4HX4 A;  4AVP A;  3WTU C;  2HFH A;  5HDN A;  4HQM A;  4LFU A;  3QOP A;  2BEO A;  4IHT A;  1YTY A;  1U5T A;  5HLH A;  1BOA A;  1T39 A;  3ZN0 A;  3Q9S A;  2IPQ X;  1HKS A;  1LQ1 A;  2IA1 A;  4KN7 X;  3GWZ A;  4PGG A;  1NHA A;  3R4K A;  2L02 A;  2A6E F;  3QU3 A;  2W25 A;  4P5O A;  1XSX A;  2HR3 A;  5F6F A;  2NRA C;  5HLG A;  1R22 A;  4TV7 A;  2ADU A;  3IWZ A;  2F5F A;  1FNN A;  5L3B A;  1HXD A;  3HTU A;  3O3K A;  2R7F A;  3E5X A;  5L3F A;  4XBF A;  3B73 A;  4Q47 A;  1KU3 A;  4Q5S F;  1MJA A;  3P9K A;  2RGV A;  3DFG A;  4FHT A;  3KZY A;  4HX8 A;  3F8F A;  5DV5 A;  4FX4 A;  2NNY A;  1I5Z A;  3SZP A;  1LNW A;  5FLX K;  5J8F A;  1ZRC A;  3K1N A;  4U88 A;  2J5O A;  2A69 F;  4P9F A;  2GWR A;  1O3Q A;  3K0L A;  2CFX A;  4XLP F;  1TQP A;  4WX9 A;  1SD5 A;  1UFM A;  3L7W A;  3FHZ A;  2UZK A;  2A68 F;  1KA8 A;  2KRF A;  3IKT A;  4EJO A;  5E18 F;  1D8K A;  3J81 Z;  4NHJ A;  3BJA A;  1IXS B;  1OR7 A;  4MQV A;  3LWF A;  1ZLJ A;  4KNY A;  2PG4 A;  3KP7 A;  5D6E A;  2HOE A;  2VC0 A;  1SMT A;  2GXG A;  5BPI A;  4WCG A;  5LEK A;  1FYL A;  1Q1H A;  1ZGA A;  4KDP A;  4EJT A;  4UHT A;  3R60 A;  1J7K A;  3GFI A;  1L0O C;  3H3U A;  4M73 A;  4ENN A;  4HV5 A;  4CO8 A;  3LA7 A;  4MEY F;  1O7L A;  3TOB A;  1CF7 B;  1LJ9 A;  3RYP A;  4KUM A;  1R5H A;  3WTV C;  2EA4 A;  4P9U A;  4U7B A;  2NNN A;  3MZH A;  2EFO A;  5TRD A;  4N9H A;  2EJR A;  2GA2 A;  3GXO A;  2ZXJ A;  1XD7 A;  5FB2 A;  3P7N A;  4OIQ F;  1IN5 A;  5ILU A;  2OZU A;  1BI3 A;  3KFW X;  2RNJ A;  2P4W A;  2EV6 A;  1JXS A;  2MA3 A;  2M5W A;  1BI2 A;  4WK8 F;  2RKH A;  3ECO A;  4FX0 A;  2C6Y A;  2VT3 A;  4S04 A;  1KYZ A;  2KJC A;  2H6C A;  4KIG A;  4L9N A;  1SMY F;  5LGT A;  3U2R A;  3TOA A;  1FC3 A;  4B09 A;  3RKX A;  4G94 A;  3CO7 C;  1YYV A;  3P9C A;  2P5V A;  3VFZ A;  5L3C A;  3C1D A;  1S6L A;  1Y0U A;  3BY6 A;  1MDM A;  2OZ6 A;  5D8K B;  1T2K A;  4MNU A;  5KK1 A;  1QQI A;  2WC2 A;  1KQ9 A;  4LB5 A;  2XAH A;  2XRN A;  3WOD F;  2FQ3 A;  4BHC A;  2GQQ A;  1UHW A;  3QP6 A;  3KE2 A;  5DUI A;  4G7O F;  4WXH A;  2VBY A;  2ISZ A;  3EQL F;  4LGW A;  1UB9 A;  1Z6T A;  2L54 A;  1T6S A;  3ECH A;  3C18 A;  6PAX A;  2DQR A;  2KIU A;  5LGN A;  1HW5 A;  4EGY A;  2PEX A;  3F6V A;  4OIP F;  3I5U A;  4I98 B;  4XRF A;  1CF7 A;  4RS8 A;  3E6D A;  3HRS A;  2E7X A;  2HTS A;  4I09 A;  3E6M A;  1XGM A;  1XMA A;  2FNA A;  2O6G E;  1LB2 A;  3GZ5 A;  4N0B A;  5FD5 A;  2EFP A;  1YG2 A;  5BQT A;  4U7D A;  2P7C B;  4EJU A;  2B0L A;  2QBY B;  1ZN2 A;  3D0S A;  2WWY A;  1YQA A;  5E1Z B;  2YPR A;  2ELH A;  2DBB A;  3JW4 A;  3V7S A;  1S7O A;  1O3S A;  3DXJ F;  3E5Q A;  2XVC A;  2XUB A;  2Y75 A;  2PN6 A;  4ZZL A;  4ETS A;  4IHS A;  2QYO A;  2KJB A;  2OAZ A;  3RI4 A;  4KYW A;  2QUF A;  2WTE A;  5JVT A;  2K4B A;  2Z9O A;  4PGH A;  1G3T A;  4G6D A;  3J80 K;  1ZAR A;  1ZRE A;  1L3L A;  4A2U A;  1HW1 A;  1I27 A;  2VN2 A;  3WTY C;  1FSH A;  4HAM A;  3FMQ A;  3JTH A;  1OYW A;  1HW2 A;  2ZO4 A;  2BBY A;  2VE8 A;  4Y15 A;  2E1N A;  1H9G A;  2CYY A;  3DP7 A;  1SD6 A;  4OMY A;  2XIG A;  5DUK A;  1IN4 A;  3FXU A;  5ICE A;  1V3F A;  3F8B A;  3JAM Z;  2KIF A;  3FM3 A;  5DYM A;  4KMF A;  2JPC A;  4HDU A;  5CLS A;  4OU0 A;  4EM2 A;  1B6A A;  2V1U A;  4RAY A;  2A61 A;  2VBZ A;  2Z99 A;  2BGC A;  3DV8 A;  2OQG A;  4YII A;  3FXR A;  4UVC A;  4G7H F;  2IA0 A;  1K79 A;  1G6N A;  3HIF A;  3HRU A;  4ASN A;  1FP2 A;  2HYG D;  1B1B A;  3HSF A;  4YFX F;  1LDJ A;  2VON A;  1TNT A;  1REP C;  1BI0 A;  2F5E A;  1GXQ A;  3SZT A;  4IVN A;  1ULY A;  1V4R A;  2R7D A;  3L09 A;  2YX4 A;  2D1H A;  2QWW A;  3PQJ A;  2RN7 A;  1YFH A;  1I1G A;  3IKV A;  1QZZ A;  2G7U A;  3T0Y A;  1BIB A;  3IWF A;  1FLI A;  1W5T A;  3TO7 A;  3QPT A;  5DEQ A;  4CZZ A;  4MTE A;  4MTD A;  2VOD A;  1D5V A;  2P8T A;  3RPU A;  5LBQ A;  3NEU A;  3T1B A;  1FT9 A;  1DDN A;  2V1X A;  3LA3 A;  4I0B A;  4ESF A;  3T8R A;  4HLX A;  2G9W A;  4RB2 C;  4A5N A;  1S29 A;  2IA2 A;  3ZN1 A;  1H9T A;  2Z5U A;  4XSX F;  1YW7 A;  3HHH A;  1FOK A;  4HF0 A;  3K69 A;  2OBP A;  4HZF A;  3K2Z A;  1J9I A;  3IRQ A;  4AIK A;  2K27 A;  3I64 A;  2O0Y A;  4Y17 A;  2NS0 A;  2P5K A;  2Q8K A;  1CGP A;  3SXY A;  2QQB A;  1QNT A;  3H92 A;  4KMU X;  5HDG A;  1T38 A;  5AON A;  3KP2 A;  4I02 A;  1XDS A;  1UCR A;  5K5R A;  2M1B A;  3D5L A;  1PP8 F;  3ZMZ A;  3CDH A;  2LKP A;  4WXC A;  3OOP A;  4A0Z A;  5CJ9 A;  5LEJ A;  1R5G A;  3LQR A;  2ACJ A;  1FBS A;  4ENM A;  2MH9 A;  4EMS A;  1IZ1 A;  1KQ8 A;  1ZH5 A;  1VTN C;  2PBI A;  5HLI A;  1DPR A;  2G7H A;  1RUN A;  3TQN A;  1XGS A;  1FP1 D;  2EV0 A;  3ZMS A;  1C0W A;  3ROU A;  1GVJ A;  2DPD A;  4ESJ A;  4NQW A;  3WTZ A;  5D4S A;  4HF2 A;  1XGO A;  4RB0 A;  2ZFW A;  2X0L A;  4IRG A;  5IT3 A;  2IP2 A;  2DT5 A;  1LEA A;  2QZ8 A;  3LQQ A;  2VOO A;  3RYR A;  1OYY A;  1XCV A;  1W4M A;  1A04 A;  5L3D A;  3I0T A;  4OOI A;  1FY7 A;  4KN4 X;  3E6C C;  1WRJ A;  1EH7 A;  3KZZ A;  3J80 Z;  5E8G A;  3TO6 A;  2EWN A;  1XSV A;  1FWZ A;  5BPD A;  2P7V B;  2HYF A;  1YW9 A;  3IHU A;  3EYI A;  3GLX A;  2UXN A;  3EDP A;  3N97 A;  4H0E A;  1BJA A;  2L4M A;  4AIH A;  3BWG A;  1P2F A;  3QU6 A;  3DQV C;  4P96 A;  1BN5 A;  1FBQ A;  1USS A;  1WQ2 A;  1UST A;  1JGS A;  4PDK A;  1Z91 A;  2VBX A;  2HTJ A;  2RVC A;  2DK5 A;  4R79 A;  4G7Z F;  3F8M A;  2OQR A;  2QLZ A;  1QZY A;  1LDK B;  5ICF A;  4BXU A;  1G3S A;  4M9X A;  1XMK A;  3T8T A;  3BP8 A;  1E2X A;  4N9I A;  5BMZ A;  1XN7 A;  4I7H A;  2O3F A;  1I1S A;  1EV7 A;  4WWC A;  5DD4 A;  5DCM A;  1SFU A;  4BH9 A;  2MC3 A;  3F8N A;  4AD9 A;  1QO0 D;  4JK1 X;  3KEQ A;  2Y0M A;  3GYH X;  4HDV A;  2DFI A;  3K1P A;  3B02 A;  2JSC A;  2KKO A;  2PI0 A;  1W7P A;  3EET A;  4BNC A;  4L5J A;  3FM5 A; 
#chains in the Genus database with same CATH topology
 4F55 A;  3HOV J;  4A6E A;  4CH7 A;  1KYW A;  3PUF A;  2KIQ A;  1IC8 A;  2DTZ A;  1R7J A;  1SVM A;  1OCP A;  1FBU A;  1R9T J;  4NB5 A;  1AKH A;  1BBY A;  2GBY A;  2M0M A;  3SFZ A;  4QIW N;  4UB6 C;  4CUG A;  3PQK A;  3HRT A;  1FX7 A;  2EA2 A;  1B72 A;  1JKQ C;  2Q2E B;  3BJ6 A;  2COM A;  4NQW B;  2H1K A;  2D2W A;  2VC1 A;  4G6T B;  3U1K A;  2R7X A;  2HQR A;  1MJ9 A;  2PFB A;  3OYL A;  2M7A A;  1STZ A;  4QLC U;  3CP2 A;  2N8G A;  3ZCO A;  1FYM A;  2FXA A;  1IV8 A;  3CES A;  3MZ8 A;  1MNE A;  2X1E A;  2MG4 A;  5ERI A;  2JA6 J;  2YU9 J;  3CUQ A;  4S0H B;  3K10 A;  4BAC A;  1ZKG A;  3PFI A;  4IHW A;  1Z0X A;  4I2O A;  4UNO A;  2K9M A;  4BXF A;  1X58 A;  1Z6R A;  2BVL A;  2LRD A;  3ABK H;  1VFC A;  4J01 A;  2K40 A;  4YFN F;  2F48 A;  4B48 A;  1HBX G;  4FCY A;  2XAS A;  1F4K A;  2RV8 A;  2CG4 A;  2DI3 A;  2HQN A;  2XRL A;  3WHC A;  4F7Z A;  3LNQ A;  1BM9 A;  3M8E A;  4A3E J;  4RGU A;  1BR2 A;  4IXA A;  3OYB A;  4Y13 A;  2R4G A;  3FMS A;  1HKT A;  3BR1 A;  1AOY A;  4M72 A;  4HX7 A;  2O03 A;  3IC7 A;  3PO2 J;  2JT1 A;  2FEZ A;  3I4M J;  2LLK A;  1I50 J;  5EEA A;  1HQC A;  1YOV B;  3O6B B;  3M4O J;  3HSR A;  1B4A A;  4E70 A;  1I3Q J;  3F21 A;  1B8I A;  3FZV A;  4L5I A;  2OC6 A;  4DNC A;  5LRR A;  3HYI A;  3S2W A;  5F0F A;  1SAN A;  1HSJ A;  1Z3X A;  3QP5 A;  4EM1 A;  4JX5 A;  3AL0 C;  2JVG A;  1JUS A;  3I53 A;  1ORK A;  3TKY A;  1QPM A;  2EH3 A;  3FXJ A;  3F22 A;  4K2E A;  1IXC A;  2ZJ2 A;  5C3E J;  2CW0 F;  4X6A J;  3WTW C;  4RGR A;  2XAJ A;  3M8J A;  1R36 A;  1ZGJ A;  1W36 C;  2W57 A;  1KU9 A;  3JRF A;  3EUH A;  3G3Z A;  2HOT A;  1U5T B;  2K9N A;  4XLN F;  4HV6 A;  3S3O A;  1P4A A;  2O5R A;  3RPQ A;  3BLY A;  5GPA A;  4Y52 J;  2DMU A;  2HQA A;  4O5V A;  3W6K B;  4BU2 A;  2F2E A;  3K9T A;  2X4H A;  4LLL A;  2DOD A;  1D1C A;  1SVL A;  4IKF A;  4BHP A;  2M34 A;  5FLM J;  2R92 J;  3V4G A;  4HSR A;  3M7G A;  2D45 A;  1IRF A;  4L0Y B;  1WWX A;  4UY8 I;  1ODD A;  4A93 J;  2EFN A;  3CTA A;  3WU0 A;  1JUP A;  2JMW A;  1YLF A;  2AS5 F;  1KU2 A;  1O57 A;  2ESN A;  4A3M J;  1YIT I;  2IVM A;  4ZZD A;  2K02 A;  2OCE A;  1MH3 A;  1DU6 A;  2FBH A;  1P92 A;  1GV2 A;  2HPM A;  2LG4 A;  5IOZ A;  3S14 J;  2PJP A;  3ZQL A;  1VQN I;  5IT9 K;  5C4J J;  4ZDP A;  5F0H A;  3A0H C;  2CW8 A;  4G6Q A;  3SDB A;  5LLQ A;  2NVQ J;  1N75 A;  2H09 A;  3KLO A;  2P5L C;  3COA C;  1IAW A;  1ZK8 A;  1JKP C;  3DU6 A;  1WSU A;  1TW2 A;  2VQC A;  3ZGK A;  2JRM A;  2IS1 A;  3CF2 A;  4BL0 B;  3HSE A;  4AM3 A;  2MD5 A;  4XN3 A;  5GAD J;  1SAX A;  4ZYH A;  2QKL B;  2BV6 A;  2E35 A;  3CCS I;  3E5U A;  2WY8 Q;  2W7N A;  1BR4 A;  5CQG A;  3KZI C;  1IGN A;  2GXB A;  2K9L A;  2VKH A;  1RET A;  2HNH A;  3GZN B;  2OV7 A;  3WE3 A;  3KEO A;  1XB4 A;  4J00 A;  2WAE A;  4HW0 A;  4QSH A;  5E1X A;  5DTD A;  2Y2Z A;  3H3Z A;  3FX3 A;  2PX9 A;  3I59 A;  3FXQ A;  1YS7 A;  3BG7 A;  2L3D A;  3E6B A;  2E71 A;  2XPU A;  3MQ0 A;  3TW6 A;  4M9Z A;  5EZG A;  1E3P A;  1H89 C;  1ZQ3 P;  1JHH A;  1TQM A;  1SFK A;  1R5I D;  3G71 I;  1OCO H;  1JI8 A;  3CUQ B;  2F6C A;  5K7H A;  3C7J A;  4OIR F;  3DTI A;  3JRH A;  3ZQC A;  2M45 A;  1R4M B;  2XHK A;  3FF5 A;  1ONV A;  1VQ7 I;  1VF9 A;  2VOP A;  3ZP5 A;  5H6R A;  2L0K A;  1Z7L A;  2P81 A;  3ZQ7 A;  4LIT A;  3TW7 A;  4D0P A;  2V79 A;  4S05 A;  4CCL A;  2E1M B;  4LMY A;  2KRC A;  3H5A A;  3OL4 A;  2JWT A;  4PJM A;  1VQK I;  5C4X J;  3L2R A;  4BBS J;  2QSG X;  3FK6 A;  4EV0 A;  2MGQ A;  2GOM A;  3S3M A;  1NK3 P;  2M8E A;  3TBI A;  4CGZ A;  3REO A;  2WA0 A;  4HBL A;  4GYG A;  2GIV A;  4QWQ A;  2ME6 A;  1TW3 A;  2ICW G;  2PMU A;  1ZR4 A;  4KIB A;  3JR9 A;  4CXF A;  2BE5 F;  2W84 A;  3SEQ A;  2CQK A;  5FFZ A;  1P9Q C;  2W24 A;  3AG3 H;  3ZMD A;  2OTL I;  2JUG A;  1MW7 A;  3WGI A;  2O8X A;  3ZMU A;  1W7P B;  3F23 A;  3IL2 A;  1SAU A;  5TJJ A;  3BPX A;  4RGX A;  3GFL A;  1LVA A;  4IPA A;  3S1M J;  4PFO A;  1ETY A;  3SFI A;  2ZBK A;  1QHH D;  3TDU C;  1MZB A;  4LLG F;  4XOR A;  3HRM A;  1GT0 C;  1ETK A;  2IRF G;  3LSR A;  4HA8 A;  2CUZ A;  2HVQ A;  3L2W A;  3IP4 B;  3DKX A;  2ME0 A;  4MFD A;  1BJZ A;  2RC4 A;  2LY1 A;  2QM3 A;  5EG0 B;  4P1W A;  4CA0 A;  3BJO A;  4ESB A;  1ZG5 A;  4BEH A;  1S3J A;  5J47 A;  2Q0O A;  3DPL C;  1OKR A;  2KT0 A;  4LLN A;  3MKZ A;  1PUE E;  4ENJ A;  1EH8 A;  2FMY A;  5D6F A;  1QU3 A;  5E3M A;  3H35 A;  3KYL A;  3CO6 C;  2R7W A;  4GRI A;  3DKW A;  3V42 A;  1YRN B;  2XF7 A;  4XR6 A;  3QPH A;  2VKV A;  4V2F A;  2AXT C;  4ABZ A;  1EKE A;  2P0W A;  2IW5 A;  1MJB A;  2FE3 A;  2CQX A;  3EUH C;  1WJ5 A;  2XAG A;  3VB2 A;  4CYD A;  3BT9 A;  1V5E A;  2E34 A;  3KET A;  1OPC A;  2HZT A;  3HOZ J;  2AHQ A;  1VI0 A;  4R1H A;  5LHH A;  1VQ4 I;  3GO5 A;  1K7A A;  4MQ9 F;  2XGD A;  2VBW A;  3IH2 A;  4RM2 A;  3BZ6 A;  1MND A;  1XGN A;  1DUX C;  2EIJ H;  4CCM A;  4RLQ A;  4LG0 B;  3HHG A;  2OD5 A;  3PM1 A;  1LUJ B;  3IUO A;  2X1C A;  4BE0 A;  1RKT A;  1YIO A;  3ZRG A;  3X2Q H;  5HNH A;  3I71 A;  4AIJ A;  2CQ7 A;  4D9J A;  2B7E A;  3BDD A;  3GVA A;  5B1A H;  2OTJ I;  1TLH B;  3QQA A;  4PJN A;  2LF8 A;  4II2 A;  3CLO A;  2JRT A;  2L7F P;  3EYY A;  3H5N A;  4ZC3 A;  3OOU A;  3LSK A;  2RAE A;  4DW6 A;  4I6Z A;  1PUF B;  4D7N A;  3M9A A;  1J75 A;  4Z2Y A;  2ZME C;  2WAQ N;  3KP5 A;  4AWX B;  1K78 B;  3HOS A;  3MN2 A;  3DTE A;  3OYC A;  2XAQ A;  1UHM A;  1T98 A;  2XPW A;  4ENK A;  4A3J J;  4XLH A;  3SQN A;  3PJR A;  3OL3 A;  4DYR A;  2O61 A;  1SFO J;  1T08 B;  1Z9C A;  4N4N B;  4IOA F;  5J3L A;  2DDB A;  2A6H F;  1R6R A;  2EV5 A;  1BR1 A;  1S9H A;  3NRV A;  5DD8 A;  4AVZ A;  2Y9Z A;  1WH7 A;  1R1V A;  3VYT B;  4DBQ A;  1A36 A;  3L2U A;  4KIC A;  2Z3Y A;  2XAF A;  1WHU A;  4L9V A;  5K7F A;  2NXN B;  5EEH A;  2LBF B;  3BPV A;  4G9Y A;  5L3G A;  1JTY A;  1TTY A;  2I5U A;  3QWL A;  3M8F A;  1OFC X;  1RZ4 A;  5IYB J;  4RBO A;  4BEH B;  3JSP A;  4WF2 A;  5FD6 A;  2E36 A;  4XOP A;  2YR2 A;  3ZQH A;  5H20 A;  5EG0 A;  5CVI A;  2FOK A;  4HOB A;  1GVD A;  2RDP A;  2Y9Y A;  1FOW A;  2F5C A;  3FXK A;  3V8J A;  3HUG B;  3G6E I;  1U8R A;  5E3O A;  3S2H J;  1TWF J;  3PSF A;  2R7V A;  1I6X A;  3HM5 A;  1HST A;  2ID6 A;  4E4H A;  1KU7 A;  2W00 A;  2NAZ A;  3QPS A;  1ZG1 A;  2K3F A;  5F1R A;  2H27 A;  1MBG A;  2Y0S A;  1FOX A;  3ABL H;  1OIS A;  4P55 A;  4XLE A;  1G4D A;  4A6D A;  2DA5 A;  2CRG A;  4GXO A;  4EJV A;  4M6V A;  1XDU A;  3MFK A;  1MDM B;  2QKM B;  1JT6 A;  1LEB A;  2VJ5 A;  1WVR A;  2K7L A;  3B6A A;  1WKM A;  3HBL A;  3CMY A;  1DU0 A;  1E3H A;  3MMY B;  4E7I A;  4LK0 F;  2DO7 A;  4PCQ A;  4Y3O A;  2V6E A;  2BY1 A;  5JFR A;  3WTX C;  2EBI A;  1JGG A;  2ISY A;  1V5G A;  2QQA A;  1E17 A;  2HGC A;  2DLL A;  3RIR A;  5K5Q A;  3L9F A;  2ZME B;  5A2Q K;  4IQ4 A;  1AHD P;  4LK1 F;  2EZL A;  4YFK F;  2EFQ A;  2KFD A;  3OYJ A;  3I58 A;  3CJN A;  4DYQ A;  3IAS 2;  5FLX Z;  3F8C A;  2O7O A;  3CF5 F;  2XB5 A;  3AAF A;  5TGT A;  2LNB A;  4YG2 F;  1NH3 A;  4BJT A;  3D5S C;  3G1M A;  5J1U A;  1X4P A;  2Z2S B;  3DLL F;  4GYI A;  5DCF A;  4XKC A;  2F5D A;  2RQP A;  1O3T A;  3BZC A;  2E1C A;  4LJZ F;  4CYC A;  1ZRF A;  2I8D A;  1XX5 A;  4KA4 A;  3WTS C;  2JTV A;  3OYH A;  1X2N A;  1GV5 A;  2A5Y B;  2MBF A;  2CUE A;  5TIS C;  2NVY J;  2DU9 A;  4BQA A;  2YU3 A;  3P9I A;  3J81 K;  2VQH A;  2ZSI B;  3V8L A;  2A3S A;  2K86 A;  3G1O A;  5HDK A;  2Z33 A;  2VJJ A;  3QYF A;  1O7F A;  2D1V A;  2DK8 A;  3E97 A;  4XRS G;  4ZJZ A;  3BTL A;  3VEP A;  5HS8 A;  2DA1 A;  2EIK H;  2HKX A;  5IP9 J;  3C3W A;  1JKO C;  2NOJ B;  4HYE A;  4A3K J;  2IGK A;  3Q5F A;  2CQN A;  3SYT A;  3CCV I;  3CD6 I;  3GW2 A;  2VXZ A;  4MO7 A;  1WI3 A;  3I54 A;  4BKX A;  3N4M A;  2STW A;  4EVI A;  4XKW A;  1JJ8 C;  4CCJ A;  3MAJ A;  3ONQ A;  2E2H J;  2KHM A;  2OUM A;  4A0Y A;  4A3B J;  2JA7 J;  4JQF A;  4MGR A;  3D1N I;  2HWV A;  2XSJ C;  5ILV A;  5D4R A;  4XLA A;  5D5V B;  1ON1 A;  3QYB A;  2DT7 B;  5BOX A;  2HDW A;  3GZ6 A;  1OYI A;  1S5L C;  1RI7 A;  2NS7 A;  1ZRD A;  1H88 C;  1NK2 P;  3MVP A;  1IF1 A;  3K6G A;  1U9O A;  4OAY A;  3Q9V A;  2K3P A;  4RLF A;  1SD4 A;  2R5Z A;  1FMV A;  4IRI A;  3K70 C;  3Q0W A;  4E6K G;  1SEU A;  3S1N J;  3WU1 B;  2DMN A;  2P6S A;  4G8X A;  2OA4 A;  2R7S A;  4PK4 A;  3FWE A;  1FMW A;  1DPU A;  1W36 D;  2LSO A;  1HLV A;  4H4K C;  1V5F A;  2PLY A;  3R61 A;  1MBJ A;  3GEZ A;  1SFX A;  3HL2 A;  1OCR H;  4GCV A;  4BYY A;  4RDU A;  3WTT C;  5E3L A;  5ICG A;  3O8G A;  1Y0N A;  2E2J J;  3UR3 C;  2M87 A;  3OIQ A;  1S7A A;  2XB0 X;  1UMQ A;  2FF4 A;  2RNG A;  1MBF A;  2V9V A;  3I4P A;  1D0Z A;  2W4S A;  3GTG J;  3R0A A;  4UV9 A;  2M7B A;  4OMZ A;  1TBX A;  3DPU A;  1D5Y A;  3KYC B;  2M4G A;  1FEX A;  5IY5 H;  1R58 A;  1LE8 B;  2R5Y B;  3G1L A;  1CQT A;  3UKG A;  3EPZ A;  1J2X A;  5IPA A;  4IO9 F;  5GTH C;  5JHF A;  2XF6 A;  3K1M A;  5EZH A;  1ZGW A;  3SHF A;  1GUU A;  1Z7U A;  1QVU A;  2NS8 A;  2DJN A;  3LFK A;  4I99 C;  4BQQ A;  1YHQ I;  2ZKZ A;  3KIO A;  2ELK A;  5ILS A;  1QPI A;  1EJ9 A;  3HPG A;  1T0F C;  4HF1 A;  3OYA A;  2VI6 A;  4FTH A;  1X19 A;  1PP7 U;  1R71 A;  3G4S I;  4LG3 A;  1J0R A;  1FPQ A;  1FJL A;  5E17 F;  2QBY A;  2GOX B;  3LSM A;  1P6R A;  1WCM J;  4WXD A;  4F91 B;  3DEU A;  1QZE A;  3QOE A;  3HOU J;  4NUB A;  2FU4 A;  4BDY A;  3MEX A;  3AG4 H;  2E5Z A;  2W1O A;  3OR2 C;  2PJR A;  1BC7 C;  4XRM A;  2DJI A;  4EAT A;  2L5Q A;  1ZYR F;  5FKN A;  4EJW A;  3O2P E;  4I0A A;  5LHI A;  2R5Y A;  3GTL J;  1F43 A;  3BR0 A;  2V1D A;  1MKM A;  3W6J B;  4LIV A;  1DQU A;  2E5N A;  3LAJ A;  4BDZ A;  2EZK A;  3WE2 A;  1MSE C;  2H8R A;  3Q0V A;  5JLX A;  4CHU A;  5D5W B;  1YI2 I;  3QAH A;  2QVO A;  1YIJ I;  5GP9 A;  2CV0 A;  1TT5 B;  4KJZ A;  1YO5 C;  3BRO A;  3V7R A;  3KLN A;  5FFX A;  5HNF A;  1Y6I A;  3NQO A;  2IJL A;  5FGM A;  4ZYD A;  2VJ4 A;  2JN6 A;  1XCB A;  2GA1 A;  1R1U A;  3G73 A;  2BZT A;  4M74 A;  3OYD A;  1IO2 A;  1X1P A;  1BC8 C;  3MWM A;  3R6S A;  2LRE A;  1B9N A;  3BR2 A;  5FO5 A;  4AC0 A;  2MLK A;  5AIQ A;  4A12 A;  1MMD A;  1AWC A;  3FMR A;  5GPC A;  4C2U A;  2LKX A;  1YW8 A;  2VE9 A;  4PSX A;  1SD7 A;  2XGC A;  1U6G A;  2CV1 A;  2DA3 A;  2F5V A;  1N78 A;  1YS6 A;  2DMT A;  4KFC A;  2NVX J;  2PMH A;  2UXX A;  3BQY A;  2E2I J;  3RDI A;  5EF6 A;  4EGZ A;  2LYC A;  2IGN A;  1O3R A;  4NDL A;  5HVQ C;  2JSP A;  3OYK A;  3LAP A;  1X3U A;  2EB7 A;  2L9R A;  1FTZ A;  1P4X A;  2RRE A;  3S1R J;  3PO3 J;  2VIX A;  5B5E C;  1JE8 A;  1R23 A;  3U1D A;  2WB1 N;  4RB3 C;  1QBJ A;  1ZLK A;  3JRC A;  5DCM B;  1RUO A;  1G59 A;  1F5T A;  2L9N A;  1JHF A;  3S2D J;  1WJE A;  2M0C A;  1IN8 A;  2VKE A;  2YUS A;  1P7J A;  4IHX A;  5HS7 A;  1TNS A;  4BAY A;  1T8I A;  2LTP A;  3OYG A;  1GDT A;  2FRH A;  5D5X B;  3IH4 A;  3J7A Y;  2FSW A;  1OCT C;  2CO5 A;  1DP7 P;  2V7F A;  4RA2 A;  3JTG A;  3ELK A;  2R7Z J;  2EFW A;  4ZTJ A;  3LA2 A;  2VLA A;  4PZJ A;  5LD2 C;  4O3M A;  4XN0 A;  2VT2 A;  3A01 A;  2MFZ A;  4A3G J;  4O6J A;  1IN7 A;  1EH6 A;  4M3G A;  4EM0 B;  3U9G A;  3RTR A;  1XPX A;  5K1Y A;  4BBR J;  1VQ9 I;  2DMP A;  1U8B A;  2DOE A;  4Y7N J;  5A2Q Z;  1S8N A;  1T33 A;  3GTM J;  4RB1 A;  4A3I J;  2J5P A;  2KIM A;  2M9H A;  2GXA A;  1ETX A;  1IN6 A;  4XID A;  2JZY A;  1HKQ A;  4B43 A;  3L00 A;  2VPR A;  3CCR I;  2BVM A;  3CMA I;  2KP6 A;  4BHB A;  5HS9 A;  3ZPL A;  3CC4 I;  5CKT A;  5J6X A;  3GX4 X;  5F64 A;  2HS5 A;  2CH0 A;  5LRS A;  2MW8 A;  1ZG3 A;  3HUG A;  3RKW A;  3H1C A;  1YX5 A;  2WV1 A;  2B63 J;  3BOQ A;  4IZZ A;  1SFE A;  1MBK A;  2A6T A;  5JI6 A;  4MLO A;  2MD0 A;  4Q48 A;  4QTR A;  2ELJ A;  3ML6 A;  2E7W A;  4U0V A;  4XL9 A;  2ZME A;  3B6C A;  4L9T A;  1VQM I;  2VQG A;  2MAB A;  2GAU A;  2G0E A;  2LMD A;  2GLO A;  3ZQI A;  1ZHF A;  2CQQ A;  3BR5 A;  5JHU A;  3HOT A;  1D8J A;  1WJF A;  3S1Q J;  5HLT A;  2DTR A;  2R7R A;  2QQ9 A;  1W5C C;  1KGS A;  3QPL A;  2NVT J;  1A35 A;  3OV8 A;  4L18 B;  3W3C A;  3A0B C;  3OYE A;  1Z1D A;  2CSO A;  5FLV A;  1UHS A;  2DAO A;  1WJB A;  4UVB A;  3F6O A;  5EDN A;  2E19 A;  2CWE A;  1MBH A;  4XSZ F;  2Z16 A;  4M3E A;  3NWS A;  1R00 A;  3MD2 A;  5HOD A;  2O8K A;  5E20 A;  2PQ8 A;  3IRR A;  2STT A;  3HTS B;  4D7M A;  5HOO A;  3R0J A;  5KVR A;  3TDZ C;  2KL4 A;  3ULQ B;  4EQQ A;  4KT5 C;  3GTO J;  1F1Z A;  4LIU A;  1TC3 C;  2KZG A;  3CDI A;  2H1L A;  2HDC A;  3KX2 A;  3JRB A;  4LOC A;  4U0W A;  3RKY A;  4IF4 A;  3VOE A;  3BC8 A;  2K85 A;  2CUF A;  3RSN A;  5LGU A;  1MD0 A;  2HZD A;  2EZI A;  1LFP A;  3MZY A;  1ON2 A;  2WV0 A;  3KP3 A;  2CV2 A;  4B3X A;  3J7A O;  4CDG A;  2H94 A;  4HNT A;  1K6Y A;  2GZW A;  1X3W B;  4UXN A;  3DLA A;  3V8K A;  3JRE A;  3GFJ A;  2DFF A;  3DCF A;  4BQO A;  1Y8Q B;  1IUY A;  1IW7 F;  1RNL A;  2FML A;  3ZMV A;  2DW4 A;  5AIP A;  5EGO A;  2XKO A;  3K2A A;  2QEN A;  5CVR A;  3CUO A;  3DU5 A;  4RAZ A;  5KNL A;  1I6H J;  4E7S A;  2M30 A;  3K70 D;  1G3W A;  2HKO A;  3GUD A;  1ZAO A;  3W2W A;  4KIT B;  4V2G A;  4DJA A;  4R8H A;  1AA7 A;  3RZD J;  4AID A;  1P4W A;  4PJL A;  2XGE A;  2R7U A;  1OCC H;  3LSG A;  1JJ6 C;  3ASO H;  4FIS A;  3FXL A;  2K4J A;  4JYK A;  3WGG A;  4CZC A;  3GTQ J;  1WJA A;  2XGX A;  3L2C A;  2DPU A;  3ZQQ A;  1Z67 A;  3ZMT A;  2YSR A;  1WGX A;  3LL7 A;  3AKZ A;  4M3B A;  2JPB A;  3MCZ A;  2H6B A;  3D5R C;  1UJ8 A;  1LDD A;  4L0Z B;  2ESH A;  5CVJ A;  4ON0 A;  1T0F A;  3F0C A;  4B8X A;  2E1O A;  1TWG J;  2V9P A;  1GHC A;  5K5O A;  4LG0 A;  3H3V K;  3JAM K;  1LFB A;  2Y0S N;  3ERE D;  3OYF A;  4HLY A;  1IRG A;  4IHV A;  3OIP A;  5D5U B;  2BYV E;  5C44 J;  2R3S A;  2X1D A;  2QQ8 A;  1XSD A;  1W0U A;  3CCJ I;  3CUQ C;  4A0X A;  5M3F J;  3DF8 A;  2HEO A;  2LF7 A;  3OS2 A;  4ZYE A;  5J1Y A;  5IP6 A;  1E0E A;  4NBQ A;  5FKO A;  5F0C A;  4LB6 B;  3RJP A;  4CSW A;  3GBG A;  3ASN H;  4GGG A;  5DDG A;  1PDN C;  3H36 A;  3H5R A;  3WGH A;  1IXR C;  3F72 A;  2LDU A;  2A07 F;  1BW6 A;  4KT6 A;  4E7L A;  2MC4 A;  5KHD A;  5J4V A;  3WG9 A;  3FXM A;  3LMM A;  1OMI A;  3ZQG A;  2IT0 A;  4LD5 A;  3JRA A;  2XV4 S;  3GTJ J;  5CYV A;  5D8L B;  3BTC A;  3A4C A;  4IJA A;  3VPR A;  2QF7 A;  2YX7 A;  2XRO A;  2JA8 J;  2DQL A;  3E3V A;  4UUV A;  2V6C A;  4OIN F;  2Q2E A;  1X1B A;  2BW3 B;  1BIA A;  2QA4 I;  4OIO F;  4JBA A;  2FBI A;  1N25 A;  4MIM A;  3M1E A;  2FX0 A;  2MH2 A;  1U2W A;  1F9N A;  1FSE A;  3GLL A;  3J7Y J;  1JT0 A;  3PNT A;  1K83 J;  5H6Q A;  4BXX J;  2FA5 A;  4CCN A;  4M3F A;  4RGS A;  1G3Y A;  3RQI A;  2FQ4 A;  1B9M A;  2KRH A;  4Q4Z F;  4UVA A;  4C3J J;  3HG9 A;  1U0J A;  1BA5 A;  5IT9 Z;  4MEX F;  2FOW A;  5E1W A;  2ETH A;  3ABT A;  2JQ7 A;  1R1T A;  4GFB A;  1LVK A;  5EEG A;  2KQR A;  2OU2 A;  1KQ0 A;  3DBH B;  5CVV A;  4ITV A;  1LPQ A;  2BY3 A;  4M6Y A;  2CMP A;  3T5X A;  3SZG A;  4ZYG A;  4C3H J;  3JRD A;  1TL8 A;  3KCC A;  1GXP A;  5E8I A;  1J5Y A;  3TMO A;  1G2H A;  1SVO A;  4FT8 A;  5CVU A;  3KP4 A;  2M3A A;  4C9Y A;  1J59 A;  1FYK A;  1K78 A;  1D3Y A;  3IAM 2;  4MHG A;  3E1S A;  1TP4 A;  1QGP A;  4KIF A;  3TGN A;  1Z77 A;  4BJ6 C;  4HQE A;  2WB1 A;  4GO1 A;  3DWL E;  2HPI A;  4IOC F;  3JSO A;  5LHG A;  2TDX A;  2ZNY A;  1B59 A;  2X51 A;  5K7Z A;  1K6O A;  2R7O A;  5CQE A;  3GTP J;  5M5W J;  3CDL A;  2EIL H;  4A3F J;  1U78 A;  2HDD A;  1TQI A;  4UV8 A;  2NYX A;  3OSF A;  1FZP B;  2ECB A;  4XKB A;  4ZYA A;  2LK2 A;  2M8G X;  2KPM A;  1U3E M;  2ZNZ A;  4B4C A;  1X1D A;  2OCC H;  3I59 B;  1W5S A;  3QRF F;  1DGR M;  3DPT A;  1PYV A;  2MLG A;  3F3X A;  5FKL A;  2CGP A;  2LD5 A;  4FAS D;  3OSG A;  4M9S A;  4A3D J;  1WI9 A;  4ZDO A;  2ZCW A;  4YEJ A;  4M71 A;  4IRH A;  2L01 A;  2L4A A;  3V7C A;  1RRJ A;  5L3E A;  4RMN A;  4XLC A;  3ABU A;  4I01 A;  3TO9 A;  3MKL A;  4UUT A;  3KP6 A;  3PFY A;  3ISP A;  1RIO H;  1H0M A;  4U0Y A;  2YS9 A;  3HC7 A;  4UUS A;  1IJW C;  5IOY A;  1U5T C;  4CIC A;  4L9J A;  5J8C A;  5ICC A;  5J1R A;  5ED4 A;  2ID3 A;  3I55 I;  2E1M C;  2FNP A;  2HI3 A;  2Y30 A;  3LST A;  3GFM A;  3RCO A;  3VOD A;  2Z1D A;  3VSK A;  2FBK A;  4DQ2 A;  4XNF A;  4A69 C;  3EUA A;  1NTC A;  1T56 A;  4ZH4 F;  4A5M A;  1WFX A;  1WJD A;  1MGT A;  3GF2 A;  4YIF A;  2Y48 A;  3JRI A;  3QYE A;  5BS6 A;  2W85 A;  2CJJ A;  2EK5 A;  4W1U A;  3GCM A;  2AXL A;  1IRX A;  2X85 A;  3A03 A;  4M6X A;  1YJN I;  5JR3 A;  1W7P D;  1WH5 A;  2P6T A;  3HOX J;  1A5J A;  1BI1 A;  1OR7 C;  3I9V 2;  4XK4 A;  1Z05 A;  4XOT A;  4Y4R A;  2XKP A;  2UWM A;  3OS0 A;  4UUS B;  3C2B A;  4HX4 A;  4AVP A;  3WTU C;  2XDV A;  2MSY A;  2F4O B;  1HOM A;  2HFH A;  5HDN A;  3IV5 A;  4HQM A;  2WY7 Q;  4LFU A;  3QOP A;  2BEO A;  5B1B H;  4IHT A;  1YTY A;  2FJ1 A;  3OYI A;  1U5T A;  5HLH A;  1ETQ A;  1BOA A;  4B1R A;  1T39 A;  3ZN0 A;  3TP3 A;  2DYS H;  3OMY A;  3Q9S A;  2IPQ X;  1HKS A;  4W97 A;  4AYB N;  1LQ1 A;  2Q1Z B;  3ZXS A;  2IA1 A;  4KN7 X;  3GWZ A;  4PGG A;  1NHA A;  2ZJR F;  5M5Y J;  3R4K A;  2KMU A;  2L02 A;  2ZB9 A;  2A6E F;  3DEE A;  2W25 A;  3QU3 A;  5F04 A;  4M3D A;  1X2M A;  4P5O A;  1XSX A;  2HR3 A;  5F6F A;  2NRA C;  4I76 A;  5HLG A;  3FIW A;  1R22 A;  2TCT A;  4E7K A;  4TV7 A;  2ADU A;  3IWZ A;  1TT0 A;  2F5F A;  1S72 I;  2QSH X;  2X6Y A;  1FNN A;  4RM3 A;  4XKV A;  4PSW A;  5L3B A;  1HXD A;  2VJI A;  4PJ0 C;  2IXS A;  3HTU A;  2HVS A;  1Y1W J;  3O3K A;  2R7F A;  2LY9 A;  1J09 A;  2QSF X;  3E5X A;  5L3F A;  3HEF A;  4XBF A;  3S16 J;  4BE1 A;  3H9J A;  1HC8 A;  2BHY A;  3B73 A;  4Q47 A;  1KU3 A;  3S17 J;  4Q5S F;  1MJA A;  4F92 B;  1M1E B;  2W82 A;  3L2Q A;  3P9K A;  1XG1 A;  2RGV A;  1MH4 A;  2KDZ A;  3DFG A;  1IV6 A;  2L7K A;  4FHT A;  3KZY A;  2V26 A;  4HPQ A;  3CP8 A;  3SDG A;  2DA2 A;  4HX8 A;  1ITY A;  1RC9 A;  9ANT A;  1ZR2 A;  1WJC A;  2VAS A;  3F8F A;  2K9Q A;  3LFU A;  5DV5 A;  4FX4 A;  2NNY A;  1I5Z A;  3LSP A;  3SZP A;  1IG7 A;  1PJR A;  1LNW A;  5FLX K;  4PJJ A;  5J8F A;  4IX7 A;  3K1N A;  1ZRC A;  4U88 A;  1B72 B;  2J5O A;  2QCO A;  2A69 F;  4P9F A;  1TWH J;  5E79 C;  2GWR A;  1O3Q A;  1MMA A;  3CLQ A;  3K0L A;  2CFX A;  4XLP F;  1TQP A;  2AQE A;  4WX9 A;  2GM4 A;  1SD5 A;  3RQ4 A;  1UFM A;  3L7W A;  4YIR X;  3E0J B;  5IP7 J;  3FHZ A;  2UZK A;  3TED A;  3RZO J;  1A6I A;  2A68 F;  4XQF A;  3LSH A;  4PFP A;  1KA8 A;  3IH3 A;  1FIP A;  4L5E A;  2KRF A;  3IKT A;  4EJO A;  2L7M P;  5GAH J;  1D8K A;  5E18 F;  3F9K A;  3J81 Z;  2B9S A;  1GLN A;  3VSL A;  4NHJ A;  3BJA A;  1IXS B;  3HOW J;  2DXI A;  1OR7 A;  4MQV A;  3NAR A;  3LWF A;  1ZLJ A;  1IDY A;  5EJC A;  4KNY A;  1P7I A;  2PG4 A;  1AU7 A;  2R0Q C;  2R7Q A;  3KP7 A;  3HB9 A;  5D6E A;  2HOE A;  2Y69 H;  1RPW A;  2VC0 A;  1SMT A;  2GXG A;  3K4M A;  5BPI A;  1FOY A;  5LEK A;  4WCG A;  3HOY J;  2X6W A;  1FYL A;  1FTT A;  3A02 A;  1Q1H A;  1QHG A;  1W1W E;  3BCB A;  3TP0 A;  3W2A A;  1ZGA A;  1IRZ A;  4EJT A;  4KDP A;  4UHT A;  3R60 A;  4X0G A;  5JVG F;  1J7K A;  1I39 A;  3S93 A;  4GDF A;  3GFI A;  5JLW A;  1L0O C;  3H3U A;  4M73 A;  4ENN A;  4HV5 A;  1MMS A;  3PL8 A;  1A31 A;  3ZOB A;  2PJR B;  3CMM A;  4CO8 A;  3LA7 A;  4MEY F;  3CCM I;  2IS6 A;  1O7L A;  3TOB A;  1CF7 B;  3N05 A;  1ETW A;  1LJ9 A;  1IDZ A;  5FKM A;  3RYP A;  4KUM A;  2L2O A;  4U87 A;  1R5H A;  3WTV C;  2EA4 A;  4P9U A;  3K4J A;  3K4L A;  3BCA A;  4U7B A;  2NNN A;  3MZH A;  2DFE A;  4FQG A;  1UZC A;  2BY0 A;  2DOA A;  5F1J A;  2EFO A;  5TRD A;  4N9H A;  2EJR A;  2GA2 A;  3GXO A;  1D1B A;  2ZXJ A;  1XD7 A;  5FB2 A;  3P7N A;  4OIQ F;  1IN5 A;  5ILU A;  2OZU A;  1BI3 A;  2D5V A;  4XM3 A;  3KFW X;  2E60 A;  1G8X A;  1OQY A;  2RNJ A;  2P4W A;  4A3L J;  1RR7 A;  4OWR B;  1LE8 A;  2EV6 A;  5FKK A;  1JXS A;  2MA3 A;  2M5W A;  5FRN A;  1BI2 A;  2UV1 A;  4WK8 F;  2RKH A;  3ECO A;  4FX0 A;  2M4K A;  2WAQ A;  2C6Y A;  3C2G A;  2VT3 A;  2VB6 A;  4S04 A;  2JA5 J;  5FRM A;  3O8H A;  2W48 A;  1KYZ A;  2KJC A;  2H6C A;  3I3L A;  4KIG A;  2HOA A;  4L9N A;  3K4N A;  3PIO F;  1SMY F;  1V54 H;  3KYD B;  4DBR A;  5J4Y A;  3U2R A;  5LGT A;  5EYR A;  3TOA A;  1FC3 A;  4B09 A;  1K61 A;  4XIC A;  3RKX A;  4G94 A;  4XON A;  2EIN H;  3CO7 C;  2K9S A;  3KEY A;  1YYV A;  3P9C A;  2P5V A;  1N77 A;  2DA4 A;  3VFZ A;  5L3C A;  2F4I A;  2TRT A;  2ZXI A;  3C1D A;  1S6L A;  3GME A;  1Y0U A;  3BY6 A;  1MDM A;  2OZ6 A;  4C2T A;  1DGW Y;  3S15 J;  5D8K B;  3WG7 H;  5DS9 A;  1YE9 A;  3FIS A;  1JTX A;  1T2K A;  4MNU A;  2JUC A;  5KK1 A;  2AQF A;  1QQI A;  2WAD A;  3W6V A;  2WC2 A;  1Y1V J;  1OLT A;  5M3M J;  1NG7 A;  1MBE A;  3AG2 H;  1KQ9 A;  4LB5 A;  2XAH A;  2XRN A;  2LVS A;  5B3S H;  3WOD F;  2DA7 A;  2FQ3 A;  2XSD C;  2I10 A;  4BHC A;  2GQQ A;  1UHW A;  3S8P A;  4ZDL A;  2DYR H;  3QP6 A;  3KE2 A;  1R49 A;  2VXD A;  5DUI A;  2LC2 A;  4HG2 A;  4NC8 A;  2BOL A;  4G7O F;  4X1E A;  4WXH A;  2VBY A;  3FBI B;  3FDY A;  4FE7 A;  3WU2 C;  3EQL F;  2ISZ A;  1DP3 A;  5F08 A;  1TZL A;  4LGW A;  2HXO A;  2JVH A;  1UB9 A;  1Z6T A;  1MIJ A;  2L54 A;  1EA3 A;  1T6S A;  2X9D A;  4NNJ A;  5FRO A;  2KDO A;  4A3C J;  3ECH A;  1VQ8 I;  3C18 A;  6PAX A;  4B3A A;  2DQR A;  3BTJ A;  2KIU A;  5LGN A;  3VWB A;  1HW5 A;  4EGY A;  2PEX A;  1Y56 A;  1ZTR A;  4CCO A;  3F6V A;  4OIP F;  3I5U A;  1UG2 A;  4I98 B;  1TWA J;  4XRF A;  1CF7 A;  4RS8 A;  3E6D A;  1ACI A;  3HRS A;  2E7X A;  2EZH A;  1K4S A;  1UEL B;  3BG6 A;  2VL8 A;  2HTS A;  4I09 A;  3A2K A;  2BHZ A;  5KCM A;  3E6M A;  1XGM A;  3L1P A;  1XMA A;  2FNA A;  2O6G E;  1D0X A;  1LB2 A;  2VUM J;  3GZ5 A;  3DKY A;  3NAU A;  4N0B A;  5FD5 A;  2EFP A;  1YG2 A;  5BQT A;  4U7D A;  2P7C B;  1PVE A;  1POG A;  2B0L A;  3FHN A;  3VYR B;  4EJU A;  2QBY B;  1ZN2 A;  1ENH A;  3D0S A;  5IYD J;  2WWY A;  1YQA A;  2OJE D;  5E1Z B;  2YPR A;  4E7H A;  1Y39 A;  1VND A;  3BR6 A;  2ELH A;  2UUZ A;  1UG0 A;  2DBB A;  1JKR C;  3SEZ A;  3JW4 A;  3V7S A;  2BW3 A;  1S7O A;  2BXY A;  1O3S A;  5EGO B;  3DXJ F;  3HXL A;  3E5Q A;  2XVC A;  3OY9 A;  2XUB A;  2Y75 A;  4IHY A;  2PN6 A;  4ZZL A;  4ETS A;  1WZ2 A;  1MMN A;  2Y31 A;  3CME I;  4IHS A;  2QYO A;  2KJB A;  4Z6Y A;  2OAZ A;  3UNG C;  4ANJ A;  4JX4 A;  3RI4 A;  1MMG A;  4QPQ A;  4KYW A;  2DT6 A;  5J40 A;  4YEL A;  1QA6 A;  2QUF A;  2HQ5 A;  3AG1 H;  2WTE A;  2PMZ A;  4HNU A;  3EUK L;  2XF5 A;  3CCQ I;  5JVT A;  3BQZ A;  3CJQ B;  4F52 A;  2K4B A;  2Z9O A;  4PGH A;  1G3T A;  4J19 A;  4G6D A;  3J80 K;  1ZAR A;  1HF0 A;  2L7Z A;  1ZRE A;  1L3L A;  4A2U A;  1HW1 A;  2ZJQ F;  1I27 A;  3HJE A;  4B47 A;  2VN2 A;  3WTY C;  3RKQ A;  1YX3 A;  1LKX A;  3BR3 A;  2JK3 A;  1FSH A;  1S7E A;  4HAM A;  1D0Y A;  3FMQ A;  1OYW A;  3JTH A;  4BY1 J;  1HW2 A;  2ZO4 A;  2XAU A;  2DFH A;  2HU9 A;  2BBY A;  4DOZ A;  3M1C A;  1BL0 A;  2VE8 A;  4Y15 A;  1VQ6 I;  2GIZ A;  2E1N A;  1H9G A;  4IQJ A;  2CYY A;  3DP7 A;  4NC6 A;  2R5Z B;  1SD6 A;  4OMY A;  1I3A A;  4B44 A;  4XRS A;  2XIG A;  1KON A;  3HGG A;  4E7J A;  1LFU P;  5DUK A;  4AUX A;  1IN4 A;  3FXU A;  5ICE A;  2BY2 A;  2KIS A;  1V3F A;  3CCY A;  2X48 A;  4F93 B;  1W0T A;  3F8B A;  2OPT A;  3JAM Z;  4EEF G;  3VYU B;  2KIF A;  3FM3 A;  2IS4 A;  5DYM A;  4DZP A;  1X3Z B;  4BE2 A;  5CPR B;  4KMF A;  2JPC A;  4F3Q A;  1ZEL A;  5CLS A;  4HDU A;  3G2B A;  4OU0 A;  2XC7 A;  3WHB A;  4C30 A;  2O9L A;  3AFH A;  3CZ6 A;  1B6A A;  4EM2 A;  5DM6 F;  3PUB A;  3W2V A;  3BZK A;  4JOM A;  2V1U A;  4FET A;  4RAY A;  1WPK A;  2A61 A;  2VBZ A;  2Z99 A;  2BGC A;  3DV8 A;  3HKZ N;  2OQG A;  4YII A;  2LH9 A;  3FXR A;  1F36 A;  4UVC A;  4IL6 C;  4DGW B;  4G7H F;  2IA0 A;  3S3N A;  1K79 A;  1G6N A;  3PIP F;  2JJ7 A;  3HIF A;  3MKY B;  3HRU A;  4ASN A;  1X1A A;  1FP2 A;  2HYG D;  1B1B A;  3FKI J;  3U21 A;  5GAE J;  3AL0 B;  1QRY A;  1X4O A;  2V9K A;  3HSF A;  2IGM A;  1HDP A;  3DBL B;  4RAG A;  4YFX F;  1LDJ A;  1Z21 A;  1VQP I;  2VON A;  1TNT A;  2QEX I;  1ERD A;  2IS2 A;  1REP C;  3C2H A;  1BI0 A;  2F5E A;  1H8A C;  1RES A;  2QGU A;  2NVU B;  3QOD A;  1GXQ A;  3SZT A;  4IVN A;  1ULY A;  1V4R A;  1FIA A;  4BY7 J;  2R7D A;  2YX4 A;  3L09 A;  2D1H A;  3BG9 A;  2QWW A;  3PQJ A;  3S32 A;  5DM7 F;  2RN7 A;  2DN0 A;  2KZV A;  4E7Z A;  1O4X A;  1YFH A;  1XTA A;  3PNY A;  1VQO I;  4BGD A;  1ETV A;  4D5C A;  2MYS A;  1I1G A;  4HEA 2;  4JX6 A;  2ZFU A;  2EPF A;  3IKV A;  1QZZ A;  2G7U A;  3VYS B;  3T0Y A;  1BIB A;  2CFO A;  3IWF A;  2R7T A;  1FLI A;  3H9G A;  3ABM H;  1W5T A;  3TO7 A;  3QPT A;  3JRG A;  3BG5 A;  4DZJ A;  4RAF A;  1U9N A;  5DEQ A;  3Q3S A;  4CZZ A;  2CW7 A;  4MTE A;  4MTD A;  2VOD A;  2RQQ A;  1D5V A;  3CJT B;  3PSI A;  2P8T A;  3RPU A;  5LBQ A;  5E3N A;  3NEU A;  4II3 A;  3CCE I;  2X6X A;  3T1B A;  4CCK A;  1FT9 A;  1DDN A;  2V1X A;  3LA3 A;  4I0B A;  1RR8 C;  2ZC2 A;  4ESF A;  3LSJ A;  3T8R A;  4DIQ A;  4HLX A;  2G9W A;  2WAF A;  3HZJ A;  5GTI C;  1OCZ H;  4RB2 C;  4A5N A;  1S29 A;  2IA2 A;  1MNM C;  3OWT A;  2R93 J;  3FK7 A;  3ZN1 A;  1Y8R B;  1H9T A;  2LOO A;  2COB A;  2Z5U A;  4XSX F;  1YW7 A;  3HHH A;  3ESW B;  1FOK A;  4HF0 A;  3K69 A;  3CC7 I;  2OBP A;  4CYC B;  3H9Q A;  4HZF A;  3K2Z A;  1JUM A;  1J9I A;  3IRQ A;  4AIK A;  3PNV A;  3H0G J;  2K27 A;  4AYB A;  3I64 A;  2O0Y A;  1XMX A;  2ZJP F;  4Y17 A;  2DCE A;  2NS0 A;  1E3O C;  2P5K A;  3A1Y A;  2Q8K A;  1CGP A;  5B66 C;  3K7A J;  3SXY A;  1NG6 A;  2WBM A;  2QQB A;  5KAI C;  2KLO A;  1QNT A;  3DEW A;  3H92 A;  4KMU X;  5HDG A;  1T38 A;  1X1C A;  5AON A;  3KP2 A;  4FE4 A;  2ZXW H;  4G12 A;  4I02 A;  3ZQF A;  2H8W A;  1XDS A;  4BJ5 C;  1UCR A;  1TWC J;  4OAZ A;  5K5R A;  3D5L A;  2IGO A;  2M1B A;  2F4M B;  4HNV A;  1PUF A;  2OF7 A;  1V55 H;  3J7Z I;  1PP8 F;  3ZMZ A;  1VZ0 A;  3CDH A;  2LKP A;  4WXC A;  2V4J C;  3OOP A;  4BS9 A;  3FXO A;  2IBD A;  4A0Z A;  5CJ9 A;  5LEJ A;  1R5G A;  1APL C;  3LQR A;  2ACJ A;  4HRI A;  1FBS A;  4Y33 A;  4ENM A;  2MH9 A;  3H0D A;  4EMS A;  1IZ1 A;  1HA8 A;  1KQ8 A;  2DMQ A;  1VTN C;  1ZH5 A;  2VPL A;  3E7L A;  2PBI A;  5HLI A;  3DTK A;  2LP0 A;  3BG3 A;  1DPR A;  3CCU I;  2G7H A;  3NWT A;  1OJL A;  1RUN A;  3K4K A;  2IEK A;  3TQN A;  1XGS A;  3CJR B;  1FP1 D;  2DOF A;  2EV0 A;  3ZMS A;  1C0W A;  1MSF C;  3ROU A;  2FD5 A;  2VQL A;  1GVJ A;  2DPD A;  3RPU D;  4ESJ A;  4NQW A;  3WTZ A;  5GAG J;  5D4S A;  4HF2 A;  3A01 B;  1IUF A;  2M2E A;  5KAF C;  3TL4 X;  1XGO A;  4RB0 A;  1BOB A;  2ZFW A;  2X0L A;  4IRG A;  2VKD A;  3CQZ J;  5IT3 A;  3OR1 C;  1YRN A;  2IP2 A;  4C2M J;  2LBF A;  2DT5 A;  1LEA A;  2QZ8 A;  1A6Q A;  2FUG 2;  3LQQ A;  2VOO A;  3RYR A;  1OYY A;  1T95 A;  1XCV A;  2K5C A;  1Z3Y A;  1W4M A;  1SC7 A;  1A04 A;  2V1N A;  2ECC A;  3I0T A;  5L3D A;  3MKW B;  2L9V A;  5BNG A;  4OOI A;  1FY7 A;  5F27 A;  3OYN A;  4KN4 X;  3GTK J;  3E6C C;  2DDA A;  1WRJ A;  1EH7 A;  4PUS A;  3KZZ A;  4V19 K;  1QVT A;  3HDD A;  5M5X J;  3I4N J;  3J80 Z;  1BW5 A;  4BUP A;  5E8G A;  4DYC A;  3TO6 A;  2EWN A;  1XSV A;  4D1Q A;  4NC7 A;  1FWZ A;  3HKZ A;  5BPD A;  2HVR A;  2EQR A;  1ETO A;  5FJ8 J;  2P7V B;  2HYF A;  1YW9 A;  3IHU A;  2A05 A;  3EYI A;  2LKS A;  3GLX A;  3FKJ A;  2UXN A;  4MFE A;  3EDP A;  3N97 A;  4H0E A;  4XLF A;  1D1A A;  1BJA A;  2L4M A;  4AIH A;  3BWG A;  2BXZ A;  1P2F A;  3Q0U A;  3QU6 A;  4UB8 C;  3DQV C;  4P96 A;  1BN5 A;  2HXI A;  3LOC A;  1FBQ A;  4XMY A;  1USS A;  4QPO A;  1WQ2 A;  4KIS A;  3L2V A;  2HYJ A;  1Q1V A;  2NOG A;  1UST A;  1JGS A;  4PDK A;  1Z91 A;  4ZTF A;  2CU7 A;  2HTJ A;  2VBX A;  4D5F A;  2RVC A;  2DK5 A;  4R79 A;  3K4B A;  2IAI A;  4G7Z F;  3I56 I;  1VQ5 I;  3F8M A;  2OQR A;  2QLZ A;  2CUJ A;  4C3I J;  1QZY A;  1K4T A;  1LDK B;  2EIM H;  4IEJ A;  5ICF A;  3FBN B;  2CS3 A;  1G3S A;  2JA2 A;  4BXU A;  4N4O B;  2LFB A;  2PMZ N;  3OIO A;  1EF4 A;  4M9X A;  3JCU C;  1XMK A;  2DA6 A;  2LY2 A;  3P5J A;  3BTI A;  3BP8 A;  3T8T A;  1E2X A;  4N9I A;  4AU7 A;  5BMZ A;  1XN7 A;  3ERM A;  4I7H A;  2O3F A;  1YJ9 I;  1I1S A;  1HCR A;  1XS9 A;  1EV7 A;  1AKH B;  3K4C A;  4WWC A;  2XPV A;  5DD4 A;  2ZSH B;  5DCM A;  1SFU A;  3HPH A;  3DBR B;  4JP0 A;  1XC5 A;  4BH9 A;  2MC3 A;  2A5W A;  3HGY A;  3F8N A;  2X6O A;  4HST A;  1KZH A;  5LFA A;  2AO9 A;  4AD9 A;  1VQL I;  1QO0 D;  4JK1 X;  3ZR8 X;  4YRV A;  3KEQ A;  2Y0M A;  3GYH X;  2ZXH A;  3CC2 I;  1UAA A;  3VDX A;  1B8I B;  3M3Y J;  4HDV A;  1RKW A;  2DFI A;  1YJW I;  1HDD C;  3K1P A;  5H2F C;  3B02 A;  3OYM A;  2JSC A;  2HOS A;  2KKO A;  3CCL I;  2PI0 A;  1W7P A;  3EET A;  4BQN A;  3KPH A;  3SJM A;  3LSI A;  1R4N B;  4BNC A;  2L9S A;  5IYC J;  3OS1 A;  4L5J A;  3FM5 A;  2LR8 A;  3M07 A; 
#chains in the Genus database with same CATH homology
 4A6E A;  1KYW A;  1R7J A;  1FBU A;  4NB5 A;  1BBY A;  3SFZ A;  3PQK A;  3HRT A;  1FX7 A;  2EA2 A;  3BJ6 A;  2COM A;  2D2W A;  2VC1 A;  2HQR A;  1MJ9 A;  2PFB A;  1STZ A;  4QLC U;  1FYM A;  2FXA A;  5ERI A;  3CUQ A;  3PFI A;  4I2O A;  4UNO A;  1Z6R A;  4YFN F;  1HBX G;  2XAS A;  1F4K A;  2RV8 A;  2CG4 A;  2DI3 A;  2HQN A;  4F7Z A;  1BM9 A;  3M8E A;  4RGU A;  4IXA A;  4Y13 A;  3FMS A;  1HKT A;  1AOY A;  4M72 A;  4HX7 A;  2O03 A;  3IC7 A;  2JT1 A;  2FEZ A;  1HQC A;  3O6B B;  3HSR A;  1B4A A;  4E70 A;  3F21 A;  3FZV A;  4L5I A;  4DNC A;  5LRR A;  3HYI A;  3S2W A;  1HSJ A;  3QP5 A;  4EM1 A;  3I53 A;  3TKY A;  1QPM A;  3F22 A;  4K2E A;  1IXC A;  2ZJ2 A;  2CW0 F;  3WTW C;  4RGR A;  2XAJ A;  1R36 A;  1ZGJ A;  2W57 A;  1KU9 A;  3EUH A;  3G3Z A;  1U5T B;  4XLN F;  4HV6 A;  1P4A A;  3RPQ A;  4O5V A;  3W6K B;  2F2E A;  3K9T A;  2X4H A;  4LLL A;  4BHP A;  3V4G A;  3M7G A;  2D45 A;  1IRF A;  4L0Y B;  1WWX A;  1ODD A;  2EFN A;  3CTA A;  3WU0 A;  1YLF A;  2AS5 F;  1KU2 A;  1O57 A;  2ESN A;  2IVM A;  4ZZD A;  2K02 A;  2FBH A;  1P92 A;  2PJP A;  5IT9 K;  4G6Q A;  5LLQ A;  2H09 A;  3KLO A;  2P5L C;  3COA C;  1IAW A;  1WSU A;  1TW2 A;  3HSE A;  2MD5 A;  1SAX A;  4ZYH A;  2BV6 A;  3E5U A;  2GXB A;  3WE3 A;  3KEO A;  1XB4 A;  4HW0 A;  5E1X A;  3H3Z A;  3FX3 A;  3I59 A;  3FXQ A;  1YS7 A;  2L3D A;  3E6B A;  3MQ0 A;  4M9Z A;  1JHH A;  1TQM A;  3CUQ B;  3C7J A;  4OIR F;  2M45 A;  2XHK A;  3FF5 A;  1ONV A;  2VOP A;  3ZP5 A;  5H6R A;  3ZQ7 A;  4D0P A;  2V79 A;  4S05 A;  4LMY A;  4EV0 A;  4CGZ A;  2M8E A;  3REO A;  4HBL A;  4GYG A;  2GIV A;  4QWQ A;  1TW3 A;  2PMU A;  4KIB A;  4CXF A;  2BE5 F;  2W84 A;  2CQK A;  5FFZ A;  2W24 A;  3ZMD A;  3WGI A;  2O8X A;  3ZMU A;  1W7P B;  3F23 A;  3IL2 A;  5TJJ A;  3BPX A;  4RGX A;  3GFL A;  1LVA A;  4IPA A;  2ZBK A;  3TDU C;  1MZB A;  4LLG F;  3HRM A;  2IRF G;  4HA8 A;  2RC4 A;  2QM3 A;  3BJO A;  4ESB A;  1ZG5 A;  1S3J A;  2Q0O A;  3DPL C;  1OKR A;  4LLN A;  1PUE E;  4ENJ A;  1EH8 A;  2FMY A;  5D6F A;  3CO6 C;  3DKW A;  3QPH A;  2IW5 A;  1MJB A;  2FE3 A;  2XAG A;  3VB2 A;  4CYD A;  3KET A;  1OPC A;  2HZT A;  4R1H A;  5LHH A;  3GO5 A;  1K7A A;  4MQ9 F;  2VBW A;  3BZ6 A;  1XGN A;  1DUX C;  4LG0 B;  3HHG A;  2OD5 A;  1YIO A;  3I71 A;  4AIJ A;  3BDD A;  3GVA A;  1TLH B;  2LF8 A;  3CLO A;  2JRT A;  3EYY A;  3M9A A;  1J75 A;  4Z2Y A;  3KP5 A;  4AWX B;  1K78 B;  3HOS A;  2XAQ A;  1UHM A;  1T98 A;  4ENK A;  3SQN A;  2O61 A;  1Z9C A;  2A6H F;  2EV5 A;  3NRV A;  5DD8 A;  1R1V A;  4KIC A;  2Z3Y A;  2XAF A;  4L9V A;  5EEH A;  3BPV A;  4G9Y A;  5L3G A;  1TTY A;  3M8F A;  1RZ4 A;  3JSP A;  4WF2 A;  5FD6 A;  2YR2 A;  5H20 A;  5CVI A;  2FOK A;  4HOB A;  2RDP A;  2F5C A;  3V8J A;  1U8R A;  1I6X A;  1HST A;  1KU7 A;  2NAZ A;  1ZG1 A;  2H27 A;  5F1R A;  4P55 A;  1G4D A;  4A6D A;  4GXO A;  4EJV A;  1XDU A;  3MFK A;  1MDM B;  1LEB A;  2K7L A;  1WKM A;  4LK0 F;  2DO7 A;  4PCQ A;  5JFR A;  3WTX C;  2ISY A;  2QQA A;  1E17 A;  2HGC A;  2DLL A;  3RIR A;  5K5Q A;  3L9F A;  2ZME B;  5A2Q K;  4LK1 F;  4YFK F;  2EFQ A;  3I58 A;  3CJN A;  5FLX Z;  3F8C A;  3AAF A;  2LNB A;  4YG2 F;  4GYI A;  5DCF A;  2F5D A;  2RQP A;  1O3T A;  2E1C A;  4LJZ F;  1ZRF A;  4KA4 A;  3WTS C;  2JTV A;  2A5Y B;  2MBF A;  2DU9 A;  4BQA A;  2YU3 A;  3P9I A;  3J81 K;  3V8L A;  2A3S A;  2K86 A;  5HDK A;  2Z33 A;  1O7F A;  2D1V A;  2DK8 A;  3E97 A;  3VEP A;  5HS8 A;  2HKX A;  3C3W A;  4HYE A;  3Q5F A;  3GW2 A;  2VXZ A;  3I54 A;  3N4M A;  2STW A;  4EVI A;  3MAJ A;  4A0Y A;  4JQF A;  4MGR A;  2HWV A;  5ILV A;  5D4R A;  5D5V B;  1ON1 A;  5BOX A;  3GZ6 A;  1OYI A;  1RI7 A;  1ZRD A;  1IF1 A;  3Q9V A;  1SD4 A;  4IRI A;  3WU1 B;  2P6S A;  4G8X A;  2OA4 A;  3FWE A;  1DPU A;  2LSO A;  2PLY A;  3R61 A;  3GEZ A;  1SFX A;  4GCV A;  4BYY A;  3WTT C;  5ICG A;  2M87 A;  1S7A A;  2FF4 A;  2V9V A;  3I4P A;  3R0A A;  4UV9 A;  4OMZ A;  1TBX A;  1R58 A;  1J2X A;  3K1M A;  3SHF A;  1Z7U A;  3LFK A;  2ZKZ A;  5ILS A;  4HF1 A;  1PP7 U;  1J0R A;  1FPQ A;  5E17 F;  2QBY A;  1P6R A;  4WXD A;  3DEU A;  2FU4 A;  3MEX A;  1BC7 C;  1ZYR F;  4EJW A;  3O2P E;  4I0A A;  5LHI A;  2V1D A;  1MKM A;  3W6J B;  3LAJ A;  3WE2 A;  4CHU A;  5D5W B;  3QAH A;  2QVO A;  1YO5 C;  3BRO A;  3V7R A;  3KLN A;  5FFX A;  3NQO A;  2IJL A;  5FGM A;  4ZYD A;  3G73 A;  1XCB A;  1R1U A;  2GA1 A;  4M74 A;  1BC8 C;  3MWM A;  3R6S A;  1B9N A;  5FO5 A;  2MLK A;  5AIQ A;  4A12 A;  1AWC A;  3FMR A;  1YW8 A;  2VE9 A;  1SD7 A;  1U6G A;  1YS6 A;  4KFC A;  2PMH A;  2UXX A;  3RDI A;  4EGZ A;  1O3R A;  5HVQ C;  3LAP A;  1X3U A;  2EB7 A;  1P4X A;  1JE8 A;  1R23 A;  3U1D A;  4RB3 C;  1QBJ A;  1ZLK A;  5DCM B;  1RUO A;  1F5T A;  1JHF A;  1IN8 A;  5HS7 A;  1TNS A;  4BAY A;  2FRH A;  5D5X B;  2FSW A;  2CO5 A;  1DP7 P;  3JTG A;  3ELK A;  2EFW A;  3LA2 A;  4PZJ A;  4O3M A;  2VT2 A;  4O6J A;  1IN7 A;  1EH6 A;  4EM0 B;  3U9G A;  3RTR A;  5K1Y A;  5A2Q Z;  1S8N A;  4RB1 A;  2J5P A;  2KIM A;  1IN6 A;  2JZY A;  1HKQ A;  3L00 A;  4BHB A;  5HS9 A;  3ZPL A;  5J6X A;  3GX4 X;  5F64 A;  2HS5 A;  5LRS A;  3HUG A;  1ZG3 A;  3RKW A;  3BOQ A;  1SFE A;  5JI6 A;  4Q48 A;  3ML6 A;  2E7W A;  4U0V A;  2ZME A;  4L9T A;  2GAU A;  1ZHF A;  5JHU A;  3HOT A;  1D8J A;  2DTR A;  2QQ9 A;  1KGS A;  3OV8 A;  4L18 B;  1Z1D A;  2CSO A;  2DAO A;  4UVB A;  3F6O A;  2CWE A;  4XSZ F;  1R00 A;  3HTS B;  2STT A;  2PQ8 A;  5E20 A;  3IRR A;  5HOO A;  3R0J A;  5KVR A;  3TDZ C;  3ULQ B;  4EQQ A;  4KT5 C;  1F1Z A;  2HDC A;  4U0W A;  3RKY A;  4IF4 A;  3VOE A;  5LGU A;  1MD0 A;  3MZY A;  1ON2 A;  2WV0 A;  3KP3 A;  3J7A O;  4CDG A;  2H94 A;  2GZW A;  4UXN A;  3V8K A;  3GFJ A;  1IUY A;  1IW7 F;  1RNL A;  2FML A;  3ZMV A;  2DW4 A;  5AIP A;  2XKO A;  2QEN A;  5CVR A;  3CUO A;  4RAZ A;  2M30 A;  1G3W A;  2HKO A;  3GUD A;  1ZAO A;  4R8H A;  1P4W A;  3WGG A;  2K4J A;  2XGX A;  3L2C A;  2DPU A;  3ZMT A;  2YSR A;  2JPB A;  3MCZ A;  2H6B A;  1LDD A;  4L0Z B;  2ESH A;  5CVJ A;  4ON0 A;  1T0F A;  4B8X A;  1GHC A;  5K5O A;  4LG0 A;  3JAM K;  3ERE D;  1IRG A;  4HLY A;  5D5U B;  2BYV E;  2R3S A;  1XSD A;  3CUQ C;  4A0X A;  2HEO A;  3DF8 A;  2LF7 A;  4ZYE A;  4LB6 B;  3RJP A;  4GGG A;  5DDG A;  1PDN C;  3WGH A;  1IXR C;  3F72 A;  2LDU A;  2A07 F;  3WG9 A;  2IT0 A;  1OMI A;  4LD5 A;  2XV4 S;  5CYV A;  5D8L B;  2XRO A;  4IJA A;  2YX7 A;  2DQL A;  3E3V A;  4UUV A;  2V6C A;  4OIN F;  2Q2E A;  1BIA A;  4OIO F;  4JBA A;  2FBI A;  3M1E A;  2MH2 A;  1U2W A;  1F9N A;  1FSE A;  5H6Q A;  2FA5 A;  4RGS A;  1G3Y A;  1B9M A;  4Q4Z F;  4UVA A;  5IT9 Z;  4MEX F;  5E1W A;  2ETH A;  3ABT A;  1R1T A;  5EEG A;  2OU2 A;  1KQ0 A;  5CVV A;  4M6Y A;  3T5X A;  4ZYG A;  3KCC A;  1GXP A;  5E8I A;  1J5Y A;  4FT8 A;  5CVU A;  3KP4 A;  1J59 A;  1FYK A;  1K78 A;  1D3Y A;  4MHG A;  4KIF A;  1QGP A;  3TGN A;  4HQE A;  4GO1 A;  3JSO A;  5LHG A;  2TDX A;  2ZNY A;  1B59 A;  1K6O A;  1U78 A;  1TQI A;  4UV8 A;  2NYX A;  1FZP B;  1U3E M;  2ZNZ A;  3I59 B;  1W5S A;  3QRF F;  3DPT A;  2MLG A;  3F3X A;  2CGP A;  4M9S A;  1WI9 A;  2ZCW A;  4M71 A;  4IRH A;  2L01 A;  2L4A A;  3V7C A;  5L3E A;  3ABU A;  4I01 A;  3TO9 A;  1H0M A;  3KP6 A;  1RIO H;  3ISP A;  4U0Y A;  1U5T C;  5J8C A;  4L9J A;  4CIC A;  5ICC A;  5ED4 A;  2FNP A;  3LST A;  3VOD A;  3GFM A;  4DQ2 A;  2FBK A;  4ZH4 F;  4A5M A;  1MGT A;  3GF2 A;  4YIF A;  2Y48 A;  5BS6 A;  2W85 A;  2EK5 A;  2AXL A;  4M6X A;  5JR3 A;  1W7P D;  2P6T A;  1BI1 A;  1Z05 A;  2XKP A;  2UWM A;  4HX4 A;  4AVP A;  3WTU C;  2HFH A;  5HDN A;  4HQM A;  4LFU A;  3QOP A;  2BEO A;  4IHT A;  1YTY A;  1U5T A;  5HLH A;  1BOA A;  1T39 A;  3ZN0 A;  3Q9S A;  2IPQ X;  1HKS A;  1LQ1 A;  2IA1 A;  4KN7 X;  3GWZ A;  4PGG A;  1NHA A;  3R4K A;  2L02 A;  2A6E F;  3QU3 A;  2W25 A;  4P5O A;  1XSX A;  2HR3 A;  5F6F A;  2NRA C;  5HLG A;  1R22 A;  4TV7 A;  2ADU A;  3IWZ A;  2F5F A;  1FNN A;  5L3B A;  1HXD A;  3HTU A;  3O3K A;  2R7F A;  3E5X A;  5L3F A;  4XBF A;  3B73 A;  4Q47 A;  1KU3 A;  4Q5S F;  1MJA A;  3P9K A;  2RGV A;  3DFG A;  4FHT A;  3KZY A;  4HX8 A;  3F8F A;  5DV5 A;  4FX4 A;  2NNY A;  1I5Z A;  3SZP A;  1LNW A;  5FLX K;  5J8F A;  1ZRC A;  3K1N A;  4U88 A;  2J5O A;  2A69 F;  4P9F A;  2GWR A;  1O3Q A;  3K0L A;  2CFX A;  4XLP F;  1TQP A;  4WX9 A;  1SD5 A;  1UFM A;  3L7W A;  3FHZ A;  2UZK A;  2A68 F;  1KA8 A;  2KRF A;  3IKT A;  4EJO A;  5E18 F;  1D8K A;  3J81 Z;  4NHJ A;  3BJA A;  1IXS B;  1OR7 A;  4MQV A;  3LWF A;  1ZLJ A;  4KNY A;  2PG4 A;  3KP7 A;  5D6E A;  2HOE A;  2VC0 A;  1SMT A;  2GXG A;  5BPI A;  4WCG A;  5LEK A;  1FYL A;  1Q1H A;  1ZGA A;  4KDP A;  4EJT A;  4UHT A;  3R60 A;  1J7K A;  3GFI A;  1L0O C;  3H3U A;  4M73 A;  4ENN A;  4HV5 A;  4CO8 A;  3LA7 A;  4MEY F;  1O7L A;  3TOB A;  1CF7 B;  1LJ9 A;  3RYP A;  4KUM A;  1R5H A;  3WTV C;  2EA4 A;  4P9U A;  4U7B A;  2NNN A;  3MZH A;  2EFO A;  5TRD A;  4N9H A;  2EJR A;  2GA2 A;  3GXO A;  2ZXJ A;  1XD7 A;  5FB2 A;  3P7N A;  4OIQ F;  1IN5 A;  5ILU A;  2OZU A;  1BI3 A;  3KFW X;  2RNJ A;  2P4W A;  2EV6 A;  1JXS A;  2MA3 A;  2M5W A;  1BI2 A;  4WK8 F;  2RKH A;  3ECO A;  4FX0 A;  2C6Y A;  2VT3 A;  4S04 A;  1KYZ A;  2KJC A;  2H6C A;  4KIG A;  4L9N A;  1SMY F;  5LGT A;  3U2R A;  3TOA A;  1FC3 A;  4B09 A;  3RKX A;  4G94 A;  3CO7 C;  1YYV A;  3P9C A;  2P5V A;  3VFZ A;  5L3C A;  3C1D A;  1S6L A;  1Y0U A;  3BY6 A;  1MDM A;  2OZ6 A;  5D8K B;  1T2K A;  4MNU A;  5KK1 A;  1QQI A;  2WC2 A;  1KQ9 A;  4LB5 A;  2XAH A;  2XRN A;  3WOD F;  2FQ3 A;  4BHC A;  2GQQ A;  1UHW A;  3QP6 A;  3KE2 A;  5DUI A;  4G7O F;  4WXH A;  2VBY A;  2ISZ A;  3EQL F;  4LGW A;  1UB9 A;  1Z6T A;  2L54 A;  1T6S A;  3ECH A;  3C18 A;  6PAX A;  2DQR A;  2KIU A;  5LGN A;  1HW5 A;  4EGY A;  2PEX A;  3F6V A;  4OIP F;  3I5U A;  4I98 B;  4XRF A;  1CF7 A;  4RS8 A;  3E6D A;  3HRS A;  2E7X A;  2HTS A;  4I09 A;  3E6M A;  1XGM A;  1XMA A;  2FNA A;  2O6G E;  1LB2 A;  3GZ5 A;  4N0B A;  5FD5 A;  2EFP A;  1YG2 A;  5BQT A;  4U7D A;  2P7C B;  4EJU A;  2B0L A;  2QBY B;  1ZN2 A;  3D0S A;  2WWY A;  1YQA A;  5E1Z B;  2YPR A;  2ELH A;  2DBB A;  3JW4 A;  3V7S A;  1S7O A;  1O3S A;  3DXJ F;  3E5Q A;  2XVC A;  2XUB A;  2Y75 A;  2PN6 A;  4ZZL A;  4ETS A;  4IHS A;  2QYO A;  2KJB A;  2OAZ A;  3RI4 A;  4KYW A;  2QUF A;  2WTE A;  5JVT A;  2K4B A;  2Z9O A;  4PGH A;  1G3T A;  4G6D A;  3J80 K;  1ZAR A;  1ZRE A;  1L3L A;  4A2U A;  1HW1 A;  1I27 A;  2VN2 A;  3WTY C;  1FSH A;  4HAM A;  3FMQ A;  3JTH A;  1OYW A;  1HW2 A;  2ZO4 A;  2BBY A;  2VE8 A;  4Y15 A;  2E1N A;  1H9G A;  2CYY A;  3DP7 A;  1SD6 A;  4OMY A;  2XIG A;  5DUK A;  1IN4 A;  3FXU A;  5ICE A;  1V3F A;  3F8B A;  3JAM Z;  2KIF A;  3FM3 A;  5DYM A;  4KMF A;  2JPC A;  4HDU A;  5CLS A;  4OU0 A;  4EM2 A;  1B6A A;  2V1U A;  4RAY A;  2A61 A;  2VBZ A;  2Z99 A;  2BGC A;  3DV8 A;  2OQG A;  4YII A;  3FXR A;  4UVC A;  4G7H F;  2IA0 A;  1K79 A;  1G6N A;  3HIF A;  3HRU A;  4ASN A;  1FP2 A;  2HYG D;  1B1B A;  3HSF A;  4YFX F;  1LDJ A;  2VON A;  1TNT A;  1REP C;  1BI0 A;  2F5E A;  1GXQ A;  3SZT A;  4IVN A;  1ULY A;  1V4R A;  2R7D A;  3L09 A;  2YX4 A;  2D1H A;  2QWW A;  3PQJ A;  2RN7 A;  1YFH A;  1I1G A;  3IKV A;  1QZZ A;  2G7U A;  3T0Y A;  1BIB A;  3IWF A;  1FLI A;  1W5T A;  3TO7 A;  3QPT A;  5DEQ A;  4CZZ A;  4MTE A;  4MTD A;  2VOD A;  1D5V A;  2P8T A;  3RPU A;  5LBQ A;  3NEU A;  3T1B A;  1FT9 A;  1DDN A;  2V1X A;  3LA3 A;  4I0B A;  4ESF A;  3T8R A;  4HLX A;  2G9W A;  4RB2 C;  4A5N A;  1S29 A;  2IA2 A;  3ZN1 A;  1H9T A;  2Z5U A;  4XSX F;  1YW7 A;  3HHH A;  1FOK A;  4HF0 A;  3K69 A;  2OBP A;  4HZF A;  3K2Z A;  1J9I A;  3IRQ A;  4AIK A;  2K27 A;  3I64 A;  2O0Y A;  4Y17 A;  2NS0 A;  2P5K A;  2Q8K A;  1CGP A;  3SXY A;  2QQB A;  1QNT A;  3H92 A;  4KMU X;  5HDG A;  1T38 A;  5AON A;  3KP2 A;  4I02 A;  1XDS A;  1UCR A;  5K5R A;  2M1B A;  3D5L A;  1PP8 F;  3ZMZ A;  3CDH A;  2LKP A;  4WXC A;  3OOP A;  4A0Z A;  5CJ9 A;  5LEJ A;  1R5G A;  3LQR A;  2ACJ A;  1FBS A;  4ENM A;  2MH9 A;  4EMS A;  1IZ1 A;  1KQ8 A;  1ZH5 A;  1VTN C;  2PBI A;  5HLI A;  1DPR A;  2G7H A;  1RUN A;  3TQN A;  1XGS A;  1FP1 D;  2EV0 A;  3ZMS A;  1C0W A;  3ROU A;  1GVJ A;  2DPD A;  4ESJ A;  4NQW A;  3WTZ A;  5D4S A;  4HF2 A;  1XGO A;  4RB0 A;  2ZFW A;  2X0L A;  4IRG A;  5IT3 A;  2IP2 A;  2DT5 A;  1LEA A;  2QZ8 A;  3LQQ A;  2VOO A;  3RYR A;  1OYY A;  1XCV A;  1W4M A;  1A04 A;  5L3D A;  3I0T A;  4OOI A;  1FY7 A;  4KN4 X;  3E6C C;  1WRJ A;  1EH7 A;  3KZZ A;  3J80 Z;  5E8G A;  3TO6 A;  2EWN A;  1XSV A;  1FWZ A;  5BPD A;  2P7V B;  2HYF A;  1YW9 A;  3IHU A;  3EYI A;  3GLX A;  2UXN A;  3EDP A;  3N97 A;  4H0E A;  1BJA A;  2L4M A;  4AIH A;  3BWG A;  1P2F A;  3QU6 A;  3DQV C;  4P96 A;  1BN5 A;  1FBQ A;  1USS A;  1WQ2 A;  1UST A;  1JGS A;  4PDK A;  1Z91 A;  2VBX A;  2HTJ A;  2RVC A;  2DK5 A;  4R79 A;  4G7Z F;  3F8M A;  2OQR A;  2QLZ A;  1QZY A;  1LDK B;  5ICF A;  4BXU A;  1G3S A;  4M9X A;  1XMK A;  3T8T A;  3BP8 A;  1E2X A;  4N9I A;  5BMZ A;  1XN7 A;  4I7H A;  2O3F A;  1I1S A;  1EV7 A;  4WWC A;  5DD4 A;  5DCM A;  1SFU A;  4BH9 A;  2MC3 A;  3F8N A;  4AD9 A;  1QO0 D;  4JK1 X;  3KEQ A;  2Y0M A;  3GYH X;  4HDV A;  2DFI A;  3K1P A;  3B02 A;  2JSC A;  2KKO A;  2PI0 A;  1W7P A;  3EET A;  4BNC A;  4L5J A;  3FM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...