4QLCU

Crystal structure of chromatosome at 3.5 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
SASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (167-mer)
publication title Structural Mechanisms of Nucleosome Recognition by Linker Histones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chromatin binding protein/dna
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2014-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4qlcU00
3TO6A 2JPBA 3WU1B 1IAWA 2XUBA 2JT1A 2HS5A 4U7DA 1PUEE 5AIPA 3FHZA 1W7PB 3CDHA 3Q5FA 1JHHA 2Z9OA 1OYIA 2HYFA 4KMUX 2V1DA 5HVQC 4M6YA 4RGUA 4HOBA 4I01A 1J7KA 4BHPA 2O61A 1YQAA 2O03A 1J0RA 3DFGA 4FX4A 3CJNA 3J80Z 2ZXJA 3LAPA 4EJOA 4A5MA 1QBJA 4KIGA 1H9TA 3RPUA 2OQGA 4NHJA 2RDPA 3PFIA 4LG0B 2EA2A 3GFJA 3JW4A 1IXCA 4HQEA 3PQJA 1LEBA 1MD0A 4KUMA 4ETSA 1G3YA 5BOXA 4U7BA 3BROA 2EWNA 4EVIA 3L7WA 1O3QA 4O3MA 2O0YA 1U8RA 5HS8A 3FF5A 3K9TA 1GXPA 3ABTA 2XAQA 2BV6A 4HAMA 2WV0A 5FB2A 1EH8A 2XRNA 3K1MA 4M9XA 2RQPA 2HFHA 2VBWA 3PQKA 3DPTA 2P7VB 2HZTA 3U2RA 3BP8A 1QQIA 1QPMA 2JTVA 3HTSB 1R00A 3GYHX 4KN7X 3RJPA 5EEHA 4BHCA 2D2WA 2MLGA 3V8LA 4LK0F 1T39A 2CYYA 2ESNA 1IRFA 1D8JA 3KP5A 4KIFA 2XAFA 2L3DA 2HGCA 3BY6A 5BMZA 1Z1DA 4I0AA 1R36A 1RIOH 3L2CA 1BIBA 1LDKB 4GXOA 2KIMA 3QU6A 4Y13A 4EQQA 2W24A 5D6EA 4IXAA 5JVTA 3WTXC 3DV8A 4G8XA 3V8JA 2IA0A 3WTZA 4HZFA 1BM9A 1MKMA 1ZRCA 1R5GA 1IXSB 3LQRA 4Q4ZF 3T1BA 3HHHA 5LGTA 3F22A 1KU2A 2VODA 1BBYA 5JFRA 1T0FA 3DQVC 1BI1A 5CJ9A 2IT0A 4G7HF 1B59A 2W85A 1ZGAA 4RGXA 2A69F 2FQ3A 3VODA 1WSUA 3HRSA 5DDGA 2BE5F 5E1WA 1KA8A 2E7XA 3I0TA 2EK5A 1UHMA 4MGRA 3N4MA 1C0WA 2UXXA 1ZN2A 2V6CA 1RI7A 3MCZA 1B6AA 4IVNA 1LB2A 1REPC 3H92A 4HX7A 1ZLJA 2ZNYA 2IA1A 2FMYA 4L9TA 2TDXA 1XCVA 2FBKA 2FF4A 2XKOA 2X0LA 2EV6A 2F5CA 1QO0D 2DI3A 2ACJA 4G6QA 3RTRA 4MEXF 5E18F 1F9NA 3RPQA 4LGWA 1R1TA 3RKXA 3L00A 2VE9A 4AIHA 1MGTA 4D0PA 1Z05A 2KJCA 4HW0A 5JI6A 5ED4A 4XLPF 4PZJA 3JAMZ 4XBFA 4HDVA 2CG4A 2X4HA 1TW2A 1DPRA 4KMFA 1KQ9A 3I53A 5L3BA 2DBBA 2EFWA 3MAJA 5L3EA 2CFXA 2M45A 3I59B 2L01A 4KA4A 3VEPA 4BAYA 2QM3A 5E1XA 2QZ8A 2RKHA 4EJVA 2DPUA 1SFXA 2LKPA 1J59A 2M87A 2WC2A 5LRSA 5H6QA 3HYIA 4NB5A 4G7OF 1S29A 1FT9A 2FRHA 3DKWA 1J75A 2BGCA 4YFKF 1XSDA 2Q2EA 1SFUA 1ZRFA 4OIOF 3IWZA 2F5DA 2FBIA 3KEQA 4MQVA 2H6BA 4OINF 5HDNA 4RGSA 4EM1A 4L18B 1Y0UA 2WTEA 2P4WA 1MJAA 2DT5A 3D5LA 3HHGA 3EUHA 2HQRA 1KU3A 2LF8A 4G7ZF 5L3FA 4F7ZA 4EGZA 2ZCWA 2A07F 2OAZA 3EYIA 1FYKA 1ON1A 4IRIA 1BC8C 3FWEA 3ZN0A 3KFWX 1DDNA 1TQIA 1SMYF 4MHGA 4XLNF 1X3UA 3F21A 1KQ0A 2E1NA 2P5KA 3J81K 2VT2A 3F8BA 2G7HA 1Z9CA 3RYRA 4HQMA 2QQ9A 2GZWA 2LSOA 3KZYA 5DV5A 3I64A 3RKYA 4ZYEA 5IT9Z 3FX3A 4FHTA 3WTSC 4OIPF 5DCMA 1XN7A 1ZH5A 3WGIA 4S05A 4WCGA 5E8GA 4P9UA 1YS6A 2VBXA 1ONVA 1OYYA 2QBYA 1IN6A 2NNNA 1ZYRF 3SQNA 3FXQA 3DP7A 1FYLA 2KJBA 2O3FA 2V9VA 3HSFA 2ZMEA 3F8FA 2FNPA 1H0MA 2VBYA 1U5TC 2GA2A 4ON0A 1T98A 1P6RA 1W5SA 4U88A 1WRJA 3BOQA 2XROA 2UZKA 2FBHA 2W84A 4A0YA 5ICGA 1SD5A 4IRGA 1MDMA 3DF8A 4PGHA 1YYVA 5D8KB 1XDUA 4CHUA 2HTJA 1S7AA 4HX4A 1D5VA 4PCQA 5K1YA 4A0ZA 2R7DA 1WKMA 4KN4X 5DUIA 3E3VA 3KLNA 4L5IA 4YFXF 4OMZA 4AIJA 3HUGA 3CUQC 3HSRA 2K86A 2MH9A 5D5VB 3QRFF 3GXOA 1B4AA 3V7CA 5L3CA 3FXRA 2GXBA 1IW7F 4WWCA 3GWZA 3REOA 1U5TA 4LLLA 5IT3A 3KLOA 4WXHA 1IZ1A 3J80K 2R7FA 3L9FA 5BS6A 3WTUC 4ESBA 3BJOA 4JK1X 1RUNA 3CO7C 1HKQA 3HRMA 3V8KA 3EETA 4ZH4F 5HDKA 2DQLA 5HOOA 4H0EA 3C3WA 2M30A 2VOPA 3E6MA 1I6XA 3SHFA 4L9NA 1SFEA 2COMA 3K1NA 2A3SA 1L0OC 4GCVA 2XVCA 1CF7B 4A12A 4QWQA 2XGXA 4EJTA 2HKOA 3CUQA 3LA3A 3MEXA 4M74A 2Y0MA 2P6SA 3IL2A 3I54A 5FFXA 5D8LB 3M8FA 1KGSA 1TLHB 1W7PD 3IWFA 4UVCA 4FT8A 1E17A 5KK1A 4WX9A 3IHUA 1W5TA 2PFBA 4N9HA 4O6JA 4LB6B 4M9SA 3QAHA 1V4RA 2Z99A 3EQLF 4EGYA 1HXDA 1HSTA 1D3YA 1OMIA 3K2ZA 2ZKZA 4MTEA 1LJ9A 3BDDA 4MEYF 3FXUA 3IKVA 4RB2C 3KP4A 1S6LA 5FD5A 2JPCA 4BXUA 4L9JA 1P4AA 1TQPA 3HRTA 4KT5C 2YX7A 3H3ZA 3GFLA 2E7WA 1ZLKA 2RC4A 3QP5A 3WU0A 4CZZA 2NNYA 1MJBA 1XB4A 1GXQA 1GHCA 3TGNA 1H9GA 2L4AA 3IC7A 1BJAA 1MJ9A 3COAC 4U0WA 2RN7A 4CYDA 2DQRA 3EDPA 3LSTA 3N97A 3BWGA 3TO9A 4P96A 1UB9A 1FSHA 3WTWC 2B0LA 1RUOA 3R0JA 5DEQA 2RGVA 3C7JA 3ZP5A 2VC0A 5FLXZ 1R1UA 4GYGA 4EJUA 4U0YA 4YIIA 3Q9VA 4HA8A 1S3JA 5E20A 3RIRA 3NRVA 5D5UB 3AAFA 5ERIA 2XAHA 1I27A 3FM5A 2IVMA 2VE8A 1TTYA 1Z7UA 4ESFA 4IHTA 1JXSA 2ZNZA 2IW5A 5E1ZB 4A0XA 3ZMDA 2PJPA 2CSOA 4XSXF 2PLYA 2IA2A 2RVCA 1AOYA 2F5FA 3JTGA 1XMKA 1QZZA 1JHFA 5FO5A 5CYVA 5H6RA 5JR3A 1HW1A 5LLQA 1R58A 2ETHA 3ELKA 1XGNA 1IXRC 1FBSA 3ZMSA 3JAMK 4L0ZB 3V7SA 5J8FA 2QYOA 1KQ8A 3DEUA 3QP6A 3CLOA 4DNCA 3E6DA 4HF1A 5ILSA 1I1SA 2P8TA 2H09A 2CGPA 4WXCA 4LFUA 3GZ6A 1F1ZA 3ISPA 2D1HA 5L3GA 2JZYA 2D1VA 1FZPB 3F8MA 2DLLA 2ZMEB 1ZAOA 2DU9A 5J6XA 2VC1A 2PG4A 4MNUA 1ODDA 1SD4A 2P6TA 2UXNA 1RNLA 2EFPA 2IPQX 2DK5A 2BEOA 2V1XA 1W7PA 4U0VA 2LNBA 1STZA 3CUOA 2K27A 1SMTA 2YR2A 1WI9A 1HW5A 2HQNA 4BQAA 4S04A 2C6YA 2QQBA 1XCBA 3RKWA 4IF4A 5HLIA 1DUXC 1Z6TA 2GIVA 1K78B 1BI2A 4LLNA 4LG0A 2OQRA 2QUFA 3GEZA 1K6OA 5FGMA 3TQNA 5LHGA 3QU3A 3V4GA 1YO5C 2VXZA 3CTAA 4M72A 1ZG1A 2UWMA 3FMQA 4ZZLA 5ILUA 3GFIA 3ZMVA 3L09A 1U5TB 1BN5A 4N0BA 1MZBA 5BQTA 1LNWA 4HF2A 5IT9K 2IJLA 2KKOA 3IRRA 2Y48A 4B8XA 2EV5A 1JGSA 3F3XA 5D6FA 4L9VA 2HWVA 3C18A 2DW4A 4P55A 2YSRA 1YLFA 2J5PA 3KETA 3SZPA 4RAYA 3GVAA 4GYIA 2A6EF 3I58A 2JRTA 2CW0F 5FFZA 3JSOA 1WWXA 5D4RA 4YIFA 3T8RA 4E70A 4MQ9F 1TNTA 4I09A 4JQFA 4GO1A 1KU9A 4G94A 2MD5A 5D4SA 3VFZA 2M8EA 1SD7A 3K0LA 5LGUA 1Z91A 3NQOA 2MH2A 1LVAA 1P4WA 2ISYA 2J5OA 4JBAA 2ISZA 3LA2A 1UCRA 1XGOA 3HSEA 5H20A 3BZ6A 1O3SA 4ENMA 3ULQB 1FP2A 3P9KA 2NYXA 4KDPA 1XDSA 3GF2A 5HS9A 3WE3A 3GW2A 1PDNC 4HDUA 2XASA 4M9ZA 3MFKA 4R79A 5AONA 2YX4A 1K79A 4RAZA 5F6FA 2RV8A 2GQQA 3LA7A 2CO5A 1O7FA 1T2KA 1K7AA 2HDCA 1FPQA 3M7GA 1HKSA 1I5ZA 3V7RA 4AVPA 4BYYA 4I2OA 1G3WA 1YW9A 1CGPA 2XAGA 5A2QZ 4CDGA 2HR3A 1USSA 2PI0A 1ZREA 4P5OA 1IN7A 2EJRA 2LDUA 3KZZA 1TQMA 1SD6A 3M1EA 4LB5A 3WE2A 2L54A 3ML6A 3C1DA 3ZN1A 2QWWA 3E6CC 2MA3A 3J7AO 3FM3A 2PN6A 4FX0A 4UVAA 2NRAC 4K2EA 1ZARA 1QGPA 1R5HA 4KNYA 2EV0A 1BI3A 2ADUA 5CVJA 1ZG5A 3MZHA 4IJAA 4UUVA 4XSZF 3I59A 1UHWA 1B9NA 3KP2A 2G7UA 1EH7A 2O8XA 5DCFA 3KP7A 2QQAA 5HDGA 2F5EA 2ZBKA 2DFIA 2GWRA 5CVUA 1YG2A 4EM0B 2PEXA 3JSPA 3KP6A 4N9IA 3KP3A 1VTNC 4RB0A 2QVOA 3K1PA 5AIQA 4BNCA 1R23A 3IRQA 1DP7P 2BYVE 2K7LA 1FOKA 4I0BA 3ZMUA 4LLGF 2FSWA 1U6GA 5F64A 4ASNA 4IHSA 2W25A 5CVVA 1XGSA 4HYEA 1ZGJA 1EV7A 4M73A 1BIAA 5HLHA 1U2WA 5BPDA 1P92A 3TKYA 4YFNF 3S2WA 1EH6A 2XHKA 5LHIA 1ZHFA 4EV0A 2G9WA 3HOSA 4HV5A 3P9IA 2F2EA 4O5VA 4M71A 4ENKA 5FLXK 2FA5A 1FBUA 1FP1D 2EFQA 4WXDA 3D0SA 4ENNA 2XIGA 3ROUA 2KIUA 4KFCA 1G3SA 3W6KB 3R60A 4BH9A 1O3TA 4UV9A 3H3UA 1XSXA 1B1BA 2VBZA 2CQKA 2L4MA 5DYMA 4AWXB 1NHAA 2KIFA 4HBLA 1O57A 4EMSA 3WTVC 3I71A 1Q1HA 4ZYDA 3F6VA 4KICA 5EEGA 2VONA 1FY7A 3SZTA 4CO8A 3SFZA 1YS7A 4BHBA 4I7HA 3SXYA 1W4MA 4AD9A 1LDDA 2EB7A 1ULYA 3TDUC 6PAXA 3LQQA 1J2XA 1RZ4A 3ZPLA 2H6CA 3Q9SA 2Q8KA 2WWYA 2HEOA 2Z5UA 5FD6A 4LK1F 2L02A 1XSVA 1USTA 2NAZA 4A2UA 1PP8F 1LEAA 4I98B 4UHTA 5D5WB 1XMAA 3WG9A 4RB1A 5J8CA 3GLXA 2A5YB 3GFMA 1O7LA 3O6BB 3GO5A 4WF2A 1R7JA 2NS0A 1HSJA 3B02A 1BC7C 4PDKA 5CVRA 2MC3A 1OYWA 1R1VA 3LWFA 3BJ6A 3TO7A 3BJAA 3R4KA 2FNAA 2ESHA 3RI4A 1QNTA 1IN5A 4EJWA 3DPLC 4IPAA 2JSCA 4KYWA 3P7NA 3FMSA 2K02A 2HOEA 3P9CA 3O3KA 2QLZA 1LDJA 2OD5A 2AS5F 2P5VA 5JHUA 3B73A 2OA4A 1XGMA 3E5UA 1JE8A 2QENA 4LMYA 3M9AA 3K69A 2FMLA 3ERED 4ESJA 2DAOA 4P9FA 3W6JB 2OZ6A 5DCMB 2D45A 4EM2A 2PMUA 3F72A 1QZYA 1CF7A 1G3TA 2FU4A 3TDZC 4A6EA 2GXGA 3DXJF 3F6OA 2P7CB 4HLXA 5DD8A 2QBYB 1TW3A 4L5JA 1ZG3A 1FSEA 4CICA 1D8KA 4R1HA 2K4BA 2OBPA 2XAJA 2W57A 4UNOA 2Z3YA 2KRFA 5CVIA 3MWMA 2STTA 2O6GE 1OPCA 3WGGA 4HLYA 2YU3A 3E97A 1R22A 3ZMZA 4G9YA 4YG2F 3ZMTA 3ECOA 1MDMB 5F1RA 1YW8A 2MBFA 1E2XA 4Z2YA 2VOOA 3EYYA 4A6DA 2H27A 5D5XB 4NQWA 1P4XA 5CLSA 4ZYHA 4CXFA 1F5TA 1I1GA 2V79A 2FEZA 4OIQF 2HKXA 3BPXA 1HW2A 4XRFA 1Z6RA 4QLCU 5ICCA 2DPDA 4LD5A 1GVJA 1HQCA 5LBQA 1OR7A 1BOAA 5DUKA 3E5XA 4ZYGA 5TRDA 2K4JA 1S7OA 3VB2A 3GX4X 2M5WA 3IKTA 4CGZA 3GUDA 3LAJA 5K5QA 2A61A 3G73A 1KYZA 5K5RA 3KE2A 1KYWA 1O3RA 3T5XA 4RB3C 2A68F 3LFKA 5KVRA 1G4DA 1J9IA 2EFOA 3WODF 4B09A 1HKTA 2PMHA 1G6NA 4KIBA 3F8NA 3OOPA 1YFHA 2DK8A 4Y17A 3CUQB 4R8HA 3HOTA 2ELHA 3WGHA 4M6XA 4OIRF 3FZVA 1ZRDA 3JTHA 3GZ5A 1U3EM 1HBXG 5DD4A 1AWCA 5L3DA 5ICFA 5A2QK 2LF7A 5LGNA 2Q0OA 3E5QA 2PQ8A 4Y15A 5LRRA 1FX7A 2OZUA 3HIFA 2DO7A 1XD7A 3G3ZA 5K5OA 3KEOA 4DQ2A 4WK8F 3QOPA 4RS8A 1B9MA 4UV8A 2BBYA 3HTUA 3E6BA 3RYPA 5E17F 3T8TA 1YW7A 3HRUA 3R61A 2Y75A 4PGGA 2IRFG 3U9GA 3ZQ7A 1YTYA 1KU7A 1IUYA 1FNNA 3BPVA 1U78A 1T38A 2IP2A 5LEJA 4UXNA 4IRHA 4OOIA 3RDIA 4TV7A 3OV8A 1PP7U 3FMRA 4UVBA 4Q5SF 3O2PE 4A5NA 3QPHA 3T0YA 1A04A 2GA1A 2CWEA 1ON2A 1DPUA 3VOEA 1L3LA 4HV6A 3MZYA 1IF1A 4I02A 2HYGD 3ECHA 3R0AA 3M8EA 5TJJA 5ICEA 4GGGA 3WTTC 1V3FA 1FYMA 1FWZA 5HS7A 5E8IA 5LHHA 3F23A 1TNSA 3ABUA 2MLKA 3KCCA 1IRGA 2ZO4A 3I5UA 1F4KA 1UFMA 4ENJA 1YIOA 2Z33A 1OKRA 1FBQA 2H94A 3U1DA 4ZZDA 3J81Z 2P5LC 2FOKA 3F8CA 1K78A 4L0YB 3MQ0A 4HF0A 1IN8A 3CO6C 1FC3A 4Q47A 1LQ1A 2ZJ2A 3R6SA 4AIKA 2AXLA 4RGRA 4G6DA 2OU2A 2HTSA 2VT3A 1TBXA 3QPTA 2R3SA 2FE3A 3TOBA 2E1CA 2FXAA 1P2FA 4Q48A 4OU0A 4OMYA 3I4PA 1BI0A 3TOAA 1J5YA 4LJZF 5LEKA 3WTYC 2STWA 2M1BA 2VN2A 2RNJA 2YPRA 1SAXA 1IN4A 2A6HF 2EA4A 1FLIA 4MTDA 2ZFWA 5HLGA 2DTRA 2V1UA 3NEUA 2GAUA 2EFNA 5BPIA 5ILVA 2XKPA 1WQ2A 1T6SA 2PBIA 1S8NA 2XV4S 4HX8A
chains in the Genus database with same CATH superfamily
3M1CA 3TO6A 2JPBA 3WU1B 2L7ZA 1AA7A 3CJQB 3S17J 3OYEA 1IAWA 2XUBA 3FXKA 2JT1A 2HS5A 5KHDA 4U7DA 1ZKGA 4HG2A 1K61A 3J7YJ 1PUEE 2LTPA 2W4SA 5AIPA 3DLLF 4BXXJ 2B9SA 3FHZA 1W7PB 4IOCF 3CDHA 3Q5FA 1JHHA 2Z9OA 1OYIA 2VASA 3DBRB 2HYFA 2ZXWH 4KMUX 3A01B 3FXLA 2CW7A 2V1DA 5HVQC 2N8GA 2IGNA 4M6YA 4RGUA 3MKWB 4HOBA 2JN6A 1J7KA 3MN2A 4I01A 3QYEA 4M6VA 4BHPA 2O61A 1YQAA 3CC4I 2EBIA 2O03A 4B1RA 1AKHA 2Y9YA 1J0RA 5J1UA 2IEKA 4AUXA 3DFGA 4FX4A 2AQEA 3CJNA 3J80Z 2DOEA 1H8AC 2ZXJA 5GP9A 3LAPA 1RPWA 3DKYA 4EJOA 4A5MA 1QBJA 3BCAA 5FKMA 4KIGA 4GDFA 1H9TA 3RPUA 3U21A 4BJ5C 2OQGA 4NHJA 4NQWB 2RDPA 2MSYA 3PFIA 4LG0B 2EA2A 1S9HA 3GFJA 2K40A 2X9DA 1RR7A 1Y1VJ 2IS4A 3JW4A 1T56A 1IXCA 1FMWA 3MKYB 4HQEA 2QSHX 3GTPJ 3PQJA 4A93J 4NNJA 2VJ4A 1LEBA 1MD0A 4KUMA 4ETSA 1G3YA 5BOXA 2DOAA 3SEZA 4U7BA 3BROA 1FIAA 2EWNA 5GAHJ 4EVIA 4HSTA 1UAAA 3L7WA 1O3QA 4BE2A 4O3MA 3AL0B 2O0YA 1U8RA 5HS8A 3FF5A 3K9TA 3OWTA 1GXPA 3ZXSA 3BR1A 2HYJA 3ABTA 2XAQA 1POGA 2BV6A 3NARA 4HAMA 1E3HA 2WV0A 5FB2A 4S0HB 2JA7J 1EH8A 2XRNA 3K1MA 2OUMA 4M9XA 2RQPA 3OL3A 2LOOA 1X1BA 2HFHA 2VBWA 4CA0A 4LOCA 5F08A 3PQKA 3DPTA 1AHDP 2KHMA 4HSRA 2P7VB 2HZTA 3U2RA 3BP8A 3ZOBA 1QQIA 3EPZA 4IHWA 2O8KA 2HU9A 1T0FC 4IQJA 1A6QA 1QPMA 2JTVA 3HTSB 2NVTJ 3VPRA 3KYDB 1R00A 3GYHX 4KN7X 2GIZA 3RJPA 2FX0A 4HRIA 2PMZN 2EZLA 2XRLA 5EEHA 4BHCA 2D2WA 2MLGA 3DU5A 3CZ6A 4M3FA 3V8LA 3BG3A 4I6ZA 2H8RA 1JT6A 4LK0F 1OCPA 3RKQA 1T39A 4EATA 5LD2C 2CYYA 2ESNA 1IRFA 3BR2A 3I3LA 1YJNI 1D8JA 3KP5A 4KIFA 5DM6F 2XAFA 2L3DA 1TWCJ 1Y8RB 2AXTC 2HGCA 4PUSA 2NXNB 2K9LA 3BY6A 4IQ4A 2L9VA 3JRHA 2ZJRF 5BMZA 1Z1DA 2I10A 4I0AA 1R36A 4RM3A 5EZGA 3L2CA 1TWGJ 1RIOH 1BIBA 1LDKB 2DA6A 5J1YA 3S15J 4GXOA 3CLQA 3IP4B 2KIMA 3QU6A 4Y13A 1TZLA 4EQQA 2W24A 5D6EA 4IXAA 3SZGA 4IL6C 1ZGWA 2VL8A 4CSWA 5JVTA 3WTXC 1J09A 3KPHA 1HC8A 1GLNA 3DV8A 1HA8A 3HOVJ 4G8XA 3V8JA 2IA0A 3WTZA 2QF7A 2F48A 4HZFA 4BUPA 1BM9A 1TP4A 4HNTA 1MKMA 2K85A 1ZRCA 1R5GA 1IXSB 3OS2A 3LQRA 4Q4ZF 4A3LJ 1DQUA 3T1BA 2BHZA 2GBYA 3GBGA 3HHHA 5LGTA 4BBSJ 3F22A 1JJ8C 1KU2A 2VODA 3W3CA 1BBYA 5JFRA 3HKZA 3J7AY 1T0FA 2BXZA 3V42A 3OYDA 3JRAA 3DQVC 4XQFA 1BI1A 5CJ9A 2IT0A 3HG9A 4D5FA 1I39A 1SC7A 4G7HF 3G2BA 1B59A 2W85A 2ICWG 3UNGC 1ZGAA 2E34A 1FEXA 4RGXA 2R7UA 3OR2C 4B48A 2A69F 2OJED 3KX2A 2FQ3A 1PVEA 3VODA 1WSUA 1NG7A 3OIQA 2DT7B 1APLC 3HRSA 4CYCA 3FBNB 5DDGA 2BE5F 4X0GA 2K3PA 5E1WA 3S3MA 1KA8A 2CV1A 2E7XA 3I0TA 2R7VA 1TT0A 1JKRC 3CMYA 2EK5A 1UHMA 1PYVA 4MGRA 4KISA 4XN3A 2XB5A 3N4MA 1C0WA 2UXXA 1ZN2A 2V6CA 2L0KA 1RI7A 3MCZA 1B6AA 2LBFB 4XRSG 2WADA 4IVNA 1ZR4A 1LB2A 1REPC 3H92A 4HX7A 3KEYA 1ZLJA 2ZNYA 2IA1A 2FMYA 2AO9A 3L2UA 4L9TA 3CCSI 2TDXA 4XNFA 2E2HJ 1XCVA 2FBKA 1T08B 2FF4A 2XKOA 2X0LA 2EV6A 2F5CA 1QO0D 2DI3A 1R4NB 2ACJA 2DA7A 4PSWA 4G6QA 3RTRA 5C4JJ 4BQNA 4MEXF 1KZHA 1W0UA 5E18F 2MYSA 1WI3A 1F9NA 3RPQA 3SDGA 1BA5A 4LGWA 1R1TA 2CRGA 3RKXA 3L00A 2VE9A 2UV1A 4AIHA 1MGTA 4C3HJ 4D0PA 3CCRI 1Z05A 2KJCA 4HW0A 4XM3A 3PFYA 5JI6A 5ED4A 1IO2A 4IO9F 4XLPF 2CU7A 4HNUA 4PZJA 3JAMZ 4XBFA 4HDVA 1DGWY 4UUTA 3GTQJ 2CG4A 1QVTA 2VIXA 2EQRA 2X4HA 3H1CA 1TW2A 1DPRA 4OAYA 4KMFA 1KQ9A 1V5EA 3QYFA 3I53A 5L3BA 1R6RA 2DBBA 2EFWA 3MAJA 2LFBA 5FKNA 4DZPA 5L3EA 4J01A 2CFXA 2M45A 3I59B 1IGNA 3Q0WA 1H89C 2L01A 2CUFA 2M34A 4KA4A 4BS9A 3BR6A 3VEPA 4BAYA 2QM3A 5E1XA 2GLOA 2L5QA 2QZ8A 3S1NJ 2BVMA 2RKHA 3K2AA 2QKMB 4EJVA 2QCOA 2M0MA 4N4OB 2DPUA 2RQQA 3G6EI 4Y52J 1UG2A 4C3IJ 1SFXA 1WZ2A 1QRYA 2CQQA 2LKPA 1J59A 1LKXA 4FETA 3GTMJ 3IH3A 3SYTA 2M87A 2WC2A 5LRSA 2TRTA 2ZC2A 2V1NA 5H6QA 3HYIA 1I3QJ 1XX5A 3PM1A 1S29A 1FT9A 4NB5A 4G7OF 3HJEA 2FRHA 3DKWA 1J75A 2BGCA 1ETVA 4YFKF 1XSDA 3DTIA 2BHYA 1DP3A 2Q2EA 2JWTA 5B3SH 1SFUA 4RLFA 1ZRFA 3H5AA 3IWZA 2F5DA 2FBIA 3KEQA 4OIOF 1QU3A 2M4KA 2V4JC 4MQVA 4A3FJ 1GV2A 2H6BA 2X1EA 4OINF 3UR3C 5HDNA 4RGSA 1X1CA 4EM1A 4OAZA 4L18B 5JLWA 1Y0UA 1K4SA 4DIQA 2WTEA 2P4WA 3MZ8A 2QEXI 3Q0UA 3DPUA 1MJAA 2DT5A 3VYSB 3D5LA 3HHGA 3EUHA 4G6TB 5EG0A 2HQRA 1KU3A 2LF8A 2QSGX 4NC7A 4F55A 5FLMJ 2BXYA 2R5YB 4BDZA 2KRCA 4G7ZF 3C2HA 5L3FA 4F7ZA 4EGZA 5IYBJ 2ZCWA 1S7EA 2A07F 2OAZA 5FLVA 3EYIA 1FYKA 4Z6YA 4BU2A 2ZMEC 4ZC3A 4E7KA 1ON1A 4BY1J 4IHXA 2P0WA 3G71I 4IRIA 2W1OA 5GTHC 4DZJA 5JVGF 1BC8C 2MG4A 3FWEA 5TISC 3ZN0A 2JA2A 3KFWX 4XIDA 1TQIA 2L9RA 1DDNA 4A3IJ 2V6EA 1SMYF 3O8HA 4MHGA 4F93B 4BGDA 4XLNF 2HOTA 1R4MB 1X3UA 3F21A 4KITB 1X4OA 2HI3A 1KQ0A 2E1NA 2JK3A 2P5KA 3WHBA 4II3A 2FJ1A 3J81K 2VT2A 3F8BA 2G7HA 2E1OA 4CCNA 1Z9CA 2CUZA 3RYRA 4A3DJ 3BG5A 4HQMA 2QQ9A 2GZWA 2LSOA 5DTDA 3KZIC 3KZYA 4AYBN 5DV5A 3I64A 3RKYA 4ZYEA 5IT9Z 3FX3A 4E7HA 5F0FA 2XC7A 4FHTA 3C2BA 3WTSC 2DYRH 3AG2H 2WBMA 4OIPF 4Y4RA 5GPAA 2PMZA 5DCMA 5E3OA 1XN7A 1ZH5A 3WGIA 2VKVA 4S05A 4WCGA 1VI0A 5E8GA 4P9UA 1YS6A 2VBXA 1ONVA 2NOJB 3Q0VA 1MIJA 3CCEI 2FD5A 1JUMA 1OYYA 2QBYA 2DDBA 5B66C 1IN6A 2NNNA 3ZQIA 3RZDJ 1ZYRF 3SQNA 3FXQA 3DP7A 5CPRB 1FYLA 3PIPF 3LSGA 2E19A 2KJBA 1WGXA 2IGMA 2O3FA 2V9VA 3K4CA 2ME6A 3HSFA 2ZMEA 1H88C 1JGGA 2A05A 3F8FA 3E7LA 2VKEA 3S1MJ 3FXOA 1A36A 2FNPA 2OPTA 1H0MA 2VBYA 1U5TC 2GA2A 3OYJA 1JTXA 4MFEA 2DCEA 4NDLA 4E7LA 4ON0A 1T98A 1P6RA 1W5SA 4U88A 3D5RC 2NOGA 1WRJA 3BOQA 3SEQA 2XROA 2O5RA 2X51A 4LIVA 1IV8A 2UZKA 2FBHA 2ZSHB 2W84A 3I55I 3LSJA 4A0YA 5ICGA 2XF5A 1SD5A 2IBDA 2RNGA 4IRGA 4A3MJ 1MDMA 2KMUA 3DF8A 4PGHA 1YYVA 5D8KB 2LLKA 2QGUA 1XDUA 4D7NA 2HTJA 4CHUA 4ZDLA 3GTLJ 4XORA 1S7AA 4HX4A 1D5VA 4PCQA 4I99C 2COBA 5K1YA 4LITA 4A0ZA 2R7DA 1WKMA 4KN4X 5DUIA 3E3VA 3KLNA 4L5IA 1LUJB 4YFXF 4G12A 4OMZA 4PSXA 1Y6IA 2ZXHA 1PUFB 1U9NA 3EUAA 3HUGA 4AIJA 3CUQC 2DTZA 3HSRA 1X19A 4YEJA 4PK4A 3H5RA 3K4NA 3QQAA 2K86A 2MH9A 2LP0A 5D5VB 3VWBA 2GOXB 5KAFC 3QRFF 1G59A 3GXOA 3GTKJ 2LKSA 1B4AA 3V7CA 2X6OA 5L3CA 2Z16A 1YI2I 3CDLA 3FXRA 2GXBA 1IW7F 1R49A 4WWCA 3GWZA 3REOA 1U5TA 2R7RA 4LLLA 1N78A 3PUFA 3KLOA 5IT3A 1JJ6C 4WXHA 1IZ1A 3FKIJ 3J80K 2R7FA 3L9FA 4BDYA 2F4IA 5BS6A 4ESBA 3WTUC 1D1AA 3BJOA 4JK1X 1RUNA 5HNHA 3CO7C 2VUMJ 1HKQA 1WH5A 3HRMA 3V8KA 3EETA 4ZH4F 5HDKA 2DQLA 5HOOA 5FROA 4H0EA 3C3WA 2M30A 2BY0A 2VOPA 2OTLI 3E6MA 3VSLA 1F36A 1I6XA 4XLHA 3RQIA 3SHFA 4L9NA 1SFEA 4ZTFA 2COMA 3K1NA 2A3SA 2HNHA 4PFPA 1L0OC 4E4HA 3W2VA 4PJMA 4GCVA 3ABMH 1HF0A 2PJRB 2XVCA 2DFHA 2M4GA 3HB9A 4A12A 1CF7B 4QWQA 2JUGA 5FKKA 2GOMA 2DMNA 1WJDA 2DA4A 1D1CA 1TWAJ 5FKLA 2KQRA 2JVHA 2XGXA 4JP0A 3P5JA 4EJTA 2HKOA 3CUQA 2E36A 2OF7A 3LA3A 4FISA 5M5WJ 1Y39A 3MEXA 5B1AH 3OL4A 3CCLI 4M74A 4C2TA 2Y0MA 4CYCB 2P6SA 1ENHA 2JRMA 3I54A 5FFXA 3IL2A 1Y1WJ 1K6YA 1QVUA 2L7MP 5D8LB 1E3PA 1NG6A 3HL2A 2VQLA 3RQ4A 3M8FA 1KGSA 4XKBA 3MKZA 2Y30A 1TLHB 1U8BA 1CQTA 1NK2P 1W7PD 3IWFA 4UVCA 1Z77A 4FT8A 1E17A 3CD6I 5KK1A 2X1DA 4WX9A 4LG3A 3IHUA 1W5TA 2PFBA 4N9HA 4O6JA 4LB6B 4M9SA 5E3LA 1SAUA 3PSFA 1V5FA 1V4RA 3B6AA 2BZTA 2OC6A 3QAHA 2F6CA 5J3LA 1SFKA 2Z99A 4BQOA 3K6GA 3KIOA 3EQLF 4EGYA 2R7OA 1HXDA 5EEAA 1HSTA 1DU6A 1VQNI 2A6TA 4FASD 3KYLA 4B3XA 2XPUA 3CCUI 1D3YA 5FRMA 1OMIA 3K2ZA 3QOEA 2DA3A 2ZKZA 4MTEA 3CMAI 3W2AA 1LJ9A 4EEFG 3BDDA 2M9HA 4MEYF 3FXUA 1OQYA 1XC5A 4MFDA 1Z7LA 3IKVA 4RB2C 1X58A 1QZEA 2E2JJ 4UY8I 3OYNA 3KP4A 1S6LA 5FD5A 4IX7A 4FQGA 2IGKA 1TWFJ 2LY1A 1ZTRA 2JPCA 2E1MC 1BR1A 4L9JA 5TGTA 1P4AA 1TQPA 4BXUA 2DMTA 3HRTA 3A1YA 4KT5C 2R0QC 2WB1N 1UG0A 1B8IB 2YX7A 3E0JB 2WAQN 2LMDA 2Y69H 5EJCA 3H3ZA 3GFLA 2E7WA 3FISA 1ZLKA 2RC4A 3QP5A 4Y7NJ 1D0XA 3WU0A 4CZZA 3LSKA 2NNYA 1MJBA 1XB4A 3B6CA 4JX4A 1GXQA 4M3DA 4BXFA 1N25A 2XSDC 2JQ7A 4BKXA 1Q1VA 1OCCH 1WHUA 1XPXA 1GHCA 3TGNA 1H9GA 2MW8A 5FRNA 2L4AA 3HEFA 2X6WA 3DWLE 3IC7A 1LE8B 2DMUA 1BJAA 3BR0A 3DTKA 1B72A 1MJ9A 3COAC 1ITYA 4U0WA 3LSHA 2RN7A 4CYDA 2DQRA 2V7FA 2O9LA 1WJ5A 4HEA2 3EDPA 3LSTA 1A5JA 3N97A 2XF7A 3IV5A 3BWGA 1GVDA 2CMPA 2D5VA 4XMYA 3TO9A 3BG7A 2V9PA 4P96A 1UB9A 1FSHA 3BZKA 4YIRX 3WTWC 2CQNA 2B0LA 4BE1A 1RUOA 1JKQC 3R0JA 2F4OB 2IS6A 5DEQA 2RGVA 3C7JA 3ZP5A 2VC0A 5FLXZ 3VYRB 1R1UA 4GYGA 4UUSB 4EJUA 3PNVA 2YS9A 1OFCX 4AYBA 4PJJA 4U0YA 4YIIA 3Q9VA 4HA8A 2X48A 1S3JA 5E20A 3RIRA 3HGGA 4MIMA 3NRVA 3AG4H 3K10A 4BJTA 5D5UB 3AAFA 2R5ZA 5ERIA 2XAHA 1I27A 3FM5A 2IVMA 2AQFA 2VE8A 1MMDA 3D1NI 1Y0NA 1TTYA 1Z7UA 5M3MJ 4ESFA 1U9OA 2VJJA 4IHTA 5C4XJ 2E60A 1O4XA 1JXSA 2ZNZA 2IW5A 2W7NA 3AG1H 3A0HC 5E1ZB 4A0XA 2JA5J 1MBFA 3ZMDA 2PJPA 2CSOA 4XSXF 3S3OA 2KZVA 2YUSA 2PLYA 3K70C 3NAUA 5EF6A 3OYMA 1JT0A 1LVKA 4C2MJ 2BVLA 1R9TJ 2IA2A 2RVCA 4QPQA 1AOYA 2F5FA 2WAFA 3JTGA 1XMKA 1QZZA 4QIWN 4L5EA 1JHFA 2DJIA 5FO5A 5E79C 5CYVA 5H6RA 1YITI 3OR1C 1VQ6I 2K9MA 3FIWA 5JR3A 4HNVA 1HW1A 5LLQA 2LYCA 3IAS2 1R58A 2ETHA 1ORKA 3ELKA 2CFOA 1XGNA 3HOYJ 2EZIA 1IXRC 3A4CA 1FBSA 5DS9A 3ZMSA 3JAMK 4L0ZB 1WJEA 5J1RA 3V7SA 2NVYJ 3VYTB 5J8FA 3BCBA 2G0EA 4XLAA 2QYOA 5J47A 2Y9ZA 1KQ8A 4DW6A 3DEUA 3NWSA 1SANA 1F43A 3IUOA 3QP6A 1X1PA 4RAGA 3CLOA 4RLQA 2L2OA 1NH3A 5K7HA 4A3EJ 3WHCA 1MBHA 3E6DA 4DNCA 1YX3A 3A03A 2VKHA 4HF1A 3I4MJ 5ILSA 2VLAA 1BR2A 1I1SA 1VQKI 2P8TA 2M3AA 3JRFA 2H09A 2CGPA 3S2DJ 3BT9A 4WXCA 3H36A 3HZJA 4LFUA 4DGWB 3GZ6A 1F1ZA 5HNFA 4NC8A 1BOBA 1D1BA 1HDPA 3ISPA 3LL7A 2R7WA 2D1HA 3TW7A 1LFBA 5L3GA 1MBJA 1VQLI 2JZYA 2D1VA 1WCMJ 1FZPB 3F8MA 1JKPC 2DLLA 1E0EA 2ZMEB 2X6YA 1ZAOA 2DU9A 5J6XA 4XRSA 1EJ9A 1W36C 3AL0C 2VC1A 2PG4A 2XGCA 4MNUA 2Y2ZA 1ODDA 1QA6A 1A35A 3CMMA 1SD4A 2P6TA 2UXNA 2OCEA 3K4JA 1RNLA 2EFPA 2WA0A 3JRIA 2IPQX 2DK5A 2BEOA 2V1XA 2Y0SN 5J4YA 4P1WA 2KT0A 3HM5A 1W7PA 4KT6A 4U0VA 2KIQA 2LNBA 1STZA 3ZQQA 3CUOA 2K27A 1SMTA 1VQ4I 2YR2A 1VFCA 1WI9A 1HW5A 2HQNA 3W6VA 4BQAA 4S04A 2C6YA 2F4MB 1S72I 2QQBA 3LOCA 1XCBA 1GUUA 3RKWA 2DN0A 4IF4A 5HLIA 3OIOA 2XPWA 1DUXC 3OYFA 1Z6TA 2KDZA 2GIVA 3W2WA 2WY8Q 4I76A 2EH3A 2P81A 2ID3A 2E71A 2DA5A 5HODA 2WAEA 1K78B 1Z67A 3CP8A 1BI2A 4LLNA 2ELKA 1V5GA 4LG0A 2OQRA 2EIMH 2QUFA 3AG3H 3GEZA 1K6OA 3ERMA 2YU9J 5FGMA 3TQNA 5LHGA 2HVQA 3QU3A 3LNQA 3V4GA 5F04A 2EILH 4YELA 5KAIC 4BEHB 1MBKA 1YO5C 2VXZA 1IC8A 3CTAA 2MC4A 4M72A 4JYKA 1IRXA 3CCMI 1ZG1A 3ASNH 2UWMA 3FMQA 4ZZLA 1YJWI 4MO7A 5ILUA 3A0BC 3GFIA 3FK6A 3ZMVA 3L09A 4ANJA 1U5TB 3HBLA 4PJ0C 2PX9A 1BN5A 4N0BA 5F0HA 1MZBA 5BQTA 5F1JA 1LNWA 2K9QA 3GMEA 2E2IJ 2ZB9A 2HOAA 4HF2A 5IT9K 2IJLA 2KKOA 3LSIA 3IRRA 1P7JA 2Y48A 4W1UA 4B8XA 5C3EJ 3DEWA 1MNMC 2EV5A 1JGSA 2DDAA 3F3XA 3IH4A 5D6FA 4DBRA 4L9VA 1IUFA 2HWVA 3C18A 2DW4A 4P55A 4CZCA 3BTLA 2QKLB 4E7JA 4C30A 3A02A 4YRVA 2YSRA 1YLFA 4ZDPA 2J5PA 5KNLA 3KETA 3LFUA 3SZPA 3HC7A 5K7FA 1XG1A 1ETQA 4RAYA 2LY9A 1ETYA 5B1BH 2K3FA 3GVAA 2LKXA 4GYIA 1T8IA 2A6EF 3GZNB 1DGRM 2WB1A 1P9QC 3I58A 2JRTA 1U0JA 2CW0F 1HDDC 2WAQA 4M3GA 5FFZA 3JSOA 1ZR2A 1W0TA 5CKTA 1WWXA 2EIJH 3QPSA 3HDDA 5D4RA 4YIFA 3T8RA 4E70A 4MQ9F 1TNTA 1P7IA 2EZHA 1GT0C 2HPMA 4A3JJ 4I09A 4E6KG 1VQOI 4UB8C 4F91B 4JQFA 4GO1A 1Z0XA 1KU9A 4G94A 3ZQLA 2MD5A 5D4SA 3ESWB 1IG7A 2DFFA 1ERDA 3VFZA 1OCOH 4BQQA 2M8EA 2KP6A 4JX6A 1SD7A 3HOWJ 3K0LA 1MMNA 1AKHB 5LGUA 2DYSH 1Z91A 2JA6J 3NQOA 5LFAA 3HXLA 2MH2A 1LVAA 1P4WA 3VSKA 1EKEA 2ISYA 2J5OA 4JBAA 3ZGKA 2ISZA 3LA2A 1UCRA 1XGOA 3GLLA 2X6XA 2VQCA 4AM3A 3HSEA 5H20A 2LRDA 4XLFA 2XPVA 4XONA 4AC0A 3BZ6A 2FOWA 1VQMI 1FOXA 1O3SA 3HOUJ 4ENMA 4RM2A 2BY2A 3ULQB 1FP2A 3RZOJ 1RRJA 5IOYA 5K7ZA 3P9KA 2NVXJ 2ECCA 2NYXA 4KDPA 1XDSA 3GF2A 1HOMA 5HS9A 3WE3A 3GW2A 3ZRGA 1AU7A 1PDNC 4HDUA 2XASA 4M9ZA 3MFKA 3VYUB 4R79A 5AONA 4F92B 2YX4A 3E1SA 1K79A 4RAZA 5F6FA 1W5CC 1LPQA 3OSGA 4IHVA 2RV8A 2GQQA 5EGOA 4E7IA 3LA7A 2CO5A 2VJIA 1O7FA 2EIKH 1UMQA 1T2KA 1K7AA 2HDCA 4XOPA 4IZZA 1FPQA 1G2HA 1M1EB 4JX5A 3FK7A 3M7GA 4AU7A 1HKSA 2VXDA 1WJCA 4W97A 1I5ZA 2EINH 3V7RA 4KJZA 4AVPA 3JRCA 2LBFA 1A6IA 2BY3A 4IOAF 4BYYA 5E3NA 4I2OA 3WU2C 1G3WA 1YW9A 2DXIA 2VQGA 1CGPA 2CV2A 2XAGA 5A2QZ 4CDGA 2HDDA 5CQGA 2M0CA 2NS8A 3FKJA 3CMEI 1UHSA 2HOSA 2HR3A 4FE4A 4E7SA 2K9NA 2QSFX 1USSA 2PI0A 2F5VA 4P5OA 1ZREA 1IN7A 2R7TA 2EJRA 1MH3A 3FDYA 2O7OA 2LDUA 2OV7A 3KZZA 1MMGA 1TQMA 1JTYA 2LG4A 3ZQCA 1SD6A 3M1EA 4A69C 3CCVI 4LB5A 1ETKA 4XLCA 3WE2A 2L54A 3O8GA 1UELB 1Z3XA 3CJRB 3ML6A 2XSJC 3C1DA 3L2RA 3ZN1A 2QWWA 2DA1A 2ZXIA 3E6CC 4XKCA 2MA3A 3I56I 1DU0A 3J7AO 3FM3A 1GV5A 2DJNA 4ZDOA 2XF6A 3ZQGA 5IP9J 4V2FA 2FUG2 2PN6A 1RR8C 4FX0A 4UVAA 2NRAC 3JRGA 5IP6A 5KCMA 4K2EA 1ZARA 1X1AA 1QGPA 1R5HA 4ZJZA 4KNYA 3N05A 5HLTA 2EV0A 1BI3A 2ADUA 3F0CA 2R7QA 5CVJA 1ZG5A 3MZHA 2VB6A 4IJAA 3CF5F 4UUVA 4XSZF 3I59A 1UHWA 2HVRA 3SFIA 1B9NA 4MLOA 3KP2A 2W82A 3ZR8X 4DJAA 5IP7J 2G7UA 3D5SC 2KLOA 1EH7A 2O8XA 4BL0B 2LH9A 1TC3C 5DCFA 3PIOF 2LREA 2B63J 1SVLA 3KP7A 2QQAA 4M3EA 5HDGA 1Z21A 2F5EA 3DEEA 2Y0SA 2XDVA 2CS3A 2ZBKA 2DFIA 2GWRA 4NBQA 3OYKA 1X3ZB 4PFOA 2L9SA 5CVUA 4RBOA 1YG2A 4EM0B 2PEXA 3JSPA 5M3FJ 3KP6A 5IYCJ 3M4OJ 4N9IA 3KP3A 3PNYA 2CV0A 1VTNC 1WFXA 2E5NA 3H9QA 1OISA 3OIPA 4RB0A 2IGOA 2QVOA 3K1PA 5AIQA 4BNCA 4F52A 1R23A 3IRQA 1DP7P 2BYVE 2L7FP 2K7LA 3H3VK 1FOKA 2DA2A 1QHHD 1IV6A 4I0BA 1A31A 3ZMUA 4LLGF 2FSWA 3K70D 1U6GA 5F64A 2H8WA 4XRMA 4ASNA 1BL0A 4IHSA 2OTJI 2W25A 3BR3A 2RREA 1XGSA 5CVVA 4HYEA 3NWTA 1ZGJA 1EV7A 4M73A 1BIAA 2R5YA 2X85A 5HLHA 1U2WA 2GXAA 2DMQA 5BPDA 3BTCA 1P92A 3TKYA 4YFNF 2KPMA 3S2WA 3TBIA 3OYHA 4RMNA 1EH6A 3F9KA 2VJ5A 2XHKA 5LHIA 2IS2A 1ZHFA 4EV0A 2G9WA 3PSIA 3TW6A 3DTEA 3HOSA 4HV5A 3P9IA 1V54H 1T95A 2F2EA 2KFDA 2VI6A 3LMMA 4O5VA 4M71A 3VDXA 4ENKA 5CQEA 2R93J 5FLXK 2FA5A 3CP2A 1FBUA 3S8PA 1FP1D 2L7KA 1FIPA 2EFQA 3D0SA 4WXDA 1VQPI 4ENNA 1MBEA 4QTRA 2M2EA 2XIGA 1JKOC 3ROUA 1ZELA 2KIUA 4KFCA 4AIDA 3H35A 1G3SA 2HQ5A 3W6KB 3R60A 4M3BA 3L2QA 4BH9A 3CJTB 1O3TA 1YOVB 1WVRA 4UV9A 3H3UA 5GAGJ 4B4CA 1XSXA 3S93A 3CF2A 1JUPA 1IRZA 1B1BA 2VBZA 2CQKA 4DYRA 2JSPA 1W36D 1BR4A 2L4MA 3H5NA 5DYMA 4AWXB 4ABZA 5FJ8J 1NHAA 2KIFA 4HBLA 2LVSA 2HXIA 2B7EA 1MMSA 1O57A 3AKZA 4DBQA 2QQ8A 4EMSA 3S16J 3WTVC 3DBHB 3I4NJ 2HDWA 3I71A 2WV1A 3S1RJ 1Q1HA 1G8XA 5IYDJ 4ZYDA 3F6VA 4KICA 5EEGA 2VONA 1N75A 1FY7A 5BNGA 3K4MA 4CCLA 3SZTA 3CCYA 4CO8A 1MW7A 3SFZA 1YHQI 3HOXJ 1YS7A 4BHBA 4I7HA 3SXYA 1W4MA 3K4LA 4AD9A 1LDDA 2EB7A 3BLYA 1ULYA 2W00A 3TDUC 3QPLA 6PAXA 5F27A 2M7BA 2IS1A 5GAEJ 3LQQA 4J19A 4OWRB 2LY2A 3H9JA 1J2XA 1RZ4A 2VPRA 2Q2EB 3ZPLA 2H6CA 1TT5B 3Q9SA 2NVUB 3H0DA 2Q8KA 2K9SA 4XR6A 2WWYA 4ZYAA 2HEOA 1X2MA 4JOMA 2Z5UA 3SJMA 1UJ8A 5FD6A 4CUGA 4LK1F 2L02A 3X2QH 1XSVA 1USTA 2NAZA 3QODA 4A2UA 1PP8F 3ABLH 1LEAA 4I98B 2CQ7A 5EDNA 1WJAA 4UHTA 3ASOH 2CUJA 5D5WB 5EG0B 1XMAA 1YRNA 3WG9A 4RB1A 5J8CA 3GLXA 2A5YB 3S3NA 3GFMA 1O7LA 2X1CA 2ID6A 1RKWA 3GO5A 3O6BB 4WF2A 1R7JA 2NS0A 1HSJA 1YE9A 3BC8A 1PUFA 3B02A 3HOZJ 2Z1DA 1OJLA 3PNTA 1BC7C 4PDKA 5CVRA 1D0YA 3OOUA 2K5CA 2MC3A 1R1VA 1OYWA 3LWFA 4XK4A 1ACIA 2XGDA 3BJ6A 3TO7A 3BJAA 3MKLA 3R4KA 3BTJA 2V26A 2FNAA 2H1LA 2LR8A 2E5ZA 2ESHA 1ETWA 3GTOJ 1ZK8A 1QNTA 3RI4A 1IN5A 4EJWA 3DPLC 4IPAA 4B44A 2JSCA 4KYWA 3OMYA 3GTJJ 3P7NA 3M8JA 3FMSA 4A3CJ 2K02A 2HOEA 2MD0A 1GDTA 3P9CA 3O3KA 2CUEA 2NS7A 2QLZA 1LDJA 1RKTA 2OD5A 1X1DA 3K4KA 1IJWC 3H0GJ 2AS5F 1MBGA 2P5VA 5JHUA 3B73A 2OA4A 1XGMA 3CQZJ 1IDYA 3E5UA 4GRIA 1JE8A 2QENA 1HCRA 4LMYA 3M9AA 3K69A 1VZ0A 2FMLA 4CH7A 4QSHA 3ERED 4ESJA 1K83J 2DAOA 2BW3A 3CCJI 4GFBA 4XOTA 4P9FA 4XL9A 3W6JB 2OZ6A 5DCMB 2XAUA 2D45A 4EM2A 2PMUA 2ZJQF 3F72A 1QZYA 2PJRA 1CF7A 3BTIA 1G3TA 2FU4A 3TDZC 4A6EA 5M5XJ 2GXGA 3DXJF 3F6OA 2P7CB 2NVQJ 4HLXA 3BZCA 5DD8A 1S5LC 2QBYB 1Y56A 2KL4A 5DM7F 3TMOA 1TW3A 4L5JA 1ZG3A 1FSEA 4CICA 3BQZA 2ELJA 3C2GA 2CQXA 3HPHA 3JRDA 2CH0A 1D8KA 5GADJ 4B47A 4R1HA 4Y33A 2K4BA 5EGOB 3AFHA 1OR7C 2OBPA 2XAJA 4XKWA 3TL4X 2W57A 4UNOA 2Z3YA 2KRFA 5JHFA 5CVIA 1R5ID 3MWMA 2STTA 3JCUC 2O6GE 5J40A 1OPCA 3CC2I 4A3GJ 2OCCH 1I6HJ 3WGGA 1MSFC 1SVOA 1FMVA 2HXOA 2YU3A 4HLYA 3E97A 1WJFA 3DCFA 3K7AJ 3A01A 2R7XA 1R22A 3ZMZA 4G9YA 4YG2F 3L2VA 1N77A 4D5CA 2R92J 3ZMTA 3ECOA 1MDMB 5F1RA 1FTZA 1YW8A 5FKOA 3G1LA 1YJ9I 2MBFA 2W48A 1E2XA 2HPIA 3K4BA 4Z2YA 2VOOA 3JREA 3EYYA 4A6DA 3HGYA 3QWLA 2H1KA 1IDZA 4II2A 2H27A 2HZDA 3J7ZI 5D5XB 4NQWA 3CDIA 1TWHJ 4BJ6C 1FTTA 1P4XA 5CLSA 1W1WE 3HUGB 3LSRA 3TP0A 4B43A 2CW8A 4ZYHA 3JRBA 3S1QJ 5GTIC 4CXFA 1F5TA 1I1GA 2V79A 1I50J 2FEZA 3HPGA 4NUBA 3KYCB 4OIQF 2ZSIB 2HKXA 3BPXA 1HW2A 4ZTJA 5EZHA 4XRFA 1Z6RA 4QLCU 5ICCA 2DPDA 3EUHC 1B8IA 4LD5A 1HQCA 1GVJA 5IOZA 1OR7A 5LBQA 1BOAA 5DUKA 3E5XA 3MVPA 3OS1A 2I5UA 4ZYGA 5TRDA 2K4JA 1S7OA 4QPOA 3VB2A 3GX4X 4BE0A 3FXJA 3ZCOA 4A3KJ 2M5WA 3IKTA 4A3BJ 1K4TA 2DODA 4CGZA 3GUDA 4DYCA 3LAJA 1PJRA 5K5QA 5M5YJ 2A61A 3EUKL 1ETXA 4UB6C 1KYZA 3G73A 5K5RA 1LE8A 2GM4A 3KE2A 1KONA 4PJLA 1KYWA 1O3RA 1D5YA 2AHQA 1SVMA 3T5XA 2DMPA 1FJLA 4RB3C 3PO2J 2A68F 3DU6A 3LFKA 4C2UA 2MGQA 5KVRA 1G4DA 1J9IA 1UZCA 3H9GA 2EFOA 3WODF 1RC9A 4B09A 1HKTA 2PMHA 4BY7J 1G6NA 4RA2A 2DT6A 3L2WA 1MNDA 3OYLA 4KIBA 3TEDA 3F8NA 4X6AJ 2HQAA 1VQ8I 3OOPA 1YFHA 2DK8A 1RETA 4NC6A 4Y17A 4CCJA 5GPCA 3CUQB 4R8HA 3HOTA 2R7ZJ 2HVSA 4UUSA 1XS9A 3I9V2 2ELHA 3WGHA 2LK2A 4M6XA 5IPAA 1QHGA 1VQ9I 4OIRF 3GCMA 3FZVA 1ZRDA 1JI8A 2BY1A 3JTHA 3GZ5A 1U3EM 3BG9A 1WPKA 2KRHA 3BG6A 3S2HJ 1HBXG 2VQHA 1Z3YA 2Q1ZB 3CCQI 5DD4A 3G4SI 1AWCA 3ZQHA 5L3DA 5ICFA 5A2QK 1NTCA 2LF7A 5LGNA 2Q0OA 4CCOA 1ETOA 3E5QA 3RCOA 3JR9A 3GTGJ 3QYBA 2PQ8A 2XGEA 4Y15A 5LRRA 1FX7A 2OZUA 3PUBA 3HIFA 2DO7A 4Y3OA 2ZFUA 1TL8A 1XD7A 3G3ZA 3DLAA 5K5OA 3KEOA 5F0CA 4DQ2A 1HLVA 4WK8F 3BR5A 2FQ4A 3QOPA 1MSEC 4RS8A 3M3YJ 2EZKA 1MMAA 1B9MA 3LSMA 3RPUD 4UV8A 2LD5A 2R7SA 2BBYA 3HTUA 3E6BA 3RYPA 4V2GA 2A5WA 1V55H 1VQ7I 1I3AA 5E17F 1LFPA 1D0ZA 4IKFA 2VPLA 1YIJI 1VNDA 1RESA 2XB0X 2Y31A 2JMWA 3T8TA 1YW7A 3HRUA 2BOLA 4ITVA 3R61A 2Y75A 3PJRA 4PGGA 2IRFG 3U9GA 3A2KA 1OLTA 3ZQ7A 3Q3SA 1YTYA 2IAIA 1KU7A 1IUYA 1FNNA 4FTHA 3SDBA 3BPVA 1U78A 3M07A 2KISA 1T38A 2IP2A 1XTAA 4F3QA 5LEJA 4X1EA 4UXNA 1X4PA 4IRHA 4OOIA 3RDIA 4TV7A 3OV8A 3LSPA 4PJNA 2ZJPF 4XN0A 1PP7U 3FMRA 4UVBA 1BW6A 3MD2A 4Q5SF 3O2PE 1WJBA 3TP3A 4A5NA 1OCZH 3QPHA 3T0YA 1A04A 3G1OA 4J00A 2GA1A 1NK3P 4H4KC 2CWEA 4CCKA 1ON2A 4AVZA 4RAFA 3VOEA 2JVGA 2WY7Q 5JLXA 3OYGA 1DPUA 3IH2A 1L3LA 4HV6A 1X3WB 3MZYA 1B72B 4I02A 1IF1A 2ECBA 2HYGD 3ECHA 3BQYA 3R0AA 3M8EA 3OYBA 5TJJA 3CESA 4XLEA 5ICEA 2LC2A 4GGGA 3HKZN 4C9YA 1T33A 3WTTC 5IY5H 1V3FA 1FYMA 1FWZA 5HS7A 5E8IA 3FBIB 5LHHA 4C3JJ 3F23A 3S14J 1BW5A 3FHNA 3OYIA 3ABUA 1TNSA 3WG7H 2MLKA 3KCCA 3OYAA 1IRGA 2ZO4A 3G1MA 3I5UA 1F4KA 1UFMA 2M7AA 2KZGA 4ENJA 1YIOA 2Z33A 1WH7A 3OSFA 2QA4I 3PO3J 3OY9A 1OKRA 2E1MB 1FBQA 2H94A 2JA8J 2TCTA 1YX5A 3ABKH 3U1DA 4ZZDA 1OCRH 1Y8QB 3J81Z 1YRNB 1MH4A 2P5LC 2FOKA 2R5ZB 3F8CA 5C44J 4IEJA 1FOYA 4DOZA 2MFZA 3MMYB 1K78A 3RSNA 4D7MA 4L0YB 3MQ0A 2I8DA 4HF0A 1IN8A 2UUZA 1R71A 4FE7A 3CO6C 1FC3A 3S32A 4Q47A 1LQ1A 2ZJ2A 2MABA 3R6SA 4BEHA 4AIKA 2AXLA 1SEUA 5H2FC 5B5EC 4RGRA 4IHYA 4G6DA 2OU2A 2HTSA 2VT3A 1TBXA 3QPTA 4D9JA 2R3SA 2FE3A 3TOBA 2E1CA 4V19K 2IXSA 2FXAA 4U87A 3U1KA 5J4VA 1OCTC 4DYQA 2DOFA 1P2FA 3IAM2 2JJ7A 2ME0A 4Q48A 4E7ZA 3CC7I 4OU0A 4OMYA 2R4GA 1MNEA 2V9KA 3I4PA 1BI0A 3TOAA 3ONQA 1LFUP 4RDUA 1J5YA 1X2NA 4LJZF 5LEKA 2DFEA 3WTYC 2CJJA 2M1BA 2STWA 2VN2A 2RNJA 3DBLB 2YPRA 3FXMA 1SAXA 1IN4A 2A6HF 4XKVA 3OS0A 2EA4A 3ZQFA 2Z2SB 1EF4A 1FLIA 2RAEA 4CCMA 3UKGA 2BW3B 9ANTA 3OYCA 2KDOA 4MTDA 1FOWA 1XMXA 2ZFWA 4FCYA 5HLGA 1SFOJ 2DTRA 1VQ5I 4XICA 4LIUA 4BBRJ 2EPFA 2V1UA 2L9NA 5EYRA 3NEUA 2GAUA 4B3AA 1ZQ3P 2EFNA 1JUSA 4N4NB 5E3MA 5BPIA 5ILVA 2JUCA 4HPQA 2E35A 1EA3A 3DKXA 2XKPA 1VF9A 1WQ2A 3PL8A 1T6SA 1QPIA 2VKDA 3L1PA 2M8GX 2PBIA 1E3OC 1S8NA 2XV4S 4BACA 4HX8A 1BJZA 4D1QA
chains in the Genus database with same CATH topology
3TO6A 2JPBA 3WU1B 1IAWA 2XUBA 2JT1A 2HS5A 4U7DA 1PUEE 5AIPA 3FHZA 1W7PB 3CDHA 3Q5FA 1JHHA 2Z9OA 1OYIA 2HYFA 4KMUX 2V1DA 5HVQC 4M6YA 4RGUA 4HOBA 4I01A 1J7KA 4BHPA 2O61A 1YQAA 2O03A 1J0RA 3DFGA 4FX4A 3CJNA 3J80Z 2ZXJA 3LAPA 4EJOA 4A5MA 1QBJA 4KIGA 1H9TA 3RPUA 2OQGA 4NHJA 2RDPA 3PFIA 4LG0B 2EA2A 3GFJA 3JW4A 1IXCA 4HQEA 3PQJA 1LEBA 1MD0A 4KUMA 4ETSA 1G3YA 5BOXA 4U7BA 3BROA 2EWNA 4EVIA 3L7WA 1O3QA 4O3MA 2O0YA 1U8RA 5HS8A 3FF5A 3K9TA 1GXPA 3ABTA 2XAQA 2BV6A 4HAMA 2WV0A 5FB2A 1EH8A 2XRNA 3K1MA 4M9XA 2RQPA 2HFHA 2VBWA 3PQKA 3DPTA 2P7VB 2HZTA 3U2RA 3BP8A 1QQIA 1QPMA 2JTVA 3HTSB 1R00A 3GYHX 4KN7X 3RJPA 5EEHA 4BHCA 2D2WA 2MLGA 3V8LA 4LK0F 1T39A 2CYYA 2ESNA 1IRFA 1D8JA 3KP5A 4KIFA 2XAFA 2L3DA 2HGCA 3BY6A 5BMZA 1Z1DA 4I0AA 1R36A 1RIOH 3L2CA 1BIBA 1LDKB 4GXOA 2KIMA 3QU6A 4Y13A 4EQQA 2W24A 5D6EA 4IXAA 5JVTA 3WTXC 3DV8A 4G8XA 3V8JA 2IA0A 3WTZA 4HZFA 1BM9A 1MKMA 1ZRCA 1R5GA 1IXSB 3LQRA 4Q4ZF 3T1BA 3HHHA 5LGTA 3F22A 1KU2A 2VODA 1BBYA 5JFRA 1T0FA 3DQVC 1BI1A 5CJ9A 2IT0A 4G7HF 1B59A 2W85A 1ZGAA 4RGXA 2A69F 2FQ3A 3VODA 1WSUA 3HRSA 5DDGA 2BE5F 5E1WA 1KA8A 2E7XA 3I0TA 2EK5A 1UHMA 4MGRA 3N4MA 1C0WA 2UXXA 1ZN2A 2V6CA 1RI7A 3MCZA 1B6AA 4IVNA 1LB2A 1REPC 3H92A 4HX7A 1ZLJA 2ZNYA 2IA1A 2FMYA 4L9TA 2TDXA 1XCVA 2FBKA 2FF4A 2XKOA 2X0LA 2EV6A 2F5CA 1QO0D 2DI3A 2ACJA 4G6QA 3RTRA 4MEXF 5E18F 1F9NA 3RPQA 4LGWA 1R1TA 3RKXA 3L00A 2VE9A 4AIHA 1MGTA 4D0PA 1Z05A 2KJCA 4HW0A 5JI6A 5ED4A 4XLPF 4PZJA 3JAMZ 4XBFA 4HDVA 2CG4A 2X4HA 1TW2A 1DPRA 4KMFA 1KQ9A 3I53A 5L3BA 2DBBA 2EFWA 3MAJA 5L3EA 2CFXA 2M45A 3I59B 2L01A 4KA4A 3VEPA 4BAYA 2QM3A 5E1XA 2QZ8A 2RKHA 4EJVA 2DPUA 1SFXA 2LKPA 1J59A 2M87A 2WC2A 5LRSA 5H6QA 3HYIA 4NB5A 4G7OF 1S29A 1FT9A 2FRHA 3DKWA 1J75A 2BGCA 4YFKF 1XSDA 2Q2EA 1SFUA 1ZRFA 4OIOF 3IWZA 2F5DA 2FBIA 3KEQA 4MQVA 2H6BA 4OINF 5HDNA 4RGSA 4EM1A 4L18B 1Y0UA 2WTEA 2P4WA 1MJAA 2DT5A 3D5LA 3HHGA 3EUHA 2HQRA 1KU3A 2LF8A 4G7ZF 5L3FA 4F7ZA 4EGZA 2ZCWA 2A07F 2OAZA 3EYIA 1FYKA 1ON1A 4IRIA 1BC8C 3FWEA 3ZN0A 3KFWX 1DDNA 1TQIA 1SMYF 4MHGA 4XLNF 1X3UA 3F21A 1KQ0A 2E1NA 2P5KA 3J81K 2VT2A 3F8BA 2G7HA 1Z9CA 3RYRA 4HQMA 2QQ9A 2GZWA 2LSOA 3KZYA 5DV5A 3I64A 3RKYA 4ZYEA 5IT9Z 3FX3A 4FHTA 3WTSC 4OIPF 5DCMA 1XN7A 1ZH5A 3WGIA 4S05A 4WCGA 5E8GA 4P9UA 1YS6A 2VBXA 1ONVA 1OYYA 2QBYA 1IN6A 2NNNA 1ZYRF 3SQNA 3FXQA 3DP7A 1FYLA 2KJBA 2O3FA 2V9VA 3HSFA 2ZMEA 3F8FA 2FNPA 1H0MA 2VBYA 1U5TC 2GA2A 4ON0A 1T98A 1P6RA 1W5SA 4U88A 1WRJA 3BOQA 2XROA 2UZKA 2FBHA 2W84A 4A0YA 5ICGA 1SD5A 4IRGA 1MDMA 3DF8A 4PGHA 1YYVA 5D8KB 1XDUA 4CHUA 2HTJA 1S7AA 4HX4A 1D5VA 4PCQA 5K1YA 4A0ZA 2R7DA 1WKMA 4KN4X 5DUIA 3E3VA 3KLNA 4L5IA 4YFXF 4OMZA 4AIJA 3HUGA 3CUQC 3HSRA 2K86A 2MH9A 5D5VB 3QRFF 3GXOA 1B4AA 3V7CA 5L3CA 3FXRA 2GXBA 1IW7F 4WWCA 3GWZA 3REOA 1U5TA 4LLLA 5IT3A 3KLOA 4WXHA 1IZ1A 3J80K 2R7FA 3L9FA 5BS6A 3WTUC 4ESBA 3BJOA 4JK1X 1RUNA 3CO7C 1HKQA 3HRMA 3V8KA 3EETA 4ZH4F 5HDKA 2DQLA 5HOOA 4H0EA 3C3WA 2M30A 2VOPA 3E6MA 1I6XA 3SHFA 4L9NA 1SFEA 2COMA 3K1NA 2A3SA 1L0OC 4GCVA 2XVCA 1CF7B 4A12A 4QWQA 2XGXA 4EJTA 2HKOA 3CUQA 3LA3A 3MEXA 4M74A 2Y0MA 2P6SA 3IL2A 3I54A 5FFXA 5D8LB 3M8FA 1KGSA 1TLHB 1W7PD 3IWFA 4UVCA 4FT8A 1E17A 5KK1A 4WX9A 3IHUA 1W5TA 2PFBA 4N9HA 4O6JA 4LB6B 4M9SA 3QAHA 1V4RA 2Z99A 3EQLF 4EGYA 1HXDA 1HSTA 1D3YA 1OMIA 3K2ZA 2ZKZA 4MTEA 1LJ9A 3BDDA 4MEYF 3FXUA 3IKVA 4RB2C 3KP4A 1S6LA 5FD5A 2JPCA 4BXUA 4L9JA 1P4AA 1TQPA 3HRTA 4KT5C 2YX7A 3H3ZA 3GFLA 2E7WA 1ZLKA 2RC4A 3QP5A 3WU0A 4CZZA 2NNYA 1MJBA 1XB4A 1GXQA 1GHCA 3TGNA 1H9GA 2L4AA 3IC7A 1BJAA 1MJ9A 3COAC 4U0WA 2RN7A 4CYDA 2DQRA 3EDPA 3LSTA 3N97A 3BWGA 3TO9A 4P96A 1UB9A 1FSHA 3WTWC 2B0LA 1RUOA 3R0JA 5DEQA 2RGVA 3C7JA 3ZP5A 2VC0A 5FLXZ 1R1UA 4GYGA 4EJUA 4U0YA 4YIIA 3Q9VA 4HA8A 1S3JA 5E20A 3RIRA 3NRVA 5D5UB 3AAFA 5ERIA 2XAHA 1I27A 3FM5A 2IVMA 2VE8A 1TTYA 1Z7UA 4ESFA 4IHTA 1JXSA 2ZNZA 2IW5A 5E1ZB 4A0XA 3ZMDA 2PJPA 2CSOA 4XSXF 2PLYA 2IA2A 2RVCA 1AOYA 2F5FA 3JTGA 1XMKA 1QZZA 1JHFA 5FO5A 5CYVA 5H6RA 5JR3A 1HW1A 5LLQA 1R58A 2ETHA 3ELKA 1XGNA 1IXRC 1FBSA 3ZMSA 3JAMK 4L0ZB 3V7SA 5J8FA 2QYOA 1KQ8A 3DEUA 3QP6A 3CLOA 4DNCA 3E6DA 4HF1A 5ILSA 1I1SA 2P8TA 2H09A 2CGPA 4WXCA 4LFUA 3GZ6A 1F1ZA 3ISPA 2D1HA 5L3GA 2JZYA 2D1VA 1FZPB 3F8MA 2DLLA 2ZMEB 1ZAOA 2DU9A 5J6XA 2VC1A 2PG4A 4MNUA 1ODDA 1SD4A 2P6TA 2UXNA 1RNLA 2EFPA 2IPQX 2DK5A 2BEOA 2V1XA 1W7PA 4U0VA 2LNBA 1STZA 3CUOA 2K27A 1SMTA 2YR2A 1WI9A 1HW5A 2HQNA 4BQAA 4S04A 2C6YA 2QQBA 1XCBA 3RKWA 4IF4A 5HLIA 1DUXC 1Z6TA 2GIVA 1K78B 1BI2A 4LLNA 4LG0A 2OQRA 2QUFA 3GEZA 1K6OA 5FGMA 3TQNA 5LHGA 3QU3A 3V4GA 1YO5C 2VXZA 3CTAA 4M72A 1ZG1A 2UWMA 3FMQA 4ZZLA 5ILUA 3GFIA 3ZMVA 3L09A 1U5TB 1BN5A 4N0BA 1MZBA 5BQTA 1LNWA 4HF2A 5IT9K 2IJLA 2KKOA 3IRRA 2Y48A 4B8XA 2EV5A 1JGSA 3F3XA 5D6FA 4L9VA 2HWVA 3C18A 2DW4A 4P55A 2YSRA 1YLFA 2J5PA 3KETA 3SZPA 4RAYA 3GVAA 4GYIA 2A6EF 3I58A 2JRTA 2CW0F 5FFZA 3JSOA 1WWXA 5D4RA 4YIFA 3T8RA 4E70A 4MQ9F 1TNTA 4I09A 4JQFA 4GO1A 1KU9A 4G94A 2MD5A 5D4SA 3VFZA 2M8EA 1SD7A 3K0LA 5LGUA 1Z91A 3NQOA 2MH2A 1LVAA 1P4WA 2ISYA 2J5OA 4JBAA 2ISZA 3LA2A 1UCRA 1XGOA 3HSEA 5H20A 3BZ6A 1O3SA 4ENMA 3ULQB 1FP2A 3P9KA 2NYXA 4KDPA 1XDSA 3GF2A 5HS9A 3WE3A 3GW2A 1PDNC 4HDUA 2XASA 4M9ZA 3MFKA 4R79A 5AONA 2YX4A 1K79A 4RAZA 5F6FA 2RV8A 2GQQA 3LA7A 2CO5A 1O7FA 1T2KA 1K7AA 2HDCA 1FPQA 3M7GA 1HKSA 1I5ZA 3V7RA 4AVPA 4BYYA 4I2OA 1G3WA 1YW9A 1CGPA 2XAGA 5A2QZ 4CDGA 2HR3A 1USSA 2PI0A 1ZREA 4P5OA 1IN7A 2EJRA 2LDUA 3KZZA 1TQMA 1SD6A 3M1EA 4LB5A 3WE2A 2L54A 3ML6A 3C1DA 3ZN1A 2QWWA 3E6CC 2MA3A 3J7AO 3FM3A 2PN6A 4FX0A 4UVAA 2NRAC 4K2EA 1ZARA 1QGPA 1R5HA 4KNYA 2EV0A 1BI3A 2ADUA 5CVJA 1ZG5A 3MZHA 4IJAA 4UUVA 4XSZF 3I59A 1UHWA 1B9NA 3KP2A 2G7UA 1EH7A 2O8XA 5DCFA 3KP7A 2QQAA 5HDGA 2F5EA 2ZBKA 2DFIA 2GWRA 5CVUA 1YG2A 4EM0B 2PEXA 3JSPA 3KP6A 4N9IA 3KP3A 1VTNC 4RB0A 2QVOA 3K1PA 5AIQA 4BNCA 1R23A 3IRQA 1DP7P 2BYVE 2K7LA 1FOKA 4I0BA 3ZMUA 4LLGF 2FSWA 1U6GA 5F64A 4ASNA 4IHSA 2W25A 5CVVA 1XGSA 4HYEA 1ZGJA 1EV7A 4M73A 1BIAA 5HLHA 1U2WA 5BPDA 1P92A 3TKYA 4YFNF 3S2WA 1EH6A 2XHKA 5LHIA 1ZHFA 4EV0A 2G9WA 3HOSA 4HV5A 3P9IA 2F2EA 4O5VA 4M71A 4ENKA 5FLXK 2FA5A 1FBUA 1FP1D 2EFQA 4WXDA 3D0SA 4ENNA 2XIGA 3ROUA 2KIUA 4KFCA 1G3SA 3W6KB 3R60A 4BH9A 1O3TA 4UV9A 3H3UA 1XSXA 1B1BA 2VBZA 2CQKA 2L4MA 5DYMA 4AWXB 1NHAA 2KIFA 4HBLA 1O57A 4EMSA 3WTVC 3I71A 1Q1HA 4ZYDA 3F6VA 4KICA 5EEGA 2VONA 1FY7A 3SZTA 4CO8A 3SFZA 1YS7A 4BHBA 4I7HA 3SXYA 1W4MA 4AD9A 1LDDA 2EB7A 1ULYA 3TDUC 6PAXA 3LQQA 1J2XA 1RZ4A 3ZPLA 2H6CA 3Q9SA 2Q8KA 2WWYA 2HEOA 2Z5UA 5FD6A 4LK1F 2L02A 1XSVA 1USTA 2NAZA 4A2UA 1PP8F 1LEAA 4I98B 4UHTA 5D5WB 1XMAA 3WG9A 4RB1A 5J8CA 3GLXA 2A5YB 3GFMA 1O7LA 3O6BB 3GO5A 4WF2A 1R7JA 2NS0A 1HSJA 3B02A 1BC7C 4PDKA 5CVRA 2MC3A 1OYWA 1R1VA 3LWFA 3BJ6A 3TO7A 3BJAA 3R4KA 2FNAA 2ESHA 3RI4A 1QNTA 1IN5A 4EJWA 3DPLC 4IPAA 2JSCA 4KYWA 3P7NA 3FMSA 2K02A 2HOEA 3P9CA 3O3KA 2QLZA 1LDJA 2OD5A 2AS5F 2P5VA 5JHUA 3B73A 2OA4A 1XGMA 3E5UA 1JE8A 2QENA 4LMYA 3M9AA 3K69A 2FMLA 3ERED 4ESJA 2DAOA 4P9FA 3W6JB 2OZ6A 5DCMB 2D45A 4EM2A 2PMUA 3F72A 1QZYA 1CF7A 1G3TA 2FU4A 3TDZC 4A6EA 2GXGA 3DXJF 3F6OA 2P7CB 4HLXA 5DD8A 2QBYB 1TW3A 4L5JA 1ZG3A 1FSEA 4CICA 1D8KA 4R1HA 2K4BA 2OBPA 2XAJA 2W57A 4UNOA 2Z3YA 2KRFA 5CVIA 3MWMA 2STTA 2O6GE 1OPCA 3WGGA 4HLYA 2YU3A 3E97A 1R22A 3ZMZA 4G9YA 4YG2F 3ZMTA 3ECOA 1MDMB 5F1RA 1YW8A 2MBFA 1E2XA 4Z2YA 2VOOA 3EYYA 4A6DA 2H27A 5D5XB 4NQWA 1P4XA 5CLSA 4ZYHA 4CXFA 1F5TA 1I1GA 2V79A 2FEZA 4OIQF 2HKXA 3BPXA 1HW2A 4XRFA 1Z6RA 4QLCU 5ICCA 2DPDA 4LD5A 1GVJA 1HQCA 5LBQA 1OR7A 1BOAA 5DUKA 3E5XA 4ZYGA 5TRDA 2K4JA 1S7OA 3VB2A 3GX4X 2M5WA 3IKTA 4CGZA 3GUDA 3LAJA 5K5QA 2A61A 3G73A 1KYZA 5K5RA 3KE2A 1KYWA 1O3RA 3T5XA 4RB3C 2A68F 3LFKA 5KVRA 1G4DA 1J9IA 2EFOA 3WODF 4B09A 1HKTA 2PMHA 1G6NA 4KIBA 3F8NA 3OOPA 1YFHA 2DK8A 4Y17A 3CUQB 4R8HA 3HOTA 2ELHA 3WGHA 4M6XA 4OIRF 3FZVA 1ZRDA 3JTHA 3GZ5A 1U3EM 1HBXG 5DD4A 1AWCA 5L3DA 5ICFA 5A2QK 2LF7A 5LGNA 2Q0OA 3E5QA 2PQ8A 4Y15A 5LRRA 1FX7A 2OZUA 3HIFA 2DO7A 1XD7A 3G3ZA 5K5OA 3KEOA 4DQ2A 4WK8F 3QOPA 4RS8A 1B9MA 4UV8A 2BBYA 3HTUA 3E6BA 3RYPA 5E17F 3T8TA 1YW7A 3HRUA 3R61A 2Y75A 4PGGA 2IRFG 3U9GA 3ZQ7A 1YTYA 1KU7A 1IUYA 1FNNA 3BPVA 1U78A 1T38A 2IP2A 5LEJA 4UXNA 4IRHA 4OOIA 3RDIA 4TV7A 3OV8A 1PP7U 3FMRA 4UVBA 4Q5SF 3O2PE 4A5NA 3QPHA 3T0YA 1A04A 2GA1A 2CWEA 1ON2A 1DPUA 3VOEA 1L3LA 4HV6A 3MZYA 1IF1A 4I02A 2HYGD 3ECHA 3R0AA 3M8EA 5TJJA 5ICEA 4GGGA 3WTTC 1V3FA 1FYMA 1FWZA 5HS7A 5E8IA 5LHHA 3F23A 1TNSA 3ABUA 2MLKA 3KCCA 1IRGA 2ZO4A 3I5UA 1F4KA 1UFMA 4ENJA 1YIOA 2Z33A 1OKRA 1FBQA 2H94A 3U1DA 4ZZDA 3J81Z 2P5LC 2FOKA 3F8CA 1K78A 4L0YB 3MQ0A 4HF0A 1IN8A 3CO6C 1FC3A 4Q47A 1LQ1A 2ZJ2A 3R6SA 4AIKA 2AXLA 4RGRA 4G6DA 2OU2A 2HTSA 2VT3A 1TBXA 3QPTA 2R3SA 2FE3A 3TOBA 2E1CA 2FXAA 1P2FA 4Q48A 4OU0A 4OMYA 3I4PA 1BI0A 3TOAA 1J5YA 4LJZF 5LEKA 3WTYC 2STWA 2M1BA 2VN2A 2RNJA 2YPRA 1SAXA 1IN4A 2A6HF 2EA4A 1FLIA 4MTDA 2ZFWA 5HLGA 2DTRA 2V1UA 3NEUA 2GAUA 2EFNA 5BPIA 5ILVA 2XKPA 1WQ2A 1T6SA 2PBIA 1S8NA 2XV4S 4HX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TO6 A;  2JPB A;  3WU1 B;  1IAW A;  2XUB A;  2JT1 A;  2HS5 A;  4U7D A;  1PUE E;  5AIP A;  3FHZ A;  1W7P B;  3CDH A;  3Q5F A;  1JHH A;  2Z9O A;  1OYI A;  2HYF A;  4KMU X;  2V1D A;  5HVQ C;  4M6Y A;  4RGU A;  4HOB A;  4I01 A;  1J7K A;  4BHP A;  2O61 A;  1YQA A;  2O03 A;  1J0R A;  3DFG A;  4FX4 A;  3CJN A;  3J80 Z;  2ZXJ A;  3LAP A;  4EJO A;  4A5M A;  1QBJ A;  4KIG A;  1H9T A;  3RPU A;  2OQG A;  4NHJ A;  2RDP A;  3PFI A;  4LG0 B;  2EA2 A;  3GFJ A;  3JW4 A;  1IXC A;  4HQE A;  3PQJ A;  1LEB A;  1MD0 A;  4KUM A;  4ETS A;  1G3Y A;  5BOX A;  4U7B A;  3BRO A;  2EWN A;  4EVI A;  3L7W A;  1O3Q A;  4O3M A;  2O0Y A;  1U8R A;  5HS8 A;  3FF5 A;  3K9T A;  1GXP A;  3ABT A;  2XAQ A;  2BV6 A;  4HAM A;  2WV0 A;  5FB2 A;  1EH8 A;  2XRN A;  3K1M A;  4M9X A;  2RQP A;  2HFH A;  2VBW A;  3PQK A;  3DPT A;  2P7V B;  2HZT A;  3U2R A;  3BP8 A;  1QQI A;  1QPM A;  2JTV A;  3HTS B;  1R00 A;  3GYH X;  4KN7 X;  3RJP A;  5EEH A;  4BHC A;  2D2W A;  2MLG A;  3V8L A;  4LK0 F;  1T39 A;  2CYY A;  2ESN A;  1IRF A;  1D8J A;  3KP5 A;  4KIF A;  2XAF A;  2L3D A;  2HGC A;  3BY6 A;  5BMZ A;  1Z1D A;  4I0A A;  1R36 A;  1RIO H;  3L2C A;  1BIB A;  1LDK B;  4GXO A;  2KIM A;  3QU6 A;  4Y13 A;  4EQQ A;  2W24 A;  5D6E A;  4IXA A;  5JVT A;  3WTX C;  3DV8 A;  4G8X A;  3V8J A;  2IA0 A;  3WTZ A;  4HZF A;  1BM9 A;  1MKM A;  1ZRC A;  1R5G A;  1IXS B;  3LQR A;  4Q4Z F;  3T1B A;  3HHH A;  5LGT A;  3F22 A;  1KU2 A;  2VOD A;  1BBY A;  5JFR A;  1T0F A;  3DQV C;  1BI1 A;  5CJ9 A;  2IT0 A;  4G7H F;  1B59 A;  2W85 A;  1ZGA A;  4RGX A;  2A69 F;  2FQ3 A;  3VOD A;  1WSU A;  3HRS A;  5DDG A;  2BE5 F;  5E1W A;  1KA8 A;  2E7X A;  3I0T A;  2EK5 A;  1UHM A;  4MGR A;  3N4M A;  1C0W A;  2UXX A;  1ZN2 A;  2V6C A;  1RI7 A;  3MCZ A;  1B6A A;  4IVN A;  1LB2 A;  1REP C;  3H92 A;  4HX7 A;  1ZLJ A;  2ZNY A;  2IA1 A;  2FMY A;  4L9T A;  2TDX A;  1XCV A;  2FBK A;  2FF4 A;  2XKO A;  2X0L A;  2EV6 A;  2F5C A;  1QO0 D;  2DI3 A;  2ACJ A;  4G6Q A;  3RTR A;  4MEX F;  5E18 F;  1F9N A;  3RPQ A;  4LGW A;  1R1T A;  3RKX A;  3L00 A;  2VE9 A;  4AIH A;  1MGT A;  4D0P A;  1Z05 A;  2KJC A;  4HW0 A;  5JI6 A;  5ED4 A;  4XLP F;  4PZJ A;  3JAM Z;  4XBF A;  4HDV A;  2CG4 A;  2X4H A;  1TW2 A;  1DPR A;  4KMF A;  1KQ9 A;  3I53 A;  5L3B A;  2DBB A;  2EFW A;  3MAJ A;  5L3E A;  2CFX A;  2M45 A;  3I59 B;  2L01 A;  4KA4 A;  3VEP A;  4BAY A;  2QM3 A;  5E1X A;  2QZ8 A;  2RKH A;  4EJV A;  2DPU A;  1SFX A;  2LKP A;  1J59 A;  2M87 A;  2WC2 A;  5LRS A;  5H6Q A;  3HYI A;  4NB5 A;  4G7O F;  1S29 A;  1FT9 A;  2FRH A;  3DKW A;  1J75 A;  2BGC A;  4YFK F;  1XSD A;  2Q2E A;  1SFU A;  1ZRF A;  4OIO F;  3IWZ A;  2F5D A;  2FBI A;  3KEQ A;  4MQV A;  2H6B A;  4OIN F;  5HDN A;  4RGS A;  4EM1 A;  4L18 B;  1Y0U A;  2WTE A;  2P4W A;  1MJA A;  2DT5 A;  3D5L A;  3HHG A;  3EUH A;  2HQR A;  1KU3 A;  2LF8 A;  4G7Z F;  5L3F A;  4F7Z A;  4EGZ A;  2ZCW A;  2A07 F;  2OAZ A;  3EYI A;  1FYK A;  1ON1 A;  4IRI A;  1BC8 C;  3FWE A;  3ZN0 A;  3KFW X;  1DDN A;  1TQI A;  1SMY F;  4MHG A;  4XLN F;  1X3U A;  3F21 A;  1KQ0 A;  2E1N A;  2P5K A;  3J81 K;  2VT2 A;  3F8B A;  2G7H A;  1Z9C A;  3RYR A;  4HQM A;  2QQ9 A;  2GZW A;  2LSO A;  3KZY A;  5DV5 A;  3I64 A;  3RKY A;  4ZYE A;  5IT9 Z;  3FX3 A;  4FHT A;  3WTS C;  4OIP F;  5DCM A;  1XN7 A;  1ZH5 A;  3WGI A;  4S05 A;  4WCG A;  5E8G A;  4P9U A;  1YS6 A;  2VBX A;  1ONV A;  1OYY A;  2QBY A;  1IN6 A;  2NNN A;  1ZYR F;  3SQN A;  3FXQ A;  3DP7 A;  1FYL A;  2KJB A;  2O3F A;  2V9V A;  3HSF A;  2ZME A;  3F8F A;  2FNP A;  1H0M A;  2VBY A;  1U5T C;  2GA2 A;  4ON0 A;  1T98 A;  1P6R A;  1W5S A;  4U88 A;  1WRJ A;  3BOQ A;  2XRO A;  2UZK A;  2FBH A;  2W84 A;  4A0Y A;  5ICG A;  1SD5 A;  4IRG A;  1MDM A;  3DF8 A;  4PGH A;  1YYV A;  5D8K B;  1XDU A;  4CHU A;  2HTJ A;  1S7A A;  4HX4 A;  1D5V A;  4PCQ A;  5K1Y A;  4A0Z A;  2R7D A;  1WKM A;  4KN4 X;  5DUI A;  3E3V A;  3KLN A;  4L5I A;  4YFX F;  4OMZ A;  4AIJ A;  3HUG A;  3CUQ C;  3HSR A;  2K86 A;  2MH9 A;  5D5V B;  3QRF F;  3GXO A;  1B4A A;  3V7C A;  5L3C A;  3FXR A;  2GXB A;  1IW7 F;  4WWC A;  3GWZ A;  3REO A;  1U5T A;  4LLL A;  5IT3 A;  3KLO A;  4WXH A;  1IZ1 A;  3J80 K;  2R7F A;  3L9F A;  5BS6 A;  3WTU C;  4ESB A;  3BJO A;  4JK1 X;  1RUN A;  3CO7 C;  1HKQ A;  3HRM A;  3V8K A;  3EET A;  4ZH4 F;  5HDK A;  2DQL A;  5HOO A;  4H0E A;  3C3W A;  2M30 A;  2VOP A;  3E6M A;  1I6X A;  3SHF A;  4L9N A;  1SFE A;  2COM A;  3K1N A;  2A3S A;  1L0O C;  4GCV A;  2XVC A;  1CF7 B;  4A12 A;  4QWQ A;  2XGX A;  4EJT A;  2HKO A;  3CUQ A;  3LA3 A;  3MEX A;  4M74 A;  2Y0M A;  2P6S A;  3IL2 A;  3I54 A;  5FFX A;  5D8L B;  3M8F A;  1KGS A;  1TLH B;  1W7P D;  3IWF A;  4UVC A;  4FT8 A;  1E17 A;  5KK1 A;  4WX9 A;  3IHU A;  1W5T A;  2PFB A;  4N9H A;  4O6J A;  4LB6 B;  4M9S A;  3QAH A;  1V4R A;  2Z99 A;  3EQL F;  4EGY A;  1HXD A;  1HST A;  1D3Y A;  1OMI A;  3K2Z A;  2ZKZ A;  4MTE A;  1LJ9 A;  3BDD A;  4MEY F;  3FXU A;  3IKV A;  4RB2 C;  3KP4 A;  1S6L A;  5FD5 A;  2JPC A;  4BXU A;  4L9J A;  1P4A A;  1TQP A;  3HRT A;  4KT5 C;  2YX7 A;  3H3Z A;  3GFL A;  2E7W A;  1ZLK A;  2RC4 A;  3QP5 A;  3WU0 A;  4CZZ A;  2NNY A;  1MJB A;  1XB4 A;  1GXQ A;  1GHC A;  3TGN A;  1H9G A;  2L4A A;  3IC7 A;  1BJA A;  1MJ9 A;  3COA C;  4U0W A;  2RN7 A;  4CYD A;  2DQR A;  3EDP A;  3LST A;  3N97 A;  3BWG A;  3TO9 A;  4P96 A;  1UB9 A;  1FSH A;  3WTW C;  2B0L A;  1RUO A;  3R0J A;  5DEQ A;  2RGV A;  3C7J A;  3ZP5 A;  2VC0 A;  5FLX Z;  1R1U A;  4GYG A;  4EJU A;  4U0Y A;  4YII A;  3Q9V A;  4HA8 A;  1S3J A;  5E20 A;  3RIR A;  3NRV A;  5D5U B;  3AAF A;  5ERI A;  2XAH A;  1I27 A;  3FM5 A;  2IVM A;  2VE8 A;  1TTY A;  1Z7U A;  4ESF A;  4IHT A;  1JXS A;  2ZNZ A;  2IW5 A;  5E1Z B;  4A0X A;  3ZMD A;  2PJP A;  2CSO A;  4XSX F;  2PLY A;  2IA2 A;  2RVC A;  1AOY A;  2F5F A;  3JTG A;  1XMK A;  1QZZ A;  1JHF A;  5FO5 A;  5CYV A;  5H6R A;  5JR3 A;  1HW1 A;  5LLQ A;  1R58 A;  2ETH A;  3ELK A;  1XGN A;  1IXR C;  1FBS A;  3ZMS A;  3JAM K;  4L0Z B;  3V7S A;  5J8F A;  2QYO A;  1KQ8 A;  3DEU A;  3QP6 A;  3CLO A;  4DNC A;  3E6D A;  4HF1 A;  5ILS A;  1I1S A;  2P8T A;  2H09 A;  2CGP A;  4WXC A;  4LFU A;  3GZ6 A;  1F1Z A;  3ISP A;  2D1H A;  5L3G A;  2JZY A;  2D1V A;  1FZP B;  3F8M A;  2DLL A;  2ZME B;  1ZAO A;  2DU9 A;  5J6X A;  2VC1 A;  2PG4 A;  4MNU A;  1ODD A;  1SD4 A;  2P6T A;  2UXN A;  1RNL A;  2EFP A;  2IPQ X;  2DK5 A;  2BEO A;  2V1X A;  1W7P A;  4U0V A;  2LNB A;  1STZ A;  3CUO A;  2K27 A;  1SMT A;  2YR2 A;  1WI9 A;  1HW5 A;  2HQN A;  4BQA A;  4S04 A;  2C6Y A;  2QQB A;  1XCB A;  3RKW A;  4IF4 A;  5HLI A;  1DUX C;  1Z6T A;  2GIV A;  1K78 B;  1BI2 A;  4LLN A;  4LG0 A;  2OQR A;  2QUF A;  3GEZ A;  1K6O A;  5FGM A;  3TQN A;  5LHG A;  3QU3 A;  3V4G A;  1YO5 C;  2VXZ A;  3CTA A;  4M72 A;  1ZG1 A;  2UWM A;  3FMQ A;  4ZZL A;  5ILU A;  3GFI A;  3ZMV A;  3L09 A;  1U5T B;  1BN5 A;  4N0B A;  1MZB A;  5BQT A;  1LNW A;  4HF2 A;  5IT9 K;  2IJL A;  2KKO A;  3IRR A;  2Y48 A;  4B8X A;  2EV5 A;  1JGS A;  3F3X A;  5D6F A;  4L9V A;  2HWV A;  3C18 A;  2DW4 A;  4P55 A;  2YSR A;  1YLF A;  2J5P A;  3KET A;  3SZP A;  4RAY A;  3GVA A;  4GYI A;  2A6E F;  3I58 A;  2JRT A;  2CW0 F;  5FFZ A;  3JSO A;  1WWX A;  5D4R A;  4YIF A;  3T8R A;  4E70 A;  4MQ9 F;  1TNT A;  4I09 A;  4JQF A;  4GO1 A;  1KU9 A;  4G94 A;  2MD5 A;  5D4S A;  3VFZ A;  2M8E A;  1SD7 A;  3K0L A;  5LGU A;  1Z91 A;  3NQO A;  2MH2 A;  1LVA A;  1P4W A;  2ISY A;  2J5O A;  4JBA A;  2ISZ A;  3LA2 A;  1UCR A;  1XGO A;  3HSE A;  5H20 A;  3BZ6 A;  1O3S A;  4ENM A;  3ULQ B;  1FP2 A;  3P9K A;  2NYX A;  4KDP A;  1XDS A;  3GF2 A;  5HS9 A;  3WE3 A;  3GW2 A;  1PDN C;  4HDU A;  2XAS A;  4M9Z A;  3MFK A;  4R79 A;  5AON A;  2YX4 A;  1K79 A;  4RAZ A;  5F6F A;  2RV8 A;  2GQQ A;  3LA7 A;  2CO5 A;  1O7F A;  1T2K A;  1K7A A;  2HDC A;  1FPQ A;  3M7G A;  1HKS A;  1I5Z A;  3V7R A;  4AVP A;  4BYY A;  4I2O A;  1G3W A;  1YW9 A;  1CGP A;  2XAG A;  5A2Q Z;  4CDG A;  2HR3 A;  1USS A;  2PI0 A;  1ZRE A;  4P5O A;  1IN7 A;  2EJR A;  2LDU A;  3KZZ A;  1TQM A;  1SD6 A;  3M1E A;  4LB5 A;  3WE2 A;  2L54 A;  3ML6 A;  3C1D A;  3ZN1 A;  2QWW A;  3E6C C;  2MA3 A;  3J7A O;  3FM3 A;  2PN6 A;  4FX0 A;  4UVA A;  2NRA C;  4K2E A;  1ZAR A;  1QGP A;  1R5H A;  4KNY A;  2EV0 A;  1BI3 A;  2ADU A;  5CVJ A;  1ZG5 A;  3MZH A;  4IJA A;  4UUV A;  4XSZ F;  3I59 A;  1UHW A;  1B9N A;  3KP2 A;  2G7U A;  1EH7 A;  2O8X A;  5DCF A;  3KP7 A;  2QQA A;  5HDG A;  2F5E A;  2ZBK A;  2DFI A;  2GWR A;  5CVU A;  1YG2 A;  4EM0 B;  2PEX A;  3JSP A;  3KP6 A;  4N9I A;  3KP3 A;  1VTN C;  4RB0 A;  2QVO A;  3K1P A;  5AIQ A;  4BNC A;  1R23 A;  3IRQ A;  1DP7 P;  2BYV E;  2K7L A;  1FOK A;  4I0B A;  3ZMU A;  4LLG F;  2FSW A;  1U6G A;  5F64 A;  4ASN A;  4IHS A;  2W25 A;  5CVV A;  1XGS A;  4HYE A;  1ZGJ A;  1EV7 A;  4M73 A;  1BIA A;  5HLH A;  1U2W A;  5BPD A;  1P92 A;  3TKY A;  4YFN F;  3S2W A;  1EH6 A;  2XHK A;  5LHI A;  1ZHF A;  4EV0 A;  2G9W A;  3HOS A;  4HV5 A;  3P9I A;  2F2E A;  4O5V A;  4M71 A;  4ENK A;  5FLX K;  2FA5 A;  1FBU A;  1FP1 D;  2EFQ A;  4WXD A;  3D0S A;  4ENN A;  2XIG A;  3ROU A;  2KIU A;  4KFC A;  1G3S A;  3W6K B;  3R60 A;  4BH9 A;  1O3T A;  4UV9 A;  3H3U A;  1XSX A;  1B1B A;  2VBZ A;  2CQK A;  2L4M A;  5DYM A;  4AWX B;  1NHA A;  2KIF A;  4HBL A;  1O57 A;  4EMS A;  3WTV C;  3I71 A;  1Q1H A;  4ZYD A;  3F6V A;  4KIC A;  5EEG A;  2VON A;  1FY7 A;  3SZT A;  4CO8 A;  3SFZ A;  1YS7 A;  4BHB A;  4I7H A;  3SXY A;  1W4M A;  4AD9 A;  1LDD A;  2EB7 A;  1ULY A;  3TDU C;  6PAX A;  3LQQ A;  1J2X A;  1RZ4 A;  3ZPL A;  2H6C A;  3Q9S A;  2Q8K A;  2WWY A;  2HEO A;  2Z5U A;  5FD6 A;  4LK1 F;  2L02 A;  1XSV A;  1UST A;  2NAZ A;  4A2U A;  1PP8 F;  1LEA A;  4I98 B;  4UHT A;  5D5W B;  1XMA A;  3WG9 A;  4RB1 A;  5J8C A;  3GLX A;  2A5Y B;  3GFM A;  1O7L A;  3O6B B;  3GO5 A;  4WF2 A;  1R7J A;  2NS0 A;  1HSJ A;  3B02 A;  1BC7 C;  4PDK A;  5CVR A;  2MC3 A;  1OYW A;  1R1V A;  3LWF A;  3BJ6 A;  3TO7 A;  3BJA A;  3R4K A;  2FNA A;  2ESH A;  3RI4 A;  1QNT A;  1IN5 A;  4EJW A;  3DPL C;  4IPA A;  2JSC A;  4KYW A;  3P7N A;  3FMS A;  2K02 A;  2HOE A;  3P9C A;  3O3K A;  2QLZ A;  1LDJ A;  2OD5 A;  2AS5 F;  2P5V A;  5JHU A;  3B73 A;  2OA4 A;  1XGM A;  3E5U A;  1JE8 A;  2QEN A;  4LMY A;  3M9A A;  3K69 A;  2FML A;  3ERE D;  4ESJ A;  2DAO A;  4P9F A;  3W6J B;  2OZ6 A;  5DCM B;  2D45 A;  4EM2 A;  2PMU A;  3F72 A;  1QZY A;  1CF7 A;  1G3T A;  2FU4 A;  3TDZ C;  4A6E A;  2GXG A;  3DXJ F;  3F6O A;  2P7C B;  4HLX A;  5DD8 A;  2QBY B;  1TW3 A;  4L5J A;  1ZG3 A;  1FSE A;  4CIC A;  1D8K A;  4R1H A;  2K4B A;  2OBP A;  2XAJ A;  2W57 A;  4UNO A;  2Z3Y A;  2KRF A;  5CVI A;  3MWM A;  2STT A;  2O6G E;  1OPC A;  3WGG A;  4HLY A;  2YU3 A;  3E97 A;  1R22 A;  3ZMZ A;  4G9Y A;  4YG2 F;  3ZMT A;  3ECO A;  1MDM B;  5F1R A;  1YW8 A;  2MBF A;  1E2X A;  4Z2Y A;  2VOO A;  3EYY A;  4A6D A;  2H27 A;  5D5X B;  4NQW A;  1P4X A;  5CLS A;  4ZYH A;  4CXF A;  1F5T A;  1I1G A;  2V79 A;  2FEZ A;  4OIQ F;  2HKX A;  3BPX A;  1HW2 A;  4XRF A;  1Z6R A;  4QLC U;  5ICC A;  2DPD A;  4LD5 A;  1GVJ A;  1HQC A;  5LBQ A;  1OR7 A;  1BOA A;  5DUK A;  3E5X A;  4ZYG A;  5TRD A;  2K4J A;  1S7O A;  3VB2 A;  3GX4 X;  2M5W A;  3IKT A;  4CGZ A;  3GUD A;  3LAJ A;  5K5Q A;  2A61 A;  3G73 A;  1KYZ A;  5K5R A;  3KE2 A;  1KYW A;  1O3R A;  3T5X A;  4RB3 C;  2A68 F;  3LFK A;  5KVR A;  1G4D A;  1J9I A;  2EFO A;  3WOD F;  4B09 A;  1HKT A;  2PMH A;  1G6N A;  4KIB A;  3F8N A;  3OOP A;  1YFH A;  2DK8 A;  4Y17 A;  3CUQ B;  4R8H A;  3HOT A;  2ELH A;  3WGH A;  4M6X A;  4OIR F;  3FZV A;  1ZRD A;  3JTH A;  3GZ5 A;  1U3E M;  1HBX G;  5DD4 A;  1AWC A;  5L3D A;  5ICF A;  5A2Q K;  2LF7 A;  5LGN A;  2Q0O A;  3E5Q A;  2PQ8 A;  4Y15 A;  5LRR A;  1FX7 A;  2OZU A;  3HIF A;  2DO7 A;  1XD7 A;  3G3Z A;  5K5O A;  3KEO A;  4DQ2 A;  4WK8 F;  3QOP A;  4RS8 A;  1B9M A;  4UV8 A;  2BBY A;  3HTU A;  3E6B A;  3RYP A;  5E17 F;  3T8T A;  1YW7 A;  3HRU A;  3R61 A;  2Y75 A;  4PGG A;  2IRF G;  3U9G A;  3ZQ7 A;  1YTY A;  1KU7 A;  1IUY A;  1FNN A;  3BPV A;  1U78 A;  1T38 A;  2IP2 A;  5LEJ A;  4UXN A;  4IRH A;  4OOI A;  3RDI A;  4TV7 A;  3OV8 A;  1PP7 U;  3FMR A;  4UVB A;  4Q5S F;  3O2P E;  4A5N A;  3QPH A;  3T0Y A;  1A04 A;  2GA1 A;  2CWE A;  1ON2 A;  1DPU A;  3VOE A;  1L3L A;  4HV6 A;  3MZY A;  1IF1 A;  4I02 A;  2HYG D;  3ECH A;  3R0A A;  3M8E A;  5TJJ A;  5ICE A;  4GGG A;  3WTT C;  1V3F A;  1FYM A;  1FWZ A;  5HS7 A;  5E8I A;  5LHH A;  3F23 A;  1TNS A;  3ABU A;  2MLK A;  3KCC A;  1IRG A;  2ZO4 A;  3I5U A;  1F4K A;  1UFM A;  4ENJ A;  1YIO A;  2Z33 A;  1OKR A;  1FBQ A;  2H94 A;  3U1D A;  4ZZD A;  3J81 Z;  2P5L C;  2FOK A;  3F8C A;  1K78 A;  4L0Y B;  3MQ0 A;  4HF0 A;  1IN8 A;  3CO6 C;  1FC3 A;  4Q47 A;  1LQ1 A;  2ZJ2 A;  3R6S A;  4AIK A;  2AXL A;  4RGR A;  4G6D A;  2OU2 A;  2HTS A;  2VT3 A;  1TBX A;  3QPT A;  2R3S A;  2FE3 A;  3TOB A;  2E1C A;  2FXA A;  1P2F A;  4Q48 A;  4OU0 A;  4OMY A;  3I4P A;  1BI0 A;  3TOA A;  1J5Y A;  4LJZ F;  5LEK A;  3WTY C;  2STW A;  2M1B A;  2VN2 A;  2RNJ A;  2YPR A;  1SAX A;  1IN4 A;  2A6H F;  2EA4 A;  1FLI A;  4MTD A;  2ZFW A;  5HLG A;  2DTR A;  2V1U A;  3NEU A;  2GAU A;  2EFN A;  5BPI A;  5ILV A;  2XKP A;  1WQ2 A;  1T6S A;  2PBI A;  1S8N A;  2XV4 S;  4HX8 A; 
#chains in the Genus database with same CATH topology
 3M1C A;  3TO6 A;  2JPB A;  3WU1 B;  2L7Z A;  1AA7 A;  3CJQ B;  3S17 J;  3OYE A;  1IAW A;  2XUB A;  3FXK A;  2JT1 A;  2HS5 A;  5KHD A;  4U7D A;  1ZKG A;  4HG2 A;  1K61 A;  3J7Y J;  1PUE E;  2LTP A;  2W4S A;  5AIP A;  3DLL F;  4BXX J;  2B9S A;  3FHZ A;  1W7P B;  4IOC F;  3CDH A;  3Q5F A;  1JHH A;  2Z9O A;  1OYI A;  2VAS A;  3DBR B;  2HYF A;  2ZXW H;  4KMU X;  3A01 B;  3FXL A;  2CW7 A;  2V1D A;  5HVQ C;  2N8G A;  2IGN A;  4M6Y A;  4RGU A;  3MKW B;  4HOB A;  2JN6 A;  1J7K A;  3MN2 A;  4I01 A;  3QYE A;  4M6V A;  4BHP A;  2O61 A;  1YQA A;  3CC4 I;  2EBI A;  2O03 A;  4B1R A;  1AKH A;  2Y9Y A;  1J0R A;  5J1U A;  2IEK A;  4AUX A;  3DFG A;  4FX4 A;  2AQE A;  3CJN A;  3J80 Z;  2DOE A;  1H8A C;  2ZXJ A;  5GP9 A;  3LAP A;  1RPW A;  3DKY A;  4EJO A;  4A5M A;  1QBJ A;  3BCA A;  5FKM A;  4KIG A;  4GDF A;  1H9T A;  3RPU A;  3U21 A;  4BJ5 C;  2OQG A;  4NHJ A;  4NQW B;  2RDP A;  2MSY A;  3PFI A;  4LG0 B;  2EA2 A;  1S9H A;  3GFJ A;  2K40 A;  2X9D A;  1RR7 A;  1Y1V J;  2IS4 A;  3JW4 A;  1T56 A;  1IXC A;  1FMW A;  3MKY B;  4HQE A;  2QSH X;  3GTP J;  3PQJ A;  4A93 J;  4NNJ A;  2VJ4 A;  1LEB A;  1MD0 A;  4KUM A;  4ETS A;  1G3Y A;  5BOX A;  2DOA A;  3SEZ A;  4U7B A;  3BRO A;  1FIA A;  2EWN A;  5GAH J;  4EVI A;  4HST A;  1UAA A;  3L7W A;  1O3Q A;  4BE2 A;  4O3M A;  3AL0 B;  2O0Y A;  1U8R A;  5HS8 A;  3FF5 A;  3K9T A;  3OWT A;  1GXP A;  3ZXS A;  3BR1 A;  2HYJ A;  3ABT A;  2XAQ A;  1POG A;  2BV6 A;  3NAR A;  4HAM A;  1E3H A;  2WV0 A;  5FB2 A;  4S0H B;  2JA7 J;  1EH8 A;  2XRN A;  3K1M A;  2OUM A;  4M9X A;  2RQP A;  3OL3 A;  2LOO A;  1X1B A;  2HFH A;  2VBW A;  4CA0 A;  4LOC A;  5F08 A;  3PQK A;  3DPT A;  1AHD P;  2KHM A;  4HSR A;  2P7V B;  2HZT A;  3U2R A;  3BP8 A;  3ZOB A;  1QQI A;  3EPZ A;  4IHW A;  2O8K A;  2HU9 A;  1T0F C;  4IQJ A;  1A6Q A;  1QPM A;  2JTV A;  3HTS B;  2NVT J;  3VPR A;  3KYD B;  1R00 A;  3GYH X;  4KN7 X;  2GIZ A;  3RJP A;  2FX0 A;  4HRI A;  2PMZ N;  2EZL A;  2XRL A;  5EEH A;  4BHC A;  2D2W A;  2MLG A;  3DU5 A;  3CZ6 A;  4M3F A;  3V8L A;  3BG3 A;  4I6Z A;  2H8R A;  1JT6 A;  4LK0 F;  1OCP A;  3RKQ A;  1T39 A;  4EAT A;  5LD2 C;  2CYY A;  2ESN A;  1IRF A;  3BR2 A;  3I3L A;  1YJN I;  1D8J A;  3KP5 A;  4KIF A;  5DM6 F;  2XAF A;  2L3D A;  1TWC J;  1Y8R B;  2AXT C;  2HGC A;  4PUS A;  2NXN B;  2K9L A;  3BY6 A;  4IQ4 A;  2L9V A;  3JRH A;  2ZJR F;  5BMZ A;  1Z1D A;  2I10 A;  4I0A A;  1R36 A;  4RM3 A;  5EZG A;  3L2C A;  1TWG J;  1RIO H;  1BIB A;  1LDK B;  2DA6 A;  5J1Y A;  3S15 J;  4GXO A;  3CLQ A;  3IP4 B;  2KIM A;  3QU6 A;  4Y13 A;  1TZL A;  4EQQ A;  2W24 A;  5D6E A;  4IXA A;  3SZG A;  4IL6 C;  1ZGW A;  2VL8 A;  4CSW A;  5JVT A;  3WTX C;  1J09 A;  3KPH A;  1HC8 A;  1GLN A;  3DV8 A;  1HA8 A;  3HOV J;  4G8X A;  3V8J A;  2IA0 A;  3WTZ A;  2QF7 A;  2F48 A;  4HZF A;  4BUP A;  1BM9 A;  1TP4 A;  4HNT A;  1MKM A;  2K85 A;  1ZRC A;  1R5G A;  1IXS B;  3OS2 A;  3LQR A;  4Q4Z F;  4A3L J;  1DQU A;  3T1B A;  2BHZ A;  2GBY A;  3GBG A;  3HHH A;  5LGT A;  4BBS J;  3F22 A;  1JJ8 C;  1KU2 A;  2VOD A;  3W3C A;  1BBY A;  5JFR A;  3HKZ A;  3J7A Y;  1T0F A;  2BXZ A;  3V42 A;  3OYD A;  3JRA A;  3DQV C;  4XQF A;  1BI1 A;  5CJ9 A;  2IT0 A;  3HG9 A;  4D5F A;  1I39 A;  1SC7 A;  4G7H F;  3G2B A;  1B59 A;  2W85 A;  2ICW G;  3UNG C;  1ZGA A;  2E34 A;  1FEX A;  4RGX A;  2R7U A;  3OR2 C;  4B48 A;  2A69 F;  2OJE D;  3KX2 A;  2FQ3 A;  1PVE A;  3VOD A;  1WSU A;  1NG7 A;  3OIQ A;  2DT7 B;  1APL C;  3HRS A;  4CYC A;  3FBN B;  5DDG A;  2BE5 F;  4X0G A;  2K3P A;  5E1W A;  3S3M A;  1KA8 A;  2CV1 A;  2E7X A;  3I0T A;  2R7V A;  1TT0 A;  1JKR C;  3CMY A;  2EK5 A;  1UHM A;  1PYV A;  4MGR A;  4KIS A;  4XN3 A;  2XB5 A;  3N4M A;  1C0W A;  2UXX A;  1ZN2 A;  2V6C A;  2L0K A;  1RI7 A;  3MCZ A;  1B6A A;  2LBF B;  4XRS G;  2WAD A;  4IVN A;  1ZR4 A;  1LB2 A;  1REP C;  3H92 A;  4HX7 A;  3KEY A;  1ZLJ A;  2ZNY A;  2IA1 A;  2FMY A;  2AO9 A;  3L2U A;  4L9T A;  3CCS I;  2TDX A;  4XNF A;  2E2H J;  1XCV A;  2FBK A;  1T08 B;  2FF4 A;  2XKO A;  2X0L A;  2EV6 A;  2F5C A;  1QO0 D;  2DI3 A;  1R4N B;  2ACJ A;  2DA7 A;  4PSW A;  4G6Q A;  3RTR A;  5C4J J;  4BQN A;  4MEX F;  1KZH A;  1W0U A;  5E18 F;  2MYS A;  1WI3 A;  1F9N A;  3RPQ A;  3SDG A;  1BA5 A;  4LGW A;  1R1T A;  2CRG A;  3RKX A;  3L00 A;  2VE9 A;  2UV1 A;  4AIH A;  1MGT A;  4C3H J;  4D0P A;  3CCR I;  1Z05 A;  2KJC A;  4HW0 A;  4XM3 A;  3PFY A;  5JI6 A;  5ED4 A;  1IO2 A;  4IO9 F;  4XLP F;  2CU7 A;  4HNU A;  4PZJ A;  3JAM Z;  4XBF A;  4HDV A;  1DGW Y;  4UUT A;  3GTQ J;  2CG4 A;  1QVT A;  2VIX A;  2EQR A;  2X4H A;  3H1C A;  1TW2 A;  1DPR A;  4OAY A;  4KMF A;  1KQ9 A;  1V5E A;  3QYF A;  3I53 A;  5L3B A;  1R6R A;  2DBB A;  2EFW A;  3MAJ A;  2LFB A;  5FKN A;  4DZP A;  5L3E A;  4J01 A;  2CFX A;  2M45 A;  3I59 B;  1IGN A;  3Q0W A;  1H89 C;  2L01 A;  2CUF A;  2M34 A;  4KA4 A;  4BS9 A;  3BR6 A;  3VEP A;  4BAY A;  2QM3 A;  5E1X A;  2GLO A;  2L5Q A;  2QZ8 A;  3S1N J;  2BVM A;  2RKH A;  3K2A A;  2QKM B;  4EJV A;  2QCO A;  2M0M A;  4N4O B;  2DPU A;  2RQQ A;  3G6E I;  4Y52 J;  1UG2 A;  4C3I J;  1SFX A;  1WZ2 A;  1QRY A;  2CQQ A;  2LKP A;  1J59 A;  1LKX A;  4FET A;  3GTM J;  3IH3 A;  3SYT A;  2M87 A;  2WC2 A;  5LRS A;  2TRT A;  2ZC2 A;  2V1N A;  5H6Q A;  3HYI A;  1I3Q J;  1XX5 A;  3PM1 A;  1S29 A;  1FT9 A;  4NB5 A;  4G7O F;  3HJE A;  2FRH A;  3DKW A;  1J75 A;  2BGC A;  1ETV A;  4YFK F;  1XSD A;  3DTI A;  2BHY A;  1DP3 A;  2Q2E A;  2JWT A;  5B3S H;  1SFU A;  4RLF A;  1ZRF A;  3H5A A;  3IWZ A;  2F5D A;  2FBI A;  3KEQ A;  4OIO F;  1QU3 A;  2M4K A;  2V4J C;  4MQV A;  4A3F J;  1GV2 A;  2H6B A;  2X1E A;  4OIN F;  3UR3 C;  5HDN A;  4RGS A;  1X1C A;  4EM1 A;  4OAZ A;  4L18 B;  5JLW A;  1Y0U A;  1K4S A;  4DIQ A;  2WTE A;  2P4W A;  3MZ8 A;  2QEX I;  3Q0U A;  3DPU A;  1MJA A;  2DT5 A;  3VYS B;  3D5L A;  3HHG A;  3EUH A;  4G6T B;  5EG0 A;  2HQR A;  1KU3 A;  2LF8 A;  2QSG X;  4NC7 A;  4F55 A;  5FLM J;  2BXY A;  2R5Y B;  4BDZ A;  2KRC A;  4G7Z F;  3C2H A;  5L3F A;  4F7Z A;  4EGZ A;  5IYB J;  2ZCW A;  1S7E A;  2A07 F;  2OAZ A;  5FLV A;  3EYI A;  1FYK A;  4Z6Y A;  4BU2 A;  2ZME C;  4ZC3 A;  4E7K A;  1ON1 A;  4BY1 J;  4IHX A;  2P0W A;  3G71 I;  4IRI A;  2W1O A;  5GTH C;  4DZJ A;  5JVG F;  1BC8 C;  2MG4 A;  3FWE A;  5TIS C;  3ZN0 A;  2JA2 A;  3KFW X;  4XID A;  1TQI A;  2L9R A;  1DDN A;  4A3I J;  2V6E A;  1SMY F;  3O8H A;  4MHG A;  4F93 B;  4BGD A;  4XLN F;  2HOT A;  1R4M B;  1X3U A;  3F21 A;  4KIT B;  1X4O A;  2HI3 A;  1KQ0 A;  2E1N A;  2JK3 A;  2P5K A;  3WHB A;  4II3 A;  2FJ1 A;  3J81 K;  2VT2 A;  3F8B A;  2G7H A;  2E1O A;  4CCN A;  1Z9C A;  2CUZ A;  3RYR A;  4A3D J;  3BG5 A;  4HQM A;  2QQ9 A;  2GZW A;  2LSO A;  5DTD A;  3KZI C;  3KZY A;  4AYB N;  5DV5 A;  3I64 A;  3RKY A;  4ZYE A;  5IT9 Z;  3FX3 A;  4E7H A;  5F0F A;  2XC7 A;  4FHT A;  3C2B A;  3WTS C;  2DYR H;  3AG2 H;  2WBM A;  4OIP F;  4Y4R A;  5GPA A;  2PMZ A;  5DCM A;  5E3O A;  1XN7 A;  1ZH5 A;  3WGI A;  2VKV A;  4S05 A;  4WCG A;  1VI0 A;  5E8G A;  4P9U A;  1YS6 A;  2VBX A;  1ONV A;  2NOJ B;  3Q0V A;  1MIJ A;  3CCE I;  2FD5 A;  1JUM A;  1OYY A;  2QBY A;  2DDB A;  5B66 C;  1IN6 A;  2NNN A;  3ZQI A;  3RZD J;  1ZYR F;  3SQN A;  3FXQ A;  3DP7 A;  5CPR B;  1FYL A;  3PIP F;  3LSG A;  2E19 A;  2KJB A;  1WGX A;  2IGM A;  2O3F A;  2V9V A;  3K4C A;  2ME6 A;  3HSF A;  2ZME A;  1H88 C;  1JGG A;  2A05 A;  3F8F A;  3E7L A;  2VKE A;  3S1M J;  3FXO A;  1A36 A;  2FNP A;  2OPT A;  1H0M A;  2VBY A;  1U5T C;  2GA2 A;  3OYJ A;  1JTX A;  4MFE A;  2DCE A;  4NDL A;  4E7L A;  4ON0 A;  1T98 A;  1P6R A;  1W5S A;  4U88 A;  3D5R C;  2NOG A;  1WRJ A;  3BOQ A;  3SEQ A;  2XRO A;  2O5R A;  2X51 A;  4LIV A;  1IV8 A;  2UZK A;  2FBH A;  2ZSH B;  2W84 A;  3I55 I;  3LSJ A;  4A0Y A;  5ICG A;  2XF5 A;  1SD5 A;  2IBD A;  2RNG A;  4IRG A;  4A3M J;  1MDM A;  2KMU A;  3DF8 A;  4PGH A;  1YYV A;  5D8K B;  2LLK A;  2QGU A;  1XDU A;  4D7N A;  2HTJ A;  4CHU A;  4ZDL A;  3GTL J;  4XOR A;  1S7A A;  4HX4 A;  1D5V A;  4PCQ A;  4I99 C;  2COB A;  5K1Y A;  4LIT A;  4A0Z A;  2R7D A;  1WKM A;  4KN4 X;  5DUI A;  3E3V A;  3KLN A;  4L5I A;  1LUJ B;  4YFX F;  4G12 A;  4OMZ A;  4PSX A;  1Y6I A;  2ZXH A;  1PUF B;  1U9N A;  3EUA A;  3HUG A;  4AIJ A;  3CUQ C;  2DTZ A;  3HSR A;  1X19 A;  4YEJ A;  4PK4 A;  3H5R A;  3K4N A;  3QQA A;  2K86 A;  2MH9 A;  2LP0 A;  5D5V B;  3VWB A;  2GOX B;  5KAF C;  3QRF F;  1G59 A;  3GXO A;  3GTK J;  2LKS A;  1B4A A;  3V7C A;  2X6O A;  5L3C A;  2Z16 A;  1YI2 I;  3CDL A;  3FXR A;  2GXB A;  1IW7 F;  1R49 A;  4WWC A;  3GWZ A;  3REO A;  1U5T A;  2R7R A;  4LLL A;  1N78 A;  3PUF A;  3KLO A;  5IT3 A;  1JJ6 C;  4WXH A;  1IZ1 A;  3FKI J;  3J80 K;  2R7F A;  3L9F A;  4BDY A;  2F4I A;  5BS6 A;  4ESB A;  3WTU C;  1D1A A;  3BJO A;  4JK1 X;  1RUN A;  5HNH A;  3CO7 C;  2VUM J;  1HKQ A;  1WH5 A;  3HRM A;  3V8K A;  3EET A;  4ZH4 F;  5HDK A;  2DQL A;  5HOO A;  5FRO A;  4H0E A;  3C3W A;  2M30 A;  2BY0 A;  2VOP A;  2OTL I;  3E6M A;  3VSL A;  1F36 A;  1I6X A;  4XLH A;  3RQI A;  3SHF A;  4L9N A;  1SFE A;  4ZTF A;  2COM A;  3K1N A;  2A3S A;  2HNH A;  4PFP A;  1L0O C;  4E4H A;  3W2V A;  4PJM A;  4GCV A;  3ABM H;  1HF0 A;  2PJR B;  2XVC A;  2DFH A;  2M4G A;  3HB9 A;  4A12 A;  1CF7 B;  4QWQ A;  2JUG A;  5FKK A;  2GOM A;  2DMN A;  1WJD A;  2DA4 A;  1D1C A;  1TWA J;  5FKL A;  2KQR A;  2JVH A;  2XGX A;  4JP0 A;  3P5J A;  4EJT A;  2HKO A;  3CUQ A;  2E36 A;  2OF7 A;  3LA3 A;  4FIS A;  5M5W J;  1Y39 A;  3MEX A;  5B1A H;  3OL4 A;  3CCL I;  4M74 A;  4C2T A;  2Y0M A;  4CYC B;  2P6S A;  1ENH A;  2JRM A;  3I54 A;  5FFX A;  3IL2 A;  1Y1W J;  1K6Y A;  1QVU A;  2L7M P;  5D8L B;  1E3P A;  1NG6 A;  3HL2 A;  2VQL A;  3RQ4 A;  3M8F A;  1KGS A;  4XKB A;  3MKZ A;  2Y30 A;  1TLH B;  1U8B A;  1CQT A;  1NK2 P;  1W7P D;  3IWF A;  4UVC A;  1Z77 A;  4FT8 A;  1E17 A;  3CD6 I;  5KK1 A;  2X1D A;  4WX9 A;  4LG3 A;  3IHU A;  1W5T A;  2PFB A;  4N9H A;  4O6J A;  4LB6 B;  4M9S A;  5E3L A;  1SAU A;  3PSF A;  1V5F A;  1V4R A;  3B6A A;  2BZT A;  2OC6 A;  3QAH A;  2F6C A;  5J3L A;  1SFK A;  2Z99 A;  4BQO A;  3K6G A;  3KIO A;  3EQL F;  4EGY A;  2R7O A;  1HXD A;  5EEA A;  1HST A;  1DU6 A;  1VQN I;  2A6T A;  4FAS D;  3KYL A;  4B3X A;  2XPU A;  3CCU I;  1D3Y A;  5FRM A;  1OMI A;  3K2Z A;  3QOE A;  2DA3 A;  2ZKZ A;  4MTE A;  3CMA I;  3W2A A;  1LJ9 A;  4EEF G;  3BDD A;  2M9H A;  4MEY F;  3FXU A;  1OQY A;  1XC5 A;  4MFD A;  1Z7L A;  3IKV A;  4RB2 C;  1X58 A;  1QZE A;  2E2J J;  4UY8 I;  3OYN A;  3KP4 A;  1S6L A;  5FD5 A;  4IX7 A;  4FQG A;  2IGK A;  1TWF J;  2LY1 A;  1ZTR A;  2JPC A;  2E1M C;  1BR1 A;  4L9J A;  5TGT A;  1P4A A;  1TQP A;  4BXU A;  2DMT A;  3HRT A;  3A1Y A;  4KT5 C;  2R0Q C;  2WB1 N;  1UG0 A;  1B8I B;  2YX7 A;  3E0J B;  2WAQ N;  2LMD A;  2Y69 H;  5EJC A;  3H3Z A;  3GFL A;  2E7W A;  3FIS A;  1ZLK A;  2RC4 A;  3QP5 A;  4Y7N J;  1D0X A;  3WU0 A;  4CZZ A;  3LSK A;  2NNY A;  1MJB A;  1XB4 A;  3B6C A;  4JX4 A;  1GXQ A;  4M3D A;  4BXF A;  1N25 A;  2XSD C;  2JQ7 A;  4BKX A;  1Q1V A;  1OCC H;  1WHU A;  1XPX A;  1GHC A;  3TGN A;  1H9G A;  2MW8 A;  5FRN A;  2L4A A;  3HEF A;  2X6W A;  3DWL E;  3IC7 A;  1LE8 B;  2DMU A;  1BJA A;  3BR0 A;  3DTK A;  1B72 A;  1MJ9 A;  3COA C;  1ITY A;  4U0W A;  3LSH A;  2RN7 A;  4CYD A;  2DQR A;  2V7F A;  2O9L A;  1WJ5 A;  4HEA 2;  3EDP A;  3LST A;  1A5J A;  3N97 A;  2XF7 A;  3IV5 A;  3BWG A;  1GVD A;  2CMP A;  2D5V A;  4XMY A;  3TO9 A;  3BG7 A;  2V9P A;  4P96 A;  1UB9 A;  1FSH A;  3BZK A;  4YIR X;  3WTW C;  2CQN A;  2B0L A;  4BE1 A;  1RUO A;  1JKQ C;  3R0J A;  2F4O B;  2IS6 A;  5DEQ A;  2RGV A;  3C7J A;  3ZP5 A;  2VC0 A;  5FLX Z;  3VYR B;  1R1U A;  4GYG A;  4UUS B;  4EJU A;  3PNV A;  2YS9 A;  1OFC X;  4AYB A;  4PJJ A;  4U0Y A;  4YII A;  3Q9V A;  4HA8 A;  2X48 A;  1S3J A;  5E20 A;  3RIR A;  3HGG A;  4MIM A;  3NRV A;  3AG4 H;  3K10 A;  4BJT A;  5D5U B;  3AAF A;  2R5Z A;  5ERI A;  2XAH A;  1I27 A;  3FM5 A;  2IVM A;  2AQF A;  2VE8 A;  1MMD A;  3D1N I;  1Y0N A;  1TTY A;  1Z7U A;  5M3M J;  4ESF A;  1U9O A;  2VJJ A;  4IHT A;  5C4X J;  2E60 A;  1O4X A;  1JXS A;  2ZNZ A;  2IW5 A;  2W7N A;  3AG1 H;  3A0H C;  5E1Z B;  4A0X A;  2JA5 J;  1MBF A;  3ZMD A;  2PJP A;  2CSO A;  4XSX F;  3S3O A;  2KZV A;  2YUS A;  2PLY A;  3K70 C;  3NAU A;  5EF6 A;  3OYM A;  1JT0 A;  1LVK A;  4C2M J;  2BVL A;  1R9T J;  2IA2 A;  2RVC A;  4QPQ A;  1AOY A;  2F5F A;  2WAF A;  3JTG A;  1XMK A;  1QZZ A;  4QIW N;  4L5E A;  1JHF A;  2DJI A;  5FO5 A;  5E79 C;  5CYV A;  5H6R A;  1YIT I;  3OR1 C;  1VQ6 I;  2K9M A;  3FIW A;  5JR3 A;  4HNV A;  1HW1 A;  5LLQ A;  2LYC A;  3IAS 2;  1R58 A;  2ETH A;  1ORK A;  3ELK A;  2CFO A;  1XGN A;  3HOY J;  2EZI A;  1IXR C;  3A4C A;  1FBS A;  5DS9 A;  3ZMS A;  3JAM K;  4L0Z B;  1WJE A;  5J1R A;  3V7S A;  2NVY J;  3VYT B;  5J8F A;  3BCB A;  2G0E A;  4XLA A;  2QYO A;  5J47 A;  2Y9Z A;  1KQ8 A;  4DW6 A;  3DEU A;  3NWS A;  1SAN A;  1F43 A;  3IUO A;  3QP6 A;  1X1P A;  4RAG A;  3CLO A;  4RLQ A;  2L2O A;  1NH3 A;  5K7H A;  4A3E J;  3WHC A;  1MBH A;  3E6D A;  4DNC A;  1YX3 A;  3A03 A;  2VKH A;  4HF1 A;  3I4M J;  5ILS A;  2VLA A;  1BR2 A;  1I1S A;  1VQK I;  2P8T A;  2M3A A;  3JRF A;  2H09 A;  2CGP A;  3S2D J;  3BT9 A;  4WXC A;  3H36 A;  3HZJ A;  4LFU A;  4DGW B;  3GZ6 A;  1F1Z A;  5HNF A;  4NC8 A;  1BOB A;  1D1B A;  1HDP A;  3ISP A;  3LL7 A;  2R7W A;  2D1H A;  3TW7 A;  1LFB A;  5L3G A;  1MBJ A;  1VQL I;  2JZY A;  2D1V A;  1WCM J;  1FZP B;  3F8M A;  1JKP C;  2DLL A;  1E0E A;  2ZME B;  2X6Y A;  1ZAO A;  2DU9 A;  5J6X A;  4XRS A;  1EJ9 A;  1W36 C;  3AL0 C;  2VC1 A;  2PG4 A;  2XGC A;  4MNU A;  2Y2Z A;  1ODD A;  1QA6 A;  1A35 A;  3CMM A;  1SD4 A;  2P6T A;  2UXN A;  2OCE A;  3K4J A;  1RNL A;  2EFP A;  2WA0 A;  3JRI A;  2IPQ X;  2DK5 A;  2BEO A;  2V1X A;  2Y0S N;  5J4Y A;  4P1W A;  2KT0 A;  3HM5 A;  1W7P A;  4KT6 A;  4U0V A;  2KIQ A;  2LNB A;  1STZ A;  3ZQQ A;  3CUO A;  2K27 A;  1SMT A;  1VQ4 I;  2YR2 A;  1VFC A;  1WI9 A;  1HW5 A;  2HQN A;  3W6V A;  4BQA A;  4S04 A;  2C6Y A;  2F4M B;  1S72 I;  2QQB A;  3LOC A;  1XCB A;  1GUU A;  3RKW A;  2DN0 A;  4IF4 A;  5HLI A;  3OIO A;  2XPW A;  1DUX C;  3OYF A;  1Z6T A;  2KDZ A;  2GIV A;  3W2W A;  2WY8 Q;  4I76 A;  2EH3 A;  2P81 A;  2ID3 A;  2E71 A;  2DA5 A;  5HOD A;  2WAE A;  1K78 B;  1Z67 A;  3CP8 A;  1BI2 A;  4LLN A;  2ELK A;  1V5G A;  4LG0 A;  2OQR A;  2EIM H;  2QUF A;  3AG3 H;  3GEZ A;  1K6O A;  3ERM A;  2YU9 J;  5FGM A;  3TQN A;  5LHG A;  2HVQ A;  3QU3 A;  3LNQ A;  3V4G A;  5F04 A;  2EIL H;  4YEL A;  5KAI C;  4BEH B;  1MBK A;  1YO5 C;  2VXZ A;  1IC8 A;  3CTA A;  2MC4 A;  4M72 A;  4JYK A;  1IRX A;  3CCM I;  1ZG1 A;  3ASN H;  2UWM A;  3FMQ A;  4ZZL A;  1YJW I;  4MO7 A;  5ILU A;  3A0B C;  3GFI A;  3FK6 A;  3ZMV A;  3L09 A;  4ANJ A;  1U5T B;  3HBL A;  4PJ0 C;  2PX9 A;  1BN5 A;  4N0B A;  5F0H A;  1MZB A;  5BQT A;  5F1J A;  1LNW A;  2K9Q A;  3GME A;  2E2I J;  2ZB9 A;  2HOA A;  4HF2 A;  5IT9 K;  2IJL A;  2KKO A;  3LSI A;  3IRR A;  1P7J A;  2Y48 A;  4W1U A;  4B8X A;  5C3E J;  3DEW A;  1MNM C;  2EV5 A;  1JGS A;  2DDA A;  3F3X A;  3IH4 A;  5D6F A;  4DBR A;  4L9V A;  1IUF A;  2HWV A;  3C18 A;  2DW4 A;  4P55 A;  4CZC A;  3BTL A;  2QKL B;  4E7J A;  4C30 A;  3A02 A;  4YRV A;  2YSR A;  1YLF A;  4ZDP A;  2J5P A;  5KNL A;  3KET A;  3LFU A;  3SZP A;  3HC7 A;  5K7F A;  1XG1 A;  1ETQ A;  4RAY A;  2LY9 A;  1ETY A;  5B1B H;  2K3F A;  3GVA A;  2LKX A;  4GYI A;  1T8I A;  2A6E F;  3GZN B;  1DGR M;  2WB1 A;  1P9Q C;  3I58 A;  2JRT A;  1U0J A;  2CW0 F;  1HDD C;  2WAQ A;  4M3G A;  5FFZ A;  3JSO A;  1ZR2 A;  1W0T A;  5CKT A;  1WWX A;  2EIJ H;  3QPS A;  3HDD A;  5D4R A;  4YIF A;  3T8R A;  4E70 A;  4MQ9 F;  1TNT A;  1P7I A;  2EZH A;  1GT0 C;  2HPM A;  4A3J J;  4I09 A;  4E6K G;  1VQO I;  4UB8 C;  4F91 B;  4JQF A;  4GO1 A;  1Z0X A;  1KU9 A;  4G94 A;  3ZQL A;  2MD5 A;  5D4S A;  3ESW B;  1IG7 A;  2DFF A;  1ERD A;  3VFZ A;  1OCO H;  4BQQ A;  2M8E A;  2KP6 A;  4JX6 A;  1SD7 A;  3HOW J;  3K0L A;  1MMN A;  1AKH B;  5LGU A;  2DYS H;  1Z91 A;  2JA6 J;  3NQO A;  5LFA A;  3HXL A;  2MH2 A;  1LVA A;  1P4W A;  3VSK A;  1EKE A;  2ISY A;  2J5O A;  4JBA A;  3ZGK A;  2ISZ A;  3LA2 A;  1UCR A;  1XGO A;  3GLL A;  2X6X A;  2VQC A;  4AM3 A;  3HSE A;  5H20 A;  2LRD A;  4XLF A;  2XPV A;  4XON A;  4AC0 A;  3BZ6 A;  2FOW A;  1VQM I;  1FOX A;  1O3S A;  3HOU J;  4ENM A;  4RM2 A;  2BY2 A;  3ULQ B;  1FP2 A;  3RZO J;  1RRJ A;  5IOY A;  5K7Z A;  3P9K A;  2NVX J;  2ECC A;  2NYX A;  4KDP A;  1XDS A;  3GF2 A;  1HOM A;  5HS9 A;  3WE3 A;  3GW2 A;  3ZRG A;  1AU7 A;  1PDN C;  4HDU A;  2XAS A;  4M9Z A;  3MFK A;  3VYU B;  4R79 A;  5AON A;  4F92 B;  2YX4 A;  3E1S A;  1K79 A;  4RAZ A;  5F6F A;  1W5C C;  1LPQ A;  3OSG A;  4IHV A;  2RV8 A;  2GQQ A;  5EGO A;  4E7I A;  3LA7 A;  2CO5 A;  2VJI A;  1O7F A;  2EIK H;  1UMQ A;  1T2K A;  1K7A A;  2HDC A;  4XOP A;  4IZZ A;  1FPQ A;  1G2H A;  1M1E B;  4JX5 A;  3FK7 A;  3M7G A;  4AU7 A;  1HKS A;  2VXD A;  1WJC A;  4W97 A;  1I5Z A;  2EIN H;  3V7R A;  4KJZ A;  4AVP A;  3JRC A;  2LBF A;  1A6I A;  2BY3 A;  4IOA F;  4BYY A;  5E3N A;  4I2O A;  3WU2 C;  1G3W A;  1YW9 A;  2DXI A;  2VQG A;  1CGP A;  2CV2 A;  2XAG A;  5A2Q Z;  4CDG A;  2HDD A;  5CQG A;  2M0C A;  2NS8 A;  3FKJ A;  3CME I;  1UHS A;  2HOS A;  2HR3 A;  4FE4 A;  4E7S A;  2K9N A;  2QSF X;  1USS A;  2PI0 A;  2F5V A;  4P5O A;  1ZRE A;  1IN7 A;  2R7T A;  2EJR A;  1MH3 A;  3FDY A;  2O7O A;  2LDU A;  2OV7 A;  3KZZ A;  1MMG A;  1TQM A;  1JTY A;  2LG4 A;  3ZQC A;  1SD6 A;  3M1E A;  4A69 C;  3CCV I;  4LB5 A;  1ETK A;  4XLC A;  3WE2 A;  2L54 A;  3O8G A;  1UEL B;  1Z3X A;  3CJR B;  3ML6 A;  2XSJ C;  3C1D A;  3L2R A;  3ZN1 A;  2QWW A;  2DA1 A;  2ZXI A;  3E6C C;  4XKC A;  2MA3 A;  3I56 I;  1DU0 A;  3J7A O;  3FM3 A;  1GV5 A;  2DJN A;  4ZDO A;  2XF6 A;  3ZQG A;  5IP9 J;  4V2F A;  2FUG 2;  2PN6 A;  1RR8 C;  4FX0 A;  4UVA A;  2NRA C;  3JRG A;  5IP6 A;  5KCM A;  4K2E A;  1ZAR A;  1X1A A;  1QGP A;  1R5H A;  4ZJZ A;  4KNY A;  3N05 A;  5HLT A;  2EV0 A;  1BI3 A;  2ADU A;  3F0C A;  2R7Q A;  5CVJ A;  1ZG5 A;  3MZH A;  2VB6 A;  4IJA A;  3CF5 F;  4UUV A;  4XSZ F;  3I59 A;  1UHW A;  2HVR A;  3SFI A;  1B9N A;  4MLO A;  3KP2 A;  2W82 A;  3ZR8 X;  4DJA A;  5IP7 J;  2G7U A;  3D5S C;  2KLO A;  1EH7 A;  2O8X A;  4BL0 B;  2LH9 A;  1TC3 C;  5DCF A;  3PIO F;  2LRE A;  2B63 J;  1SVL A;  3KP7 A;  2QQA A;  4M3E A;  5HDG A;  1Z21 A;  2F5E A;  3DEE A;  2Y0S A;  2XDV A;  2CS3 A;  2ZBK A;  2DFI A;  2GWR A;  4NBQ A;  3OYK A;  1X3Z B;  4PFO A;  2L9S A;  5CVU A;  4RBO A;  1YG2 A;  4EM0 B;  2PEX A;  3JSP A;  5M3F J;  3KP6 A;  5IYC J;  3M4O J;  4N9I A;  3KP3 A;  3PNY A;  2CV0 A;  1VTN C;  1WFX A;  2E5N A;  3H9Q A;  1OIS A;  3OIP A;  4RB0 A;  2IGO A;  2QVO A;  3K1P A;  5AIQ A;  4BNC A;  4F52 A;  1R23 A;  3IRQ A;  1DP7 P;  2BYV E;  2L7F P;  2K7L A;  3H3V K;  1FOK A;  2DA2 A;  1QHH D;  1IV6 A;  4I0B A;  1A31 A;  3ZMU A;  4LLG F;  2FSW A;  3K70 D;  1U6G A;  5F64 A;  2H8W A;  4XRM A;  4ASN A;  1BL0 A;  4IHS A;  2OTJ I;  2W25 A;  3BR3 A;  2RRE A;  1XGS A;  5CVV A;  4HYE A;  3NWT A;  1ZGJ A;  1EV7 A;  4M73 A;  1BIA A;  2R5Y A;  2X85 A;  5HLH A;  1U2W A;  2GXA A;  2DMQ A;  5BPD A;  3BTC A;  1P92 A;  3TKY A;  4YFN F;  2KPM A;  3S2W A;  3TBI A;  3OYH A;  4RMN A;  1EH6 A;  3F9K A;  2VJ5 A;  2XHK A;  5LHI A;  2IS2 A;  1ZHF A;  4EV0 A;  2G9W A;  3PSI A;  3TW6 A;  3DTE A;  3HOS A;  4HV5 A;  3P9I A;  1V54 H;  1T95 A;  2F2E A;  2KFD A;  2VI6 A;  3LMM A;  4O5V A;  4M71 A;  3VDX A;  4ENK A;  5CQE A;  2R93 J;  5FLX K;  2FA5 A;  3CP2 A;  1FBU A;  3S8P A;  1FP1 D;  2L7K A;  1FIP A;  2EFQ A;  3D0S A;  4WXD A;  1VQP I;  4ENN A;  1MBE A;  4QTR A;  2M2E A;  2XIG A;  1JKO C;  3ROU A;  1ZEL A;  2KIU A;  4KFC A;  4AID A;  3H35 A;  1G3S A;  2HQ5 A;  3W6K B;  3R60 A;  4M3B A;  3L2Q A;  4BH9 A;  3CJT B;  1O3T A;  1YOV B;  1WVR A;  4UV9 A;  3H3U A;  5GAG J;  4B4C A;  1XSX A;  3S93 A;  3CF2 A;  1JUP A;  1IRZ A;  1B1B A;  2VBZ A;  2CQK A;  4DYR A;  2JSP A;  1W36 D;  1BR4 A;  2L4M A;  3H5N A;  5DYM A;  4AWX B;  4ABZ A;  5FJ8 J;  1NHA A;  2KIF A;  4HBL A;  2LVS A;  2HXI A;  2B7E A;  1MMS A;  1O57 A;  3AKZ A;  4DBQ A;  2QQ8 A;  4EMS A;  3S16 J;  3WTV C;  3DBH B;  3I4N J;  2HDW A;  3I71 A;  2WV1 A;  3S1R J;  1Q1H A;  1G8X A;  5IYD J;  4ZYD A;  3F6V A;  4KIC A;  5EEG A;  2VON A;  1N75 A;  1FY7 A;  5BNG A;  3K4M A;  4CCL A;  3SZT A;  3CCY A;  4CO8 A;  1MW7 A;  3SFZ A;  1YHQ I;  3HOX J;  1YS7 A;  4BHB A;  4I7H A;  3SXY A;  1W4M A;  3K4L A;  4AD9 A;  1LDD A;  2EB7 A;  3BLY A;  1ULY A;  2W00 A;  3TDU C;  3QPL A;  6PAX A;  5F27 A;  2M7B A;  2IS1 A;  5GAE J;  3LQQ A;  4J19 A;  4OWR B;  2LY2 A;  3H9J A;  1J2X A;  1RZ4 A;  2VPR A;  2Q2E B;  3ZPL A;  2H6C A;  1TT5 B;  3Q9S A;  2NVU B;  3H0D A;  2Q8K A;  2K9S A;  4XR6 A;  2WWY A;  4ZYA A;  2HEO A;  1X2M A;  4JOM A;  2Z5U A;  3SJM A;  1UJ8 A;  5FD6 A;  4CUG A;  4LK1 F;  2L02 A;  3X2Q H;  1XSV A;  1UST A;  2NAZ A;  3QOD A;  4A2U A;  1PP8 F;  3ABL H;  1LEA A;  4I98 B;  2CQ7 A;  5EDN A;  1WJA A;  4UHT A;  3ASO H;  2CUJ A;  5D5W B;  5EG0 B;  1XMA A;  1YRN A;  3WG9 A;  4RB1 A;  5J8C A;  3GLX A;  2A5Y B;  3S3N A;  3GFM A;  1O7L A;  2X1C A;  2ID6 A;  1RKW A;  3GO5 A;  3O6B B;  4WF2 A;  1R7J A;  2NS0 A;  1HSJ A;  1YE9 A;  3BC8 A;  1PUF A;  3B02 A;  3HOZ J;  2Z1D A;  1OJL A;  3PNT A;  1BC7 C;  4PDK A;  5CVR A;  1D0Y A;  3OOU A;  2K5C A;  2MC3 A;  1R1V A;  1OYW A;  3LWF A;  4XK4 A;  1ACI A;  2XGD A;  3BJ6 A;  3TO7 A;  3BJA A;  3MKL A;  3R4K A;  3BTJ A;  2V26 A;  2FNA A;  2H1L A;  2LR8 A;  2E5Z A;  2ESH A;  1ETW A;  3GTO J;  1ZK8 A;  1QNT A;  3RI4 A;  1IN5 A;  4EJW A;  3DPL C;  4IPA A;  4B44 A;  2JSC A;  4KYW A;  3OMY A;  3GTJ J;  3P7N A;  3M8J A;  3FMS A;  4A3C J;  2K02 A;  2HOE A;  2MD0 A;  1GDT A;  3P9C A;  3O3K A;  2CUE A;  2NS7 A;  2QLZ A;  1LDJ A;  1RKT A;  2OD5 A;  1X1D A;  3K4K A;  1IJW C;  3H0G J;  2AS5 F;  1MBG A;  2P5V A;  5JHU A;  3B73 A;  2OA4 A;  1XGM A;  3CQZ J;  1IDY A;  3E5U A;  4GRI A;  1JE8 A;  2QEN A;  1HCR A;  4LMY A;  3M9A A;  3K69 A;  1VZ0 A;  2FML A;  4CH7 A;  4QSH A;  3ERE D;  4ESJ A;  1K83 J;  2DAO A;  2BW3 A;  3CCJ I;  4GFB A;  4XOT A;  4P9F A;  4XL9 A;  3W6J B;  2OZ6 A;  5DCM B;  2XAU A;  2D45 A;  4EM2 A;  2PMU A;  2ZJQ F;  3F72 A;  1QZY A;  2PJR A;  1CF7 A;  3BTI A;  1G3T A;  2FU4 A;  3TDZ C;  4A6E A;  5M5X J;  2GXG A;  3DXJ F;  3F6O A;  2P7C B;  2NVQ J;  4HLX A;  3BZC A;  5DD8 A;  1S5L C;  2QBY B;  1Y56 A;  2KL4 A;  5DM7 F;  3TMO A;  1TW3 A;  4L5J A;  1ZG3 A;  1FSE A;  4CIC A;  3BQZ A;  2ELJ A;  3C2G A;  2CQX A;  3HPH A;  3JRD A;  2CH0 A;  1D8K A;  5GAD J;  4B47 A;  4R1H A;  4Y33 A;  2K4B A;  5EGO B;  3AFH A;  1OR7 C;  2OBP A;  2XAJ A;  4XKW A;  3TL4 X;  2W57 A;  4UNO A;  2Z3Y A;  2KRF A;  5JHF A;  5CVI A;  1R5I D;  3MWM A;  2STT A;  3JCU C;  2O6G E;  5J40 A;  1OPC A;  3CC2 I;  4A3G J;  2OCC H;  1I6H J;  3WGG A;  1MSF C;  1SVO A;  1FMV A;  2HXO A;  2YU3 A;  4HLY A;  3E97 A;  1WJF A;  3DCF A;  3K7A J;  3A01 A;  2R7X A;  1R22 A;  3ZMZ A;  4G9Y A;  4YG2 F;  3L2V A;  1N77 A;  4D5C A;  2R92 J;  3ZMT A;  3ECO A;  1MDM B;  5F1R A;  1FTZ A;  1YW8 A;  5FKO A;  3G1L A;  1YJ9 I;  2MBF A;  2W48 A;  1E2X A;  2HPI A;  3K4B A;  4Z2Y A;  2VOO A;  3JRE A;  3EYY A;  4A6D A;  3HGY A;  3QWL A;  2H1K A;  1IDZ A;  4II2 A;  2H27 A;  2HZD A;  3J7Z I;  5D5X B;  4NQW A;  3CDI A;  1TWH J;  4BJ6 C;  1FTT A;  1P4X A;  5CLS A;  1W1W E;  3HUG B;  3LSR A;  3TP0 A;  4B43 A;  2CW8 A;  4ZYH A;  3JRB A;  3S1Q J;  5GTI C;  4CXF A;  1F5T A;  1I1G A;  2V79 A;  1I50 J;  2FEZ A;  3HPG A;  4NUB A;  3KYC B;  4OIQ F;  2ZSI B;  2HKX A;  3BPX A;  1HW2 A;  4ZTJ A;  5EZH A;  4XRF A;  1Z6R A;  4QLC U;  5ICC A;  2DPD A;  3EUH C;  1B8I A;  4LD5 A;  1HQC A;  1GVJ A;  5IOZ A;  1OR7 A;  5LBQ A;  1BOA A;  5DUK A;  3E5X A;  3MVP A;  3OS1 A;  2I5U A;  4ZYG A;  5TRD A;  2K4J A;  1S7O A;  4QPO A;  3VB2 A;  3GX4 X;  4BE0 A;  3FXJ A;  3ZCO A;  4A3K J;  2M5W A;  3IKT A;  4A3B J;  1K4T A;  2DOD A;  4CGZ A;  3GUD A;  4DYC A;  3LAJ A;  1PJR A;  5K5Q A;  5M5Y J;  2A61 A;  3EUK L;  1ETX A;  4UB6 C;  1KYZ A;  3G73 A;  5K5R A;  1LE8 A;  2GM4 A;  3KE2 A;  1KON A;  4PJL A;  1KYW A;  1O3R A;  1D5Y A;  2AHQ A;  1SVM A;  3T5X A;  2DMP A;  1FJL A;  4RB3 C;  3PO2 J;  2A68 F;  3DU6 A;  3LFK A;  4C2U A;  2MGQ A;  5KVR A;  1G4D A;  1J9I A;  1UZC A;  3H9G A;  2EFO A;  3WOD F;  1RC9 A;  4B09 A;  1HKT A;  2PMH A;  4BY7 J;  1G6N A;  4RA2 A;  2DT6 A;  3L2W A;  1MND A;  3OYL A;  4KIB A;  3TED A;  3F8N A;  4X6A J;  2HQA A;  1VQ8 I;  3OOP A;  1YFH A;  2DK8 A;  1RET A;  4NC6 A;  4Y17 A;  4CCJ A;  5GPC A;  3CUQ B;  4R8H A;  3HOT A;  2R7Z J;  2HVS A;  4UUS A;  1XS9 A;  3I9V 2;  2ELH A;  3WGH A;  2LK2 A;  4M6X A;  5IPA A;  1QHG A;  1VQ9 I;  4OIR F;  3GCM A;  3FZV A;  1ZRD A;  1JI8 A;  2BY1 A;  3JTH A;  3GZ5 A;  1U3E M;  3BG9 A;  1WPK A;  2KRH A;  3BG6 A;  3S2H J;  1HBX G;  2VQH A;  1Z3Y A;  2Q1Z B;  3CCQ I;  5DD4 A;  3G4S I;  1AWC A;  3ZQH A;  5L3D A;  5ICF A;  5A2Q K;  1NTC A;  2LF7 A;  5LGN A;  2Q0O A;  4CCO A;  1ETO A;  3E5Q A;  3RCO A;  3JR9 A;  3GTG J;  3QYB A;  2PQ8 A;  2XGE A;  4Y15 A;  5LRR A;  1FX7 A;  2OZU A;  3PUB A;  3HIF A;  2DO7 A;  4Y3O A;  2ZFU A;  1TL8 A;  1XD7 A;  3G3Z A;  3DLA A;  5K5O A;  3KEO A;  5F0C A;  4DQ2 A;  1HLV A;  4WK8 F;  3BR5 A;  2FQ4 A;  3QOP A;  1MSE C;  4RS8 A;  3M3Y J;  2EZK A;  1MMA A;  1B9M A;  3LSM A;  3RPU D;  4UV8 A;  2LD5 A;  2R7S A;  2BBY A;  3HTU A;  3E6B A;  3RYP A;  4V2G A;  2A5W A;  1V55 H;  1VQ7 I;  1I3A A;  5E17 F;  1LFP A;  1D0Z A;  4IKF A;  2VPL A;  1YIJ I;  1VND A;  1RES A;  2XB0 X;  2Y31 A;  2JMW A;  3T8T A;  1YW7 A;  3HRU A;  2BOL A;  4ITV A;  3R61 A;  2Y75 A;  3PJR A;  4PGG A;  2IRF G;  3U9G A;  3A2K A;  1OLT A;  3ZQ7 A;  3Q3S A;  1YTY A;  2IAI A;  1KU7 A;  1IUY A;  1FNN A;  4FTH A;  3SDB A;  3BPV A;  1U78 A;  3M07 A;  2KIS A;  1T38 A;  2IP2 A;  1XTA A;  4F3Q A;  5LEJ A;  4X1E A;  4UXN A;  1X4P A;  4IRH A;  4OOI A;  3RDI A;  4TV7 A;  3OV8 A;  3LSP A;  4PJN A;  2ZJP F;  4XN0 A;  1PP7 U;  3FMR A;  4UVB A;  1BW6 A;  3MD2 A;  4Q5S F;  3O2P E;  1WJB A;  3TP3 A;  4A5N A;  1OCZ H;  3QPH A;  3T0Y A;  1A04 A;  3G1O A;  4J00 A;  2GA1 A;  1NK3 P;  4H4K C;  2CWE A;  4CCK A;  1ON2 A;  4AVZ A;  4RAF A;  3VOE A;  2JVG A;  2WY7 Q;  5JLX A;  3OYG A;  1DPU A;  3IH2 A;  1L3L A;  4HV6 A;  1X3W B;  3MZY A;  1B72 B;  4I02 A;  1IF1 A;  2ECB A;  2HYG D;  3ECH A;  3BQY A;  3R0A A;  3M8E A;  3OYB A;  5TJJ A;  3CES A;  4XLE A;  5ICE A;  2LC2 A;  4GGG A;  3HKZ N;  4C9Y A;  1T33 A;  3WTT C;  5IY5 H;  1V3F A;  1FYM A;  1FWZ A;  5HS7 A;  5E8I A;  3FBI B;  5LHH A;  4C3J J;  3F23 A;  3S14 J;  1BW5 A;  3FHN A;  3OYI A;  3ABU A;  1TNS A;  3WG7 H;  2MLK A;  3KCC A;  3OYA A;  1IRG A;  2ZO4 A;  3G1M A;  3I5U A;  1F4K A;  1UFM A;  2M7A A;  2KZG A;  4ENJ A;  1YIO A;  2Z33 A;  1WH7 A;  3OSF A;  2QA4 I;  3PO3 J;  3OY9 A;  1OKR A;  2E1M B;  1FBQ A;  2H94 A;  2JA8 J;  2TCT A;  1YX5 A;  3ABK H;  3U1D A;  4ZZD A;  1OCR H;  1Y8Q B;  3J81 Z;  1YRN B;  1MH4 A;  2P5L C;  2FOK A;  2R5Z B;  3F8C A;  5C44 J;  4IEJ A;  1FOY A;  4DOZ A;  2MFZ A;  3MMY B;  1K78 A;  3RSN A;  4D7M A;  4L0Y B;  3MQ0 A;  2I8D A;  4HF0 A;  1IN8 A;  2UUZ A;  1R71 A;  4FE7 A;  3CO6 C;  1FC3 A;  3S32 A;  4Q47 A;  1LQ1 A;  2ZJ2 A;  2MAB A;  3R6S A;  4BEH A;  4AIK A;  2AXL A;  1SEU A;  5H2F C;  5B5E C;  4RGR A;  4IHY A;  4G6D A;  2OU2 A;  2HTS A;  2VT3 A;  1TBX A;  3QPT A;  4D9J A;  2R3S A;  2FE3 A;  3TOB A;  2E1C A;  4V19 K;  2IXS A;  2FXA A;  4U87 A;  3U1K A;  5J4V A;  1OCT C;  4DYQ A;  2DOF A;  1P2F A;  3IAM 2;  2JJ7 A;  2ME0 A;  4Q48 A;  4E7Z A;  3CC7 I;  4OU0 A;  4OMY A;  2R4G A;  1MNE A;  2V9K A;  3I4P A;  1BI0 A;  3TOA A;  3ONQ A;  1LFU P;  4RDU A;  1J5Y A;  1X2N A;  4LJZ F;  5LEK A;  2DFE A;  3WTY C;  2CJJ A;  2M1B A;  2STW A;  2VN2 A;  2RNJ A;  3DBL B;  2YPR A;  3FXM A;  1SAX A;  1IN4 A;  2A6H F;  4XKV A;  3OS0 A;  2EA4 A;  3ZQF A;  2Z2S B;  1EF4 A;  1FLI A;  2RAE A;  4CCM A;  3UKG A;  2BW3 B;  9ANT A;  3OYC A;  2KDO A;  4MTD A;  1FOW A;  1XMX A;  2ZFW A;  4FCY A;  5HLG A;  1SFO J;  2DTR A;  1VQ5 I;  4XIC A;  4LIU A;  4BBR J;  2EPF A;  2V1U A;  2L9N A;  5EYR A;  3NEU A;  2GAU A;  4B3A A;  1ZQ3 P;  2EFN A;  1JUS A;  4N4N B;  5E3M A;  5BPI A;  5ILV A;  2JUC A;  4HPQ A;  2E35 A;  1EA3 A;  3DKX A;  2XKP A;  1VF9 A;  1WQ2 A;  3PL8 A;  1T6S A;  1QPI A;  2VKD A;  3L1P A;  2M8G X;  2PBI A;  1E3O C;  1S8N A;  2XV4 S;  4BAC A;  4HX8 A;  1BJZ A;  4D1Q A; 
#chains in the Genus database with same CATH homology
 3TO6 A;  2JPB A;  3WU1 B;  1IAW A;  2XUB A;  2JT1 A;  2HS5 A;  4U7D A;  1PUE E;  5AIP A;  3FHZ A;  1W7P B;  3CDH A;  3Q5F A;  1JHH A;  2Z9O A;  1OYI A;  2HYF A;  4KMU X;  2V1D A;  5HVQ C;  4M6Y A;  4RGU A;  4HOB A;  4I01 A;  1J7K A;  4BHP A;  2O61 A;  1YQA A;  2O03 A;  1J0R A;  3DFG A;  4FX4 A;  3CJN A;  3J80 Z;  2ZXJ A;  3LAP A;  4EJO A;  4A5M A;  1QBJ A;  4KIG A;  1H9T A;  3RPU A;  2OQG A;  4NHJ A;  2RDP A;  3PFI A;  4LG0 B;  2EA2 A;  3GFJ A;  3JW4 A;  1IXC A;  4HQE A;  3PQJ A;  1LEB A;  1MD0 A;  4KUM A;  4ETS A;  1G3Y A;  5BOX A;  4U7B A;  3BRO A;  2EWN A;  4EVI A;  3L7W A;  1O3Q A;  4O3M A;  2O0Y A;  1U8R A;  5HS8 A;  3FF5 A;  3K9T A;  1GXP A;  3ABT A;  2XAQ A;  2BV6 A;  4HAM A;  2WV0 A;  5FB2 A;  1EH8 A;  2XRN A;  3K1M A;  4M9X A;  2RQP A;  2HFH A;  2VBW A;  3PQK A;  3DPT A;  2P7V B;  2HZT A;  3U2R A;  3BP8 A;  1QQI A;  1QPM A;  2JTV A;  3HTS B;  1R00 A;  3GYH X;  4KN7 X;  3RJP A;  5EEH A;  4BHC A;  2D2W A;  2MLG A;  3V8L A;  4LK0 F;  1T39 A;  2CYY A;  2ESN A;  1IRF A;  1D8J A;  3KP5 A;  4KIF A;  2XAF A;  2L3D A;  2HGC A;  3BY6 A;  5BMZ A;  1Z1D A;  4I0A A;  1R36 A;  1RIO H;  3L2C A;  1BIB A;  1LDK B;  4GXO A;  2KIM A;  3QU6 A;  4Y13 A;  4EQQ A;  2W24 A;  5D6E A;  4IXA A;  5JVT A;  3WTX C;  3DV8 A;  4G8X A;  3V8J A;  2IA0 A;  3WTZ A;  4HZF A;  1BM9 A;  1MKM A;  1ZRC A;  1R5G A;  1IXS B;  3LQR A;  4Q4Z F;  3T1B A;  3HHH A;  5LGT A;  3F22 A;  1KU2 A;  2VOD A;  1BBY A;  5JFR A;  1T0F A;  3DQV C;  1BI1 A;  5CJ9 A;  2IT0 A;  4G7H F;  1B59 A;  2W85 A;  1ZGA A;  4RGX A;  2A69 F;  2FQ3 A;  3VOD A;  1WSU A;  3HRS A;  5DDG A;  2BE5 F;  5E1W A;  1KA8 A;  2E7X A;  3I0T A;  2EK5 A;  1UHM A;  4MGR A;  3N4M A;  1C0W A;  2UXX A;  1ZN2 A;  2V6C A;  1RI7 A;  3MCZ A;  1B6A A;  4IVN A;  1LB2 A;  1REP C;  3H92 A;  4HX7 A;  1ZLJ A;  2ZNY A;  2IA1 A;  2FMY A;  4L9T A;  2TDX A;  1XCV A;  2FBK A;  2FF4 A;  2XKO A;  2X0L A;  2EV6 A;  2F5C A;  1QO0 D;  2DI3 A;  2ACJ A;  4G6Q A;  3RTR A;  4MEX F;  5E18 F;  1F9N A;  3RPQ A;  4LGW A;  1R1T A;  3RKX A;  3L00 A;  2VE9 A;  4AIH A;  1MGT A;  4D0P A;  1Z05 A;  2KJC A;  4HW0 A;  5JI6 A;  5ED4 A;  4XLP F;  4PZJ A;  3JAM Z;  4XBF A;  4HDV A;  2CG4 A;  2X4H A;  1TW2 A;  1DPR A;  4KMF A;  1KQ9 A;  3I53 A;  5L3B A;  2DBB A;  2EFW A;  3MAJ A;  5L3E A;  2CFX A;  2M45 A;  3I59 B;  2L01 A;  4KA4 A;  3VEP A;  4BAY A;  2QM3 A;  5E1X A;  2QZ8 A;  2RKH A;  4EJV A;  2DPU A;  1SFX A;  2LKP A;  1J59 A;  2M87 A;  2WC2 A;  5LRS A;  5H6Q A;  3HYI A;  4NB5 A;  4G7O F;  1S29 A;  1FT9 A;  2FRH A;  3DKW A;  1J75 A;  2BGC A;  4YFK F;  1XSD A;  2Q2E A;  1SFU A;  1ZRF A;  4OIO F;  3IWZ A;  2F5D A;  2FBI A;  3KEQ A;  4MQV A;  2H6B A;  4OIN F;  5HDN A;  4RGS A;  4EM1 A;  4L18 B;  1Y0U A;  2WTE A;  2P4W A;  1MJA A;  2DT5 A;  3D5L A;  3HHG A;  3EUH A;  2HQR A;  1KU3 A;  2LF8 A;  4G7Z F;  5L3F A;  4F7Z A;  4EGZ A;  2ZCW A;  2A07 F;  2OAZ A;  3EYI A;  1FYK A;  1ON1 A;  4IRI A;  1BC8 C;  3FWE A;  3ZN0 A;  3KFW X;  1DDN A;  1TQI A;  1SMY F;  4MHG A;  4XLN F;  1X3U A;  3F21 A;  1KQ0 A;  2E1N A;  2P5K A;  3J81 K;  2VT2 A;  3F8B A;  2G7H A;  1Z9C A;  3RYR A;  4HQM A;  2QQ9 A;  2GZW A;  2LSO A;  3KZY A;  5DV5 A;  3I64 A;  3RKY A;  4ZYE A;  5IT9 Z;  3FX3 A;  4FHT A;  3WTS C;  4OIP F;  5DCM A;  1XN7 A;  1ZH5 A;  3WGI A;  4S05 A;  4WCG A;  5E8G A;  4P9U A;  1YS6 A;  2VBX A;  1ONV A;  1OYY A;  2QBY A;  1IN6 A;  2NNN A;  1ZYR F;  3SQN A;  3FXQ A;  3DP7 A;  1FYL A;  2KJB A;  2O3F A;  2V9V A;  3HSF A;  2ZME A;  3F8F A;  2FNP A;  1H0M A;  2VBY A;  1U5T C;  2GA2 A;  4ON0 A;  1T98 A;  1P6R A;  1W5S A;  4U88 A;  1WRJ A;  3BOQ A;  2XRO A;  2UZK A;  2FBH A;  2W84 A;  4A0Y A;  5ICG A;  1SD5 A;  4IRG A;  1MDM A;  3DF8 A;  4PGH A;  1YYV A;  5D8K B;  1XDU A;  4CHU A;  2HTJ A;  1S7A A;  4HX4 A;  1D5V A;  4PCQ A;  5K1Y A;  4A0Z A;  2R7D A;  1WKM A;  4KN4 X;  5DUI A;  3E3V A;  3KLN A;  4L5I A;  4YFX F;  4OMZ A;  4AIJ A;  3HUG A;  3CUQ C;  3HSR A;  2K86 A;  2MH9 A;  5D5V B;  3QRF F;  3GXO A;  1B4A A;  3V7C A;  5L3C A;  3FXR A;  2GXB A;  1IW7 F;  4WWC A;  3GWZ A;  3REO A;  1U5T A;  4LLL A;  5IT3 A;  3KLO A;  4WXH A;  1IZ1 A;  3J80 K;  2R7F A;  3L9F A;  5BS6 A;  3WTU C;  4ESB A;  3BJO A;  4JK1 X;  1RUN A;  3CO7 C;  1HKQ A;  3HRM A;  3V8K A;  3EET A;  4ZH4 F;  5HDK A;  2DQL A;  5HOO A;  4H0E A;  3C3W A;  2M30 A;  2VOP A;  3E6M A;  1I6X A;  3SHF A;  4L9N A;  1SFE A;  2COM A;  3K1N A;  2A3S A;  1L0O C;  4GCV A;  2XVC A;  1CF7 B;  4A12 A;  4QWQ A;  2XGX A;  4EJT A;  2HKO A;  3CUQ A;  3LA3 A;  3MEX A;  4M74 A;  2Y0M A;  2P6S A;  3IL2 A;  3I54 A;  5FFX A;  5D8L B;  3M8F A;  1KGS A;  1TLH B;  1W7P D;  3IWF A;  4UVC A;  4FT8 A;  1E17 A;  5KK1 A;  4WX9 A;  3IHU A;  1W5T A;  2PFB A;  4N9H A;  4O6J A;  4LB6 B;  4M9S A;  3QAH A;  1V4R A;  2Z99 A;  3EQL F;  4EGY A;  1HXD A;  1HST A;  1D3Y A;  1OMI A;  3K2Z A;  2ZKZ A;  4MTE A;  1LJ9 A;  3BDD A;  4MEY F;  3FXU A;  3IKV A;  4RB2 C;  3KP4 A;  1S6L A;  5FD5 A;  2JPC A;  4BXU A;  4L9J A;  1P4A A;  1TQP A;  3HRT A;  4KT5 C;  2YX7 A;  3H3Z A;  3GFL A;  2E7W A;  1ZLK A;  2RC4 A;  3QP5 A;  3WU0 A;  4CZZ A;  2NNY A;  1MJB A;  1XB4 A;  1GXQ A;  1GHC A;  3TGN A;  1H9G A;  2L4A A;  3IC7 A;  1BJA A;  1MJ9 A;  3COA C;  4U0W A;  2RN7 A;  4CYD A;  2DQR A;  3EDP A;  3LST A;  3N97 A;  3BWG A;  3TO9 A;  4P96 A;  1UB9 A;  1FSH A;  3WTW C;  2B0L A;  1RUO A;  3R0J A;  5DEQ A;  2RGV A;  3C7J A;  3ZP5 A;  2VC0 A;  5FLX Z;  1R1U A;  4GYG A;  4EJU A;  4U0Y A;  4YII A;  3Q9V A;  4HA8 A;  1S3J A;  5E20 A;  3RIR A;  3NRV A;  5D5U B;  3AAF A;  5ERI A;  2XAH A;  1I27 A;  3FM5 A;  2IVM A;  2VE8 A;  1TTY A;  1Z7U A;  4ESF A;  4IHT A;  1JXS A;  2ZNZ A;  2IW5 A;  5E1Z B;  4A0X A;  3ZMD A;  2PJP A;  2CSO A;  4XSX F;  2PLY A;  2IA2 A;  2RVC A;  1AOY A;  2F5F A;  3JTG A;  1XMK A;  1QZZ A;  1JHF A;  5FO5 A;  5CYV A;  5H6R A;  5JR3 A;  1HW1 A;  5LLQ A;  1R58 A;  2ETH A;  3ELK A;  1XGN A;  1IXR C;  1FBS A;  3ZMS A;  3JAM K;  4L0Z B;  3V7S A;  5J8F A;  2QYO A;  1KQ8 A;  3DEU A;  3QP6 A;  3CLO A;  4DNC A;  3E6D A;  4HF1 A;  5ILS A;  1I1S A;  2P8T A;  2H09 A;  2CGP A;  4WXC A;  4LFU A;  3GZ6 A;  1F1Z A;  3ISP A;  2D1H A;  5L3G A;  2JZY A;  2D1V A;  1FZP B;  3F8M A;  2DLL A;  2ZME B;  1ZAO A;  2DU9 A;  5J6X A;  2VC1 A;  2PG4 A;  4MNU A;  1ODD A;  1SD4 A;  2P6T A;  2UXN A;  1RNL A;  2EFP A;  2IPQ X;  2DK5 A;  2BEO A;  2V1X A;  1W7P A;  4U0V A;  2LNB A;  1STZ A;  3CUO A;  2K27 A;  1SMT A;  2YR2 A;  1WI9 A;  1HW5 A;  2HQN A;  4BQA A;  4S04 A;  2C6Y A;  2QQB A;  1XCB A;  3RKW A;  4IF4 A;  5HLI A;  1DUX C;  1Z6T A;  2GIV A;  1K78 B;  1BI2 A;  4LLN A;  4LG0 A;  2OQR A;  2QUF A;  3GEZ A;  1K6O A;  5FGM A;  3TQN A;  5LHG A;  3QU3 A;  3V4G A;  1YO5 C;  2VXZ A;  3CTA A;  4M72 A;  1ZG1 A;  2UWM A;  3FMQ A;  4ZZL A;  5ILU A;  3GFI A;  3ZMV A;  3L09 A;  1U5T B;  1BN5 A;  4N0B A;  1MZB A;  5BQT A;  1LNW A;  4HF2 A;  5IT9 K;  2IJL A;  2KKO A;  3IRR A;  2Y48 A;  4B8X A;  2EV5 A;  1JGS A;  3F3X A;  5D6F A;  4L9V A;  2HWV A;  3C18 A;  2DW4 A;  4P55 A;  2YSR A;  1YLF A;  2J5P A;  3KET A;  3SZP A;  4RAY A;  3GVA A;  4GYI A;  2A6E F;  3I58 A;  2JRT A;  2CW0 F;  5FFZ A;  3JSO A;  1WWX A;  5D4R A;  4YIF A;  3T8R A;  4E70 A;  4MQ9 F;  1TNT A;  4I09 A;  4JQF A;  4GO1 A;  1KU9 A;  4G94 A;  2MD5 A;  5D4S A;  3VFZ A;  2M8E A;  1SD7 A;  3K0L A;  5LGU A;  1Z91 A;  3NQO A;  2MH2 A;  1LVA A;  1P4W A;  2ISY A;  2J5O A;  4JBA A;  2ISZ A;  3LA2 A;  1UCR A;  1XGO A;  3HSE A;  5H20 A;  3BZ6 A;  1O3S A;  4ENM A;  3ULQ B;  1FP2 A;  3P9K A;  2NYX A;  4KDP A;  1XDS A;  3GF2 A;  5HS9 A;  3WE3 A;  3GW2 A;  1PDN C;  4HDU A;  2XAS A;  4M9Z A;  3MFK A;  4R79 A;  5AON A;  2YX4 A;  1K79 A;  4RAZ A;  5F6F A;  2RV8 A;  2GQQ A;  3LA7 A;  2CO5 A;  1O7F A;  1T2K A;  1K7A A;  2HDC A;  1FPQ A;  3M7G A;  1HKS A;  1I5Z A;  3V7R A;  4AVP A;  4BYY A;  4I2O A;  1G3W A;  1YW9 A;  1CGP A;  2XAG A;  5A2Q Z;  4CDG A;  2HR3 A;  1USS A;  2PI0 A;  1ZRE A;  4P5O A;  1IN7 A;  2EJR A;  2LDU A;  3KZZ A;  1TQM A;  1SD6 A;  3M1E A;  4LB5 A;  3WE2 A;  2L54 A;  3ML6 A;  3C1D A;  3ZN1 A;  2QWW A;  3E6C C;  2MA3 A;  3J7A O;  3FM3 A;  2PN6 A;  4FX0 A;  4UVA A;  2NRA C;  4K2E A;  1ZAR A;  1QGP A;  1R5H A;  4KNY A;  2EV0 A;  1BI3 A;  2ADU A;  5CVJ A;  1ZG5 A;  3MZH A;  4IJA A;  4UUV A;  4XSZ F;  3I59 A;  1UHW A;  1B9N A;  3KP2 A;  2G7U A;  1EH7 A;  2O8X A;  5DCF A;  3KP7 A;  2QQA A;  5HDG A;  2F5E A;  2ZBK A;  2DFI A;  2GWR A;  5CVU A;  1YG2 A;  4EM0 B;  2PEX A;  3JSP A;  3KP6 A;  4N9I A;  3KP3 A;  1VTN C;  4RB0 A;  2QVO A;  3K1P A;  5AIQ A;  4BNC A;  1R23 A;  3IRQ A;  1DP7 P;  2BYV E;  2K7L A;  1FOK A;  4I0B A;  3ZMU A;  4LLG F;  2FSW A;  1U6G A;  5F64 A;  4ASN A;  4IHS A;  2W25 A;  5CVV A;  1XGS A;  4HYE A;  1ZGJ A;  1EV7 A;  4M73 A;  1BIA A;  5HLH A;  1U2W A;  5BPD A;  1P92 A;  3TKY A;  4YFN F;  3S2W A;  1EH6 A;  2XHK A;  5LHI A;  1ZHF A;  4EV0 A;  2G9W A;  3HOS A;  4HV5 A;  3P9I A;  2F2E A;  4O5V A;  4M71 A;  4ENK A;  5FLX K;  2FA5 A;  1FBU A;  1FP1 D;  2EFQ A;  4WXD A;  3D0S A;  4ENN A;  2XIG A;  3ROU A;  2KIU A;  4KFC A;  1G3S A;  3W6K B;  3R60 A;  4BH9 A;  1O3T A;  4UV9 A;  3H3U A;  1XSX A;  1B1B A;  2VBZ A;  2CQK A;  2L4M A;  5DYM A;  4AWX B;  1NHA A;  2KIF A;  4HBL A;  1O57 A;  4EMS A;  3WTV C;  3I71 A;  1Q1H A;  4ZYD A;  3F6V A;  4KIC A;  5EEG A;  2VON A;  1FY7 A;  3SZT A;  4CO8 A;  3SFZ A;  1YS7 A;  4BHB A;  4I7H A;  3SXY A;  1W4M A;  4AD9 A;  1LDD A;  2EB7 A;  1ULY A;  3TDU C;  6PAX A;  3LQQ A;  1J2X A;  1RZ4 A;  3ZPL A;  2H6C A;  3Q9S A;  2Q8K A;  2WWY A;  2HEO A;  2Z5U A;  5FD6 A;  4LK1 F;  2L02 A;  1XSV A;  1UST A;  2NAZ A;  4A2U A;  1PP8 F;  1LEA A;  4I98 B;  4UHT A;  5D5W B;  1XMA A;  3WG9 A;  4RB1 A;  5J8C A;  3GLX A;  2A5Y B;  3GFM A;  1O7L A;  3O6B B;  3GO5 A;  4WF2 A;  1R7J A;  2NS0 A;  1HSJ A;  3B02 A;  1BC7 C;  4PDK A;  5CVR A;  2MC3 A;  1OYW A;  1R1V A;  3LWF A;  3BJ6 A;  3TO7 A;  3BJA A;  3R4K A;  2FNA A;  2ESH A;  3RI4 A;  1QNT A;  1IN5 A;  4EJW A;  3DPL C;  4IPA A;  2JSC A;  4KYW A;  3P7N A;  3FMS A;  2K02 A;  2HOE A;  3P9C A;  3O3K A;  2QLZ A;  1LDJ A;  2OD5 A;  2AS5 F;  2P5V A;  5JHU A;  3B73 A;  2OA4 A;  1XGM A;  3E5U A;  1JE8 A;  2QEN A;  4LMY A;  3M9A A;  3K69 A;  2FML A;  3ERE D;  4ESJ A;  2DAO A;  4P9F A;  3W6J B;  2OZ6 A;  5DCM B;  2D45 A;  4EM2 A;  2PMU A;  3F72 A;  1QZY A;  1CF7 A;  1G3T A;  2FU4 A;  3TDZ C;  4A6E A;  2GXG A;  3DXJ F;  3F6O A;  2P7C B;  4HLX A;  5DD8 A;  2QBY B;  1TW3 A;  4L5J A;  1ZG3 A;  1FSE A;  4CIC A;  1D8K A;  4R1H A;  2K4B A;  2OBP A;  2XAJ A;  2W57 A;  4UNO A;  2Z3Y A;  2KRF A;  5CVI A;  3MWM A;  2STT A;  2O6G E;  1OPC A;  3WGG A;  4HLY A;  2YU3 A;  3E97 A;  1R22 A;  3ZMZ A;  4G9Y A;  4YG2 F;  3ZMT A;  3ECO A;  1MDM B;  5F1R A;  1YW8 A;  2MBF A;  1E2X A;  4Z2Y A;  2VOO A;  3EYY A;  4A6D A;  2H27 A;  5D5X B;  4NQW A;  1P4X A;  5CLS A;  4ZYH A;  4CXF A;  1F5T A;  1I1G A;  2V79 A;  2FEZ A;  4OIQ F;  2HKX A;  3BPX A;  1HW2 A;  4XRF A;  1Z6R A;  4QLC U;  5ICC A;  2DPD A;  4LD5 A;  1GVJ A;  1HQC A;  5LBQ A;  1OR7 A;  1BOA A;  5DUK A;  3E5X A;  4ZYG A;  5TRD A;  2K4J A;  1S7O A;  3VB2 A;  3GX4 X;  2M5W A;  3IKT A;  4CGZ A;  3GUD A;  3LAJ A;  5K5Q A;  2A61 A;  3G73 A;  1KYZ A;  5K5R A;  3KE2 A;  1KYW A;  1O3R A;  3T5X A;  4RB3 C;  2A68 F;  3LFK A;  5KVR A;  1G4D A;  1J9I A;  2EFO A;  3WOD F;  4B09 A;  1HKT A;  2PMH A;  1G6N A;  4KIB A;  3F8N A;  3OOP A;  1YFH A;  2DK8 A;  4Y17 A;  3CUQ B;  4R8H A;  3HOT A;  2ELH A;  3WGH A;  4M6X A;  4OIR F;  3FZV A;  1ZRD A;  3JTH A;  3GZ5 A;  1U3E M;  1HBX G;  5DD4 A;  1AWC A;  5L3D A;  5ICF A;  5A2Q K;  2LF7 A;  5LGN A;  2Q0O A;  3E5Q A;  2PQ8 A;  4Y15 A;  5LRR A;  1FX7 A;  2OZU A;  3HIF A;  2DO7 A;  1XD7 A;  3G3Z A;  5K5O A;  3KEO A;  4DQ2 A;  4WK8 F;  3QOP A;  4RS8 A;  1B9M A;  4UV8 A;  2BBY A;  3HTU A;  3E6B A;  3RYP A;  5E17 F;  3T8T A;  1YW7 A;  3HRU A;  3R61 A;  2Y75 A;  4PGG A;  2IRF G;  3U9G A;  3ZQ7 A;  1YTY A;  1KU7 A;  1IUY A;  1FNN A;  3BPV A;  1U78 A;  1T38 A;  2IP2 A;  5LEJ A;  4UXN A;  4IRH A;  4OOI A;  3RDI A;  4TV7 A;  3OV8 A;  1PP7 U;  3FMR A;  4UVB A;  4Q5S F;  3O2P E;  4A5N A;  3QPH A;  3T0Y A;  1A04 A;  2GA1 A;  2CWE A;  1ON2 A;  1DPU A;  3VOE A;  1L3L A;  4HV6 A;  3MZY A;  1IF1 A;  4I02 A;  2HYG D;  3ECH A;  3R0A A;  3M8E A;  5TJJ A;  5ICE A;  4GGG A;  3WTT C;  1V3F A;  1FYM A;  1FWZ A;  5HS7 A;  5E8I A;  5LHH A;  3F23 A;  1TNS A;  3ABU A;  2MLK A;  3KCC A;  1IRG A;  2ZO4 A;  3I5U A;  1F4K A;  1UFM A;  4ENJ A;  1YIO A;  2Z33 A;  1OKR A;  1FBQ A;  2H94 A;  3U1D A;  4ZZD A;  3J81 Z;  2P5L C;  2FOK A;  3F8C A;  1K78 A;  4L0Y B;  3MQ0 A;  4HF0 A;  1IN8 A;  3CO6 C;  1FC3 A;  4Q47 A;  1LQ1 A;  2ZJ2 A;  3R6S A;  4AIK A;  2AXL A;  4RGR A;  4G6D A;  2OU2 A;  2HTS A;  2VT3 A;  1TBX A;  3QPT A;  2R3S A;  2FE3 A;  3TOB A;  2E1C A;  2FXA A;  1P2F A;  4Q48 A;  4OU0 A;  4OMY A;  3I4P A;  1BI0 A;  3TOA A;  1J5Y A;  4LJZ F;  5LEK A;  3WTY C;  2STW A;  2M1B A;  2VN2 A;  2RNJ A;  2YPR A;  1SAX A;  1IN4 A;  2A6H F;  2EA4 A;  1FLI A;  4MTD A;  2ZFW A;  5HLG A;  2DTR A;  2V1U A;  3NEU A;  2GAU A;  2EFN A;  5BPI A;  5ILV A;  2XKP A;  1WQ2 A;  1T6S A;  2PBI A;  1S8N A;  2XV4 S;  4HX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...