4QLCU

Crystal structure of chromatosome at 3.5 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
b'SASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (167-mer)
publication title Structural Mechanisms of Nucleosome Recognition by Linker Histones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chromatin binding protein/dna
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2014-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4qlcU00
2O6GE 5D5UB 1QZZA 3GF2A 1B9MA 4KIBA 4R79A 2PEXA 3TO7A 3SFZA 4LFUA 2DO7A 1QQIA 1IN7A 2EA4A 2DTRA 1HQCA 3F8NA 4ZZDA 1UB9A 3K1NA 1RI7A 4ZYHA 1YIOA 1ONVA 1Z91A 1FLIA 2OU2A 3K1PA 3S2WA 1BI3A 4U0YA 5LRRA 4IRHA 3I58A 3DKWA 4L5JA 3CO6C 2GWRA 2P5KA 4Y17A 1GVJA 4OIOF 2IW5A 1S7OA 4HBLA 3P9IA 5IT9K 1FWZA 3KZYA 3ABUA 2HYGD 3WTUC 2UXNA 1REPC 3IC7A 2A5YB 4BQAA 1JXSA 4LG0B 2CQKA 4MEYF 3IWZA 2UXXA 1R00A 1DUXC 2PMHA 4ZZLA 2IVMA 2E7WA 3QP5A 2V1XA 4L9TA 1IAWA 4MQ9F 2ZFWA 4LMYA 1R36A 2V6CA 4GGGA 1D8JA 3RKYA 4Y13A 3V8LA 1UCRA 1DDNA 5HDKA 3K0LA 2P6SA 3WG9A 2LF7A 3ULQB 2D1HA 2Y75A 5JI6A 5HDGA 5E8IA 1J2XA 5HS7A 3COAC 1MDMB 5H6RA 1T2KA 1EH6A 3Q9VA 3LAJA 4S04A 4KFCA 1XGOA 2ZKZA 3KP5A 4UNOA 3HRUA 2F5DA 1AWCA 3J81Z 4F7ZA 2CGPA 2FBKA 3ZMDA 2P5VA 3W6JB 1PP8F 5K5RA 3HIFA 3E5UA 4P96A 2FMLA 3CJNA 1HW5A 3WU1B 4RB1A 3I64A 6PAXA 1ZH5A 1P92A 3C18A 4LGWA 3TDZC 4O5VA 4NQWA 2Z5UA 3EDPA 3FX3A 1WKMA 2GXGA 5ICCA 3QU3A 2V1DA 3QP6A 4EVIA 3FZVA 4K2EA 4B8XA 4AVPA 1J75A 4WXDA 2HS5A 4QWQA 2LDUA 4BXUA 3GO5A 1BN5A 3T5XA 3E6MA 3GFJA 5BMZA 1B9NA 2P8TA 3LFKA 3M8EA 3KEQA 4UHTA 3HTUA 1TNTA 2P7CB 3REOA 2GQQA 1MJAA 3PQKA 3ZN1A 4Q5SF 3C1DA 4HF1A 5E18F 2OQGA 2WC2A 4JQFA 1FC3A 1OYYA 5HLHA 3GXOA 1ZN2A 1YW7A 1S7AA 2Y48A 4OMYA 4MNUA 3WTZA 3SZTA 1KYWA 3HTSB 2XAFA 1FT9A 2ZNYA 3LWFA 1GXPA 2H6CA 2STWA 4N9HA 4E70A 4EM2A 2NYXA 3EYYA 4R1HA 5K5OA 3BDDA 1K6OA 3ZMVA 3T8TA 3RPQA 2Z3YA 4PZJA 3E5XA 1HKTA 1Q1HA 4MGRA 4M9ZA 1ULYA 3ERED 5D6EA 2HOEA 2VT3A 3WGIA 4EV0A 4EJWA 2W24A 1RNLA 1J59A 2CSOA 5EEGA 3NRVA 4G7HF 5LLQA 4XLPF 3DFGA 1EH7A 5FFXA 1J0RA 2K4JA 1TW2A 2BYVE 1LVAA 3KP2A 1S6LA 2RN7A 1RIOH 5FO5A 3K2ZA 4G94A 4YIFA 4M6XA 1U5TC 2A68F 3H3ZA 1XDUA 1FBQA 4UVCA 5J8CA 2IPQX 2HYFA 1FP2A 4KIGA 1YTYA 2YU3A 5L3CA 1BI1A 3I71A 5FD5A 2RDPA 2QUFA 1SMYF 1EH8A 5DCMA 5CVUA 4M71A 3F8BA 2JPCA 4GO1A 2ZCWA 1V4RA 3G73A 3FF5A 2RGVA 5FGMA 4CHUA 3HUGA 4U0VA 2FOKA 2ZXJA 2RV8A 2EA2A 2KIMA 2FMYA 1BI2A 1UFMA 3CDHA 2XVCA 1OYWA 2Q8KA 5A2QZ 4BNCA 1ZG1A 2QM3A 2HFHA 3MEXA 3EETA 2Q2EA 3LA2A 2QVOA 5AONA 4CICA 3DV8A 3K1MA 3GX4X 2VBZA 3KLOA 3PQJA 2CWEA 1Z9CA 4P5OA 1LQ1A 2FSWA 4GYGA 3ZN0A 4OU0A 1WI9A 4Y15A 2XIGA 5LBQA 4M6YA 1YW8A 1S29A 2EWNA 3QAHA 3JAMZ 2D1VA 1WWXA 1LEAA 4EM0B 3HSRA 3K9TA 3GFMA 2M5WA 4UV9A 2HKXA 3F6VA 4RB0A 2W57A 1FYMA 4M74A 4LLLA 1BOAA 2JTVA 3C3WA 4IVNA 2B0LA 5IT9Z 3V7SA 4UXNA 3ROUA 2F2EA 1ZG5A 1KA8A 4IF4A 4KIFA 2H94A 3MFKA 2DAOA 3ECHA 5LRSA 2GAUA 1YQAA 3QRFF 2RNJA 4HV6A 5DV5A 1H0MA 4P9UA 1O3RA 2COMA 3GEZA 1IXSB 1QGPA 3Q5FA 1G3TA 3EYIA 1FBUA 4LD5A 2OBPA 1Y0UA 3VEPA 5DD4A 4LJZF 2KJBA 1P6RA 4EQQA 2UWMA 2PFBA 1FZPB 2VBYA 4A0ZA 2XUBA 3M1EA 1FBSA 1QPMA 3F72A 3BPXA 1V3FA 1W7PA 4MQVA 5ILVA 2J5PA 2OD5A 5EEHA 4A0XA 5TRDA 3M9AA 4DQ2A 3VFZA 3TDUC 3TO6A 1SMTA 3T1BA 1K78A 3QU6A 4MEXF 2O61A 2EFQA 5E1WA 1J5YA 2QQAA 5D5WB 1F1ZA 2WV0A 1Z6RA 4RGXA 3F8MA 5A2QK 2ESNA 2FU4A 1U5TB 1TBXA 2QWWA 3SXYA 5DCMB 3ZPLA 1C0WA 4WCGA 2W84A 4BH9A 1BIBA 1HSJA 2VODA 3WE3A 2QQ9A 5ED4A 2O03A 4U7BA 4HQEA 1XSDA 1ODDA 1E17A 4OOIA 3HYIA 1ZREA 1J9IA 2MD5A 2VN2A 3JAMK 1PP7U 4KMFA 4GCVA 1A04A 4P55A 5F1RA 2HQRA 4IHTA 4AD9A 1FP1D 3P7NA 1ZGAA 3DXJF 2DPUA 1LDDA 3ZQ7A 4I0BA 5HLGA 2HWVA 1MZBA 2JT1A 1W5TA 5BQTA 2DLLA 3CUOA 3U9GA 5H6QA 1GHCA 1KYZA 2FXAA 4HX4A 1LDKB 1MGTA 2EJRA 1G3YA 4A6EA 3KEOA 4UUVA 2AXLA 3V8JA 2MH2A 2GXBA 2GZWA 4OMZA 2GIVA 4NHJA 1CF7A 3M8FA 2HKOA 4ZH4F 1PUEE 1XN7A 2IP2A 3U2RA 5D5VB 4ASNA 2IRFG 1S8NA 2CG4A 3IRRA 3DPTA 2W25A 3DPLC 1G3WA 1HSTA 3IKTA 3JSPA 1XDSA 3R61A 1IN4A 1LNWA 1SD5A 5J8FA 2EFPA 1R23A 3L09A 4YG2F 5LEKA 3MCZA 1B59A 2QQBA 4BHBA 4EJOA 4Q48A 5KVRA 3WGGA 3BJAA 5DDGA 2K86A 3K69A 4UVBA 1U2WA 1W7PB 3N97A 2BGCA 2JPBA 5BPDA 1HBXG 1I1SA 4HZFA 5D4RA 3L00A 4LLGF 4OIPF 3TOAA 3KFWX 2XGXA 3J80K 2EV6A 2O0YA 1TNSA 1U3EM 3O3KA 1MJ9A 2M30A 4WF2A 4I0AA 3LA3A 3GZ6A 1YYVA 1H9TA 2EV0A 4ENKA 3KP6A 3HSFA 4BYYA 4RAZA 2ZNZA 2MH9A 3R0JA 2EFOA 2P7VB 3R4KA 5HVQC 1I27A 2X0LA 1LB2A 3I53A 5ICGA 3F8FA 1J7KA 5DD8A 2KIFA 4A5MA 2DT5A 2ZO4A 4LK0F 1FYKA 1KQ8A 4BHPA 1KQ0A 3F23A 4AIKA 2FF4A 3RPUA 4I09A 3E6DA 1E2XA 2IA0A 1ZYRF 2XAGA 5D4SA 3HHGA 1R7JA 2EB7A 4G8XA 3EUHA 5D6FA 2E7XA 2NRAC 1QBJA 4A12A 3T0YA 4MTEA 4FX0A 2OQRA 3HHHA 3QPTA 2HDCA 4HOBA 3I59A 4EJTA 5JVTA 3HSEA 2R3SA 1TLHB 2Z33A 1TTYA 5AIQA 3L2CA 1BI0A 3E97A 1QNTA 2J5OA 2V1UA 3NQOA 1O7LA 4ETSA 5K1YA 3BPVA 2O8XA 1R5GA 2MC3A 5F64A 3NEUA 3W6KB 3HOSA 1G4DA 4A6DA 3E6CC 2G7UA 5BOXA 2XV4S 1T0FA 3GVAA 4HF0A 1IN5A 2DK5A 4HF2A 1FNNA 3O6BB 1PDNC 3I54A 2IJLA 2D45A 1D5VA 1TQIA 3TKYA 3F22A 2F5CA 2G7HA 2V9VA 3T8RA 1UHWA 1HKQA 2BEOA 2NNNA 1USTA 3QPHA 4G7ZF 4O3MA 4KMUX 1H9GA 3P9KA 2M45A 2KIUA 3QOPA 1B6AA 2K7LA 4PGGA 4YIIA 3WTVC 3BOQA 2MA3A 4LB6B 3FM5A 3M7GA 2FEZA 3V7RA 2V79A 5HOOA 4L9VA 3IRQA 4YFKF 1BC8C 2NS0A 1D8KA 2MLKA 2HTSA 2VOOA 1KU7A 1KQ9A 1IF1A 2G9WA 3B73A 2DQLA 3HRSA 4ZYDA 2FA5A 2DU9A 2M87A 3OOPA 4ESJA 3MZHA 5CVRA 2PG4A 1ZRCA 3G3ZA 1TW3A 4I01A 2QYOA 1QO0D 2ISZA 2VE9A 3N4MA 1FSEA 1O3SA 2VXZA 2F5EA 4RAYA 1WQ2A 3FXQA 1K79A 3E6BA 3V7CA 1YLFA 3H92A 2QZ8A 1I1GA 4HQMA 2PI0A 5DUKA 1ZGJA 2STTA 1P4AA 2KKOA 2AS5F 1ZLKA 3LAPA 1I6XA 3P9CA 1XMKA 1U6GA 2YSRA 2FNAA 2JZYA 2NAZA 3JW4A 1NHAA 1XSXA 4WXCA 4XBFA 5JFRA 3IWFA 1JGSA 3RYPA 4A0YA 3SHFA 2BBYA 2A61A 5E17F 2R7FA 4LG0A 1YFHA 4KYWA 1W7PD 4U0WA 3ZMTA 2RVCA 1HKSA 2QENA 2IT0A 2P5LC 4LB5A 3BJ6A 3CLOA 4EGYA 4LK1F 4G6QA 2IA2A 3SQNA 2HEOA 2FBHA 4GXOA 2Z99A 4IRGA 3F3XA 3RDIA 4Q4ZF 5FLXK 4I98B 1SD4A 2OAZA 3RJPA 5LHGA 4I7HA 2XKPA 1IZ1A 4Q47A 4HW0A 1IUYA 1BBYA 2HZTA 1MDMA 1QZYA 3F6OA 3HOTA 1SFXA 1P2FA 2A3SA 2XRNA 3RTRA 3C7JA 3PFIA 2M8EA 2CFXA 3E5QA 1U8RA 2MBFA 3CUQA 5BS6A 2ACJA 3GZ5A 2EV5A 3WTXC 1ZAOA 1BJAA 4O6JA 5CVIA 1ZG3A 2PJPA 3D5LA 4WXHA 2ESHA 4NB5A 4OINF 4RGRA 1XGNA 5FD6A 1IN6A 2L4AA 4L0ZB 4PCQA 4H0EA 1IXRC 3JTHA 2VOPA 5CLSA 4ZYEA 2FBIA 1OYIA 4CDGA 3FHZA 1YS7A 1R1VA 5DUIA 3FMRA 3KCCA 5L3FA 3OV8A 4KICA 3ML6A 3GFLA 4JBAA 2YR2A 2L4MA 4FT8A 3EQLF 3J80Z 5CVVA 2H27A 4MTDA 5TJJA 5LGNA 4CZZA 2H6BA 2HGCA 2DFIA 2FNPA 3VODA 2ISYA 5J6XA 1JHFA 3RKWA 5ICFA 3ECOA 4XLNF 1RUNA 3FXRA 3FMSA 5HS8A 2YPRA 4TV7A 2PLYA 1D3YA 4WK8F 1ON2A 2BV6A 2A6HF 2PBIA 2DBBA 5D8KB 2A6EF 5DEQA 1SFEA 4Z2YA 2K02A 4U88A 2R7DA 4BAYA 5CJ9A 1MKMA 4XSXF 1RUOA 3BY6A 4OIQF 2ZBKA 1R5HA 5F6FA 4CYDA 3F8CA 4ON0A 3WTSC 4RS8A 1STZA 3R6SA 4EM1A 1MD0A 4GYIA 5LHHA 4M9SA 3FXUA 2ZMEA 1S3JA 1O3QA 2QBYA 3MAJA 1FPQA 3RIRA 2VONA 1W5SA 3GLXA 1XMAA 1FYLA 2EK5A 3R0AA 3DF8A 5KK1A 5L3GA 1SD6A 5HS9A 3FMQA 2LSOA 2CW0F 4KUMA 3I0TA 2HR3A 4KDPA 5AIPA 4ENJA 1IXCA 4MHGA 2WWYA 5D8LB 3MZYA 4KA4A 1VTNC 2RC4A 4IPAA 2M1BA 4XSZF 3CTAA 2L54A 5ILUA 1XCBA 1F5TA 3GUDA 3WTYC 4D0PA 1KU3A 2EFNA 4IJAA 3HRMA 1XGSA 2L01A 4HV5A 3V4GA 4S05A 3CUQB 3DEUA 4YFNF 3SZPA 2P6TA 4HLYA 3KP7A 2KJCA 1K78B 3TGNA 3TO9A 4IHSA 4R8HA 2VC0A 1T38A 1W4MA 5L3DA 3JSOA 4HDVA 4ESBA 2A07F 1ON1A 5FB2A 2K27A 1WSUA 4EGZA 1UHMA 3J7AO 5K5QA 1Z6TA 2VC1A 5DCFA 3AAFA 3KP4A 3MQ0A 3HRTA 4HDUA 2OA4A 4M9XA 1JHHA 5IT3A 4WWCA 1IRFA 4KN4X 1YW9A 2VBXA 1P4WA 1ZLJA 4HLXA 4KN7X 3ZMSA 4YFXF 1Z1DA 4FX4A 5CVJA 2XHKA 2GA1A 1BM9A 5BPIA 1KU2A 1HXDA 2TDXA 3WE2A 2HQNA 4HAMA 2Y0MA 1O3TA 3GFIA 3LSTA 2VE8A 4HX8A 1ZRDA 3VB2A 4PDKA 2ETHA 4XRFA 4OIRF 2VT2A 2OZ6A 3GWZA 4EJVA 4PGHA 3D0SA 4N0BA 3F21A 3TQNA 5L3BA 1XB4A 2ELHA 4BHCA 5E20A 1HW2A 4ESFA 1LEBA 1YO5C 1R22A 2WTEA 4CGZA 4HX7A 3LQRA 2YX4A 2YX7A 1XSVA 4L0YB 2MLGA 1EV7A 5JR3A 4RGSA 3GYHX 4KT5C 4UVAA 2ZMEB 1CF7B 4P9FA 3KE2A 2W85A 1KGSA 3RKXA 2QBYB 5E1XA 2GA2A 2EFWA 4RGUA 2PN6A 2XAQA 2Q0OA 2NNYA 5D5XB 4B09A 2PQ8A 4I02A 1BC7C 5FLXZ 1FSHA 1K7AA 3GW2A 2VBWA 1YS6A 4L18B 3J81K 4G7OF 2XASA 3WGHA 4ENNA 5E8GA 3KZZA 3B02A 3WODF 4EJUA 3ELKA 4CO8A 2H09A 2DW4A 2D2WA 1USSA 5DYMA 4AIHA 4A2UA 3MWMA 2BE5F 4EMSA 1OR7A 2P4WA 2RKHA 5HLIA 1R1UA 2XAHA 1DPUA 1U5TA 3R60A 4M73A 3BROA 4L9NA 2KRFA 3DP7A 1CGPA 1WRJA 5ILSA 1DP7P 3KP3A 1KU9A 2XAJA 2FRHA 1T39A 4DNCA 4FHTA 5LHIA 5ICEA 5LGUA 4UV8A 3E3VA 2OZUA 3ZMUA 3IHUA 4U7DA 1T98A 1LDJA 1P4XA 3TOBA 2CYYA 4LLNA 1T6SA 2DQRA 3ISPA 2L3DA 5ERIA 1MJBA 1L0OC 1DPRA 3DQVC 1G3SA 3ABTA 2CO5A 1LJ9A 1TQMA 4RB3C 5FFZA 4IRIA 2HTJA 1OPCA 3RYRA 2UZKA 1R1TA 3FM3A 3I4PA 4IXAA 2DI3A 4HYEA 4HA8A 1OMIA 3L7WA 3RI4A 1ZARA 4RB2C 1O7FA 1SAXA 3BJOA 4QLCU 4G9YA 1ZRFA 3KETA 2X4HA 3V8KA 3WTWC 2Z9OA 1HW1A 3I59B 2L02A 4L5IA 2PMUA 1SFUA 2E1CA 1Z7UA 3ZMZA 2QLZA 3IKVA 2IA1A 3ZP5A 1F9NA 1F4KA 2LF8A 1AOYA 1L3LA 1XCVA 1IN8A 3Q9SA 1X3UA 5JHUA 3BZ6A 5E1ZB 2FQ3A 1JE8A 1B4AA 4ENMA 2E1NA 5L3EA 3CUQC 3JTGA 4CXFA 3VOEA 1I5ZA 1B1BA 3LQQA 1ZHFA 3O2PE 5LGTA 4JK1X 2F5FA 4I2OA 3U1DA 4A5NA 2A69F 4AWXB 3BP8A 5CYVA 3WU0A 2JRTA 1XGMA 4KNYA 2RQPA 3BWGA 3KLNA 3CO7C 5LEJA 4G6DA 2LKPA 4L9JA 1O57A 1R58A 1SD7A 3IL2A 1IRGA 1U78A 5HDNA 2XROA 2LNBA 2DPDA 2ADUA 1Z05A 2K4BA 2C6YA 1TQPA 1G6NA 1FOKA 2O3FA 4AIJA 3FWEA 1OKRA 3WTTC 1YG2A 1GXQA 1XD7A 3I5UA 3H3UA 2JSCA 4WX9A 2FE3A 2XKOA 2ZJ2A 4N9IA 4M72A 1FY7A 1FX7A 3L9FA 1RZ4A 5H20A 4ZYGA 1BIAA 1IW7F 3LA7A 2DK8A
chains in the Genus database with same CATH superfamily
2O6GE 5D5UB 1QZZA 3BTLA 2HU9A 4DOZA 4HSRA 5M5WJ 2JQ7A 4XRMA 2IS4A 4CSWA 2V6EA 3GF2A 1B9MA 3LMMA 4KIBA 3X2QH 5EEAA 4YRVA 4R79A 2PEXA 1DQUA 3F9KA 3TO7A 2E60A 2X6WA 3FKJA 1VFCA 3SFZA 4LFUA 5KNLA 2DO7A 1LE8B 1QQIA 1IN7A 2EA4A 2DTRA 3ZQFA 2B9SA 1HQCA 3F8NA 3CQZJ 3AKZA 4ZZDA 2O9LA 2IS1A 2K3FA 1UB9A 3K1NA 1RI7A 1Z77A 1WFXA 2E1OA 4ZYHA 1P7IA 1APLC 1YIOA 1ONVA 2F6CA 3NWTA 1QZEA 1BA5A 1Z91A 1FLIA 2OU2A 4E7JA 2X6YA 3K1PA 3OYCA 3S2WA 1ETYA 1BI3A 3K7AJ 1D1BA 2HQ5A 4U0YA 2UV1A 5LRRA 1X1DA 1PJRA 3ZQGA 1ETQA 4IRHA 4NNJA 3H3VK 1WI3A 2ID3A 3I58A 3DKWA 4L5JA 3CO6C 2ZMEC 2GWRA 3CP2A 2P5KA 4Y17A 3CCQI 1GVJA 1MMSA 3FDYA 3IAS2 4OIOF 1WGXA 3GTQJ 2IW5A 1S7OA 4HBLA 1HA8A 3P9IA 5IT9K 4BBSJ 1FWZA 3KZYA 3OYAA 1LVKA 3ABUA 3HGGA 2HYGD 3WTUC 1I3AA 2UXNA 2XPUA 1REPC 2VKHA 3H9GA 3IC7A 1ERDA 1SAUA 1X58A 2A5YB 4BQAA 2W48A 4PFPA 3ZR8X 1W36C 1JXSA 3RSNA 2HZDA 4A69C 4LG0B 2CQKA 2DOAA 4MEYF 1SVLA 4BQQA 3PL8A 2E5ZA 4BY1J 3IWZA 3AG3H 2UXXA 1R00A 1DUXC 3JREA 2PMHA 3LSRA 3JRFA 5IP6A 2EILH 4ZZLA 3H9QA 1TP4A 4HPQA 1E3OC 2IVMA 3O8HA 2E7WA 3QP5A 1NG6A 2V1XA 3OL4A 1AKHB 3OYEA 4L9TA 5B66C 1IAWA 4MQ9F 3MN2A 2M8GX 2ZFWA 4LMYA 4C30A 1R36A 2V6CA 3KEYA 3OR2C 4GGGA 3CCEI 1D8JA 5FROA 1IGNA 2VQLA 3RKYA 3VDXA 4Y13A 3V8LA 1UCRA 1DDNA 2OTLI 3L2WA 5HDKA 2PJRB 3K0LA 2P6SA 3WG9A 2LF7A 4LIUA 3ULQB 2D1HA 2IXSA 2Y75A 2H1LA 1VQ8I 5JI6A 2JA6J 5HDGA 5E8IA 1J2XA 2X48A 5HS7A 1OFCX 3COAC 1MDMB 5H6RA 1T2KA 1EH6A 2Y9ZA 1QVTA 3Q9VA 2HOSA 3LAJA 5DTDA 4S04A 2MSYA 1JUMA 4KFCA 5E3NA 3S15J 1XGOA 3OYLA 2ZKZA 3D1NI 3KP5A 2E1MB 4UNOA 1XC5A 3HRUA 2JVHA 1QVUA 2AHQA 2L7KA 2DMPA 2F5DA 4BEHA 1AWCA 3J81Z 4F7ZA 3OY9A 2CGPA 3JRBA 2JRMA 4XL9A 3BR2A 2DJNA 4HNTA 2FBKA 3ZMDA 2P5VA 3W6JB 5M5XJ 1PP8F 5E3OA 5K5RA 2X1EA 3HIFA 3E5UA 1RPWA 2LREA 2AO9A 3A02A 4P96A 2FMLA 3PFYA 4A3LJ 2NOJB 1YJWI 3CJNA 1HW5A 3WU1B 4RB1A 1ZR4A 3I64A 1ETKA 6PAXA 3RPUD 1ZH5A 1VQPI 2DOEA 5J4YA 1P92A 3C18A 4LGWA 3TDZC 4O5VA 5HLTA 4NQWA 3H35A 3FIWA 2Z5UA 3EDPA 3FX3A 1WKMA 2GXGA 3G1MA 5ICCA 3QU3A 2V1DA 3QP6A 2Z1DA 2EZKA 4EVIA 4JX4A 5J47A 3G71I 4F55A 2VLAA 3WG7H 2KQRA 3FZVA 2E34A 4G12A 4K2EA 4B8XA 4AVPA 1J75A 1VI0A 3KZIC 3PSFA 4IL6C 4WXDA 3PO2J 2HS5A 1ENHA 4HEA2 3CD6I 2WA0A 4QWQA 4NC6A 2LDUA 3CCMI 4BXUA 3GO5A 1BN5A 1Z7LA 4RDUA 1UG0A 3T5XA 3E6MA 3GFJA 5KAFC 2FX0A 2KFDA 2W82A 4FASD 5E79C 2CU7A 5BMZA 3E7LA 1B9NA 2P8TA 3L2QA 3LFKA 3M8EA 4LITA 3KEQA 4UHTA 3HTUA 3CP8A 1TNTA 3CF5F 3REOA 2P7CB 2GQQA 1MJAA 4BACA 4B48A 4P1WA 3PQKA 3ZN1A 4J01A 3C1DA 4Q5SF 3ZQLA 4HF1A 2B7EA 3N05A 4BQNA 5E18F 2OQGA 2E19A 2WC2A 3K4JA 4JQFA 1FC3A 3DTKA 3M3YJ 1OYYA 5HLHA 3GXOA 1ZN2A 1YW7A 1S7AA 2Y48A 3FXJA 4XLCA 5C44J 4OMYA 2G0EA 4OWRB 4MNUA 1BR4A 2B63J 3WTZA 1QA6A 3SZTA 5F04A 2LRDA 1KYWA 3CMMA 2K9QA 4Z6YA 3HTSB 5C4XJ 2XAFA 3FBNB 1FT9A 1DU6A 2ZNYA 3LWFA 2H8WA 4II2A 2DT6A 1GXPA 3G1OA 2H6CA 3A1YA 1ETOA 2STWA 3NARA 4N9HA 4YELA 4E70A 2NYXA 4EM2A 3W2WA 3EYYA 1A6QA 4BE0A 2ID6A 1EF4A 2ECCA 2FUG2 4E7KA 4R1HA 5K5OA 1X1CA 3BDDA 2BZTA 1K61A 2EZIA 2CS3A 1K6OA 3ZMVA 3T8TA 1LKXA 1FJLA 4JYKA 3RKQA 4F93B 2VJJA 3RPQA 4QIWN 2Z3YA 4PZJA 3CMEI 3E5XA 1HKTA 1W5CC 1T08B 4KITB 1Q1HA 4MGRA 2R5YA 4GRIA 1ULYA 4M9ZA 5D6EA 3ERED 2HOEA 2VT3A 4XOPA 3WGIA 4EV0A 3FK6A 3A03A 4E7LA 4EJWA 4JP0A 1MSFC 2W24A 1RNLA 1J59A 2CSOA 1NH3A 5EEGA 4A3GJ 3NRVA 4G7HF 2HI3A 2TRTA 1YHQI 2Y0SN 4DYQA 3LL7A 5LLQA 4DGWB 4XLPF 3DFGA 1EH7A 1I3QJ 5FFXA 3FXKA 1J0RA 2K4JA 3LSIA 1TW2A 2BYVE 4UUSA 3CC4I 1LVAA 2QKLB 1JKRC 2CMPA 1OCTC 1JJ6C 3KP2A 1N78A 3IAM2 1S5LC 1S6LA 4ZTJA 1H88C 2RN7A 1RIOH 1TL8A 2WAQA 5FO5A 3K2ZA 3ZRGA 3CDLA 1OR7C 3HDDA 5K7HA 1QHHD 4G94A 1B8IA 3AL0B 4YIFA 1VQMI 4M6XA 2F4MB 2ICWG 1U5TC 2A68F 4NDLA 1LPQA 3H3ZA 2IGNA 3ESWB 1XDUA 1MNEA 3ASOH 1IO2A 1FBQA 1TWGJ 1WCMJ 4UVCA 3MMYB 2XGEA 1E3PA 5J8CA 2IPQX 2HYFA 4XLHA 1FP2A 4CZCA 4KIGA 1YTYA 1XTAA 2YU3A 5L3CA 2HYJA 1BI1A 3I71A 2WB1A 3FXOA 3OYGA 5FD5A 2RDPA 2QUFA 1SMYF 1EH8A 4A3BJ 5DCMA 4BEHB 5CVUA 4M71A 4A3JJ 4XICA 3SZGA 3F8BA 2ELKA 2JPCA 4GO1A 3MKLA 2H1KA 2PMZN 2ZCWA 1V4RA 2JA2A 2F5VA 3G73A 3FF5A 1MMNA 2RGVA 5FGMA 4CHUA 3HUGA 3ERMA 1UHSA 4U0VA 2FOKA 2ZXJA 2RV8A 4ZJZA 1RESA 2EA2A 2X85A 2KIMA 3Q0WA 2ZSIB 2DMTA 2L9SA 2VJ5A 2FMYA 1BI2A 1UFMA 3CDHA 4IQJA 1MMAA 4L5EA 1W0TA 1SC7A 2ZXWH 2K3PA 1OYWA 2XVCA 2Q8KA 5A2QZ 4BNCA 1JKOC 2KP6A 1ZG1A 2QM3A 3GCMA 1K6YA 3SYTA 1S9HA 2HFHA 3MEXA 5C3EJ 3VYUB 4QPOA 3EETA 1UMQA 2Q2EA 3LA2A 4CCNA 1Z0XA 3DPUA 1G59A 3CMYA 2QVOA 5AONA 4CICA 3DV8A 4BY7J 3HEFA 3K1MA 3GX4X 2VBZA 3KLOA 3PQJA 1SVOA 2DMQA 2CWEA 3IV5A 1Z9CA 4P5OA 1D5YA 1LQ1A 2FSWA 4I6ZA 4GYGA 3ZN0A 2E35A 2ZJRF 3HZJA 4OU0A 1T95A 1WI9A 4Y15A 2XIGA 1A35A 2OPTA 2A6TA 5LBQA 4M6YA 1YW8A 1S29A 2EWNA 4BU2A 4UUTA 3S93A 3WU2C 5DM7F 5J4VA 1DP3A 4AU7A 5EYRA 5FKLA 3MZ8A 2V1NA 2K9MA 3QAHA 3JAMZ 2D1VA 2HVQA 1WWXA 2LLKA 4DBQA 1LEAA 4EM0B 3HSRA 1GLNA 3B6AA 3K9TA 3GFMA 2M5WA 4UV9A 2HKXA 3F6VA 4IO9F 2ELJA 4BXXJ 4RB0A 2OJED 2BHYA 2W57A 1FYMA 4M74A 4LLLA 1BOAA 1LFBA 1GT0C 1X3ZB 2JTVA 5HODA 5K7FA 3C3WA 4IVNA 4XKBA 4M3EA 2B0LA 5IT9Z 3V7SA 4UXNA 5B5EC 3ROUA 2F2EA 1ZG5A 3OSGA 1KA8A 4IF4A 4KIFA 5GTHC 5F27A 2H94A 3K70C 3IH3A 3MFKA 2DAOA 4UB6C 2E2IJ 3ECHA 5LRSA 2E2HJ 2KMUA 1RC9A 2E1MC 2I5UA 3QQAA 4XKVA 2XF5A 2GAUA 1YQAA 3DU5A 3QRFF 2LR8A 2RNJA 1MMGA 3H5NA 2D5VA 4BGDA 5IOYA 1Z67A 4HV6A 3IUOA 5GAHJ 3BCBA 1T56A 5DV5A 3UR3C 1WPKA 1H0MA 4P9UA 1N77A 1O3RA 3TBIA 2COMA 3GEZA 1IXSB 2JK3A 3CMAI 3PIPF 1QGPA 3BG7A 3OS1A 3Q5FA 1G3TA 4BKXA 3EYIA 1VQOI 3DBHB 5IYDJ 1FBUA 4LD5A 1GVDA 2OBPA 1Y0UA 5E3MA 3VEPA 5EG0A 5DD4A 4LJZF 2ZSHB 3LSJA 4BE2A 2KJBA 1P6RA 1Y8RB 3C2GA 4EQQA 3JRIA 1N75A 2CV0A 1UJ8A 2KRCA 2UWMA 1VNDA 2PFBA 1FZPB 2VBYA 3VYTB 4A0ZA 3S2HJ 1TWFJ 2XUBA 3M1EA 1FBSA 1P7JA 1GV5A 1QPMA 2MYSA 3BPXA 3F72A 4YEJA 5TISC 3W6VA 1IRZA 1V3FA 5EZHA 1W7PA 2AXTC 4MQVA 5ILVA 2ME0A 2J5PA 2OD5A 4C2TA 5EEHA 4A0XA 5TRDA 1VQLI 1TWHJ 4C3HJ 1IJWC 4AC0A 1MSEC 1ACIA 1B8IB 3DLLF 2DFHA 3M9AA 4DQ2A 3VFZA 3TDUC 4B4CA 2XDVA 5GP9A 3PSIA 3TO6A 2M7BA 3OWTA 1SMTA 3T1BA 1K78A 1LFPA 3QU6A 4MEXF 2O61A 2EFQA 2BW3A 1J5YA 5E1WA 2QQAA 2KRHA 5D5WB 3PUFA 3DKYA 2ZFUA 1F1ZA 2WV0A 1JI8A 1Z6RA 4RGXA 3F8MA 5A2QK 2ESNA 2FU4A 1U5TB 2HDDA 2R7UA 1TBXA 3GTGJ 5H2FC 2QWWA 3BR0A 3SXYA 5DCMB 3FKIJ 3ZPLA 1C0WA 4WCGA 3RQIA 2NVQJ 2YS9A 4B1RA 4CCOA 4X6AJ 2QGUA 4BJ5C 2W84A 3OYJA 3HUGB 3MVPA 4BH9A 1BIBA 1HSJA 2VODA 3WE3A 5JLWA 2QQ9A 4QSHA 5ED4A 2O03A 1HOMA 4U7BA 4HQEA 3SFIA 3RQ4A 2EH3A 1XSDA 3LSMA 2M2EA 3RZOJ 1A6IA 1ODDA 1E17A 4PJMA 2O8KA 4OOIA 5FLMJ 2VXDA 1VQ4I 1QU3A 2PMZA 3RCOA 1JGGA 3SJMA 3HYIA 1ZREA 1J9IA 4MLOA 4N4OB 2MD5A 2M0CA 2VN2A 1VQ7I 3JAMK 3RZDJ 1PP7U 1BOBA 4KMFA 4GCVA 1E3HA 2Q2EB 1A04A 4P55A 5F1RA 2HQRA 4IHTA 4AD9A 1S7EA 1NK3P 1D0XA 1FP1D 4A3FJ 2LY2A 3P7NA 1RR7A 3CCUI 3BG6A 1HDDC 3MD2A 3G1LA 1R5ID 1OCPA 1ZGAA 3DXJF 3MKWB 1W36D 1LUJB 2DPUA 3LOCA 1PYVA 1BJZA 3OYHA 3S3MA 1LDDA 2LOOA 4I76A 1X1PA 4D5FA 4ABZA 3M8JA 1FTZA 3ZQ7A 3GTMJ 4I0BA 5HLGA 2HWVA 1MZBA 2JT1A 3BQYA 1W5TA 3B6CA 3I9V2 5BQTA 2DLLA 3CUOA 4MO7A 3U9GA 2L7ZA 5H6QA 1GHCA 4JX5A 1KYZA 2FXAA 3CF2A 1R49A 1ZKGA 4HX4A 2W7NA 1LDKB 3W2AA 2R92J 1MGTA 4AM3A 3BT9A 2R7RA 3BLYA 3ZOBA 2EJRA 1G3YA 4A6EA 3D5RC 1YX5A 3GBGA 3KEOA 2AXLA 4UUVA 3V8JA 2MH2A 1ZK8A 1WJBA 2GXBA 3CLQA 1CQTA 2JWTA 2GZWA 4OMZA 3AL0C 2GIVA 1I6HJ 4NHJA 1VQKI 1CF7A 2EINH 4D1QA 3M8FA 4G6TB 2NVYJ 2HKOA 4C3IJ 3KPHA 2DOFA 2KISA 4ZH4F 2V26A 2OTJI 1PUEE 1XN7A 2IP2A 3U2RA 5D5VB 4NC8A 2CQ7A 1SFOJ 4A3KJ 5CKTA 4ASNA 2IRFG 2GBYA 4MFDA 1S8NA 2CG4A 3IRRA 2M7AA 3DPTA 2EQRA 1MBGA 3OYIA 2W25A 2VASA 3GTOJ 4DJAA 4A3EJ 3DPLC 3C2HA 3VSKA 1VZ0A 1G3WA 1HSTA 3IKTA 3KIOA 3JSPA 1XDSA 4D7NA 3R61A 1IN4A 1LNWA 1SD5A 1A5JA 2QKMB 3QOEA 5J8FA 2ZJPF 1MBHA 4BS9A 3WHCA 2EFPA 1R23A 3L09A 1MBFA 4YG2F 2HVSA 5LEKA 3MCZA 2E36A 1B59A 2A5WA 3I55I 2NVTJ 3IH2A 3HC7A 2Z16A 2QQBA 4BHBA 4EJOA 2R93J 1Y56A 3I3LA 4Q48A 4RM2A 5KVRA 4ZTFA 1TT5B 2DA7A 3WGGA 3BJAA 1V5FA 5DDGA 2K86A 3K69A 3CCLI 5BNGA 4UVBA 2V9KA 1U2WA 4XOTA 1YJ9I 1W7PB 1X19A 4FTHA 2LY1A 3M4OJ 4X0GA 3N97A 3A4CA 3JRCA 2BGCA 2JPBA 3NAUA 5BPDA 1HBXG 1ZR2A 1X4PA 1F36A 1I1SA 4HZFA 5D4RA 2DDAA 3L00A 4LLGF 3S3NA 1ZGWA 1JUSA 1PUFB 4KJZA 4OIPF 2V7FA 3TOAA 4NBQA 3KFWX 4RA2A 2HNHA 2XGXA 2NVUB 2VPLA 3J80K 1UAAA 2BW3B 2EV6A 3BTCA 2O0YA 5IY5H 1TNSA 5GPCA 1U3EM 3O3KA 3CC2I 1MJ9A 2M30A 5JHFA 2DXIA 4WF2A 3S1MJ 4I0AA 1N25A 2XPVA 3LA3A 3GZ6A 1SVMA 1YYVA 5TGTA 3TP0A 1H9TA 1H89C 2EV0A 2Z2SB 4ENKA 3KP6A 3HSFA 4BYYA 3QYBA 2KZVA 4RAZA 2ZNZA 1NK2P 2CUFA 2MH9A 3R0JA 4RMNA 2EFOA 2P7VB 3FBIB 3R4KA 5IP9J 3S14J 1B72B 2BVLA 5HVQC 2CW7A 2EZHA 5F0CA 1I27A 3A2KA 4E7HA 2X0LA 2OCEA 1LB2A 4UY8I 2Q1ZB 3I53A 1MNMC 3C2BA 5ICGA 3F8FA 1J7KA 5DD8A 2KIFA 2XB5A 4A5MA 1YITI 2DT5A 2ZO4A 4LK0F 1FYKA 1KQ8A 4BHPA 1KQ0A 1Y1VJ 3F23A 3M1CA 4HG2A 4AYBA 2VPRA 4AIKA 2FF4A 3RPUA 1WZ2A 4A3MJ 3QODA 4I09A 3E6DA 1E2XA 2IA0A 2QSFX 1ZYRF 2K9SA 2XAGA 5D4SA 3HHGA 1R7JA 2EB7A 3Q0UA 4G8XA 3P5JA 3EUHA 5D6FA 2E7XA 2R7OA 2NRAC 3QPLA 2OV7A 1QBJA 4A12A 3T0YA 1FIPA 4MTEA 4FX0A 4FE4A 2OQRA 3HHHA 1KONA 2CW8A 3HM5A 3BR3A 3DEEA 3QPTA 2P81A 2HDCA 4HOBA 1O4XA 1UELB 1ZTRA 3I59A 4EJTA 2Y69H 5JVTA 3HSEA 2R3SA 1TLHB 2Z33A 4W1UA 1TTYA 5AIQA 3L2CA 1BI0A 3E1SA 3E97A 3LSKA 1QNTA 1NG7A 3M07A 4YIRX 2QEXI 3DTEA 2J5OA 2V1UA 3NQOA 4XN3A 4CCLA 1O7LA 4ETSA 3TMOA 5K1YA 1EJ9A 3BPVA 2O8XA 5GAGJ 1R5GA 2MC3A 3CDIA 5J1UA 5F64A 2XC7A 5FRMA 3HPGA 3NEUA 2PX9A 1W1WE 1GV2A 3W6KB 3HOSA 3OIPA 1G4DA 4A6DA 3E6CC 3DEWA 2VQGA 2G7UA 5BOXA 2XV4S 1T0FA 3GVAA 4HF0A 1IN5A 4HNVA 5IYCJ 2DK5A 4HF2A 1FNNA 3O6BB 1PDNC 4XKWA 3I54A 2IJLA 2D45A 1D5VA 1TQIA 3TKYA 3F22A 5EJCA 1BR1A 1SEUA 2CUEA 1JUPA 1MBKA 2TCTA 2F5CA 5KHDA 2JN6A 4RAFA 3EPZA 2G7HA 3EUKL 2V9VA 3T8RA 2CV2A 1UHWA 3Q3SA 1I39A 2GLOA 2DMNA 3PUBA 4PUSA 2WADA 1ETWA 1HKQA 1JTXA 4QTRA 2BEOA 2L9NA 3LSHA 2NNNA 1USTA 2O5RA 3K6GA 3QPHA 4ZDLA 2QF7A 2LBFA 3I56I 4J19A 4G7ZF 4ZYAA 4O3MA 1XX5A 3OYFA 4KMUX 1H9GA 3P9KA 5EGOA 2M45A 4BE1A 3IH4A 2KIUA 3QOPA 1B6AA 2K7LA 4PGGA 4YIIA 1K4SA 3WTVC 4GDFA 1VQNI 3BOQA 2MA3A 1RKTA 3HJEA 4LB6B 3FM5A 3M7GA 2FEZA 2JA5J 3V7RA 2V79A 4UB8C 2CH0A 2NXNB 5HOOA 3DTIA 1ZELA 1QRYA 4L9VA 2QCOA 3IRQA 5EDNA 4YFKF 1BC8C 2NS0A 3TW7A 1D8KA 2MLKA 2ZB9A 3CJTB 5FLVA 3OYBA 3PIOF 2OUMA 2HTSA 4BDYA 2VOOA 1KU7A 5JVGF 3ZQCA 1KQ9A 2DYSH 5IPAA 2G9WA 1IF1A 4A3DJ 2KDOA 3B73A 2E71A 4BJ6C 1HC8A 2HOAA 2DQLA 3HRSA 2R4GA 5GAEJ 2FA5A 3BR1A 4ZYDA 4NQWB 3L2UA 3QYEA 2DU9A 2M87A 1FOWA 3OOPA 1Y6IA 4IHXA 4ESJA 3MZHA 1XG1A 1JTYA 4Y33A 1SFKA 4XIDA 5CVRA 2PG4A 1ZRCA 3G2BA 3HKZN 2NOGA 3FXMA 3G3ZA 1TW3A 4I01A 2QA4I 1U9NA 2QYOA 2VIXA 1WJAA 3CC7I 2DA1A 5C4JJ 1QO0D 3OYNA 2ISZA 2VE9A 3N4MA 1XPXA 1FOXA 2L7MP 1FSEA 3S1NJ 5DS9A 1O3SA 2VXZA 2F5EA 4RAYA 1WQ2A 3FXQA 1K79A 3DWLE 2HXIA 3E6BA 3V7CA 1IUFA 1YLFA 3H92A 4V2GA 2QZ8A 2CQNA 5HNHA 4PJJA 1I1GA 4HQMA 2PI0A 3CESA 3LSPA 5FRNA 5DUKA 2R7XA 1ZGJA 3OYDA 2STTA 1RRJA 2YU9J 1P4AA 2KKOA 2AS5F 4B47A 4IKFA 1ZLKA 1Y0NA 3LAPA 1YOVB 2F4OB 1I6XA 4ZDPA 1JJ8C 3HOXJ 3P9CA 2CJJA 1XMKA 3K70D 1U6GA 2YSRA 4CH7A 1E0EA 2IS2A 2FNAA 2BY1A 2JZYA 1IV6A 1G8XA 2NAZA 3I4NJ 1T33A 5FKNA 4IHVA 3JW4A 1NHAA 1XSXA 4Y3OA 4WXCA 4XBFA 3QPSA 1X4OA 5JFRA 4A93J 3IWFA 1JGSA 3RYPA 4A0YA 2R7SA 2R7VA 3OSFA 3SHFA 2IAIA 2DFFA 2X51A 1A31A 2BBYA 2A61A 4W97A 5E17F 4M3FA 3K4CA 4IOAF 2IS6A 2R7FA 3OIOA 2WAFA 4LG0A 1UG2A 1JKPC 2MABA 1YFHA 1YRNA 2LKSA 4KYWA 1W7PD 2MC4A 4U0WA 4RAGA 3BG9A 1HF0A 3ZMTA 1MH4A 2RVCA 1ITYA 1YE9A 3SEZA 1MBJA 1HKSA 3GTJJ 1X2NA 2QENA 2IT0A 4B3XA 2JUGA 2W1OA 2P5LC 4LB5A 3BJ6A 2R7WA 3CLOA 2X6OA 4M6VA 2R5YB 4EGYA 3LNQA 5GTIC 2R7ZJ 4LIVA 4LK1F 3JRHA 4G6QA 2IA2A 3SQNA 4E7ZA 2HEOA 2FBHA 2VKDA 2K5CA 4GXOA 2Z99A 4IRGA 3F3XA 3RDIA 4Q4ZF 5FLXK 4I98B 1SD4A 2OAZA 3RJPA 5LHGA 4I7HA 2PJRA 2BXYA 2XKPA 2M3AA 5M3MJ 1IZ1A 4Q47A 2XGDA 4HW0A 4RLFA 1IUYA 4CYCA 2OCCH 2X1DA 3S32A 1BBYA 2HZTA 4V19K 2HDWA 3F0CA 2HXOA 1MDMA 1QZYA 2E2JJ 3BG3A 1SANA 1QHGA 3F6OA 3HOTA 2KIQA 1SFXA 4UUSB 3MKYB 4XM3A 1P2FA 2A3SA 1DGWY 2XRNA 3GTKJ 1OCRH 3RTRA 2IEKA 3C7JA 3PFIA 2EIMH 3L1PA 2M8EA 2CFXA 3E5QA 1U8RA 2AQFA 2MBFA 3BZKA 2Y0SA 3CUQA 5BS6A 1GUUA 3ASNH 3HGYA 4E7IA 2ACJA 3GZ5A 2EV5A 3WTXC 4PSWA 1JKQC 1TZLA 1ZAOA 4I99C 1Y39A 1BJAA 1OCZH 3K4MA 4O6JA 2LBFB 3VWBA 2WY7Q 5CVIA 1ZG3A 2PJPA 5EGOB 3S3OA 1U8BA 1TWAJ 3D5LA 2DJIA 2VL8A 3KYDB 5EZGA 3ZQIA 4IZZA 4HRIA 4WXHA 1TT0A 2L2OA 2XF7A 2ESHA 1D1CA 4NB5A 4OINF 4RGRA 1XGNA 2X9DA 5FD6A 1IN6A 2L4AA 1BL0A 4BJTA 4A3CJ 1WH7A 4L0ZB 3W3CA 4PCQA 1P9QC 4H0EA 3DLAA 1IXRC 3JTHA 2VOPA 5CLSA 2NS8A 4RBOA 4ZYEA 2FBIA 1OYIA 4CDGA 5K7ZA 3FHZA 1YS7A 1R1VA 2R7QA 5DUIA 3FMRA 3KCCA 4XMYA 1D0ZA 1J09A 2W00A 5L3FA 3OV8A 4KICA 3ML6A 5IYBJ 3O8GA 2NVXJ 3TP3A 3GFLA 4JBAA 2O7OA 2IGMA 3BG5A 2YR2A 2E5NA 4KT6A 2L4MA 4FT8A 3EQLF 3J80Z 4IEJA 5CVVA 2H27A 1RR8C 4MTDA 3BZCA 5TJJA 1YX3A 5LGNA 4CZZA 2H6BA 2HGCA 2DFIA 2FNPA 3QWLA 2ZC2A 3VODA 2ISYA 4J00A 1A36A 5J6XA 1JHFA 4XRSA 2XRLA 3CCYA 3A0HC 3RKWA 4XQFA 3ZQHA 2RNGA 2Y2ZA 5ICFA 3S17J 1D0YA 3ECOA 4XLNF 3V42A 1RUNA 3FXRA 5M3FJ 3FMSA 5HS8A 2YPRA 4TV7A 2PLYA 1D3YA 2JA8J 1R4NB 2K40A 2K85A 4AIDA 4WK8F 3GTPJ 1ON2A 2BV6A 1AU7A 2CV1A 2A6HF 2BHZA 2LFBA 3H0DA 2M4KA 1KZHA 3IP4B 5JLXA 2PBIA 3S16J 2DBBA 3FXLA 5D8KB 2A6EF 2NS7A 2KDZA 1BR2A 3G4SI 1DU0A 5DEQA 3JRDA 2XB0X 1SFEA 4Z2YA 3HKZA 2K02A 4PJLA 4U88A 2R7DA 5CPRB 4BAYA 5CJ9A 3K4LA 1MKMA 2I10A 5LFAA 2MFZA 4XSXF 1RUOA 2OC6A 3BY6A 1FOYA 1IC8A 3LSGA 4OIQF 2R0QC 2ZBKA 1MH3A 4CA0A 1V55H 5F08A 3HOWJ 1R5HA 3BTJA 5F6FA 4CYDA 3F8CA 3ONQA 4ON0A 3OS2A 4XKCA 3WTSC 4RS8A 1STZA 3R6SA 3PNTA 4EM1A 1MD0A 4GYIA 3KYCB 4CCMA 4M9SA 5LHHA 4N4NB 3FXUA 2ZMEA 4CCKA 3H5RA 1S3JA 1O3QA 2UUZA 4DZPA 2QBYA 1MIJA 1V5GA 2VJ4A 2OF7A 1FPQA 3MAJA 3RIRA 2VONA 1YRNB 1W5SA 2WAQN 3GLXA 3WHBA 3GTLJ 1XMAA 1FYLA 1OLTA 4M3DA 2EK5A 4FE7A 3ZCOA 1WVRA 3R0AA 3DF8A 1FMVA 2LP0A 5KK1A 2GOXB 2BXZA 2DMUA 5L3GA 1SD6A 4PK4A 2CQXA 3FMQA 5HS9A 2LSOA 5KCMA 1FTTA 2CW0F 2KPMA 4KUMA 3I0TA 4AVZA 2HR3A 2DYRH 2CFOA 1WJDA 2GM4A 4KDPA 1VF9A 5AIPA 2L0KA 3S1RJ 4ENJA 1IXCA 2ZXHA 4MHGA 2WWYA 2R5ZA 5HNFA 3MKZA 4IHYA 5D8LB 2WB1N 3MZYA 4KA4A 5DM6F 2LD5A 1VQ6I 1VTNC 2ZJQF 4JX6A 1RETA 4AUXA 2RC4A 4IPAA 5EG0B 4XLFA 2M1BA 3PO3J 2XAUA 4CYCB 2L5QA 1R9TJ 3G6EI 4XSZF 3CTAA 2L54A 2HQAA 1V5EA 4XLEA 4PJ0C 5ILUA 2EIJH 4NUBA 3ZXSA 1XCBA 4XNFA 1F5TA 3GUDA 4PFOA 3WTYC 4XK4A 1IDYA 4D0PA 1KU3A 2EFNA 2DA3A 3E0JB 4IJAA 3HRMA 1XGSA 2YUSA 2L01A 4HV5A 3V4GA 2VKVA 5LD2C 4S05A 3CUQB 3DEUA 2RREA 4YFNF 3GMEA 4D7MA 3HOVJ 3SZPA 2L9VA 2P6TA 3CJQB 1X3WB 1RKWA 4HLYA 3KP7A 4M3BA 4E6KG 2KJCA 2M0MA 1K78B 3TGNA 3TO9A 4IHSA 3Q0VA 3S2DJ 5GPAA 4R8HA 5J1RA 2VC0A 2CQQA 1HDPA 2KHMA 3DCFA 4XRSG 2Y31A 2DCEA 3J7ZI 1T38A 1W4MA 5L3DA 3JSOA 4HDVA 4LOCA 3HB9A 4ESBA 3CCRI 2A07F 4OAYA 1ON1A 5FB2A 1WH5A 2K27A 1WSUA 4EGZA 2LC2A 3BC8A 4RM3A 1UHMA 3UNGC 4C2MJ 3J7AO 5K5QA 1Z6TA 2VC1A 4HSTA 3K4KA 5DCFA 3AAFA 3KP4A 3MQ0A 3HOZJ 2LKXA 1TWCJ 3HRTA 3UKGA 1EA3A 1T8IA 3PM1A 4HDUA 1IG7A 2V9PA 3A0BC 3PNVA 2OA4A 4M9XA 5GADJ 1JHHA 5IT3A 4WWCA 3L2VA 1IRFA 1YIJI 4HNUA 4KN4X 1YW9A 2RQQA 2VBXA 4BDZA 1X1BA 2I8DA 1P4WA 1ZLJA 1FEXA 4XONA 3EUHC 4HLXA 1OCOH 2BY2A 1UZCA 3AFHA 4F92B 2BY3A 4KN7X 4V2FA 3ZMSA 2R7TA 3HXLA 3FK7A 3CCJI 4YFXF 1K4TA 1Z1DA 3TEDA 3HPHA 2M34A 4BUPA 4FX4A 5CVJA 4C3JJ 4C9YA 4JOMA 3S1QJ 4LG3A 4F3QA 3S8PA 3U1KA 3HL2A 2KZGA 2XHKA 3AG1H 2GA1A 1BM9A 5BPIA 2DA6A 4FQGA 1KU2A 4DZJA 2V4JC 1HXDA 2TDXA 1YJNI 3KX2A 2XSDC 2XGCA 1X2MA 3WE2A 4XN0A 2HQNA 3J7YJ 3H9JA 2LYCA 2Y0MA 4HAMA 1O3TA 3GFIA 3LSTA 2VE8A 1ETXA 4HX8A 1ZRDA 2N8GA 3VB2A 4PDKA 2ETHA 3A01A 1BW5A 2JUCA 4XRFA 4OIRF 2VT2A 2COBA 1T0FC 2OZ6A 3GWZA 1OQYA 4ZDOA 4EJVA 2FOWA 3OL3A 2W4SA 3H36A 5J40A 5F0HA 4PGHA 3D0SA 3JRGA 3HOYJ 4N0BA 1DGRM 2DA4A 3GLLA 3TQNA 5L3BA 3F21A 1XB4A 2LVSA 1WJFA 1F43A 2EIKH 2ELHA 4BHCA 5E20A 1HW2A 4FETA 4ESFA 1LEBA 1YO5C 1BW6A 1R22A 1U0JA 2WTEA 4HX7A 2DDBA 2YX4A 2VJIA 3LQRA 2YX7A 1JT0A 4CGZA 2EPFA 1XSVA 1IV8A 4L0YB 2MLGA 2P0WA 1LFUP 3BTIA 1EV7A 1IDZA 1HCRA 5JR3A 2BOLA 4MIMA 4RGSA 4RLQA 3GYHX 4KT5C 1S72I 4UVAA 2XPWA 2DA2A 2ZMEB 1M1EB 5B1AH 1CF7B 3NWSA 4P9FA 3KE2A 2L9RA 4B3AA 2W85A 1KGSA 3RKXA 2QBYB 2L7FP 2DN0A 5E1XA 3HG9A 2IGKA 2GA2A 2EFWA 4RGUA 2VUMJ 3JRAA 1JT6A 2PN6A 2XAQA 2Q0OA 2MD0A 1R71A 3QYFA 2NNYA 1POGA 5D5XB 4B09A 3LFUA 2AQEA 2BY0A 2PQ8A 2MG4A 3TL4X 1H8AC 4I02A 1BC7C 5FLXZ 3ABMH 4DYRA 2JSPA 9ANTA 1FSHA 1K7AA 3GW2A 2VBWA 1YS6A 4L18B 4PSXA 4B44A 4Y52J 2FQ4A 3J81K 4G7OF 2XASA 3WGHA 2HPMA 4ENNA 2R5ZB 5E8GA 3AG2H 4U87A 3KZZA 5FJ8J 3B02A 2M9HA 2MGQA 4M3GA 4CCJA 4MFEA 3I4MJ 5CQEA 3K4NA 1OCCH 3WODF 4EJUA 3ELKA 4CO8A 2H09A 2DW4A 2D2WA 4XLAA 1USSA 3W2VA 4DYCA 1HLVA 5DYMA 4AIHA 4A2UA 3MWMA 2BE5F 3BCAA 4EMSA 3GZNB 1OR7A 5E3LA 3PJRA 2P4WA 2RKHA 5HLIA 1QPIA 4KISA 1R1UA 2XAHA 2CRGA 3SDGA 4IX7A 5F1JA 1DPUA 4QPQA 1U5TA 1AA7A 3DBRB 3R60A 4M73A 3BROA 2FD5A 3FHNA 1MMDA 2MW8A 3DU6A 1Q1VA 4L9NA 3BQZA 4EATA 2KRFA 3DP7A 2K9LA 3OYMA 1CGPA 2DT7B 1WRJA 5ILSA 3ZQQA 1DP7P 3KP3A 1KU9A 2XAJA 2FRHA 2VI6A 1EKEA 1T39A 4DNCA 1Z21A 4FHTA 5LHIA 1R4MB 5ICEA 1Z3YA 5LGUA 4UV8A 1Z3XA 3CCSI 3E3VA 2XSJC 2OZUA 3ZMUA 2CUZA 3IHUA 4U7DA 1T98A 2WAEA 2ECBA 3TW6A 1LDJA 1P4XA 1LE8A 4OAZA 3SDBA 3TOBA 3K10A 5IOZA 3ABLH 4BBRJ 5FKKA 2CYYA 4LLNA 1T6SA 2DQRA 4C2UA 3HOUJ 3ISPA 1WJEA 5B3SH 2IBDA 1K83J 2L3DA 4NC7A 1WHUA 4II3A 5ERIA 2HOTA 1MJBA 1L0OC 2LMDA 4BL0B 2QQ8A 2RAEA 3JR9A 1DPRA 4F52A 1V54H 3DQVC 1G3SA 3ABTA 5FKMA 4Y4RA 3U21A 5EF6A 2QSGX 1G2HA 2CO5A 1MW7A 4B43A 2LK2A 2FJ1A 2Y9YA 1TC3C 3OMYA 3VYRB 5CQGA 1LJ9A 2KLOA 1TQMA 2A05A 1WJCA 1VQ9I 4RB3C 5FFZA 4IRIA 1AHDP 2HTJA 3ZGKA 1FIAA 1OPCA 3J7AY 1MNDA 3OOUA 3RYRA 2WY8Q 1U9OA 3OS0A 2UZKA 1R1TA 3FM3A 3I4PA 2JMWA 4IXAA 2DI3A 2JA7J 2KL4A 4HYEA 3BR5A 2DA5A 4HA8A 4IQ4A 1OMIA 1GDTA 1Y1WJ 3L7WA 1ZARA 4RB2C 3RI4A 1O7FA 4EEFG 3FISA 3K2AA 1SAXA 4DBRA 3BJOA 4QLCU 1I50J 4G9YA 1ZRFA 4E7SA 3KETA 1ETVA 1PVEA 2IGOA 3PNYA 3KYLA 2X4HA 5B1BH 3V8KA 3D5SC 3WTWC 2Z9OA 1HW1A 3I59B 2EZLA 2EBIA 1X1AA 2L02A 4E4HA 2LG4A 3VSLA 4L5IA 3CCVI 2PMUA 3AG4H 3DKXA 1NTCA 2BVMA 1SFUA 2E1CA 5FKOA 2JJ7A 3A01B 1Z7UA 3H0GJ 3ZMZA 2QLZA 3IKVA 3H5AA 1VQ5I 1AKHA 2IA1A 4S0HB 4IOCF 3ZP5A 1F9NA 1F4KA 1ORKA 2LF8A 4DW6A 1AOYA 3OR1C 4PJNA 1L3LA 2JVGA 1XCVA 1IN8A 3Q9SA 1X3UA 4BXFA 2X1CA 5J1YA 5JHUA 3BZ6A 5E1ZB 2F48A 2VKEA 2FQ3A 1JE8A 2DTZA 2HVRA 1B4AA 4ENMA 2VQCA 5M5YJ 2E1NA 1WJ5A 5L3EA 2LH9A 2Y30A 2GXAA 1D1AA 1W0UA 2F4IA 3CUQC 4DIQA 5IP7J 4X1EA 2M4GA 4A3IJ 3JTGA 4CXFA 1MBEA 1ZQ3P 3VOEA 1I5ZA 3VYSB 1B1BA 3LQQA 1ZHFA 4ZC3A 2ME6A 3VPRA 3O2PE 2LTPA 5LGTA 4JK1X 4H4KC 2F5FA 1YI2I 2WV1A 4I2OA 3U1DA 2GOMA 4A5NA 2A69F 1Y8QB 4AWXB 3DBLB 3BP8A 2GIZA 2LY9A 5CYVA 4GFBA 2X6XA 4FISA 1XMXA 3WU0A 3H1CA 2DODA 2H8RA 2JRTA 1XGMA 4KNYA 1IRXA 2WBMA 2K9NA 4IHWA 5KAIC 2RQPA 3BWGA 3KLNA 3CO7C 4ITVA 2VB6A 5LEJA 2ZXIA 4G6DA 3CZ6A 3JCUC 2LKPA 4L9JA 1O57A 1R58A 1SD7A 3HBLA 3IL2A 1IRGA 5F0FA 1XS9A 1U78A 3OIQA 5HDNA 2XROA 2LNBA 3L2RA 1PUFA 2QSHX 2DPDA 4D9JA 2ADUA 3EUAA 1Z05A 5J3LA 2KT0A 2K4BA 2C6YA 1TQPA 3ABKH 3K4BA 3OYKA 1G6NA 1FOKA 4XORA 2O3FA 4AIJA 3FWEA 4XR6A 1OKRA 2DFEA 3WTTC 4Y7NJ 2CUJA 1YG2A 3SEQA 1GXQA 1XD7A 3I5UA 3H3UA 2JSCA 4FCYA 4D5CA 1OISA 2XF6A 4WX9A 2FE3A 2XKOA 2ZJ2A 4N9IA 4M72A 3BR6A 2VQHA 1OJLA 1FMWA 4BQOA 1FY7A 1FX7A 4ANJA 4CUGA 3L9FA 3CJRB 1R6RA 1RZ4A 4F91B 5H20A 4ZYGA 2HPIA 1BIAA 4AYBN 1IW7F 3LA7A 1B72A 2DK8A
chains in the Genus database with same CATH topology
2O6GE 5D5UB 1QZZA 3GF2A 1B9MA 4KIBA 4R79A 2PEXA 3TO7A 3SFZA 4LFUA 2DO7A 1QQIA 1IN7A 2EA4A 2DTRA 1HQCA 3F8NA 4ZZDA 1UB9A 3K1NA 1RI7A 4ZYHA 1YIOA 1ONVA 1Z91A 1FLIA 2OU2A 3K1PA 3S2WA 1BI3A 4U0YA 5LRRA 4IRHA 3I58A 3DKWA 4L5JA 3CO6C 2GWRA 2P5KA 4Y17A 1GVJA 4OIOF 2IW5A 1S7OA 4HBLA 3P9IA 5IT9K 1FWZA 3KZYA 3ABUA 2HYGD 3WTUC 2UXNA 1REPC 3IC7A 2A5YB 4BQAA 1JXSA 4LG0B 2CQKA 4MEYF 3IWZA 2UXXA 1R00A 1DUXC 2PMHA 4ZZLA 2IVMA 2E7WA 3QP5A 2V1XA 4L9TA 1IAWA 4MQ9F 2ZFWA 4LMYA 1R36A 2V6CA 4GGGA 1D8JA 3RKYA 4Y13A 3V8LA 1UCRA 1DDNA 5HDKA 3K0LA 2P6SA 3WG9A 2LF7A 3ULQB 2D1HA 2Y75A 5JI6A 5HDGA 5E8IA 1J2XA 5HS7A 3COAC 1MDMB 5H6RA 1T2KA 1EH6A 3Q9VA 3LAJA 4S04A 4KFCA 1XGOA 2ZKZA 3KP5A 4UNOA 3HRUA 2F5DA 1AWCA 3J81Z 4F7ZA 2CGPA 2FBKA 3ZMDA 2P5VA 3W6JB 1PP8F 5K5RA 3HIFA 3E5UA 4P96A 2FMLA 3CJNA 1HW5A 3WU1B 4RB1A 3I64A 6PAXA 1ZH5A 1P92A 3C18A 4LGWA 3TDZC 4O5VA 4NQWA 2Z5UA 3EDPA 3FX3A 1WKMA 2GXGA 5ICCA 3QU3A 2V1DA 3QP6A 4EVIA 3FZVA 4K2EA 4B8XA 4AVPA 1J75A 4WXDA 2HS5A 4QWQA 2LDUA 4BXUA 3GO5A 1BN5A 3T5XA 3E6MA 3GFJA 5BMZA 1B9NA 2P8TA 3LFKA 3M8EA 3KEQA 4UHTA 3HTUA 1TNTA 2P7CB 3REOA 2GQQA 1MJAA 3PQKA 3ZN1A 4Q5SF 3C1DA 4HF1A 5E18F 2OQGA 2WC2A 4JQFA 1FC3A 1OYYA 5HLHA 3GXOA 1ZN2A 1YW7A 1S7AA 2Y48A 4OMYA 4MNUA 3WTZA 3SZTA 1KYWA 3HTSB 2XAFA 1FT9A 2ZNYA 3LWFA 1GXPA 2H6CA 2STWA 4N9HA 4E70A 4EM2A 2NYXA 3EYYA 4R1HA 5K5OA 3BDDA 1K6OA 3ZMVA 3T8TA 3RPQA 2Z3YA 4PZJA 3E5XA 1HKTA 1Q1HA 4MGRA 4M9ZA 1ULYA 3ERED 5D6EA 2HOEA 2VT3A 3WGIA 4EV0A 4EJWA 2W24A 1RNLA 1J59A 2CSOA 5EEGA 3NRVA 4G7HF 5LLQA 4XLPF 3DFGA 1EH7A 5FFXA 1J0RA 2K4JA 1TW2A 2BYVE 1LVAA 3KP2A 1S6LA 2RN7A 1RIOH 5FO5A 3K2ZA 4G94A 4YIFA 4M6XA 1U5TC 2A68F 3H3ZA 1XDUA 1FBQA 4UVCA 5J8CA 2IPQX 2HYFA 1FP2A 4KIGA 1YTYA 2YU3A 5L3CA 1BI1A 3I71A 5FD5A 2RDPA 2QUFA 1SMYF 1EH8A 5DCMA 5CVUA 4M71A 3F8BA 2JPCA 4GO1A 2ZCWA 1V4RA 3G73A 3FF5A 2RGVA 5FGMA 4CHUA 3HUGA 4U0VA 2FOKA 2ZXJA 2RV8A 2EA2A 2KIMA 2FMYA 1BI2A 1UFMA 3CDHA 2XVCA 1OYWA 2Q8KA 5A2QZ 4BNCA 1ZG1A 2QM3A 2HFHA 3MEXA 3EETA 2Q2EA 3LA2A 2QVOA 5AONA 4CICA 3DV8A 3K1MA 3GX4X 2VBZA 3KLOA 3PQJA 2CWEA 1Z9CA 4P5OA 1LQ1A 2FSWA 4GYGA 3ZN0A 4OU0A 1WI9A 4Y15A 2XIGA 5LBQA 4M6YA 1YW8A 1S29A 2EWNA 3QAHA 3JAMZ 2D1VA 1WWXA 1LEAA 4EM0B 3HSRA 3K9TA 3GFMA 2M5WA 4UV9A 2HKXA 3F6VA 4RB0A 2W57A 1FYMA 4M74A 4LLLA 1BOAA 2JTVA 3C3WA 4IVNA 2B0LA 5IT9Z 3V7SA 4UXNA 3ROUA 2F2EA 1ZG5A 1KA8A 4IF4A 4KIFA 2H94A 3MFKA 2DAOA 3ECHA 5LRSA 2GAUA 1YQAA 3QRFF 2RNJA 4HV6A 5DV5A 1H0MA 4P9UA 1O3RA 2COMA 3GEZA 1IXSB 1QGPA 3Q5FA 1G3TA 3EYIA 1FBUA 4LD5A 2OBPA 1Y0UA 3VEPA 5DD4A 4LJZF 2KJBA 1P6RA 4EQQA 2UWMA 2PFBA 1FZPB 2VBYA 4A0ZA 2XUBA 3M1EA 1FBSA 1QPMA 3F72A 3BPXA 1V3FA 1W7PA 4MQVA 5ILVA 2J5PA 2OD5A 5EEHA 4A0XA 5TRDA 3M9AA 4DQ2A 3VFZA 3TDUC 3TO6A 1SMTA 3T1BA 1K78A 3QU6A 4MEXF 2O61A 2EFQA 5E1WA 1J5YA 2QQAA 5D5WB 1F1ZA 2WV0A 1Z6RA 4RGXA 3F8MA 5A2QK 2ESNA 2FU4A 1U5TB 1TBXA 2QWWA 3SXYA 5DCMB 3ZPLA 1C0WA 4WCGA 2W84A 4BH9A 1BIBA 1HSJA 2VODA 3WE3A 2QQ9A 5ED4A 2O03A 4U7BA 4HQEA 1XSDA 1ODDA 1E17A 4OOIA 3HYIA 1ZREA 1J9IA 2MD5A 2VN2A 3JAMK 1PP7U 4KMFA 4GCVA 1A04A 4P55A 5F1RA 2HQRA 4IHTA 4AD9A 1FP1D 3P7NA 1ZGAA 3DXJF 2DPUA 1LDDA 3ZQ7A 4I0BA 5HLGA 2HWVA 1MZBA 2JT1A 1W5TA 5BQTA 2DLLA 3CUOA 3U9GA 5H6QA 1GHCA 1KYZA 2FXAA 4HX4A 1LDKB 1MGTA 2EJRA 1G3YA 4A6EA 3KEOA 4UUVA 2AXLA 3V8JA 2MH2A 2GXBA 2GZWA 4OMZA 2GIVA 4NHJA 1CF7A 3M8FA 2HKOA 4ZH4F 1PUEE 1XN7A 2IP2A 3U2RA 5D5VB 4ASNA 2IRFG 1S8NA 2CG4A 3IRRA 3DPTA 2W25A 3DPLC 1G3WA 1HSTA 3IKTA 3JSPA 1XDSA 3R61A 1IN4A 1LNWA 1SD5A 5J8FA 2EFPA 1R23A 3L09A 4YG2F 5LEKA 3MCZA 1B59A 2QQBA 4BHBA 4EJOA 4Q48A 5KVRA 3WGGA 3BJAA 5DDGA 2K86A 3K69A 4UVBA 1U2WA 1W7PB 3N97A 2BGCA 2JPBA 5BPDA 1HBXG 1I1SA 4HZFA 5D4RA 3L00A 4LLGF 4OIPF 3TOAA 3KFWX 2XGXA 3J80K 2EV6A 2O0YA 1TNSA 1U3EM 3O3KA 1MJ9A 2M30A 4WF2A 4I0AA 3LA3A 3GZ6A 1YYVA 1H9TA 2EV0A 4ENKA 3KP6A 3HSFA 4BYYA 4RAZA 2ZNZA 2MH9A 3R0JA 2EFOA 2P7VB 3R4KA 5HVQC 1I27A 2X0LA 1LB2A 3I53A 5ICGA 3F8FA 1J7KA 5DD8A 2KIFA 4A5MA 2DT5A 2ZO4A 4LK0F 1FYKA 1KQ8A 4BHPA 1KQ0A 3F23A 4AIKA 2FF4A 3RPUA 4I09A 3E6DA 1E2XA 2IA0A 1ZYRF 2XAGA 5D4SA 3HHGA 1R7JA 2EB7A 4G8XA 3EUHA 5D6FA 2E7XA 2NRAC 1QBJA 4A12A 3T0YA 4MTEA 4FX0A 2OQRA 3HHHA 3QPTA 2HDCA 4HOBA 3I59A 4EJTA 5JVTA 3HSEA 2R3SA 1TLHB 2Z33A 1TTYA 5AIQA 3L2CA 1BI0A 3E97A 1QNTA 2J5OA 2V1UA 3NQOA 1O7LA 4ETSA 5K1YA 3BPVA 2O8XA 1R5GA 2MC3A 5F64A 3NEUA 3W6KB 3HOSA 1G4DA 4A6DA 3E6CC 2G7UA 5BOXA 2XV4S 1T0FA 3GVAA 4HF0A 1IN5A 2DK5A 4HF2A 1FNNA 3O6BB 1PDNC 3I54A 2IJLA 2D45A 1D5VA 1TQIA 3TKYA 3F22A 2F5CA 2G7HA 2V9VA 3T8RA 1UHWA 1HKQA 2BEOA 2NNNA 1USTA 3QPHA 4G7ZF 4O3MA 4KMUX 1H9GA 3P9KA 2M45A 2KIUA 3QOPA 1B6AA 2K7LA 4PGGA 4YIIA 3WTVC 3BOQA 2MA3A 4LB6B 3FM5A 3M7GA 2FEZA 3V7RA 2V79A 5HOOA 4L9VA 3IRQA 4YFKF 1BC8C 2NS0A 1D8KA 2MLKA 2HTSA 2VOOA 1KU7A 1KQ9A 1IF1A 2G9WA 3B73A 2DQLA 3HRSA 4ZYDA 2FA5A 2DU9A 2M87A 3OOPA 4ESJA 3MZHA 5CVRA 2PG4A 1ZRCA 3G3ZA 1TW3A 4I01A 2QYOA 1QO0D 2ISZA 2VE9A 3N4MA 1FSEA 1O3SA 2VXZA 2F5EA 4RAYA 1WQ2A 3FXQA 1K79A 3E6BA 3V7CA 1YLFA 3H92A 2QZ8A 1I1GA 4HQMA 2PI0A 5DUKA 1ZGJA 2STTA 1P4AA 2KKOA 2AS5F 1ZLKA 3LAPA 1I6XA 3P9CA 1XMKA 1U6GA 2YSRA 2FNAA 2JZYA 2NAZA 3JW4A 1NHAA 1XSXA 4WXCA 4XBFA 5JFRA 3IWFA 1JGSA 3RYPA 4A0YA 3SHFA 2BBYA 2A61A 5E17F 2R7FA 4LG0A 1YFHA 4KYWA 1W7PD 4U0WA 3ZMTA 2RVCA 1HKSA 2QENA 2IT0A 2P5LC 4LB5A 3BJ6A 3CLOA 4EGYA 4LK1F 4G6QA 2IA2A 3SQNA 2HEOA 2FBHA 4GXOA 2Z99A 4IRGA 3F3XA 3RDIA 4Q4ZF 5FLXK 4I98B 1SD4A 2OAZA 3RJPA 5LHGA 4I7HA 2XKPA 1IZ1A 4Q47A 4HW0A 1IUYA 1BBYA 2HZTA 1MDMA 1QZYA 3F6OA 3HOTA 1SFXA 1P2FA 2A3SA 2XRNA 3RTRA 3C7JA 3PFIA 2M8EA 2CFXA 3E5QA 1U8RA 2MBFA 3CUQA 5BS6A 2ACJA 3GZ5A 2EV5A 3WTXC 1ZAOA 1BJAA 4O6JA 5CVIA 1ZG3A 2PJPA 3D5LA 4WXHA 2ESHA 4NB5A 4OINF 4RGRA 1XGNA 5FD6A 1IN6A 2L4AA 4L0ZB 4PCQA 4H0EA 1IXRC 3JTHA 2VOPA 5CLSA 4ZYEA 2FBIA 1OYIA 4CDGA 3FHZA 1YS7A 1R1VA 5DUIA 3FMRA 3KCCA 5L3FA 3OV8A 4KICA 3ML6A 3GFLA 4JBAA 2YR2A 2L4MA 4FT8A 3EQLF 3J80Z 5CVVA 2H27A 4MTDA 5TJJA 5LGNA 4CZZA 2H6BA 2HGCA 2DFIA 2FNPA 3VODA 2ISYA 5J6XA 1JHFA 3RKWA 5ICFA 3ECOA 4XLNF 1RUNA 3FXRA 3FMSA 5HS8A 2YPRA 4TV7A 2PLYA 1D3YA 4WK8F 1ON2A 2BV6A 2A6HF 2PBIA 2DBBA 5D8KB 2A6EF 5DEQA 1SFEA 4Z2YA 2K02A 4U88A 2R7DA 4BAYA 5CJ9A 1MKMA 4XSXF 1RUOA 3BY6A 4OIQF 2ZBKA 1R5HA 5F6FA 4CYDA 3F8CA 4ON0A 3WTSC 4RS8A 1STZA 3R6SA 4EM1A 1MD0A 4GYIA 5LHHA 4M9SA 3FXUA 2ZMEA 1S3JA 1O3QA 2QBYA 3MAJA 1FPQA 3RIRA 2VONA 1W5SA 3GLXA 1XMAA 1FYLA 2EK5A 3R0AA 3DF8A 5KK1A 5L3GA 1SD6A 5HS9A 3FMQA 2LSOA 2CW0F 4KUMA 3I0TA 2HR3A 4KDPA 5AIPA 4ENJA 1IXCA 4MHGA 2WWYA 5D8LB 3MZYA 4KA4A 1VTNC 2RC4A 4IPAA 2M1BA 4XSZF 3CTAA 2L54A 5ILUA 1XCBA 1F5TA 3GUDA 3WTYC 4D0PA 1KU3A 2EFNA 4IJAA 3HRMA 1XGSA 2L01A 4HV5A 3V4GA 4S05A 3CUQB 3DEUA 4YFNF 3SZPA 2P6TA 4HLYA 3KP7A 2KJCA 1K78B 3TGNA 3TO9A 4IHSA 4R8HA 2VC0A 1T38A 1W4MA 5L3DA 3JSOA 4HDVA 4ESBA 2A07F 1ON1A 5FB2A 2K27A 1WSUA 4EGZA 1UHMA 3J7AO 5K5QA 1Z6TA 2VC1A 5DCFA 3AAFA 3KP4A 3MQ0A 3HRTA 4HDUA 2OA4A 4M9XA 1JHHA 5IT3A 4WWCA 1IRFA 4KN4X 1YW9A 2VBXA 1P4WA 1ZLJA 4HLXA 4KN7X 3ZMSA 4YFXF 1Z1DA 4FX4A 5CVJA 2XHKA 2GA1A 1BM9A 5BPIA 1KU2A 1HXDA 2TDXA 3WE2A 2HQNA 4HAMA 2Y0MA 1O3TA 3GFIA 3LSTA 2VE8A 4HX8A 1ZRDA 3VB2A 4PDKA 2ETHA 4XRFA 4OIRF 2VT2A 2OZ6A 3GWZA 4EJVA 4PGHA 3D0SA 4N0BA 3F21A 3TQNA 5L3BA 1XB4A 2ELHA 4BHCA 5E20A 1HW2A 4ESFA 1LEBA 1YO5C 1R22A 2WTEA 4CGZA 4HX7A 3LQRA 2YX4A 2YX7A 1XSVA 4L0YB 2MLGA 1EV7A 5JR3A 4RGSA 3GYHX 4KT5C 4UVAA 2ZMEB 1CF7B 4P9FA 3KE2A 2W85A 1KGSA 3RKXA 2QBYB 5E1XA 2GA2A 2EFWA 4RGUA 2PN6A 2XAQA 2Q0OA 2NNYA 5D5XB 4B09A 2PQ8A 4I02A 1BC7C 5FLXZ 1FSHA 1K7AA 3GW2A 2VBWA 1YS6A 4L18B 3J81K 4G7OF 2XASA 3WGHA 4ENNA 5E8GA 3KZZA 3B02A 3WODF 4EJUA 3ELKA 4CO8A 2H09A 2DW4A 2D2WA 1USSA 5DYMA 4AIHA 4A2UA 3MWMA 2BE5F 4EMSA 1OR7A 2P4WA 2RKHA 5HLIA 1R1UA 2XAHA 1DPUA 1U5TA 3R60A 4M73A 3BROA 4L9NA 2KRFA 3DP7A 1CGPA 1WRJA 5ILSA 1DP7P 3KP3A 1KU9A 2XAJA 2FRHA 1T39A 4DNCA 4FHTA 5LHIA 5ICEA 5LGUA 4UV8A 3E3VA 2OZUA 3ZMUA 3IHUA 4U7DA 1T98A 1LDJA 1P4XA 3TOBA 2CYYA 4LLNA 1T6SA 2DQRA 3ISPA 2L3DA 5ERIA 1MJBA 1L0OC 1DPRA 3DQVC 1G3SA 3ABTA 2CO5A 1LJ9A 1TQMA 4RB3C 5FFZA 4IRIA 2HTJA 1OPCA 3RYRA 2UZKA 1R1TA 3FM3A 3I4PA 4IXAA 2DI3A 4HYEA 4HA8A 1OMIA 3L7WA 3RI4A 1ZARA 4RB2C 1O7FA 1SAXA 3BJOA 4QLCU 4G9YA 1ZRFA 3KETA 2X4HA 3V8KA 3WTWC 2Z9OA 1HW1A 3I59B 2L02A 4L5IA 2PMUA 1SFUA 2E1CA 1Z7UA 3ZMZA 2QLZA 3IKVA 2IA1A 3ZP5A 1F9NA 1F4KA 2LF8A 1AOYA 1L3LA 1XCVA 1IN8A 3Q9SA 1X3UA 5JHUA 3BZ6A 5E1ZB 2FQ3A 1JE8A 1B4AA 4ENMA 2E1NA 5L3EA 3CUQC 3JTGA 4CXFA 3VOEA 1I5ZA 1B1BA 3LQQA 1ZHFA 3O2PE 5LGTA 4JK1X 2F5FA 4I2OA 3U1DA 4A5NA 2A69F 4AWXB 3BP8A 5CYVA 3WU0A 2JRTA 1XGMA 4KNYA 2RQPA 3BWGA 3KLNA 3CO7C 5LEJA 4G6DA 2LKPA 4L9JA 1O57A 1R58A 1SD7A 3IL2A 1IRGA 1U78A 5HDNA 2XROA 2LNBA 2DPDA 2ADUA 1Z05A 2K4BA 2C6YA 1TQPA 1G6NA 1FOKA 2O3FA 4AIJA 3FWEA 1OKRA 3WTTC 1YG2A 1GXQA 1XD7A 3I5UA 3H3UA 2JSCA 4WX9A 2FE3A 2XKOA 2ZJ2A 4N9IA 4M72A 1FY7A 1FX7A 3L9FA 1RZ4A 5H20A 4ZYGA 1BIAA 1IW7F 3LA7A 2DK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6G E;  5D5U B;  1QZZ A;  3GF2 A;  1B9M A;  4KIB A;  4R79 A;  2PEX A;  3TO7 A;  3SFZ A;  4LFU A;  2DO7 A;  1QQI A;  1IN7 A;  2EA4 A;  2DTR A;  1HQC A;  3F8N A;  4ZZD A;  1UB9 A;  3K1N A;  1RI7 A;  4ZYH A;  1YIO A;  1ONV A;  1Z91 A;  1FLI A;  2OU2 A;  3K1P A;  3S2W A;  1BI3 A;  4U0Y A;  5LRR A;  4IRH A;  3I58 A;  3DKW A;  4L5J A;  3CO6 C;  2GWR A;  2P5K A;  4Y17 A;  1GVJ A;  4OIO F;  2IW5 A;  1S7O A;  4HBL A;  3P9I A;  5IT9 K;  1FWZ A;  3KZY A;  3ABU A;  2HYG D;  3WTU C;  2UXN A;  1REP C;  3IC7 A;  2A5Y B;  4BQA A;  1JXS A;  4LG0 B;  2CQK A;  4MEY F;  3IWZ A;  2UXX A;  1R00 A;  1DUX C;  2PMH A;  4ZZL A;  2IVM A;  2E7W A;  3QP5 A;  2V1X A;  4L9T A;  1IAW A;  4MQ9 F;  2ZFW A;  4LMY A;  1R36 A;  2V6C A;  4GGG A;  1D8J A;  3RKY A;  4Y13 A;  3V8L A;  1UCR A;  1DDN A;  5HDK A;  3K0L A;  2P6S A;  3WG9 A;  2LF7 A;  3ULQ B;  2D1H A;  2Y75 A;  5JI6 A;  5HDG A;  5E8I A;  1J2X A;  5HS7 A;  3COA C;  1MDM B;  5H6R A;  1T2K A;  1EH6 A;  3Q9V A;  3LAJ A;  4S04 A;  4KFC A;  1XGO A;  2ZKZ A;  3KP5 A;  4UNO A;  3HRU A;  2F5D A;  1AWC A;  3J81 Z;  4F7Z A;  2CGP A;  2FBK A;  3ZMD A;  2P5V A;  3W6J B;  1PP8 F;  5K5R A;  3HIF A;  3E5U A;  4P96 A;  2FML A;  3CJN A;  1HW5 A;  3WU1 B;  4RB1 A;  3I64 A;  6PAX A;  1ZH5 A;  1P92 A;  3C18 A;  4LGW A;  3TDZ C;  4O5V A;  4NQW A;  2Z5U A;  3EDP A;  3FX3 A;  1WKM A;  2GXG A;  5ICC A;  3QU3 A;  2V1D A;  3QP6 A;  4EVI A;  3FZV A;  4K2E A;  4B8X A;  4AVP A;  1J75 A;  4WXD A;  2HS5 A;  4QWQ A;  2LDU A;  4BXU A;  3GO5 A;  1BN5 A;  3T5X A;  3E6M A;  3GFJ A;  5BMZ A;  1B9N A;  2P8T A;  3LFK A;  3M8E A;  3KEQ A;  4UHT A;  3HTU A;  1TNT A;  2P7C B;  3REO A;  2GQQ A;  1MJA A;  3PQK A;  3ZN1 A;  4Q5S F;  3C1D A;  4HF1 A;  5E18 F;  2OQG A;  2WC2 A;  4JQF A;  1FC3 A;  1OYY A;  5HLH A;  3GXO A;  1ZN2 A;  1YW7 A;  1S7A A;  2Y48 A;  4OMY A;  4MNU A;  3WTZ A;  3SZT A;  1KYW A;  3HTS B;  2XAF A;  1FT9 A;  2ZNY A;  3LWF A;  1GXP A;  2H6C A;  2STW A;  4N9H A;  4E70 A;  4EM2 A;  2NYX A;  3EYY A;  4R1H A;  5K5O A;  3BDD A;  1K6O A;  3ZMV A;  3T8T A;  3RPQ A;  2Z3Y A;  4PZJ A;  3E5X A;  1HKT A;  1Q1H A;  4MGR A;  4M9Z A;  1ULY A;  3ERE D;  5D6E A;  2HOE A;  2VT3 A;  3WGI A;  4EV0 A;  4EJW A;  2W24 A;  1RNL A;  1J59 A;  2CSO A;  5EEG A;  3NRV A;  4G7H F;  5LLQ A;  4XLP F;  3DFG A;  1EH7 A;  5FFX A;  1J0R A;  2K4J A;  1TW2 A;  2BYV E;  1LVA A;  3KP2 A;  1S6L A;  2RN7 A;  1RIO H;  5FO5 A;  3K2Z A;  4G94 A;  4YIF A;  4M6X A;  1U5T C;  2A68 F;  3H3Z A;  1XDU A;  1FBQ A;  4UVC A;  5J8C A;  2IPQ X;  2HYF A;  1FP2 A;  4KIG A;  1YTY A;  2YU3 A;  5L3C A;  1BI1 A;  3I71 A;  5FD5 A;  2RDP A;  2QUF A;  1SMY F;  1EH8 A;  5DCM A;  5CVU A;  4M71 A;  3F8B A;  2JPC A;  4GO1 A;  2ZCW A;  1V4R A;  3G73 A;  3FF5 A;  2RGV A;  5FGM A;  4CHU A;  3HUG A;  4U0V A;  2FOK A;  2ZXJ A;  2RV8 A;  2EA2 A;  2KIM A;  2FMY A;  1BI2 A;  1UFM A;  3CDH A;  2XVC A;  1OYW A;  2Q8K A;  5A2Q Z;  4BNC A;  1ZG1 A;  2QM3 A;  2HFH A;  3MEX A;  3EET A;  2Q2E A;  3LA2 A;  2QVO A;  5AON A;  4CIC A;  3DV8 A;  3K1M A;  3GX4 X;  2VBZ A;  3KLO A;  3PQJ A;  2CWE A;  1Z9C A;  4P5O A;  1LQ1 A;  2FSW A;  4GYG A;  3ZN0 A;  4OU0 A;  1WI9 A;  4Y15 A;  2XIG A;  5LBQ A;  4M6Y A;  1YW8 A;  1S29 A;  2EWN A;  3QAH A;  3JAM Z;  2D1V A;  1WWX A;  1LEA A;  4EM0 B;  3HSR A;  3K9T A;  3GFM A;  2M5W A;  4UV9 A;  2HKX A;  3F6V A;  4RB0 A;  2W57 A;  1FYM A;  4M74 A;  4LLL A;  1BOA A;  2JTV A;  3C3W A;  4IVN A;  2B0L A;  5IT9 Z;  3V7S A;  4UXN A;  3ROU A;  2F2E A;  1ZG5 A;  1KA8 A;  4IF4 A;  4KIF A;  2H94 A;  3MFK A;  2DAO A;  3ECH A;  5LRS A;  2GAU A;  1YQA A;  3QRF F;  2RNJ A;  4HV6 A;  5DV5 A;  1H0M A;  4P9U A;  1O3R A;  2COM A;  3GEZ A;  1IXS B;  1QGP A;  3Q5F A;  1G3T A;  3EYI A;  1FBU A;  4LD5 A;  2OBP A;  1Y0U A;  3VEP A;  5DD4 A;  4LJZ F;  2KJB A;  1P6R A;  4EQQ A;  2UWM A;  2PFB A;  1FZP B;  2VBY A;  4A0Z A;  2XUB A;  3M1E A;  1FBS A;  1QPM A;  3F72 A;  3BPX A;  1V3F A;  1W7P A;  4MQV A;  5ILV A;  2J5P A;  2OD5 A;  5EEH A;  4A0X A;  5TRD A;  3M9A A;  4DQ2 A;  3VFZ A;  3TDU C;  3TO6 A;  1SMT A;  3T1B A;  1K78 A;  3QU6 A;  4MEX F;  2O61 A;  2EFQ A;  5E1W A;  1J5Y A;  2QQA A;  5D5W B;  1F1Z A;  2WV0 A;  1Z6R A;  4RGX A;  3F8M A;  5A2Q K;  2ESN A;  2FU4 A;  1U5T B;  1TBX A;  2QWW A;  3SXY A;  5DCM B;  3ZPL A;  1C0W A;  4WCG A;  2W84 A;  4BH9 A;  1BIB A;  1HSJ A;  2VOD A;  3WE3 A;  2QQ9 A;  5ED4 A;  2O03 A;  4U7B A;  4HQE A;  1XSD A;  1ODD A;  1E17 A;  4OOI A;  3HYI A;  1ZRE A;  1J9I A;  2MD5 A;  2VN2 A;  3JAM K;  1PP7 U;  4KMF A;  4GCV A;  1A04 A;  4P55 A;  5F1R A;  2HQR A;  4IHT A;  4AD9 A;  1FP1 D;  3P7N A;  1ZGA A;  3DXJ F;  2DPU A;  1LDD A;  3ZQ7 A;  4I0B A;  5HLG A;  2HWV A;  1MZB A;  2JT1 A;  1W5T A;  5BQT A;  2DLL A;  3CUO A;  3U9G A;  5H6Q A;  1GHC A;  1KYZ A;  2FXA A;  4HX4 A;  1LDK B;  1MGT A;  2EJR A;  1G3Y A;  4A6E A;  3KEO A;  4UUV A;  2AXL A;  3V8J A;  2MH2 A;  2GXB A;  2GZW A;  4OMZ A;  2GIV A;  4NHJ A;  1CF7 A;  3M8F A;  2HKO A;  4ZH4 F;  1PUE E;  1XN7 A;  2IP2 A;  3U2R A;  5D5V B;  4ASN A;  2IRF G;  1S8N A;  2CG4 A;  3IRR A;  3DPT A;  2W25 A;  3DPL C;  1G3W A;  1HST A;  3IKT A;  3JSP A;  1XDS A;  3R61 A;  1IN4 A;  1LNW A;  1SD5 A;  5J8F A;  2EFP A;  1R23 A;  3L09 A;  4YG2 F;  5LEK A;  3MCZ A;  1B59 A;  2QQB A;  4BHB A;  4EJO A;  4Q48 A;  5KVR A;  3WGG A;  3BJA A;  5DDG A;  2K86 A;  3K69 A;  4UVB A;  1U2W A;  1W7P B;  3N97 A;  2BGC A;  2JPB A;  5BPD A;  1HBX G;  1I1S A;  4HZF A;  5D4R A;  3L00 A;  4LLG F;  4OIP F;  3TOA A;  3KFW X;  2XGX A;  3J80 K;  2EV6 A;  2O0Y A;  1TNS A;  1U3E M;  3O3K A;  1MJ9 A;  2M30 A;  4WF2 A;  4I0A A;  3LA3 A;  3GZ6 A;  1YYV A;  1H9T A;  2EV0 A;  4ENK A;  3KP6 A;  3HSF A;  4BYY A;  4RAZ A;  2ZNZ A;  2MH9 A;  3R0J A;  2EFO A;  2P7V B;  3R4K A;  5HVQ C;  1I27 A;  2X0L A;  1LB2 A;  3I53 A;  5ICG A;  3F8F A;  1J7K A;  5DD8 A;  2KIF A;  4A5M A;  2DT5 A;  2ZO4 A;  4LK0 F;  1FYK A;  1KQ8 A;  4BHP A;  1KQ0 A;  3F23 A;  4AIK A;  2FF4 A;  3RPU A;  4I09 A;  3E6D A;  1E2X A;  2IA0 A;  1ZYR F;  2XAG A;  5D4S A;  3HHG A;  1R7J A;  2EB7 A;  4G8X A;  3EUH A;  5D6F A;  2E7X A;  2NRA C;  1QBJ A;  4A12 A;  3T0Y A;  4MTE A;  4FX0 A;  2OQR A;  3HHH A;  3QPT A;  2HDC A;  4HOB A;  3I59 A;  4EJT A;  5JVT A;  3HSE A;  2R3S A;  1TLH B;  2Z33 A;  1TTY A;  5AIQ A;  3L2C A;  1BI0 A;  3E97 A;  1QNT A;  2J5O A;  2V1U A;  3NQO A;  1O7L A;  4ETS A;  5K1Y A;  3BPV A;  2O8X A;  1R5G A;  2MC3 A;  5F64 A;  3NEU A;  3W6K B;  3HOS A;  1G4D A;  4A6D A;  3E6C C;  2G7U A;  5BOX A;  2XV4 S;  1T0F A;  3GVA A;  4HF0 A;  1IN5 A;  2DK5 A;  4HF2 A;  1FNN A;  3O6B B;  1PDN C;  3I54 A;  2IJL A;  2D45 A;  1D5V A;  1TQI A;  3TKY A;  3F22 A;  2F5C A;  2G7H A;  2V9V A;  3T8R A;  1UHW A;  1HKQ A;  2BEO A;  2NNN A;  1UST A;  3QPH A;  4G7Z F;  4O3M A;  4KMU X;  1H9G A;  3P9K A;  2M45 A;  2KIU A;  3QOP A;  1B6A A;  2K7L A;  4PGG A;  4YII A;  3WTV C;  3BOQ A;  2MA3 A;  4LB6 B;  3FM5 A;  3M7G A;  2FEZ A;  3V7R A;  2V79 A;  5HOO A;  4L9V A;  3IRQ A;  4YFK F;  1BC8 C;  2NS0 A;  1D8K A;  2MLK A;  2HTS A;  2VOO A;  1KU7 A;  1KQ9 A;  1IF1 A;  2G9W A;  3B73 A;  2DQL A;  3HRS A;  4ZYD A;  2FA5 A;  2DU9 A;  2M87 A;  3OOP A;  4ESJ A;  3MZH A;  5CVR A;  2PG4 A;  1ZRC A;  3G3Z A;  1TW3 A;  4I01 A;  2QYO A;  1QO0 D;  2ISZ A;  2VE9 A;  3N4M A;  1FSE A;  1O3S A;  2VXZ A;  2F5E A;  4RAY A;  1WQ2 A;  3FXQ A;  1K79 A;  3E6B A;  3V7C A;  1YLF A;  3H92 A;  2QZ8 A;  1I1G A;  4HQM A;  2PI0 A;  5DUK A;  1ZGJ A;  2STT A;  1P4A A;  2KKO A;  2AS5 F;  1ZLK A;  3LAP A;  1I6X A;  3P9C A;  1XMK A;  1U6G A;  2YSR A;  2FNA A;  2JZY A;  2NAZ A;  3JW4 A;  1NHA A;  1XSX A;  4WXC A;  4XBF A;  5JFR A;  3IWF A;  1JGS A;  3RYP A;  4A0Y A;  3SHF A;  2BBY A;  2A61 A;  5E17 F;  2R7F A;  4LG0 A;  1YFH A;  4KYW A;  1W7P D;  4U0W A;  3ZMT A;  2RVC A;  1HKS A;  2QEN A;  2IT0 A;  2P5L C;  4LB5 A;  3BJ6 A;  3CLO A;  4EGY A;  4LK1 F;  4G6Q A;  2IA2 A;  3SQN A;  2HEO A;  2FBH A;  4GXO A;  2Z99 A;  4IRG A;  3F3X A;  3RDI A;  4Q4Z F;  5FLX K;  4I98 B;  1SD4 A;  2OAZ A;  3RJP A;  5LHG A;  4I7H A;  2XKP A;  1IZ1 A;  4Q47 A;  4HW0 A;  1IUY A;  1BBY A;  2HZT A;  1MDM A;  1QZY A;  3F6O A;  3HOT A;  1SFX A;  1P2F A;  2A3S A;  2XRN A;  3RTR A;  3C7J A;  3PFI A;  2M8E A;  2CFX A;  3E5Q A;  1U8R A;  2MBF A;  3CUQ A;  5BS6 A;  2ACJ A;  3GZ5 A;  2EV5 A;  3WTX C;  1ZAO A;  1BJA A;  4O6J A;  5CVI A;  1ZG3 A;  2PJP A;  3D5L A;  4WXH A;  2ESH A;  4NB5 A;  4OIN F;  4RGR A;  1XGN A;  5FD6 A;  1IN6 A;  2L4A A;  4L0Z B;  4PCQ A;  4H0E A;  1IXR C;  3JTH A;  2VOP A;  5CLS A;  4ZYE A;  2FBI A;  1OYI A;  4CDG A;  3FHZ A;  1YS7 A;  1R1V A;  5DUI A;  3FMR A;  3KCC A;  5L3F A;  3OV8 A;  4KIC A;  3ML6 A;  3GFL A;  4JBA A;  2YR2 A;  2L4M A;  4FT8 A;  3EQL F;  3J80 Z;  5CVV A;  2H27 A;  4MTD A;  5TJJ A;  5LGN A;  4CZZ A;  2H6B A;  2HGC A;  2DFI A;  2FNP A;  3VOD A;  2ISY A;  5J6X A;  1JHF A;  3RKW A;  5ICF A;  3ECO A;  4XLN F;  1RUN A;  3FXR A;  3FMS A;  5HS8 A;  2YPR A;  4TV7 A;  2PLY A;  1D3Y A;  4WK8 F;  1ON2 A;  2BV6 A;  2A6H F;  2PBI A;  2DBB A;  5D8K B;  2A6E F;  5DEQ A;  1SFE A;  4Z2Y A;  2K02 A;  4U88 A;  2R7D A;  4BAY A;  5CJ9 A;  1MKM A;  4XSX F;  1RUO A;  3BY6 A;  4OIQ F;  2ZBK A;  1R5H A;  5F6F A;  4CYD A;  3F8C A;  4ON0 A;  3WTS C;  4RS8 A;  1STZ A;  3R6S A;  4EM1 A;  1MD0 A;  4GYI A;  5LHH A;  4M9S A;  3FXU A;  2ZME A;  1S3J A;  1O3Q A;  2QBY A;  3MAJ A;  1FPQ A;  3RIR A;  2VON A;  1W5S A;  3GLX A;  1XMA A;  1FYL A;  2EK5 A;  3R0A A;  3DF8 A;  5KK1 A;  5L3G A;  1SD6 A;  5HS9 A;  3FMQ A;  2LSO A;  2CW0 F;  4KUM A;  3I0T A;  2HR3 A;  4KDP A;  5AIP A;  4ENJ A;  1IXC A;  4MHG A;  2WWY A;  5D8L B;  3MZY A;  4KA4 A;  1VTN C;  2RC4 A;  4IPA A;  2M1B A;  4XSZ F;  3CTA A;  2L54 A;  5ILU A;  1XCB A;  1F5T A;  3GUD A;  3WTY C;  4D0P A;  1KU3 A;  2EFN A;  4IJA A;  3HRM A;  1XGS A;  2L01 A;  4HV5 A;  3V4G A;  4S05 A;  3CUQ B;  3DEU A;  4YFN F;  3SZP A;  2P6T A;  4HLY A;  3KP7 A;  2KJC A;  1K78 B;  3TGN A;  3TO9 A;  4IHS A;  4R8H A;  2VC0 A;  1T38 A;  1W4M A;  5L3D A;  3JSO A;  4HDV A;  4ESB A;  2A07 F;  1ON1 A;  5FB2 A;  2K27 A;  1WSU A;  4EGZ A;  1UHM A;  3J7A O;  5K5Q A;  1Z6T A;  2VC1 A;  5DCF A;  3AAF A;  3KP4 A;  3MQ0 A;  3HRT A;  4HDU A;  2OA4 A;  4M9X A;  1JHH A;  5IT3 A;  4WWC A;  1IRF A;  4KN4 X;  1YW9 A;  2VBX A;  1P4W A;  1ZLJ A;  4HLX A;  4KN7 X;  3ZMS A;  4YFX F;  1Z1D A;  4FX4 A;  5CVJ A;  2XHK A;  2GA1 A;  1BM9 A;  5BPI A;  1KU2 A;  1HXD A;  2TDX A;  3WE2 A;  2HQN A;  4HAM A;  2Y0M A;  1O3T A;  3GFI A;  3LST A;  2VE8 A;  4HX8 A;  1ZRD A;  3VB2 A;  4PDK A;  2ETH A;  4XRF A;  4OIR F;  2VT2 A;  2OZ6 A;  3GWZ A;  4EJV A;  4PGH A;  3D0S A;  4N0B A;  3F21 A;  3TQN A;  5L3B A;  1XB4 A;  2ELH A;  4BHC A;  5E20 A;  1HW2 A;  4ESF A;  1LEB A;  1YO5 C;  1R22 A;  2WTE A;  4CGZ A;  4HX7 A;  3LQR A;  2YX4 A;  2YX7 A;  1XSV A;  4L0Y B;  2MLG A;  1EV7 A;  5JR3 A;  4RGS A;  3GYH X;  4KT5 C;  4UVA A;  2ZME B;  1CF7 B;  4P9F A;  3KE2 A;  2W85 A;  1KGS A;  3RKX A;  2QBY B;  5E1X A;  2GA2 A;  2EFW A;  4RGU A;  2PN6 A;  2XAQ A;  2Q0O A;  2NNY A;  5D5X B;  4B09 A;  2PQ8 A;  4I02 A;  1BC7 C;  5FLX Z;  1FSH A;  1K7A A;  3GW2 A;  2VBW A;  1YS6 A;  4L18 B;  3J81 K;  4G7O F;  2XAS A;  3WGH A;  4ENN A;  5E8G A;  3KZZ A;  3B02 A;  3WOD F;  4EJU A;  3ELK A;  4CO8 A;  2H09 A;  2DW4 A;  2D2W A;  1USS A;  5DYM A;  4AIH A;  4A2U A;  3MWM A;  2BE5 F;  4EMS A;  1OR7 A;  2P4W A;  2RKH A;  5HLI A;  1R1U A;  2XAH A;  1DPU A;  1U5T A;  3R60 A;  4M73 A;  3BRO A;  4L9N A;  2KRF A;  3DP7 A;  1CGP A;  1WRJ A;  5ILS A;  1DP7 P;  3KP3 A;  1KU9 A;  2XAJ A;  2FRH A;  1T39 A;  4DNC A;  4FHT A;  5LHI A;  5ICE A;  5LGU A;  4UV8 A;  3E3V A;  2OZU A;  3ZMU A;  3IHU A;  4U7D A;  1T98 A;  1LDJ A;  1P4X A;  3TOB A;  2CYY A;  4LLN A;  1T6S A;  2DQR A;  3ISP A;  2L3D A;  5ERI A;  1MJB A;  1L0O C;  1DPR A;  3DQV C;  1G3S A;  3ABT A;  2CO5 A;  1LJ9 A;  1TQM A;  4RB3 C;  5FFZ A;  4IRI A;  2HTJ A;  1OPC A;  3RYR A;  2UZK A;  1R1T A;  3FM3 A;  3I4P A;  4IXA A;  2DI3 A;  4HYE A;  4HA8 A;  1OMI A;  3L7W A;  3RI4 A;  1ZAR A;  4RB2 C;  1O7F A;  1SAX A;  3BJO A;  4QLC U;  4G9Y A;  1ZRF A;  3KET A;  2X4H A;  3V8K A;  3WTW C;  2Z9O A;  1HW1 A;  3I59 B;  2L02 A;  4L5I A;  2PMU A;  1SFU A;  2E1C A;  1Z7U A;  3ZMZ A;  2QLZ A;  3IKV A;  2IA1 A;  3ZP5 A;  1F9N A;  1F4K A;  2LF8 A;  1AOY A;  1L3L A;  1XCV A;  1IN8 A;  3Q9S A;  1X3U A;  5JHU A;  3BZ6 A;  5E1Z B;  2FQ3 A;  1JE8 A;  1B4A A;  4ENM A;  2E1N A;  5L3E A;  3CUQ C;  3JTG A;  4CXF A;  3VOE A;  1I5Z A;  1B1B A;  3LQQ A;  1ZHF A;  3O2P E;  5LGT A;  4JK1 X;  2F5F A;  4I2O A;  3U1D A;  4A5N A;  2A69 F;  4AWX B;  3BP8 A;  5CYV A;  3WU0 A;  2JRT A;  1XGM A;  4KNY A;  2RQP A;  3BWG A;  3KLN A;  3CO7 C;  5LEJ A;  4G6D A;  2LKP A;  4L9J A;  1O57 A;  1R58 A;  1SD7 A;  3IL2 A;  1IRG A;  1U78 A;  5HDN A;  2XRO A;  2LNB A;  2DPD A;  2ADU A;  1Z05 A;  2K4B A;  2C6Y A;  1TQP A;  1G6N A;  1FOK A;  2O3F A;  4AIJ A;  3FWE A;  1OKR A;  3WTT C;  1YG2 A;  1GXQ A;  1XD7 A;  3I5U A;  3H3U A;  2JSC A;  4WX9 A;  2FE3 A;  2XKO A;  2ZJ2 A;  4N9I A;  4M72 A;  1FY7 A;  1FX7 A;  3L9F A;  1RZ4 A;  5H20 A;  4ZYG A;  1BIA A;  1IW7 F;  3LA7 A;  2DK8 A; 
#chains in the Genus database with same CATH topology
 2O6G E;  5D5U B;  1QZZ A;  3BTL A;  2HU9 A;  4DOZ A;  4HSR A;  5M5W J;  2JQ7 A;  4XRM A;  2IS4 A;  4CSW A;  2V6E A;  3GF2 A;  1B9M A;  3LMM A;  4KIB A;  3X2Q H;  5EEA A;  4YRV A;  4R79 A;  2PEX A;  1DQU A;  3F9K A;  3TO7 A;  2E60 A;  2X6W A;  3FKJ A;  1VFC A;  3SFZ A;  4LFU A;  5KNL A;  2DO7 A;  1LE8 B;  1QQI A;  1IN7 A;  2EA4 A;  2DTR A;  3ZQF A;  2B9S A;  1HQC A;  3F8N A;  3CQZ J;  3AKZ A;  4ZZD A;  2O9L A;  2IS1 A;  2K3F A;  1UB9 A;  3K1N A;  1RI7 A;  1Z77 A;  1WFX A;  2E1O A;  4ZYH A;  1P7I A;  1APL C;  1YIO A;  1ONV A;  2F6C A;  3NWT A;  1QZE A;  1BA5 A;  1Z91 A;  1FLI A;  2OU2 A;  4E7J A;  2X6Y A;  3K1P A;  3OYC A;  3S2W A;  1ETY A;  1BI3 A;  3K7A J;  1D1B A;  2HQ5 A;  4U0Y A;  2UV1 A;  5LRR A;  1X1D A;  1PJR A;  3ZQG A;  1ETQ A;  4IRH A;  4NNJ A;  3H3V K;  1WI3 A;  2ID3 A;  3I58 A;  3DKW A;  4L5J A;  3CO6 C;  2ZME C;  2GWR A;  3CP2 A;  2P5K A;  4Y17 A;  3CCQ I;  1GVJ A;  1MMS A;  3FDY A;  3IAS 2;  4OIO F;  1WGX A;  3GTQ J;  2IW5 A;  1S7O A;  4HBL A;  1HA8 A;  3P9I A;  5IT9 K;  4BBS J;  1FWZ A;  3KZY A;  3OYA A;  1LVK A;  3ABU A;  3HGG A;  2HYG D;  3WTU C;  1I3A A;  2UXN A;  2XPU A;  1REP C;  2VKH A;  3H9G A;  3IC7 A;  1ERD A;  1SAU A;  1X58 A;  2A5Y B;  4BQA A;  2W48 A;  4PFP A;  3ZR8 X;  1W36 C;  1JXS A;  3RSN A;  2HZD A;  4A69 C;  4LG0 B;  2CQK A;  2DOA A;  4MEY F;  1SVL A;  4BQQ A;  3PL8 A;  2E5Z A;  4BY1 J;  3IWZ A;  3AG3 H;  2UXX A;  1R00 A;  1DUX C;  3JRE A;  2PMH A;  3LSR A;  3JRF A;  5IP6 A;  2EIL H;  4ZZL A;  3H9Q A;  1TP4 A;  4HPQ A;  1E3O C;  2IVM A;  3O8H A;  2E7W A;  3QP5 A;  1NG6 A;  2V1X A;  3OL4 A;  1AKH B;  3OYE A;  4L9T A;  5B66 C;  1IAW A;  4MQ9 F;  3MN2 A;  2M8G X;  2ZFW A;  4LMY A;  4C30 A;  1R36 A;  2V6C A;  3KEY A;  3OR2 C;  4GGG A;  3CCE I;  1D8J A;  5FRO A;  1IGN A;  2VQL A;  3RKY A;  3VDX A;  4Y13 A;  3V8L A;  1UCR A;  1DDN A;  2OTL I;  3L2W A;  5HDK A;  2PJR B;  3K0L A;  2P6S A;  3WG9 A;  2LF7 A;  4LIU A;  3ULQ B;  2D1H A;  2IXS A;  2Y75 A;  2H1L A;  1VQ8 I;  5JI6 A;  2JA6 J;  5HDG A;  5E8I A;  1J2X A;  2X48 A;  5HS7 A;  1OFC X;  3COA C;  1MDM B;  5H6R A;  1T2K A;  1EH6 A;  2Y9Z A;  1QVT A;  3Q9V A;  2HOS A;  3LAJ A;  5DTD A;  4S04 A;  2MSY A;  1JUM A;  4KFC A;  5E3N A;  3S15 J;  1XGO A;  3OYL A;  2ZKZ A;  3D1N I;  3KP5 A;  2E1M B;  4UNO A;  1XC5 A;  3HRU A;  2JVH A;  1QVU A;  2AHQ A;  2L7K A;  2DMP A;  2F5D A;  4BEH A;  1AWC A;  3J81 Z;  4F7Z A;  3OY9 A;  2CGP A;  3JRB A;  2JRM A;  4XL9 A;  3BR2 A;  2DJN A;  4HNT A;  2FBK A;  3ZMD A;  2P5V A;  3W6J B;  5M5X J;  1PP8 F;  5E3O A;  5K5R A;  2X1E A;  3HIF A;  3E5U A;  1RPW A;  2LRE A;  2AO9 A;  3A02 A;  4P96 A;  2FML A;  3PFY A;  4A3L J;  2NOJ B;  1YJW I;  3CJN A;  1HW5 A;  3WU1 B;  4RB1 A;  1ZR4 A;  3I64 A;  1ETK A;  6PAX A;  3RPU D;  1ZH5 A;  1VQP I;  2DOE A;  5J4Y A;  1P92 A;  3C18 A;  4LGW A;  3TDZ C;  4O5V A;  5HLT A;  4NQW A;  3H35 A;  3FIW A;  2Z5U A;  3EDP A;  3FX3 A;  1WKM A;  2GXG A;  3G1M A;  5ICC A;  3QU3 A;  2V1D A;  3QP6 A;  2Z1D A;  2EZK A;  4EVI A;  4JX4 A;  5J47 A;  3G71 I;  4F55 A;  2VLA A;  3WG7 H;  2KQR A;  3FZV A;  2E34 A;  4G12 A;  4K2E A;  4B8X A;  4AVP A;  1J75 A;  1VI0 A;  3KZI C;  3PSF A;  4IL6 C;  4WXD A;  3PO2 J;  2HS5 A;  1ENH A;  4HEA 2;  3CD6 I;  2WA0 A;  4QWQ A;  4NC6 A;  2LDU A;  3CCM I;  4BXU A;  3GO5 A;  1BN5 A;  1Z7L A;  4RDU A;  1UG0 A;  3T5X A;  3E6M A;  3GFJ A;  5KAF C;  2FX0 A;  2KFD A;  2W82 A;  4FAS D;  5E79 C;  2CU7 A;  5BMZ A;  3E7L A;  1B9N A;  2P8T A;  3L2Q A;  3LFK A;  3M8E A;  4LIT A;  3KEQ A;  4UHT A;  3HTU A;  3CP8 A;  1TNT A;  3CF5 F;  3REO A;  2P7C B;  2GQQ A;  1MJA A;  4BAC A;  4B48 A;  4P1W A;  3PQK A;  3ZN1 A;  4J01 A;  3C1D A;  4Q5S F;  3ZQL A;  4HF1 A;  2B7E A;  3N05 A;  4BQN A;  5E18 F;  2OQG A;  2E19 A;  2WC2 A;  3K4J A;  4JQF A;  1FC3 A;  3DTK A;  3M3Y J;  1OYY A;  5HLH A;  3GXO A;  1ZN2 A;  1YW7 A;  1S7A A;  2Y48 A;  3FXJ A;  4XLC A;  5C44 J;  4OMY A;  2G0E A;  4OWR B;  4MNU A;  1BR4 A;  2B63 J;  3WTZ A;  1QA6 A;  3SZT A;  5F04 A;  2LRD A;  1KYW A;  3CMM A;  2K9Q A;  4Z6Y A;  3HTS B;  5C4X J;  2XAF A;  3FBN B;  1FT9 A;  1DU6 A;  2ZNY A;  3LWF A;  2H8W A;  4II2 A;  2DT6 A;  1GXP A;  3G1O A;  2H6C A;  3A1Y A;  1ETO A;  2STW A;  3NAR A;  4N9H A;  4YEL A;  4E70 A;  2NYX A;  4EM2 A;  3W2W A;  3EYY A;  1A6Q A;  4BE0 A;  2ID6 A;  1EF4 A;  2ECC A;  2FUG 2;  4E7K A;  4R1H A;  5K5O A;  1X1C A;  3BDD A;  2BZT A;  1K61 A;  2EZI A;  2CS3 A;  1K6O A;  3ZMV A;  3T8T A;  1LKX A;  1FJL A;  4JYK A;  3RKQ A;  4F93 B;  2VJJ A;  3RPQ A;  4QIW N;  2Z3Y A;  4PZJ A;  3CME I;  3E5X A;  1HKT A;  1W5C C;  1T08 B;  4KIT B;  1Q1H A;  4MGR A;  2R5Y A;  4GRI A;  1ULY A;  4M9Z A;  5D6E A;  3ERE D;  2HOE A;  2VT3 A;  4XOP A;  3WGI A;  4EV0 A;  3FK6 A;  3A03 A;  4E7L A;  4EJW A;  4JP0 A;  1MSF C;  2W24 A;  1RNL A;  1J59 A;  2CSO A;  1NH3 A;  5EEG A;  4A3G J;  3NRV A;  4G7H F;  2HI3 A;  2TRT A;  1YHQ I;  2Y0S N;  4DYQ A;  3LL7 A;  5LLQ A;  4DGW B;  4XLP F;  3DFG A;  1EH7 A;  1I3Q J;  5FFX A;  3FXK A;  1J0R A;  2K4J A;  3LSI A;  1TW2 A;  2BYV E;  4UUS A;  3CC4 I;  1LVA A;  2QKL B;  1JKR C;  2CMP A;  1OCT C;  1JJ6 C;  3KP2 A;  1N78 A;  3IAM 2;  1S5L C;  1S6L A;  4ZTJ A;  1H88 C;  2RN7 A;  1RIO H;  1TL8 A;  2WAQ A;  5FO5 A;  3K2Z A;  3ZRG A;  3CDL A;  1OR7 C;  3HDD A;  5K7H A;  1QHH D;  4G94 A;  1B8I A;  3AL0 B;  4YIF A;  1VQM I;  4M6X A;  2F4M B;  2ICW G;  1U5T C;  2A68 F;  4NDL A;  1LPQ A;  3H3Z A;  2IGN A;  3ESW B;  1XDU A;  1MNE A;  3ASO H;  1IO2 A;  1FBQ A;  1TWG J;  1WCM J;  4UVC A;  3MMY B;  2XGE A;  1E3P A;  5J8C A;  2IPQ X;  2HYF A;  4XLH A;  1FP2 A;  4CZC A;  4KIG A;  1YTY A;  1XTA A;  2YU3 A;  5L3C A;  2HYJ A;  1BI1 A;  3I71 A;  2WB1 A;  3FXO A;  3OYG A;  5FD5 A;  2RDP A;  2QUF A;  1SMY F;  1EH8 A;  4A3B J;  5DCM A;  4BEH B;  5CVU A;  4M71 A;  4A3J J;  4XIC A;  3SZG A;  3F8B A;  2ELK A;  2JPC A;  4GO1 A;  3MKL A;  2H1K A;  2PMZ N;  2ZCW A;  1V4R A;  2JA2 A;  2F5V A;  3G73 A;  3FF5 A;  1MMN A;  2RGV A;  5FGM A;  4CHU A;  3HUG A;  3ERM A;  1UHS A;  4U0V A;  2FOK A;  2ZXJ A;  2RV8 A;  4ZJZ A;  1RES A;  2EA2 A;  2X85 A;  2KIM A;  3Q0W A;  2ZSI B;  2DMT A;  2L9S A;  2VJ5 A;  2FMY A;  1BI2 A;  1UFM A;  3CDH A;  4IQJ A;  1MMA A;  4L5E A;  1W0T A;  1SC7 A;  2ZXW H;  2K3P A;  1OYW A;  2XVC A;  2Q8K A;  5A2Q Z;  4BNC A;  1JKO C;  2KP6 A;  1ZG1 A;  2QM3 A;  3GCM A;  1K6Y A;  3SYT A;  1S9H A;  2HFH A;  3MEX A;  5C3E J;  3VYU B;  4QPO A;  3EET A;  1UMQ A;  2Q2E A;  3LA2 A;  4CCN A;  1Z0X A;  3DPU A;  1G59 A;  3CMY A;  2QVO A;  5AON A;  4CIC A;  3DV8 A;  4BY7 J;  3HEF A;  3K1M A;  3GX4 X;  2VBZ A;  3KLO A;  3PQJ A;  1SVO A;  2DMQ A;  2CWE A;  3IV5 A;  1Z9C A;  4P5O A;  1D5Y A;  1LQ1 A;  2FSW A;  4I6Z A;  4GYG A;  3ZN0 A;  2E35 A;  2ZJR F;  3HZJ A;  4OU0 A;  1T95 A;  1WI9 A;  4Y15 A;  2XIG A;  1A35 A;  2OPT A;  2A6T A;  5LBQ A;  4M6Y A;  1YW8 A;  1S29 A;  2EWN A;  4BU2 A;  4UUT A;  3S93 A;  3WU2 C;  5DM7 F;  5J4V A;  1DP3 A;  4AU7 A;  5EYR A;  5FKL A;  3MZ8 A;  2V1N A;  2K9M A;  3QAH A;  3JAM Z;  2D1V A;  2HVQ A;  1WWX A;  2LLK A;  4DBQ A;  1LEA A;  4EM0 B;  3HSR A;  1GLN A;  3B6A A;  3K9T A;  3GFM A;  2M5W A;  4UV9 A;  2HKX A;  3F6V A;  4IO9 F;  2ELJ A;  4BXX J;  4RB0 A;  2OJE D;  2BHY A;  2W57 A;  1FYM A;  4M74 A;  4LLL A;  1BOA A;  1LFB A;  1GT0 C;  1X3Z B;  2JTV A;  5HOD A;  5K7F A;  3C3W A;  4IVN A;  4XKB A;  4M3E A;  2B0L A;  5IT9 Z;  3V7S A;  4UXN A;  5B5E C;  3ROU A;  2F2E A;  1ZG5 A;  3OSG A;  1KA8 A;  4IF4 A;  4KIF A;  5GTH C;  5F27 A;  2H94 A;  3K70 C;  3IH3 A;  3MFK A;  2DAO A;  4UB6 C;  2E2I J;  3ECH A;  5LRS A;  2E2H J;  2KMU A;  1RC9 A;  2E1M C;  2I5U A;  3QQA A;  4XKV A;  2XF5 A;  2GAU A;  1YQA A;  3DU5 A;  3QRF F;  2LR8 A;  2RNJ A;  1MMG A;  3H5N A;  2D5V A;  4BGD A;  5IOY A;  1Z67 A;  4HV6 A;  3IUO A;  5GAH J;  3BCB A;  1T56 A;  5DV5 A;  3UR3 C;  1WPK A;  1H0M A;  4P9U A;  1N77 A;  1O3R A;  3TBI A;  2COM A;  3GEZ A;  1IXS B;  2JK3 A;  3CMA I;  3PIP F;  1QGP A;  3BG7 A;  3OS1 A;  3Q5F A;  1G3T A;  4BKX A;  3EYI A;  1VQO I;  3DBH B;  5IYD J;  1FBU A;  4LD5 A;  1GVD A;  2OBP A;  1Y0U A;  5E3M A;  3VEP A;  5EG0 A;  5DD4 A;  4LJZ F;  2ZSH B;  3LSJ A;  4BE2 A;  2KJB A;  1P6R A;  1Y8R B;  3C2G A;  4EQQ A;  3JRI A;  1N75 A;  2CV0 A;  1UJ8 A;  2KRC A;  2UWM A;  1VND A;  2PFB A;  1FZP B;  2VBY A;  3VYT B;  4A0Z A;  3S2H J;  1TWF J;  2XUB A;  3M1E A;  1FBS A;  1P7J A;  1GV5 A;  1QPM A;  2MYS A;  3BPX A;  3F72 A;  4YEJ A;  5TIS C;  3W6V A;  1IRZ A;  1V3F A;  5EZH A;  1W7P A;  2AXT C;  4MQV A;  5ILV A;  2ME0 A;  2J5P A;  2OD5 A;  4C2T A;  5EEH A;  4A0X A;  5TRD A;  1VQL I;  1TWH J;  4C3H J;  1IJW C;  4AC0 A;  1MSE C;  1ACI A;  1B8I B;  3DLL F;  2DFH A;  3M9A A;  4DQ2 A;  3VFZ A;  3TDU C;  4B4C A;  2XDV A;  5GP9 A;  3PSI A;  3TO6 A;  2M7B A;  3OWT A;  1SMT A;  3T1B A;  1K78 A;  1LFP A;  3QU6 A;  4MEX F;  2O61 A;  2EFQ A;  2BW3 A;  1J5Y A;  5E1W A;  2QQA A;  2KRH A;  5D5W B;  3PUF A;  3DKY A;  2ZFU A;  1F1Z A;  2WV0 A;  1JI8 A;  1Z6R A;  4RGX A;  3F8M A;  5A2Q K;  2ESN A;  2FU4 A;  1U5T B;  2HDD A;  2R7U A;  1TBX A;  3GTG J;  5H2F C;  2QWW A;  3BR0 A;  3SXY A;  5DCM B;  3FKI J;  3ZPL A;  1C0W A;  4WCG A;  3RQI A;  2NVQ J;  2YS9 A;  4B1R A;  4CCO A;  4X6A J;  2QGU A;  4BJ5 C;  2W84 A;  3OYJ A;  3HUG B;  3MVP A;  4BH9 A;  1BIB A;  1HSJ A;  2VOD A;  3WE3 A;  5JLW A;  2QQ9 A;  4QSH A;  5ED4 A;  2O03 A;  1HOM A;  4U7B A;  4HQE A;  3SFI A;  3RQ4 A;  2EH3 A;  1XSD A;  3LSM A;  2M2E A;  3RZO J;  1A6I A;  1ODD A;  1E17 A;  4PJM A;  2O8K A;  4OOI A;  5FLM J;  2VXD A;  1VQ4 I;  1QU3 A;  2PMZ A;  3RCO A;  1JGG A;  3SJM A;  3HYI A;  1ZRE A;  1J9I A;  4MLO A;  4N4O B;  2MD5 A;  2M0C A;  2VN2 A;  1VQ7 I;  3JAM K;  3RZD J;  1PP7 U;  1BOB A;  4KMF A;  4GCV A;  1E3H A;  2Q2E B;  1A04 A;  4P55 A;  5F1R A;  2HQR A;  4IHT A;  4AD9 A;  1S7E A;  1NK3 P;  1D0X A;  1FP1 D;  4A3F J;  2LY2 A;  3P7N A;  1RR7 A;  3CCU I;  3BG6 A;  1HDD C;  3MD2 A;  3G1L A;  1R5I D;  1OCP A;  1ZGA A;  3DXJ F;  3MKW B;  1W36 D;  1LUJ B;  2DPU A;  3LOC A;  1PYV A;  1BJZ A;  3OYH A;  3S3M A;  1LDD A;  2LOO A;  4I76 A;  1X1P A;  4D5F A;  4ABZ A;  3M8J A;  1FTZ A;  3ZQ7 A;  3GTM J;  4I0B A;  5HLG A;  2HWV A;  1MZB A;  2JT1 A;  3BQY A;  1W5T A;  3B6C A;  3I9V 2;  5BQT A;  2DLL A;  3CUO A;  4MO7 A;  3U9G A;  2L7Z A;  5H6Q A;  1GHC A;  4JX5 A;  1KYZ A;  2FXA A;  3CF2 A;  1R49 A;  1ZKG A;  4HX4 A;  2W7N A;  1LDK B;  3W2A A;  2R92 J;  1MGT A;  4AM3 A;  3BT9 A;  2R7R A;  3BLY A;  3ZOB A;  2EJR A;  1G3Y A;  4A6E A;  3D5R C;  1YX5 A;  3GBG A;  3KEO A;  2AXL A;  4UUV A;  3V8J A;  2MH2 A;  1ZK8 A;  1WJB A;  2GXB A;  3CLQ A;  1CQT A;  2JWT A;  2GZW A;  4OMZ A;  3AL0 C;  2GIV A;  1I6H J;  4NHJ A;  1VQK I;  1CF7 A;  2EIN H;  4D1Q A;  3M8F A;  4G6T B;  2NVY J;  2HKO A;  4C3I J;  3KPH A;  2DOF A;  2KIS A;  4ZH4 F;  2V26 A;  2OTJ I;  1PUE E;  1XN7 A;  2IP2 A;  3U2R A;  5D5V B;  4NC8 A;  2CQ7 A;  1SFO J;  4A3K J;  5CKT A;  4ASN A;  2IRF G;  2GBY A;  4MFD A;  1S8N A;  2CG4 A;  3IRR A;  2M7A A;  3DPT A;  2EQR A;  1MBG A;  3OYI A;  2W25 A;  2VAS A;  3GTO J;  4DJA A;  4A3E J;  3DPL C;  3C2H A;  3VSK A;  1VZ0 A;  1G3W A;  1HST A;  3IKT A;  3KIO A;  3JSP A;  1XDS A;  4D7N A;  3R61 A;  1IN4 A;  1LNW A;  1SD5 A;  1A5J A;  2QKM B;  3QOE A;  5J8F A;  2ZJP F;  1MBH A;  4BS9 A;  3WHC A;  2EFP A;  1R23 A;  3L09 A;  1MBF A;  4YG2 F;  2HVS A;  5LEK A;  3MCZ A;  2E36 A;  1B59 A;  2A5W A;  3I55 I;  2NVT J;  3IH2 A;  3HC7 A;  2Z16 A;  2QQB A;  4BHB A;  4EJO A;  2R93 J;  1Y56 A;  3I3L A;  4Q48 A;  4RM2 A;  5KVR A;  4ZTF A;  1TT5 B;  2DA7 A;  3WGG A;  3BJA A;  1V5F A;  5DDG A;  2K86 A;  3K69 A;  3CCL I;  5BNG A;  4UVB A;  2V9K A;  1U2W A;  4XOT A;  1YJ9 I;  1W7P B;  1X19 A;  4FTH A;  2LY1 A;  3M4O J;  4X0G A;  3N97 A;  3A4C A;  3JRC A;  2BGC A;  2JPB A;  3NAU A;  5BPD A;  1HBX G;  1ZR2 A;  1X4P A;  1F36 A;  1I1S A;  4HZF A;  5D4R A;  2DDA A;  3L00 A;  4LLG F;  3S3N A;  1ZGW A;  1JUS A;  1PUF B;  4KJZ A;  4OIP F;  2V7F A;  3TOA A;  4NBQ A;  3KFW X;  4RA2 A;  2HNH A;  2XGX A;  2NVU B;  2VPL A;  3J80 K;  1UAA A;  2BW3 B;  2EV6 A;  3BTC A;  2O0Y A;  5IY5 H;  1TNS A;  5GPC A;  1U3E M;  3O3K A;  3CC2 I;  1MJ9 A;  2M30 A;  5JHF A;  2DXI A;  4WF2 A;  3S1M J;  4I0A A;  1N25 A;  2XPV A;  3LA3 A;  3GZ6 A;  1SVM A;  1YYV A;  5TGT A;  3TP0 A;  1H9T A;  1H89 C;  2EV0 A;  2Z2S B;  4ENK A;  3KP6 A;  3HSF A;  4BYY A;  3QYB A;  2KZV A;  4RAZ A;  2ZNZ A;  1NK2 P;  2CUF A;  2MH9 A;  3R0J A;  4RMN A;  2EFO A;  2P7V B;  3FBI B;  3R4K A;  5IP9 J;  3S14 J;  1B72 B;  2BVL A;  5HVQ C;  2CW7 A;  2EZH A;  5F0C A;  1I27 A;  3A2K A;  4E7H A;  2X0L A;  2OCE A;  1LB2 A;  4UY8 I;  2Q1Z B;  3I53 A;  1MNM C;  3C2B A;  5ICG A;  3F8F A;  1J7K A;  5DD8 A;  2KIF A;  2XB5 A;  4A5M A;  1YIT I;  2DT5 A;  2ZO4 A;  4LK0 F;  1FYK A;  1KQ8 A;  4BHP A;  1KQ0 A;  1Y1V J;  3F23 A;  3M1C A;  4HG2 A;  4AYB A;  2VPR A;  4AIK A;  2FF4 A;  3RPU A;  1WZ2 A;  4A3M J;  3QOD A;  4I09 A;  3E6D A;  1E2X A;  2IA0 A;  2QSF X;  1ZYR F;  2K9S A;  2XAG A;  5D4S A;  3HHG A;  1R7J A;  2EB7 A;  3Q0U A;  4G8X A;  3P5J A;  3EUH A;  5D6F A;  2E7X A;  2R7O A;  2NRA C;  3QPL A;  2OV7 A;  1QBJ A;  4A12 A;  3T0Y A;  1FIP A;  4MTE A;  4FX0 A;  4FE4 A;  2OQR A;  3HHH A;  1KON A;  2CW8 A;  3HM5 A;  3BR3 A;  3DEE A;  3QPT A;  2P81 A;  2HDC A;  4HOB A;  1O4X A;  1UEL B;  1ZTR A;  3I59 A;  4EJT A;  2Y69 H;  5JVT A;  3HSE A;  2R3S A;  1TLH B;  2Z33 A;  4W1U A;  1TTY A;  5AIQ A;  3L2C A;  1BI0 A;  3E1S A;  3E97 A;  3LSK A;  1QNT A;  1NG7 A;  3M07 A;  4YIR X;  2QEX I;  3DTE A;  2J5O A;  2V1U A;  3NQO A;  4XN3 A;  4CCL A;  1O7L A;  4ETS A;  3TMO A;  5K1Y A;  1EJ9 A;  3BPV A;  2O8X A;  5GAG J;  1R5G A;  2MC3 A;  3CDI A;  5J1U A;  5F64 A;  2XC7 A;  5FRM A;  3HPG A;  3NEU A;  2PX9 A;  1W1W E;  1GV2 A;  3W6K B;  3HOS A;  3OIP A;  1G4D A;  4A6D A;  3E6C C;  3DEW A;  2VQG A;  2G7U A;  5BOX A;  2XV4 S;  1T0F A;  3GVA A;  4HF0 A;  1IN5 A;  4HNV A;  5IYC J;  2DK5 A;  4HF2 A;  1FNN A;  3O6B B;  1PDN C;  4XKW A;  3I54 A;  2IJL A;  2D45 A;  1D5V A;  1TQI A;  3TKY A;  3F22 A;  5EJC A;  1BR1 A;  1SEU A;  2CUE A;  1JUP A;  1MBK A;  2TCT A;  2F5C A;  5KHD A;  2JN6 A;  4RAF A;  3EPZ A;  2G7H A;  3EUK L;  2V9V A;  3T8R A;  2CV2 A;  1UHW A;  3Q3S A;  1I39 A;  2GLO A;  2DMN A;  3PUB A;  4PUS A;  2WAD A;  1ETW A;  1HKQ A;  1JTX A;  4QTR A;  2BEO A;  2L9N A;  3LSH A;  2NNN A;  1UST A;  2O5R A;  3K6G A;  3QPH A;  4ZDL A;  2QF7 A;  2LBF A;  3I56 I;  4J19 A;  4G7Z F;  4ZYA A;  4O3M A;  1XX5 A;  3OYF A;  4KMU X;  1H9G A;  3P9K A;  5EGO A;  2M45 A;  4BE1 A;  3IH4 A;  2KIU A;  3QOP A;  1B6A A;  2K7L A;  4PGG A;  4YII A;  1K4S A;  3WTV C;  4GDF A;  1VQN I;  3BOQ A;  2MA3 A;  1RKT A;  3HJE A;  4LB6 B;  3FM5 A;  3M7G A;  2FEZ A;  2JA5 J;  3V7R A;  2V79 A;  4UB8 C;  2CH0 A;  2NXN B;  5HOO A;  3DTI A;  1ZEL A;  1QRY A;  4L9V A;  2QCO A;  3IRQ A;  5EDN A;  4YFK F;  1BC8 C;  2NS0 A;  3TW7 A;  1D8K A;  2MLK A;  2ZB9 A;  3CJT B;  5FLV A;  3OYB A;  3PIO F;  2OUM A;  2HTS A;  4BDY A;  2VOO A;  1KU7 A;  5JVG F;  3ZQC A;  1KQ9 A;  2DYS H;  5IPA A;  2G9W A;  1IF1 A;  4A3D J;  2KDO A;  3B73 A;  2E71 A;  4BJ6 C;  1HC8 A;  2HOA A;  2DQL A;  3HRS A;  2R4G A;  5GAE J;  2FA5 A;  3BR1 A;  4ZYD A;  4NQW B;  3L2U A;  3QYE A;  2DU9 A;  2M87 A;  1FOW A;  3OOP A;  1Y6I A;  4IHX A;  4ESJ A;  3MZH A;  1XG1 A;  1JTY A;  4Y33 A;  1SFK A;  4XID A;  5CVR A;  2PG4 A;  1ZRC A;  3G2B A;  3HKZ N;  2NOG A;  3FXM A;  3G3Z A;  1TW3 A;  4I01 A;  2QA4 I;  1U9N A;  2QYO A;  2VIX A;  1WJA A;  3CC7 I;  2DA1 A;  5C4J J;  1QO0 D;  3OYN A;  2ISZ A;  2VE9 A;  3N4M A;  1XPX A;  1FOX A;  2L7M P;  1FSE A;  3S1N J;  5DS9 A;  1O3S A;  2VXZ A;  2F5E A;  4RAY A;  1WQ2 A;  3FXQ A;  1K79 A;  3DWL E;  2HXI A;  3E6B A;  3V7C A;  1IUF A;  1YLF A;  3H92 A;  4V2G A;  2QZ8 A;  2CQN A;  5HNH A;  4PJJ A;  1I1G A;  4HQM A;  2PI0 A;  3CES A;  3LSP A;  5FRN A;  5DUK A;  2R7X A;  1ZGJ A;  3OYD A;  2STT A;  1RRJ A;  2YU9 J;  1P4A A;  2KKO A;  2AS5 F;  4B47 A;  4IKF A;  1ZLK A;  1Y0N A;  3LAP A;  1YOV B;  2F4O B;  1I6X A;  4ZDP A;  1JJ8 C;  3HOX J;  3P9C A;  2CJJ A;  1XMK A;  3K70 D;  1U6G A;  2YSR A;  4CH7 A;  1E0E A;  2IS2 A;  2FNA A;  2BY1 A;  2JZY A;  1IV6 A;  1G8X A;  2NAZ A;  3I4N J;  1T33 A;  5FKN A;  4IHV A;  3JW4 A;  1NHA A;  1XSX A;  4Y3O A;  4WXC A;  4XBF A;  3QPS A;  1X4O A;  5JFR A;  4A93 J;  3IWF A;  1JGS A;  3RYP A;  4A0Y A;  2R7S A;  2R7V A;  3OSF A;  3SHF A;  2IAI A;  2DFF A;  2X51 A;  1A31 A;  2BBY A;  2A61 A;  4W97 A;  5E17 F;  4M3F A;  3K4C A;  4IOA F;  2IS6 A;  2R7F A;  3OIO A;  2WAF A;  4LG0 A;  1UG2 A;  1JKP C;  2MAB A;  1YFH A;  1YRN A;  2LKS A;  4KYW A;  1W7P D;  2MC4 A;  4U0W A;  4RAG A;  3BG9 A;  1HF0 A;  3ZMT A;  1MH4 A;  2RVC A;  1ITY A;  1YE9 A;  3SEZ A;  1MBJ A;  1HKS A;  3GTJ J;  1X2N A;  2QEN A;  2IT0 A;  4B3X A;  2JUG A;  2W1O A;  2P5L C;  4LB5 A;  3BJ6 A;  2R7W A;  3CLO A;  2X6O A;  4M6V A;  2R5Y B;  4EGY A;  3LNQ A;  5GTI C;  2R7Z J;  4LIV A;  4LK1 F;  3JRH A;  4G6Q A;  2IA2 A;  3SQN A;  4E7Z A;  2HEO A;  2FBH A;  2VKD A;  2K5C A;  4GXO A;  2Z99 A;  4IRG A;  3F3X A;  3RDI A;  4Q4Z F;  5FLX K;  4I98 B;  1SD4 A;  2OAZ A;  3RJP A;  5LHG A;  4I7H A;  2PJR A;  2BXY A;  2XKP A;  2M3A A;  5M3M J;  1IZ1 A;  4Q47 A;  2XGD A;  4HW0 A;  4RLF A;  1IUY A;  4CYC A;  2OCC H;  2X1D A;  3S32 A;  1BBY A;  2HZT A;  4V19 K;  2HDW A;  3F0C A;  2HXO A;  1MDM A;  1QZY A;  2E2J J;  3BG3 A;  1SAN A;  1QHG A;  3F6O A;  3HOT A;  2KIQ A;  1SFX A;  4UUS B;  3MKY B;  4XM3 A;  1P2F A;  2A3S A;  1DGW Y;  2XRN A;  3GTK J;  1OCR H;  3RTR A;  2IEK A;  3C7J A;  3PFI A;  2EIM H;  3L1P A;  2M8E A;  2CFX A;  3E5Q A;  1U8R A;  2AQF A;  2MBF A;  3BZK A;  2Y0S A;  3CUQ A;  5BS6 A;  1GUU A;  3ASN H;  3HGY A;  4E7I A;  2ACJ A;  3GZ5 A;  2EV5 A;  3WTX C;  4PSW A;  1JKQ C;  1TZL A;  1ZAO A;  4I99 C;  1Y39 A;  1BJA A;  1OCZ H;  3K4M A;  4O6J A;  2LBF B;  3VWB A;  2WY7 Q;  5CVI A;  1ZG3 A;  2PJP A;  5EGO B;  3S3O A;  1U8B A;  1TWA J;  3D5L A;  2DJI A;  2VL8 A;  3KYD B;  5EZG A;  3ZQI A;  4IZZ A;  4HRI A;  4WXH A;  1TT0 A;  2L2O A;  2XF7 A;  2ESH A;  1D1C A;  4NB5 A;  4OIN F;  4RGR A;  1XGN A;  2X9D A;  5FD6 A;  1IN6 A;  2L4A A;  1BL0 A;  4BJT A;  4A3C J;  1WH7 A;  4L0Z B;  3W3C A;  4PCQ A;  1P9Q C;  4H0E A;  3DLA A;  1IXR C;  3JTH A;  2VOP A;  5CLS A;  2NS8 A;  4RBO A;  4ZYE A;  2FBI A;  1OYI A;  4CDG A;  5K7Z A;  3FHZ A;  1YS7 A;  1R1V A;  2R7Q A;  5DUI A;  3FMR A;  3KCC A;  4XMY A;  1D0Z A;  1J09 A;  2W00 A;  5L3F A;  3OV8 A;  4KIC A;  3ML6 A;  5IYB J;  3O8G A;  2NVX J;  3TP3 A;  3GFL A;  4JBA A;  2O7O A;  2IGM A;  3BG5 A;  2YR2 A;  2E5N A;  4KT6 A;  2L4M A;  4FT8 A;  3EQL F;  3J80 Z;  4IEJ A;  5CVV A;  2H27 A;  1RR8 C;  4MTD A;  3BZC A;  5TJJ A;  1YX3 A;  5LGN A;  4CZZ A;  2H6B A;  2HGC A;  2DFI A;  2FNP A;  3QWL A;  2ZC2 A;  3VOD A;  2ISY A;  4J00 A;  1A36 A;  5J6X A;  1JHF A;  4XRS A;  2XRL A;  3CCY A;  3A0H C;  3RKW A;  4XQF A;  3ZQH A;  2RNG A;  2Y2Z A;  5ICF A;  3S17 J;  1D0Y A;  3ECO A;  4XLN F;  3V42 A;  1RUN A;  3FXR A;  5M3F J;  3FMS A;  5HS8 A;  2YPR A;  4TV7 A;  2PLY A;  1D3Y A;  2JA8 J;  1R4N B;  2K40 A;  2K85 A;  4AID A;  4WK8 F;  3GTP J;  1ON2 A;  2BV6 A;  1AU7 A;  2CV1 A;  2A6H F;  2BHZ A;  2LFB A;  3H0D A;  2M4K A;  1KZH A;  3IP4 B;  5JLX A;  2PBI A;  3S16 J;  2DBB A;  3FXL A;  5D8K B;  2A6E F;  2NS7 A;  2KDZ A;  1BR2 A;  3G4S I;  1DU0 A;  5DEQ A;  3JRD A;  2XB0 X;  1SFE A;  4Z2Y A;  3HKZ A;  2K02 A;  4PJL A;  4U88 A;  2R7D A;  5CPR B;  4BAY A;  5CJ9 A;  3K4L A;  1MKM A;  2I10 A;  5LFA A;  2MFZ A;  4XSX F;  1RUO A;  2OC6 A;  3BY6 A;  1FOY A;  1IC8 A;  3LSG A;  4OIQ F;  2R0Q C;  2ZBK A;  1MH3 A;  4CA0 A;  1V55 H;  5F08 A;  3HOW J;  1R5H A;  3BTJ A;  5F6F A;  4CYD A;  3F8C A;  3ONQ A;  4ON0 A;  3OS2 A;  4XKC A;  3WTS C;  4RS8 A;  1STZ A;  3R6S A;  3PNT A;  4EM1 A;  1MD0 A;  4GYI A;  3KYC B;  4CCM A;  4M9S A;  5LHH A;  4N4N B;  3FXU A;  2ZME A;  4CCK A;  3H5R A;  1S3J A;  1O3Q A;  2UUZ A;  4DZP A;  2QBY A;  1MIJ A;  1V5G A;  2VJ4 A;  2OF7 A;  1FPQ A;  3MAJ A;  3RIR A;  2VON A;  1YRN B;  1W5S A;  2WAQ N;  3GLX A;  3WHB A;  3GTL J;  1XMA A;  1FYL A;  1OLT A;  4M3D A;  2EK5 A;  4FE7 A;  3ZCO A;  1WVR A;  3R0A A;  3DF8 A;  1FMV A;  2LP0 A;  5KK1 A;  2GOX B;  2BXZ A;  2DMU A;  5L3G A;  1SD6 A;  4PK4 A;  2CQX A;  3FMQ A;  5HS9 A;  2LSO A;  5KCM A;  1FTT A;  2CW0 F;  2KPM A;  4KUM A;  3I0T A;  4AVZ A;  2HR3 A;  2DYR H;  2CFO A;  1WJD A;  2GM4 A;  4KDP A;  1VF9 A;  5AIP A;  2L0K A;  3S1R J;  4ENJ A;  1IXC A;  2ZXH A;  4MHG A;  2WWY A;  2R5Z A;  5HNF A;  3MKZ A;  4IHY A;  5D8L B;  2WB1 N;  3MZY A;  4KA4 A;  5DM6 F;  2LD5 A;  1VQ6 I;  1VTN C;  2ZJQ F;  4JX6 A;  1RET A;  4AUX A;  2RC4 A;  4IPA A;  5EG0 B;  4XLF A;  2M1B A;  3PO3 J;  2XAU A;  4CYC B;  2L5Q A;  1R9T J;  3G6E I;  4XSZ F;  3CTA A;  2L54 A;  2HQA A;  1V5E A;  4XLE A;  4PJ0 C;  5ILU A;  2EIJ H;  4NUB A;  3ZXS A;  1XCB A;  4XNF A;  1F5T A;  3GUD A;  4PFO A;  3WTY C;  4XK4 A;  1IDY A;  4D0P A;  1KU3 A;  2EFN A;  2DA3 A;  3E0J B;  4IJA A;  3HRM A;  1XGS A;  2YUS A;  2L01 A;  4HV5 A;  3V4G A;  2VKV A;  5LD2 C;  4S05 A;  3CUQ B;  3DEU A;  2RRE A;  4YFN F;  3GME A;  4D7M A;  3HOV J;  3SZP A;  2L9V A;  2P6T A;  3CJQ B;  1X3W B;  1RKW A;  4HLY A;  3KP7 A;  4M3B A;  4E6K G;  2KJC A;  2M0M A;  1K78 B;  3TGN A;  3TO9 A;  4IHS A;  3Q0V A;  3S2D J;  5GPA A;  4R8H A;  5J1R A;  2VC0 A;  2CQQ A;  1HDP A;  2KHM A;  3DCF A;  4XRS G;  2Y31 A;  2DCE A;  3J7Z I;  1T38 A;  1W4M A;  5L3D A;  3JSO A;  4HDV A;  4LOC A;  3HB9 A;  4ESB A;  3CCR I;  2A07 F;  4OAY A;  1ON1 A;  5FB2 A;  1WH5 A;  2K27 A;  1WSU A;  4EGZ A;  2LC2 A;  3BC8 A;  4RM3 A;  1UHM A;  3UNG C;  4C2M J;  3J7A O;  5K5Q A;  1Z6T A;  2VC1 A;  4HST A;  3K4K A;  5DCF A;  3AAF A;  3KP4 A;  3MQ0 A;  3HOZ J;  2LKX A;  1TWC J;  3HRT A;  3UKG A;  1EA3 A;  1T8I A;  3PM1 A;  4HDU A;  1IG7 A;  2V9P A;  3A0B C;  3PNV A;  2OA4 A;  4M9X A;  5GAD J;  1JHH A;  5IT3 A;  4WWC A;  3L2V A;  1IRF A;  1YIJ I;  4HNU A;  4KN4 X;  1YW9 A;  2RQQ A;  2VBX A;  4BDZ A;  1X1B A;  2I8D A;  1P4W A;  1ZLJ A;  1FEX A;  4XON A;  3EUH C;  4HLX A;  1OCO H;  2BY2 A;  1UZC A;  3AFH A;  4F92 B;  2BY3 A;  4KN7 X;  4V2F A;  3ZMS A;  2R7T A;  3HXL A;  3FK7 A;  3CCJ I;  4YFX F;  1K4T A;  1Z1D A;  3TED A;  3HPH A;  2M34 A;  4BUP A;  4FX4 A;  5CVJ A;  4C3J J;  4C9Y A;  4JOM A;  3S1Q J;  4LG3 A;  4F3Q A;  3S8P A;  3U1K A;  3HL2 A;  2KZG A;  2XHK A;  3AG1 H;  2GA1 A;  1BM9 A;  5BPI A;  2DA6 A;  4FQG A;  1KU2 A;  4DZJ A;  2V4J C;  1HXD A;  2TDX A;  1YJN I;  3KX2 A;  2XSD C;  2XGC A;  1X2M A;  3WE2 A;  4XN0 A;  2HQN A;  3J7Y J;  3H9J A;  2LYC A;  2Y0M A;  4HAM A;  1O3T A;  3GFI A;  3LST A;  2VE8 A;  1ETX A;  4HX8 A;  1ZRD A;  2N8G A;  3VB2 A;  4PDK A;  2ETH A;  3A01 A;  1BW5 A;  2JUC A;  4XRF A;  4OIR F;  2VT2 A;  2COB A;  1T0F C;  2OZ6 A;  3GWZ A;  1OQY A;  4ZDO A;  4EJV A;  2FOW A;  3OL3 A;  2W4S A;  3H36 A;  5J40 A;  5F0H A;  4PGH A;  3D0S A;  3JRG A;  3HOY J;  4N0B A;  1DGR M;  2DA4 A;  3GLL A;  3TQN A;  5L3B A;  3F21 A;  1XB4 A;  2LVS A;  1WJF A;  1F43 A;  2EIK H;  2ELH A;  4BHC A;  5E20 A;  1HW2 A;  4FET A;  4ESF A;  1LEB A;  1YO5 C;  1BW6 A;  1R22 A;  1U0J A;  2WTE A;  4HX7 A;  2DDB A;  2YX4 A;  2VJI A;  3LQR A;  2YX7 A;  1JT0 A;  4CGZ A;  2EPF A;  1XSV A;  1IV8 A;  4L0Y B;  2MLG A;  2P0W A;  1LFU P;  3BTI A;  1EV7 A;  1IDZ A;  1HCR A;  5JR3 A;  2BOL A;  4MIM A;  4RGS A;  4RLQ A;  3GYH X;  4KT5 C;  1S72 I;  4UVA A;  2XPW A;  2DA2 A;  2ZME B;  1M1E B;  5B1A H;  1CF7 B;  3NWS A;  4P9F A;  3KE2 A;  2L9R A;  4B3A A;  2W85 A;  1KGS A;  3RKX A;  2QBY B;  2L7F P;  2DN0 A;  5E1X A;  3HG9 A;  2IGK A;  2GA2 A;  2EFW A;  4RGU A;  2VUM J;  3JRA A;  1JT6 A;  2PN6 A;  2XAQ A;  2Q0O A;  2MD0 A;  1R71 A;  3QYF A;  2NNY A;  1POG A;  5D5X B;  4B09 A;  3LFU A;  2AQE A;  2BY0 A;  2PQ8 A;  2MG4 A;  3TL4 X;  1H8A C;  4I02 A;  1BC7 C;  5FLX Z;  3ABM H;  4DYR A;  2JSP A;  9ANT A;  1FSH A;  1K7A A;  3GW2 A;  2VBW A;  1YS6 A;  4L18 B;  4PSX A;  4B44 A;  4Y52 J;  2FQ4 A;  3J81 K;  4G7O F;  2XAS A;  3WGH A;  2HPM A;  4ENN A;  2R5Z B;  5E8G A;  3AG2 H;  4U87 A;  3KZZ A;  5FJ8 J;  3B02 A;  2M9H A;  2MGQ A;  4M3G A;  4CCJ A;  4MFE A;  3I4M J;  5CQE A;  3K4N A;  1OCC H;  3WOD F;  4EJU A;  3ELK A;  4CO8 A;  2H09 A;  2DW4 A;  2D2W A;  4XLA A;  1USS A;  3W2V A;  4DYC A;  1HLV A;  5DYM A;  4AIH A;  4A2U A;  3MWM A;  2BE5 F;  3BCA A;  4EMS A;  3GZN B;  1OR7 A;  5E3L A;  3PJR A;  2P4W A;  2RKH A;  5HLI A;  1QPI A;  4KIS A;  1R1U A;  2XAH A;  2CRG A;  3SDG A;  4IX7 A;  5F1J A;  1DPU A;  4QPQ A;  1U5T A;  1AA7 A;  3DBR B;  3R60 A;  4M73 A;  3BRO A;  2FD5 A;  3FHN A;  1MMD A;  2MW8 A;  3DU6 A;  1Q1V A;  4L9N A;  3BQZ A;  4EAT A;  2KRF A;  3DP7 A;  2K9L A;  3OYM A;  1CGP A;  2DT7 B;  1WRJ A;  5ILS A;  3ZQQ A;  1DP7 P;  3KP3 A;  1KU9 A;  2XAJ A;  2FRH A;  2VI6 A;  1EKE A;  1T39 A;  4DNC A;  1Z21 A;  4FHT A;  5LHI A;  1R4M B;  5ICE A;  1Z3Y A;  5LGU A;  4UV8 A;  1Z3X A;  3CCS I;  3E3V A;  2XSJ C;  2OZU A;  3ZMU A;  2CUZ A;  3IHU A;  4U7D A;  1T98 A;  2WAE A;  2ECB A;  3TW6 A;  1LDJ A;  1P4X A;  1LE8 A;  4OAZ A;  3SDB A;  3TOB A;  3K10 A;  5IOZ A;  3ABL H;  4BBR J;  5FKK A;  2CYY A;  4LLN A;  1T6S A;  2DQR A;  4C2U A;  3HOU J;  3ISP A;  1WJE A;  5B3S H;  2IBD A;  1K83 J;  2L3D A;  4NC7 A;  1WHU A;  4II3 A;  5ERI A;  2HOT A;  1MJB A;  1L0O C;  2LMD A;  4BL0 B;  2QQ8 A;  2RAE A;  3JR9 A;  1DPR A;  4F52 A;  1V54 H;  3DQV C;  1G3S A;  3ABT A;  5FKM A;  4Y4R A;  3U21 A;  5EF6 A;  2QSG X;  1G2H A;  2CO5 A;  1MW7 A;  4B43 A;  2LK2 A;  2FJ1 A;  2Y9Y A;  1TC3 C;  3OMY A;  3VYR B;  5CQG A;  1LJ9 A;  2KLO A;  1TQM A;  2A05 A;  1WJC A;  1VQ9 I;  4RB3 C;  5FFZ A;  4IRI A;  1AHD P;  2HTJ A;  3ZGK A;  1FIA A;  1OPC A;  3J7A Y;  1MND A;  3OOU A;  3RYR A;  2WY8 Q;  1U9O A;  3OS0 A;  2UZK A;  1R1T A;  3FM3 A;  3I4P A;  2JMW A;  4IXA A;  2DI3 A;  2JA7 J;  2KL4 A;  4HYE A;  3BR5 A;  2DA5 A;  4HA8 A;  4IQ4 A;  1OMI A;  1GDT A;  1Y1W J;  3L7W A;  1ZAR A;  4RB2 C;  3RI4 A;  1O7F A;  4EEF G;  3FIS A;  3K2A A;  1SAX A;  4DBR A;  3BJO A;  4QLC U;  1I50 J;  4G9Y A;  1ZRF A;  4E7S A;  3KET A;  1ETV A;  1PVE A;  2IGO A;  3PNY A;  3KYL A;  2X4H A;  5B1B H;  3V8K A;  3D5S C;  3WTW C;  2Z9O A;  1HW1 A;  3I59 B;  2EZL A;  2EBI A;  1X1A A;  2L02 A;  4E4H A;  2LG4 A;  3VSL A;  4L5I A;  3CCV I;  2PMU A;  3AG4 H;  3DKX A;  1NTC A;  2BVM A;  1SFU A;  2E1C A;  5FKO A;  2JJ7 A;  3A01 B;  1Z7U A;  3H0G J;  3ZMZ A;  2QLZ A;  3IKV A;  3H5A A;  1VQ5 I;  1AKH A;  2IA1 A;  4S0H B;  4IOC F;  3ZP5 A;  1F9N A;  1F4K A;  1ORK A;  2LF8 A;  4DW6 A;  1AOY A;  3OR1 C;  4PJN A;  1L3L A;  2JVG A;  1XCV A;  1IN8 A;  3Q9S A;  1X3U A;  4BXF A;  2X1C A;  5J1Y A;  5JHU A;  3BZ6 A;  5E1Z B;  2F48 A;  2VKE A;  2FQ3 A;  1JE8 A;  2DTZ A;  2HVR A;  1B4A A;  4ENM A;  2VQC A;  5M5Y J;  2E1N A;  1WJ5 A;  5L3E A;  2LH9 A;  2Y30 A;  2GXA A;  1D1A A;  1W0U A;  2F4I A;  3CUQ C;  4DIQ A;  5IP7 J;  4X1E A;  2M4G A;  4A3I J;  3JTG A;  4CXF A;  1MBE A;  1ZQ3 P;  3VOE A;  1I5Z A;  3VYS B;  1B1B A;  3LQQ A;  1ZHF A;  4ZC3 A;  2ME6 A;  3VPR A;  3O2P E;  2LTP A;  5LGT A;  4JK1 X;  4H4K C;  2F5F A;  1YI2 I;  2WV1 A;  4I2O A;  3U1D A;  2GOM A;  4A5N A;  2A69 F;  1Y8Q B;  4AWX B;  3DBL B;  3BP8 A;  2GIZ A;  2LY9 A;  5CYV A;  4GFB A;  2X6X A;  4FIS A;  1XMX A;  3WU0 A;  3H1C A;  2DOD A;  2H8R A;  2JRT A;  1XGM A;  4KNY A;  1IRX A;  2WBM A;  2K9N A;  4IHW A;  5KAI C;  2RQP A;  3BWG A;  3KLN A;  3CO7 C;  4ITV A;  2VB6 A;  5LEJ A;  2ZXI A;  4G6D A;  3CZ6 A;  3JCU C;  2LKP A;  4L9J A;  1O57 A;  1R58 A;  1SD7 A;  3HBL A;  3IL2 A;  1IRG A;  5F0F A;  1XS9 A;  1U78 A;  3OIQ A;  5HDN A;  2XRO A;  2LNB A;  3L2R A;  1PUF A;  2QSH X;  2DPD A;  4D9J A;  2ADU A;  3EUA A;  1Z05 A;  5J3L A;  2KT0 A;  2K4B A;  2C6Y A;  1TQP A;  3ABK H;  3K4B A;  3OYK A;  1G6N A;  1FOK A;  4XOR A;  2O3F A;  4AIJ A;  3FWE A;  4XR6 A;  1OKR A;  2DFE A;  3WTT C;  4Y7N J;  2CUJ A;  1YG2 A;  3SEQ A;  1GXQ A;  1XD7 A;  3I5U A;  3H3U A;  2JSC A;  4FCY A;  4D5C A;  1OIS A;  2XF6 A;  4WX9 A;  2FE3 A;  2XKO A;  2ZJ2 A;  4N9I A;  4M72 A;  3BR6 A;  2VQH A;  1OJL A;  1FMW A;  4BQO A;  1FY7 A;  1FX7 A;  4ANJ A;  4CUG A;  3L9F A;  3CJR B;  1R6R A;  1RZ4 A;  4F91 B;  5H20 A;  4ZYG A;  2HPI A;  1BIA A;  4AYB N;  1IW7 F;  3LA7 A;  1B72 A;  2DK8 A; 
#chains in the Genus database with same CATH homology
 2O6G E;  5D5U B;  1QZZ A;  3GF2 A;  1B9M A;  4KIB A;  4R79 A;  2PEX A;  3TO7 A;  3SFZ A;  4LFU A;  2DO7 A;  1QQI A;  1IN7 A;  2EA4 A;  2DTR A;  1HQC A;  3F8N A;  4ZZD A;  1UB9 A;  3K1N A;  1RI7 A;  4ZYH A;  1YIO A;  1ONV A;  1Z91 A;  1FLI A;  2OU2 A;  3K1P A;  3S2W A;  1BI3 A;  4U0Y A;  5LRR A;  4IRH A;  3I58 A;  3DKW A;  4L5J A;  3CO6 C;  2GWR A;  2P5K A;  4Y17 A;  1GVJ A;  4OIO F;  2IW5 A;  1S7O A;  4HBL A;  3P9I A;  5IT9 K;  1FWZ A;  3KZY A;  3ABU A;  2HYG D;  3WTU C;  2UXN A;  1REP C;  3IC7 A;  2A5Y B;  4BQA A;  1JXS A;  4LG0 B;  2CQK A;  4MEY F;  3IWZ A;  2UXX A;  1R00 A;  1DUX C;  2PMH A;  4ZZL A;  2IVM A;  2E7W A;  3QP5 A;  2V1X A;  4L9T A;  1IAW A;  4MQ9 F;  2ZFW A;  4LMY A;  1R36 A;  2V6C A;  4GGG A;  1D8J A;  3RKY A;  4Y13 A;  3V8L A;  1UCR A;  1DDN A;  5HDK A;  3K0L A;  2P6S A;  3WG9 A;  2LF7 A;  3ULQ B;  2D1H A;  2Y75 A;  5JI6 A;  5HDG A;  5E8I A;  1J2X A;  5HS7 A;  3COA C;  1MDM B;  5H6R A;  1T2K A;  1EH6 A;  3Q9V A;  3LAJ A;  4S04 A;  4KFC A;  1XGO A;  2ZKZ A;  3KP5 A;  4UNO A;  3HRU A;  2F5D A;  1AWC A;  3J81 Z;  4F7Z A;  2CGP A;  2FBK A;  3ZMD A;  2P5V A;  3W6J B;  1PP8 F;  5K5R A;  3HIF A;  3E5U A;  4P96 A;  2FML A;  3CJN A;  1HW5 A;  3WU1 B;  4RB1 A;  3I64 A;  6PAX A;  1ZH5 A;  1P92 A;  3C18 A;  4LGW A;  3TDZ C;  4O5V A;  4NQW A;  2Z5U A;  3EDP A;  3FX3 A;  1WKM A;  2GXG A;  5ICC A;  3QU3 A;  2V1D A;  3QP6 A;  4EVI A;  3FZV A;  4K2E A;  4B8X A;  4AVP A;  1J75 A;  4WXD A;  2HS5 A;  4QWQ A;  2LDU A;  4BXU A;  3GO5 A;  1BN5 A;  3T5X A;  3E6M A;  3GFJ A;  5BMZ A;  1B9N A;  2P8T A;  3LFK A;  3M8E A;  3KEQ A;  4UHT A;  3HTU A;  1TNT A;  2P7C B;  3REO A;  2GQQ A;  1MJA A;  3PQK A;  3ZN1 A;  4Q5S F;  3C1D A;  4HF1 A;  5E18 F;  2OQG A;  2WC2 A;  4JQF A;  1FC3 A;  1OYY A;  5HLH A;  3GXO A;  1ZN2 A;  1YW7 A;  1S7A A;  2Y48 A;  4OMY A;  4MNU A;  3WTZ A;  3SZT A;  1KYW A;  3HTS B;  2XAF A;  1FT9 A;  2ZNY A;  3LWF A;  1GXP A;  2H6C A;  2STW A;  4N9H A;  4E70 A;  4EM2 A;  2NYX A;  3EYY A;  4R1H A;  5K5O A;  3BDD A;  1K6O A;  3ZMV A;  3T8T A;  3RPQ A;  2Z3Y A;  4PZJ A;  3E5X A;  1HKT A;  1Q1H A;  4MGR A;  4M9Z A;  1ULY A;  3ERE D;  5D6E A;  2HOE A;  2VT3 A;  3WGI A;  4EV0 A;  4EJW A;  2W24 A;  1RNL A;  1J59 A;  2CSO A;  5EEG A;  3NRV A;  4G7H F;  5LLQ A;  4XLP F;  3DFG A;  1EH7 A;  5FFX A;  1J0R A;  2K4J A;  1TW2 A;  2BYV E;  1LVA A;  3KP2 A;  1S6L A;  2RN7 A;  1RIO H;  5FO5 A;  3K2Z A;  4G94 A;  4YIF A;  4M6X A;  1U5T C;  2A68 F;  3H3Z A;  1XDU A;  1FBQ A;  4UVC A;  5J8C A;  2IPQ X;  2HYF A;  1FP2 A;  4KIG A;  1YTY A;  2YU3 A;  5L3C A;  1BI1 A;  3I71 A;  5FD5 A;  2RDP A;  2QUF A;  1SMY F;  1EH8 A;  5DCM A;  5CVU A;  4M71 A;  3F8B A;  2JPC A;  4GO1 A;  2ZCW A;  1V4R A;  3G73 A;  3FF5 A;  2RGV A;  5FGM A;  4CHU A;  3HUG A;  4U0V A;  2FOK A;  2ZXJ A;  2RV8 A;  2EA2 A;  2KIM A;  2FMY A;  1BI2 A;  1UFM A;  3CDH A;  2XVC A;  1OYW A;  2Q8K A;  5A2Q Z;  4BNC A;  1ZG1 A;  2QM3 A;  2HFH A;  3MEX A;  3EET A;  2Q2E A;  3LA2 A;  2QVO A;  5AON A;  4CIC A;  3DV8 A;  3K1M A;  3GX4 X;  2VBZ A;  3KLO A;  3PQJ A;  2CWE A;  1Z9C A;  4P5O A;  1LQ1 A;  2FSW A;  4GYG A;  3ZN0 A;  4OU0 A;  1WI9 A;  4Y15 A;  2XIG A;  5LBQ A;  4M6Y A;  1YW8 A;  1S29 A;  2EWN A;  3QAH A;  3JAM Z;  2D1V A;  1WWX A;  1LEA A;  4EM0 B;  3HSR A;  3K9T A;  3GFM A;  2M5W A;  4UV9 A;  2HKX A;  3F6V A;  4RB0 A;  2W57 A;  1FYM A;  4M74 A;  4LLL A;  1BOA A;  2JTV A;  3C3W A;  4IVN A;  2B0L A;  5IT9 Z;  3V7S A;  4UXN A;  3ROU A;  2F2E A;  1ZG5 A;  1KA8 A;  4IF4 A;  4KIF A;  2H94 A;  3MFK A;  2DAO A;  3ECH A;  5LRS A;  2GAU A;  1YQA A;  3QRF F;  2RNJ A;  4HV6 A;  5DV5 A;  1H0M A;  4P9U A;  1O3R A;  2COM A;  3GEZ A;  1IXS B;  1QGP A;  3Q5F A;  1G3T A;  3EYI A;  1FBU A;  4LD5 A;  2OBP A;  1Y0U A;  3VEP A;  5DD4 A;  4LJZ F;  2KJB A;  1P6R A;  4EQQ A;  2UWM A;  2PFB A;  1FZP B;  2VBY A;  4A0Z A;  2XUB A;  3M1E A;  1FBS A;  1QPM A;  3F72 A;  3BPX A;  1V3F A;  1W7P A;  4MQV A;  5ILV A;  2J5P A;  2OD5 A;  5EEH A;  4A0X A;  5TRD A;  3M9A A;  4DQ2 A;  3VFZ A;  3TDU C;  3TO6 A;  1SMT A;  3T1B A;  1K78 A;  3QU6 A;  4MEX F;  2O61 A;  2EFQ A;  5E1W A;  1J5Y A;  2QQA A;  5D5W B;  1F1Z A;  2WV0 A;  1Z6R A;  4RGX A;  3F8M A;  5A2Q K;  2ESN A;  2FU4 A;  1U5T B;  1TBX A;  2QWW A;  3SXY A;  5DCM B;  3ZPL A;  1C0W A;  4WCG A;  2W84 A;  4BH9 A;  1BIB A;  1HSJ A;  2VOD A;  3WE3 A;  2QQ9 A;  5ED4 A;  2O03 A;  4U7B A;  4HQE A;  1XSD A;  1ODD A;  1E17 A;  4OOI A;  3HYI A;  1ZRE A;  1J9I A;  2MD5 A;  2VN2 A;  3JAM K;  1PP7 U;  4KMF A;  4GCV A;  1A04 A;  4P55 A;  5F1R A;  2HQR A;  4IHT A;  4AD9 A;  1FP1 D;  3P7N A;  1ZGA A;  3DXJ F;  2DPU A;  1LDD A;  3ZQ7 A;  4I0B A;  5HLG A;  2HWV A;  1MZB A;  2JT1 A;  1W5T A;  5BQT A;  2DLL A;  3CUO A;  3U9G A;  5H6Q A;  1GHC A;  1KYZ A;  2FXA A;  4HX4 A;  1LDK B;  1MGT A;  2EJR A;  1G3Y A;  4A6E A;  3KEO A;  4UUV A;  2AXL A;  3V8J A;  2MH2 A;  2GXB A;  2GZW A;  4OMZ A;  2GIV A;  4NHJ A;  1CF7 A;  3M8F A;  2HKO A;  4ZH4 F;  1PUE E;  1XN7 A;  2IP2 A;  3U2R A;  5D5V B;  4ASN A;  2IRF G;  1S8N A;  2CG4 A;  3IRR A;  3DPT A;  2W25 A;  3DPL C;  1G3W A;  1HST A;  3IKT A;  3JSP A;  1XDS A;  3R61 A;  1IN4 A;  1LNW A;  1SD5 A;  5J8F A;  2EFP A;  1R23 A;  3L09 A;  4YG2 F;  5LEK A;  3MCZ A;  1B59 A;  2QQB A;  4BHB A;  4EJO A;  4Q48 A;  5KVR A;  3WGG A;  3BJA A;  5DDG A;  2K86 A;  3K69 A;  4UVB A;  1U2W A;  1W7P B;  3N97 A;  2BGC A;  2JPB A;  5BPD A;  1HBX G;  1I1S A;  4HZF A;  5D4R A;  3L00 A;  4LLG F;  4OIP F;  3TOA A;  3KFW X;  2XGX A;  3J80 K;  2EV6 A;  2O0Y A;  1TNS A;  1U3E M;  3O3K A;  1MJ9 A;  2M30 A;  4WF2 A;  4I0A A;  3LA3 A;  3GZ6 A;  1YYV A;  1H9T A;  2EV0 A;  4ENK A;  3KP6 A;  3HSF A;  4BYY A;  4RAZ A;  2ZNZ A;  2MH9 A;  3R0J A;  2EFO A;  2P7V B;  3R4K A;  5HVQ C;  1I27 A;  2X0L A;  1LB2 A;  3I53 A;  5ICG A;  3F8F A;  1J7K A;  5DD8 A;  2KIF A;  4A5M A;  2DT5 A;  2ZO4 A;  4LK0 F;  1FYK A;  1KQ8 A;  4BHP A;  1KQ0 A;  3F23 A;  4AIK A;  2FF4 A;  3RPU A;  4I09 A;  3E6D A;  1E2X A;  2IA0 A;  1ZYR F;  2XAG A;  5D4S A;  3HHG A;  1R7J A;  2EB7 A;  4G8X A;  3EUH A;  5D6F A;  2E7X A;  2NRA C;  1QBJ A;  4A12 A;  3T0Y A;  4MTE A;  4FX0 A;  2OQR A;  3HHH A;  3QPT A;  2HDC A;  4HOB A;  3I59 A;  4EJT A;  5JVT A;  3HSE A;  2R3S A;  1TLH B;  2Z33 A;  1TTY A;  5AIQ A;  3L2C A;  1BI0 A;  3E97 A;  1QNT A;  2J5O A;  2V1U A;  3NQO A;  1O7L A;  4ETS A;  5K1Y A;  3BPV A;  2O8X A;  1R5G A;  2MC3 A;  5F64 A;  3NEU A;  3W6K B;  3HOS A;  1G4D A;  4A6D A;  3E6C C;  2G7U A;  5BOX A;  2XV4 S;  1T0F A;  3GVA A;  4HF0 A;  1IN5 A;  2DK5 A;  4HF2 A;  1FNN A;  3O6B B;  1PDN C;  3I54 A;  2IJL A;  2D45 A;  1D5V A;  1TQI A;  3TKY A;  3F22 A;  2F5C A;  2G7H A;  2V9V A;  3T8R A;  1UHW A;  1HKQ A;  2BEO A;  2NNN A;  1UST A;  3QPH A;  4G7Z F;  4O3M A;  4KMU X;  1H9G A;  3P9K A;  2M45 A;  2KIU A;  3QOP A;  1B6A A;  2K7L A;  4PGG A;  4YII A;  3WTV C;  3BOQ A;  2MA3 A;  4LB6 B;  3FM5 A;  3M7G A;  2FEZ A;  3V7R A;  2V79 A;  5HOO A;  4L9V A;  3IRQ A;  4YFK F;  1BC8 C;  2NS0 A;  1D8K A;  2MLK A;  2HTS A;  2VOO A;  1KU7 A;  1KQ9 A;  1IF1 A;  2G9W A;  3B73 A;  2DQL A;  3HRS A;  4ZYD A;  2FA5 A;  2DU9 A;  2M87 A;  3OOP A;  4ESJ A;  3MZH A;  5CVR A;  2PG4 A;  1ZRC A;  3G3Z A;  1TW3 A;  4I01 A;  2QYO A;  1QO0 D;  2ISZ A;  2VE9 A;  3N4M A;  1FSE A;  1O3S A;  2VXZ A;  2F5E A;  4RAY A;  1WQ2 A;  3FXQ A;  1K79 A;  3E6B A;  3V7C A;  1YLF A;  3H92 A;  2QZ8 A;  1I1G A;  4HQM A;  2PI0 A;  5DUK A;  1ZGJ A;  2STT A;  1P4A A;  2KKO A;  2AS5 F;  1ZLK A;  3LAP A;  1I6X A;  3P9C A;  1XMK A;  1U6G A;  2YSR A;  2FNA A;  2JZY A;  2NAZ A;  3JW4 A;  1NHA A;  1XSX A;  4WXC A;  4XBF A;  5JFR A;  3IWF A;  1JGS A;  3RYP A;  4A0Y A;  3SHF A;  2BBY A;  2A61 A;  5E17 F;  2R7F A;  4LG0 A;  1YFH A;  4KYW A;  1W7P D;  4U0W A;  3ZMT A;  2RVC A;  1HKS A;  2QEN A;  2IT0 A;  2P5L C;  4LB5 A;  3BJ6 A;  3CLO A;  4EGY A;  4LK1 F;  4G6Q A;  2IA2 A;  3SQN A;  2HEO A;  2FBH A;  4GXO A;  2Z99 A;  4IRG A;  3F3X A;  3RDI A;  4Q4Z F;  5FLX K;  4I98 B;  1SD4 A;  2OAZ A;  3RJP A;  5LHG A;  4I7H A;  2XKP A;  1IZ1 A;  4Q47 A;  4HW0 A;  1IUY A;  1BBY A;  2HZT A;  1MDM A;  1QZY A;  3F6O A;  3HOT A;  1SFX A;  1P2F A;  2A3S A;  2XRN A;  3RTR A;  3C7J A;  3PFI A;  2M8E A;  2CFX A;  3E5Q A;  1U8R A;  2MBF A;  3CUQ A;  5BS6 A;  2ACJ A;  3GZ5 A;  2EV5 A;  3WTX C;  1ZAO A;  1BJA A;  4O6J A;  5CVI A;  1ZG3 A;  2PJP A;  3D5L A;  4WXH A;  2ESH A;  4NB5 A;  4OIN F;  4RGR A;  1XGN A;  5FD6 A;  1IN6 A;  2L4A A;  4L0Z B;  4PCQ A;  4H0E A;  1IXR C;  3JTH A;  2VOP A;  5CLS A;  4ZYE A;  2FBI A;  1OYI A;  4CDG A;  3FHZ A;  1YS7 A;  1R1V A;  5DUI A;  3FMR A;  3KCC A;  5L3F A;  3OV8 A;  4KIC A;  3ML6 A;  3GFL A;  4JBA A;  2YR2 A;  2L4M A;  4FT8 A;  3EQL F;  3J80 Z;  5CVV A;  2H27 A;  4MTD A;  5TJJ A;  5LGN A;  4CZZ A;  2H6B A;  2HGC A;  2DFI A;  2FNP A;  3VOD A;  2ISY A;  5J6X A;  1JHF A;  3RKW A;  5ICF A;  3ECO A;  4XLN F;  1RUN A;  3FXR A;  3FMS A;  5HS8 A;  2YPR A;  4TV7 A;  2PLY A;  1D3Y A;  4WK8 F;  1ON2 A;  2BV6 A;  2A6H F;  2PBI A;  2DBB A;  5D8K B;  2A6E F;  5DEQ A;  1SFE A;  4Z2Y A;  2K02 A;  4U88 A;  2R7D A;  4BAY A;  5CJ9 A;  1MKM A;  4XSX F;  1RUO A;  3BY6 A;  4OIQ F;  2ZBK A;  1R5H A;  5F6F A;  4CYD A;  3F8C A;  4ON0 A;  3WTS C;  4RS8 A;  1STZ A;  3R6S A;  4EM1 A;  1MD0 A;  4GYI A;  5LHH A;  4M9S A;  3FXU A;  2ZME A;  1S3J A;  1O3Q A;  2QBY A;  3MAJ A;  1FPQ A;  3RIR A;  2VON A;  1W5S A;  3GLX A;  1XMA A;  1FYL A;  2EK5 A;  3R0A A;  3DF8 A;  5KK1 A;  5L3G A;  1SD6 A;  5HS9 A;  3FMQ A;  2LSO A;  2CW0 F;  4KUM A;  3I0T A;  2HR3 A;  4KDP A;  5AIP A;  4ENJ A;  1IXC A;  4MHG A;  2WWY A;  5D8L B;  3MZY A;  4KA4 A;  1VTN C;  2RC4 A;  4IPA A;  2M1B A;  4XSZ F;  3CTA A;  2L54 A;  5ILU A;  1XCB A;  1F5T A;  3GUD A;  3WTY C;  4D0P A;  1KU3 A;  2EFN A;  4IJA A;  3HRM A;  1XGS A;  2L01 A;  4HV5 A;  3V4G A;  4S05 A;  3CUQ B;  3DEU A;  4YFN F;  3SZP A;  2P6T A;  4HLY A;  3KP7 A;  2KJC A;  1K78 B;  3TGN A;  3TO9 A;  4IHS A;  4R8H A;  2VC0 A;  1T38 A;  1W4M A;  5L3D A;  3JSO A;  4HDV A;  4ESB A;  2A07 F;  1ON1 A;  5FB2 A;  2K27 A;  1WSU A;  4EGZ A;  1UHM A;  3J7A O;  5K5Q A;  1Z6T A;  2VC1 A;  5DCF A;  3AAF A;  3KP4 A;  3MQ0 A;  3HRT A;  4HDU A;  2OA4 A;  4M9X A;  1JHH A;  5IT3 A;  4WWC A;  1IRF A;  4KN4 X;  1YW9 A;  2VBX A;  1P4W A;  1ZLJ A;  4HLX A;  4KN7 X;  3ZMS A;  4YFX F;  1Z1D A;  4FX4 A;  5CVJ A;  2XHK A;  2GA1 A;  1BM9 A;  5BPI A;  1KU2 A;  1HXD A;  2TDX A;  3WE2 A;  2HQN A;  4HAM A;  2Y0M A;  1O3T A;  3GFI A;  3LST A;  2VE8 A;  4HX8 A;  1ZRD A;  3VB2 A;  4PDK A;  2ETH A;  4XRF A;  4OIR F;  2VT2 A;  2OZ6 A;  3GWZ A;  4EJV A;  4PGH A;  3D0S A;  4N0B A;  3F21 A;  3TQN A;  5L3B A;  1XB4 A;  2ELH A;  4BHC A;  5E20 A;  1HW2 A;  4ESF A;  1LEB A;  1YO5 C;  1R22 A;  2WTE A;  4CGZ A;  4HX7 A;  3LQR A;  2YX4 A;  2YX7 A;  1XSV A;  4L0Y B;  2MLG A;  1EV7 A;  5JR3 A;  4RGS A;  3GYH X;  4KT5 C;  4UVA A;  2ZME B;  1CF7 B;  4P9F A;  3KE2 A;  2W85 A;  1KGS A;  3RKX A;  2QBY B;  5E1X A;  2GA2 A;  2EFW A;  4RGU A;  2PN6 A;  2XAQ A;  2Q0O A;  2NNY A;  5D5X B;  4B09 A;  2PQ8 A;  4I02 A;  1BC7 C;  5FLX Z;  1FSH A;  1K7A A;  3GW2 A;  2VBW A;  1YS6 A;  4L18 B;  3J81 K;  4G7O F;  2XAS A;  3WGH A;  4ENN A;  5E8G A;  3KZZ A;  3B02 A;  3WOD F;  4EJU A;  3ELK A;  4CO8 A;  2H09 A;  2DW4 A;  2D2W A;  1USS A;  5DYM A;  4AIH A;  4A2U A;  3MWM A;  2BE5 F;  4EMS A;  1OR7 A;  2P4W A;  2RKH A;  5HLI A;  1R1U A;  2XAH A;  1DPU A;  1U5T A;  3R60 A;  4M73 A;  3BRO A;  4L9N A;  2KRF A;  3DP7 A;  1CGP A;  1WRJ A;  5ILS A;  1DP7 P;  3KP3 A;  1KU9 A;  2XAJ A;  2FRH A;  1T39 A;  4DNC A;  4FHT A;  5LHI A;  5ICE A;  5LGU A;  4UV8 A;  3E3V A;  2OZU A;  3ZMU A;  3IHU A;  4U7D A;  1T98 A;  1LDJ A;  1P4X A;  3TOB A;  2CYY A;  4LLN A;  1T6S A;  2DQR A;  3ISP A;  2L3D A;  5ERI A;  1MJB A;  1L0O C;  1DPR A;  3DQV C;  1G3S A;  3ABT A;  2CO5 A;  1LJ9 A;  1TQM A;  4RB3 C;  5FFZ A;  4IRI A;  2HTJ A;  1OPC A;  3RYR A;  2UZK A;  1R1T A;  3FM3 A;  3I4P A;  4IXA A;  2DI3 A;  4HYE A;  4HA8 A;  1OMI A;  3L7W A;  3RI4 A;  1ZAR A;  4RB2 C;  1O7F A;  1SAX A;  3BJO A;  4QLC U;  4G9Y A;  1ZRF A;  3KET A;  2X4H A;  3V8K A;  3WTW C;  2Z9O A;  1HW1 A;  3I59 B;  2L02 A;  4L5I A;  2PMU A;  1SFU A;  2E1C A;  1Z7U A;  3ZMZ A;  2QLZ A;  3IKV A;  2IA1 A;  3ZP5 A;  1F9N A;  1F4K A;  2LF8 A;  1AOY A;  1L3L A;  1XCV A;  1IN8 A;  3Q9S A;  1X3U A;  5JHU A;  3BZ6 A;  5E1Z B;  2FQ3 A;  1JE8 A;  1B4A A;  4ENM A;  2E1N A;  5L3E A;  3CUQ C;  3JTG A;  4CXF A;  3VOE A;  1I5Z A;  1B1B A;  3LQQ A;  1ZHF A;  3O2P E;  5LGT A;  4JK1 X;  2F5F A;  4I2O A;  3U1D A;  4A5N A;  2A69 F;  4AWX B;  3BP8 A;  5CYV A;  3WU0 A;  2JRT A;  1XGM A;  4KNY A;  2RQP A;  3BWG A;  3KLN A;  3CO7 C;  5LEJ A;  4G6D A;  2LKP A;  4L9J A;  1O57 A;  1R58 A;  1SD7 A;  3IL2 A;  1IRG A;  1U78 A;  5HDN A;  2XRO A;  2LNB A;  2DPD A;  2ADU A;  1Z05 A;  2K4B A;  2C6Y A;  1TQP A;  1G6N A;  1FOK A;  2O3F A;  4AIJ A;  3FWE A;  1OKR A;  3WTT C;  1YG2 A;  1GXQ A;  1XD7 A;  3I5U A;  3H3U A;  2JSC A;  4WX9 A;  2FE3 A;  2XKO A;  2ZJ2 A;  4N9I A;  4M72 A;  1FY7 A;  1FX7 A;  3L9F A;  1RZ4 A;  5H20 A;  4ZYG A;  1BIA A;  1IW7 F;  3LA7 A;  2DK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...