4QM7A

Structure of bacterial polynucleotide kinase bound to gtp and pdna
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLMSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallophosphoesterase
publication title Structures of bacterial polynucleotide kinase in a michaelis complex with nucleoside triphosphate (NTP)-Mg2+ and 5'-OH RNA and a mixed substrate-product complex with NTP-Mg2+ and a 5'-phosphorylated oligonucleotide.
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Transferase/dna
total genus 64
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qm7A00
3GLFB 5AUOB 1CRQA 2BJVA 2Q21A 2ZTSA 2H92A 2CXXA 2IYUA 3TKLA 3PIRA 1TUEA 2OT3B 2O8CA 3P4XA 4AIIA 1LS1A 3GLHA 2YOGA 4D81A 4M1OA 2WVJA 1ZCAA 3MWKA 2IYYA 3K9GA 4NHOA 4RD0A 1KK0A 2IXGA 3I72A 4KJZA 1KO5A 2C5LA 3KTAA 4DKXA 3GQBA 1W4RA 1E0KA 1ZC4A 3RANA 2J7PD 3JVVA 2OFOA 2HCJB 2YWHA 3SJCA 2ORWA 2BBOA 4MYCA 3TRFA 1FX0B 1X8JA 5EE5B 2JIZA 4Z8YA 2PT7A 3AF3A 5BXQC 3KB2A 4EPYA 2CMKA 3SC3A 3TQCA 4A9AA 2XTZA 2CL7X 2R44A 4LHZA 2FPKA 1G8YA 3QENA 2F3RA 3U4QA 1PUIA 1U81A 1W49A 2HXYA 3THWB 3E1SA 3SN6A 4M0LA 5SZJA 2ONKA 4NYJQ 4Q02A 1XPRA 3AP3A 2EFCB 2OE2A 2BCJQ 5DN6A 4ZI3A 5HPYB 3U5ZB 4M9QA 4A8JB 2NZJA 1XZPA 2D62A 1V43A 3WP1B 2C96A 5JCZA 4IDPA 3H84A 2ZVPX 4TT3D 4QFMA 2RHMA 1FW6A 1CULC 1C1YA 1HYQA 5JSZB 3GJ5A 3BRWD 5L3VA 2ONJA 2VRWA 2ZJ8A 3C16C 3K9LA 5FBQB 5AUPB 1GP2A 1ZNZA 2ZUDA 3LXRA 4B43A 2XXAA 1W44A 2P67A 5AJXA 1OXXK 1KO1A 4OK3A 4P33A 1T0JB 3WMEA 2F43B 5KYKA 2C99A 4GBMA 3IBYA 1ZUNB 3SJAA 2HEIA 4CGZA 4A15A 1A7JA 1ZD9A 3EA5A 3U7GA 3IILA 2CK3A 4OI2A 3QPUA 4US0R 1F60A 2YVUA 4QNMA 4WBSA 5D3MA 2Z4SA 4Q21A 2ZROA 1VCOA 4L9WA 4M9XA 4HLQB 5K8UA 3V00A 3MFYA 3U60B 3F0TA 2FFAA 2D3WA 1FOEB 3LO5A 4KFSA 3EIQA 4RD2A 2C9CA 2R2AA 1HV8A 1CTQA 3CBQA 2D4HA 1OE0A 3F5FA 1XFAA 1FQKA 4UXIA 3X1WA 1VIAA 3FKSA 4E09A 4PZLA 4B32A 1XJQA 3BBPA 2ZITA 2WJHA 4FCVA 4Q47A 4M9SA 4KFTA 3LA6A 4WIAA 1MRNA 5CIWA 2AN9A 5H1YA 2RH5A 4BLTA 3CR7A 4DLRA 4PO1A 3MWLA 4PPGA 2IS2A 1Q22A 2ZS7A 4M22A 3SBEA 4Q7LA 4GT1A 2O8BB 2QBYB 1UJ2A 2ZAMA 5JWRA 4D2IA 1COWD 4JZKA 5LB2A 2J5XA 5LBIA 4UXHA 3AVUA 4MKFA 3LQRA 2V1UA 1N0WA 5FOVA 3AM1A 1R0ZA 3GFPA 3PR1A 4V0OA 2MSDB 1TL7C 3OFNA 2ZSAA 1NVVQ 4FCWA 4D0LB 4KFUA 4IXMA 3W8RA 3SYKA 4QXAA 1SVMA 2CNWA 1FQJA 3A58B 1JQLB 1YZUA 2A5DA 3Q72A 3ZH9B 5B64A 1VTKA 1E98A 2NO1A 4BPBA 3I5YA 2VSFA 2QAGA 4A6XA 4Z51A 3T1VA 3VNVA 3CR8A 5KTYA 1UKEA 3FWYA 4OHWA 3HYTA 5FPSA 3TQFA 1VG0B 1T3SA 4L8GA 4HLUC 4ACBA 1Z0IA 4BEJA 2OAP1 3VR4A 5DYIA 4PHHA 4DRZA 3IIJA 2DFLA 3KKOA 3W6NA 1JR6A 1OKKA 1JR3A 1G20E 1NJGA 2R6CA 2ZRJA 1LW7A 1UKYA 4FMDB 4LY6A 3X1ZA 1TEVA 1WBBA 4MRRA 2ORVA 1E2IA 4OQXA 2R6GA 1N5KA 4Q9IA 2BEKA 2X1VA 2YNMA 3PUXA 2OBNA 4X8LA 1G1MA 4B2PA 4G5GA 3AGPA 1H8HA 3LRPA 4PC1A 4TYQA 4ZCIA 3JZMA 5A0FA 1E0JA 4URYR 1KI6B 3DM5A 4U00A 3D7MA 4LHVA 5HKKA 1QHSA 1IY1A 4FWTA 2BBWA 1IY2A 3LDAA 3KZ1E 1C9KA 3H4MA 5FPHA 4YMUA 4YMTA 4KFRA 3EG5A 4PQYA 5GVSA 4Q1AA 3C8UA 3CNNA 2ZRPA 4P4SB 4FD2A 1JALA 2FWRA 1YZQA 3GJ6A 2FGKA 2H16A 3HWSA 2VF7A 3TUIC 4KODA 3KUCA 3W3ZB 3KB1A 4NYIQ 4QHTA 3QKUA 2FFQA 1E2MA 4M9ZA 4R98A 1IQPA 2W6ID 2IYQA 3V9PA 1ZU5A 1EFCA 3MRSA 3SJZA 4NCHA 1SXJE 2GJ8A 3EW9A 1CR2A 2DHRA 4LPKA 3D31A 4YXWA 2WJGA 4F7WA 4LZZA 4CYMA 2GF0A 621PA 4M4SA 3CRVA 4HAWA 2YOHA 1ZJ6A 3DMNA 4YMWA 1NI3A 4MGIR 4TMXA 3RC3A 3W8NA 2ZQ5A 2GK6A 4NU0A 2QN6A 3LBNA 4CW7A 5CK4A 2NMVA 2O8DA 3S1AB 3K09A 4JLKA 1WXQA 4Q7KA 3K0AB 5FPYA 1NY6A 1XCPA 1DARA 4JSYA 3ADBA 4POAA 3GJXC 2W6JA 2Q6TA 3ADCA 4ZDKA 1SVWA 3MLEA 3PUYA 3O8RA 2O8EA 3LV8A 3MAAC 1A2BA 1UM8A 3SU8A 4UNNA 1I2DA 3PG5A 4D80A 5JS8A 5FBVB 5FL7A 2FEMA 4JLAA 3A36A 3BB3A 4GSYA 2BEJA 4HUTA 1F48A 4D4KA 4DB2A 5IK2D 2OZEA 1RIFA 3CF6R 4AY2A 3QKRB 2ODEA 3T61A 2ZRIA 1NSFA 1XEWX 4D0GA 2VSXA 4JBWA 1S3SA 1N6PA 5HCNA 2ZRMA 2VHJA 1CRPA 4Q9JA 1J90A 1G18A 4JS0A 2ASEA 1ZNWA 3Q3JB 4O2LA 5K8LA 2C77A 4YMSA 2LKDA 4OJQA 3NDBB 4AC9A 4B76A 4JVLA 4XOIA 3TH5A 2IWHA 3Q9LA 1PZNA 4QM6A 521PA 5CYPA 2ZREA 4BZQA 1E79D 1A82A 1N25A 3T5DA 4BFSA 4DSOA 4U7DA 1MRSA 2FOLA 1TU3A 3ZVRA 2W2VA 1OB2A 1L4UA 1Z29A 2C04A 1U0LA 4E07A 3W3AA 4B47A 5FPKA 3HU3A 1II8A 4W5HA 3SDZA 1JEDA 1OIXA 1RFLA 4QNRA 2H7VA 3U3RA 3TW4A 2GAAA 4Q48A 5E7JA 1OFTA 4MGZR 1HQYE 1G64A 5KHOC 1IONA 4BRWA 4ILEA 1EFTA 3RRYA 1UF9A 5GJWC 4GNKA 2EU8A 2QRNA 4C0JA 3SI7A 1G7CA 4DBLC 1FUUA 3GLIA 3OIUA 1M7GA 4LJAA 2QE7D 2O0KA 4XH9B 1OFHA 4YDHB 4AI6A 1AA9A 1XXHB 2WWWA 4JVMA 1M34E 2ZU0C 2HCBA 2WMOB 4TZ6A 2IHYA 4L4UA 4BEBA 1IOZA 2HV8A 1Q1BA 1XEXB 2P0EA 5HR5A 3VX4A 2IYLD 2F9MA 1QG2A 1TAGA 4TMVA 5KUTA 3T1TA 3U7HB 4LYJA 2NGRA 4TTPA 4I4LA 4CVNA 2PCJA 4JLBA 5FUWA 3ZZ0A 3K0FB 3I32A 5KNCA 1LB1B 3KJGA 1BMFA 3RRNA 1L2TA 2QM7A 3FMOB 2GVZC 1XDBA 2VIIA 1ZM9A 4DLYA 1CU1A 3ZS8A 3MD0A 4HB0A 4GMXA 2J0VA 3ICQB 1M74A 3QEJA 1TMKA 4WAUA 3UPUA 1XCGB 1A1VA 5EXXA 4WOPA 1E4VA 1HH4A 1KO4A 2ZANA 3L0OA 1KJYA 4LJ4A 3W34A 4B48A 4EJSA 4EPWA 2CEAA 2WJYA 5E3HA 4IVPA 1JAIA 3DEFA 1KO7A 5E7IA 1KIMA 3FE2A 3P32A 3FKQA 4B3FX 3U44A 2IK8A 3R8FA 2JJ2A 3GD7A 4R7ZA 2ZJ2A 2CE2X 1E9AA 4PTLA 4TQAA 1M6NA 4RFVA 5FL3A 5KNBA 2GRJA 3PITA 3TSWA 1Z0JA 2N46A 2SHKA 2VQSA 4B74A 2ZRHA 4EDHA 3QJYA 2BKUA 4M21A 3AKCA 1D2MA 1KMHA 4LBVA 4PANA 5JI3E 1E1RD 1UKZA 4JVNA 4DUGA 4ZI2A 1G8FA 5LD2C 1L7VC 4DSNA 2KJQA 2WWFA 2GCOA 1S1CA 4MH0R 1F2TA 4KV9A 1TQ6A 2WIAA 5C46F 4IDOA 3SS8A 3A1VA 1R6BX 3GFTA 4C0KA 3TIFA 3THXB 4PQRA 1T3HA 4Q9KA 2XNDA 3I73A 2VP6A 1J70A 2FN4A 1W4CA 3JZAA 2DCUA 1PJRA 5CLQA 2RCNA 3KXKA 1X1RA 5AWFC 3HR8A 2XEXA 4XD7D 2CL0X 3EX7C 4TLAA 5B57C 6Q21A 2WBLC 4ZO4A 4UXJA 4HAXA 4G01B 1KY2A 1OHHA 1GL6A 2IA5A 2A7QA 4ZDIA 2OBMA 1Z22A 2D74A 3IDQA 4PSAA 4X8OA 2Z83A 2J3EA 4HUQA 4CEJA 3OEHA 4OI4A 1R5OA 2XZLA 3FMFA 1SXJA 1Q0UA 1VMAA 1D8TA 3DO6A 2VF8A 2QPTA 3CWQA 2XNSA 3FHOA 4B2LA 4NPHA 2OCYC 1P7CA 2GJKA 3CM0A 1JAHA 3HYRA 1EFRA 1E2EA 2DBYA 4NYMQ 4WZAE 2BIFA 1ZCBA 3FTQA 3TAHA 3DL0A 2FE4A 4LHXA 4C2TA 121PA 4D25A 4HLDA 4JLPA 2YOFA 1CJVC 5FR1A 1GILA 1HUQA 4C0QC 1XF9A 2GNOA 2WSSD 4OK6A 3T06B 2GETA 1SKQA 3H86A 2GWHA 2YINC 2ZJOA 4QHSA 4Q19A 5FTNA 3R7WA 2YHSA 3C15C 4ASUA 3GLGA 3NKVA 2FZ4A 4V02A 4URVR 1W1WA 4DEYA 4BWYA 5JI2E 4AKGA 5EJEA 3ZVMA 3RS4A 3VKWA 2PX0A 1IBRA 1W0JA 2NZ8A 4IDHA 3KQUA 3VNUA 1U90A 3NHBA 3A1SA 4NL4H 2Z4RA 2WSMA 3OIVA 4TYYA 1GL7A 4O3MA 2YWGA 5JBQA 2RAPA 3RC8A 2JA1A 1PLLA 2IUTA 1Z6AA 1LNZA 1KKLA 1FP6A 2Q9BA 3CZQA 1EX7A 2ZRLA 4QGHA 4Y0VA 4WW0A 4TLBA 2JJ1A 4ZPXA 4QJ3A 5JWHA 3V4RA 2FZLA 3CRQA 1XJCA 5EE1A 3W90A 2N1BA 2AD1A 4OHYA 4A0HA 4B3CA 2WAXA 2YWFA 3PEYA 3PENA 2ZJYA 1YJ5A 2IS4A 2MSCB 1DAEA 2OM2A 5CIQA 3UKDA 2IXFA 4M53A 3KUDA 4IOLA 1SVOA 1HY3A 3Q5DA 1EESA 2WJJA 4PHTA 1YZTA 2FV8A 3CO5A 1CF4A 2B8TA 1XX6A 2VP2A 4OI1A 1E0SA 3V4FA 4EQ6A 3GLFE 1SVKA 1KZ7B 2E87A 4XSHA 3VR2A 4YMVA 2IW3A 3P20A 3QOFA 5DN6D 4MYTA 4EPRA 3CZPA 2LKCA 1G3QA 1VPLA 2IHBA 3QE0A 3RS7A 1OJLA 2JLQA 4BFYA 5FPTA 3PEWA 4D82A 1E1QA 1NJFA 1Z06A 4GFDA 2Z5FA 4D0NA 2CVHA 2HT6A 4BLOA 3OEEA 2F7SA 3BFVA 1W0KA 4MQBA 2RKOA 4Q03A 4W5WA 2ZR0A 4MRVA 4B3DA 3W6PA 5DNYB 3WBKA 4PAMA 1KAGA 5FOXA 1DAHA 3H2YA 1YVDA 2B6HA 5B2ZA 2P5TB 2QM8A 2AFIE 4CEIA 4JLOA 2CK3D 4DDVA 3WNCA 3MJHA 1LS6A 1RYFA 4Q7JB 4CRWB 2BBSA 2BBTA 1IXRC 4BRUA 4KVAA 3EIHA 2IWRA 2N42A 1F5NA 2DFNA 3GMTA 3EARA 3VU9A 3O8BA 3QI2A 3ZIAA 1IY0A 4HB3A 2ATXA 3BH0A 3PV0A 3QQ5A 5GJCA 3AVXA 4DB4A 1IN4A 4RZ3A 1DE0A 3IHLA 2GEUA 1G291 1T8UA 2GJAA 3A4MA 3HJNA 3EWAA 1ZP6A 3FMIA 2KI5A 1K8RA 1J2JA 1E99A 5DYGA 1RZ3A 2O8CB 5GADl 2REOA 3GLHB 4GRAA 2RGDA 4LHWA 2GCNA 3QBVA 4GZMA 2I4IA 2PLFA 3AKDA 4RVCA 3U6KA 1M2OB 5FFMA 4XTCS 4JLDA 1VKJA 1N6NA 3KTAB 1WRBA 3AH8A 8OHMA 2ODBA 4R71A 4RD3A 1R0XA 3FMPB 5G3ZA 3BGWA 1GNPA 2QPOA 4HAZA 3U3JA 2J0SA 1ZUIA 4FI3C 3IUYA 4HZUA 1KI8A 4C0BA 5BN5A 3ASYA 3H0KA 3X1YA 1Z47A 2WJIA 3DDCA 3O8CA 2A5JA 1QZXA 1VECA 2XOKA 3RWMB 2JLYA 2GJSA 1B0UA 4WXPA 1BH2A 2GESA 1G5TA 4XSGA 2XGJA 4RZXA 1U9IA 3LVRE 1KI4A 4S2EA 1ZW6A 1KJZA 2Q9AA 3AVOA 1AQUA 2Z43A 2IX3A 1II9A 5LD2B 4Q4AB 3FVQA 4N0DA 2HLDD 1UEIA 2ZS9A 1QHHA 1W5TA 4HATA 2XXAB 1YU9A 2PZEA 2QPAA 4QBGB 3A6PC 1E9FA 1W5SA 1AM4D 5H68A 1ETUA 4GZLA 4MUBA 4UNQA 3T35A 3UG7A 5M04A 2AHOA 4ACAA 4KHZA 3VR1A 2ZSFA 1NVWQ 2C98A 1CR1A 2FFHA 5CLLA 5HKKD 3GEHA 1I4TD 4OJKA 1OFUX 1G16A 2RGAA 2V8OA 4LJYA 3FB4A 1U8YA 3IBGA 4MITA 4MGKR 1V5WA 4IOMA 1R8QA 4C3ZA 5LB4A 4LJ9A 4DLWA 3KDSE 2O5VA 4TYWA 2GEVA 3R9IA 2VP9A 1XZQA 3WBJA 3CF0A 3B9PA 2DFTA 4IKEA 2HJGA 2PCLA 4Q18A 1ZRHA 3TR0A 1NBMA 4DDUA 2CHQA 4A92A 1DO0A 4I1OA 1XD2A 2Q0HA 4D26A 2P65A 4ZDWA 3RLFA 1N2CE 4GL2A 4TLEA 2DYKA 2H5EA 3AF4A 2B7BA 1XTJA 3AVQA 2QGNA 1DEKA 1S9DA 1N5JA 2BWJA 2ZRKA 4Q1EA 4BFXA 1KSJA 3A8TA 3U6BA 5CK5A 2J45A 1J8YF 1AKEA 1TQ2A 3NEJA 4JJZA 4LWZA 4WZ6A 5EP1A 4FIDA 5C18A 3LVQE 3KJHA 3MSXA 1E2KA 1GL9B 2H57A 2VPPA 3T1QA 2EYUA 4LBYA 2HYDA 1L4YA 2CL6X 4C0LA 4E03A 3ZZTA 4PAOA 4MYHA 3QSYA 1NIPA 5F2EA 1OH7A 2AKAB 3Q7QA 3ZD6A 1XRJA 3X2SA 2WWIA 4LSGA 5EQTA 2Z6VA 4HAUA 4HEJA 5E7MA 3TUZC 3BB4A 4Q9LA 1DAIA 2VP0A 2W6JD 3CH5A 1Z6GA 5TVKA 2B21A 5J5CA 5JRJA 2FSHA 3I8SA 4FMCB 3UG6A 3WYGA 4BASA 3QF7A 4Q4HB 2JASA 3FYHA 2RHDA 1R5NA 2UVQA 2OXCA 1RPZA 1S4QA 4IHQA 4ON9A 3B1YA 3RVBA 1QVRA 4ARZB 2YYZA 3QKSB 1MABA 4Q7MB 4B3GA 1DG3A 3T5GA 1WQ1R 1CJKC 4Q66C 1QHYA 2ZVQX 1IXZA 1N5IA 1N5LA 3EA0A 3IPXA 4MA4A 5IDVA 4US2R 5TV2A 1N6LA 2YJTD 1E9EA 2RMKA 1R10A 4M1TA 2XJ9A 3DZDA 2OHFA 2RGXA 1E2FA 1E9BA 4PPNA 2QZ4A 2ZUBA 3SFZA 2FX3A 5KSOA 2K5UA 1E2NA 3CX6A 2ZSEA 1OF1A 1N6HA 2R65A 3BH7A 2ZIAA 5BN4A 3IQWA 4LI0A 4B34A 4OHXA 2OFWA 4GOJA 5FBWB 3QF4A 3RDPA 5HCIA 1W4BA 3KKMA 3IKJA 4LBWA 3TSZA 5KPDA 2AWOA 2REBA 1FX0A 1SKYB 4LK2A 1VHTA 2A5FA 4BECA 1X8KA 3HPQA 4UKDA 3A1TA 4R9UC 2QGZA 3C5HA 2F1HA 3IEUA 4G5SA 3B85A 3K0CA 2OXRA 3UATA 3THWA 4BFZA 3GPLA 3NWJA 4YDSA 1FP7A 2HUPA 4EPVA 3NIBA 2AXNA 3CX7A 2GZDA 4A8JA 2JDID 3L8YA 4HZIA 3AP2A 4M1SA 2BV3A 1D2EA 2C2HA 3QKTA 2ZRDA 2G9NA 4RD4A 4C30A 3FFAA 4BQSA 1ZD8A 5JHGB 5JSZA 3P4YA 5JFGA 4DT1B 4DIEA 1ZD1A 1TQDA 4MKIA 4ERNA 4TMZA 1G3IA 1P75A 3KXLA 3O47A 2ZU6A 3KQKA 2ZYTX 2O8FB 2F43A 2WWGA 4R2IA 2EW1A 3P27A 2ECKA 1E9DA 1XEFA 1QF9A 4PSVA 1XBTA 1IN7A 2XB4A 3TNFA 3FOZA 4FW9A 3A1WA 4V03A 2ZI4A 3UANA 2EFGA 1FTSA 1MO4A 1F3OA 1OSNA 1N3BA 2F6RA 1W36C 3NDPA 5EE9A 5BQ5A 1W46A 1P5ZB 1VIYA 4IFBA 3L82B 1G8PA 2KBEA 1LF5A 3ADDA 3OAAD 3DKPA 1Y3AA 2R6FA 3N5CA 1AK2A 1FZQA 3MWYW 4OL0A 2IYXA 3NH6A 1XXHE 3ND8A 2YC2C 2JJ2D 4DHEA 2PZFA 1E2GA 4RCZA 1LY1A 2IF0A 3EWSA 5BWMA 2IUUA 4F92B 1Q57A 3U3KA 3LW7A 3W6OA 3HU2A 2ZRAA 1FPMA 3CX8A 3PUWA 4RJLA 5JEEA 1G8GA 1G6OA 3ADKA 4XVQA 2CHGA 2GBLA 4FCTA 5AUNB 1GITA 5FTKA 3VQTA 1AQYA 1Q12A 4KLNA 2I1VB 2OAQ1 3VX3A 3AUXA 2J7PA 5JJKA 2DR3A 4U5XA 5UKDA 2WIBA 2ZI6A 2ZYWX 1T5LA 1UAAA 3BIFA 1O87A 1OXSC 4TL9A 1SHZA 1II8B 4US1R 3TK1A 3MMPA 5FTJA 1OB5A 2VH5R 1VCMA 1Q1QA 1NMZA 4QHYA 4XWOA 2Q9CA 1X3SA 3TUJC 4Z1MD 2QTVB 2VHUA 3ECCA 3B82A 4DCVA 4DCUA 3WRYC 3LH5A 2PZGA 5AJWA 2FF7A 2PMKA 2NO0A 4IOKA 4QJ5A 1J8MF 4PC2A 1J99A 1KI1A 3SR0A 5KDOA 3GLIB 4DLUA 3BAFA 4IVQA 3T1OA 3WY9A 5DI3A 1UDXA 2ZRBA 1T6NA 2IYVA 4JLVA 4TT3A 4E5UA 4ZV4A 1IJEA 2J46A 1U8ZA 3QG5A 3ETLA 4M1KA 3RAPR 3OEHD 2MSEB 1ZM4A 4A1FA 4QRHA 5CB6A 3PFIA 2IBMA 4CT4B 4NKRA 1R2QA 1Z2AA 4LJ5A 3PQCA 2OUKA 1E9SA 2H17A 3AP1A 4LCBA 2ZXUA 3Q85A 5AJYA 4JVSB 2BC9A 1KI6A 2KSQA 2WM9B 2WWXA 4OQFA 3EZ7A 3CKLA 4MKGA 2A5GA 4Q1CA 5TDHA 4TMWA 5JEDA 1YE8A 3LBHA 2WKRA 4LDJA 2J87A 4KBFA 4DCSA 4PR0A 3TE6A 2V7QD 1E69A 1US8B 4W9MC 4NP6A 5A5GA 4P4UA 3BXZA 1S0UA 2ZAOA 4RCYA 4DSUA 3BD9A 1NNEA 4JT4A 1GG2A 1Q1EA 3MGCA 4ZIRB 1EX6A 3MJRA 2UKDA 5SZIA 3SHWA 2O0HA 4JBYA 1G41A 3N2EA 1AGRA 3UXMA 2RGNC 3QXJA 1AZTA 1IAQA 3CF2A 821PA 1T91A 1YKSA 1X86B 5K8IA 2DPXA 3B1WA 1S3GA 1KMHB 3U3OA 1P4SA 1QBKC 4Q4JB 4WXRA 2VSOA 1CBUA 4TYPA 3TBKA 4AWXA 1F2TB 2QL6A 3LQQA 5DO9A 5F3WB 3AVTA 4JKYA 4B2IA 3BOSA 1WE2A 1YZLA 1GKYA 1OXUA 2VHCA 1BIFA 2D2EA 1OPXA 4I99A 3S1AA 2H8KA 4PQFA 1W36D 2QMEA 2V54A 3K0AA 1G4AE 3R20A 1RJ9B 1XCMA 2PLRA 3CNOA 4ZKDA 2WWYA 2OV2A 4FINA 4PC3A 4KI0A 3E2IA 4JSTA 4WZBE 2WPDA 4HAVA 5FBLB 1Q44A 4B73A 2IEYA 3AV0B 3KFXA 3VR5A 4CEHB 1IHUA 2YZ2A 2AR7A 3IHWA 2IYSA 3KX2A 4UNSA 4M1WA 2ZRCA 1T0HB 2DB3A 3PUZA 3IIKA 2EFDB 3D8BA 4NH0A 2C9OA 3B5JA 1VG9B 4HDOB 1IM2A 4CEJB 3M0EA 4QBHA 1X1SA 5HE8A 4WA7A 1H8ED 2YV5A 1E1QD 4V0ME 4RFSB 1FTNA 2EFEB 3GFOA 3RSOA 3UWOA 1NRJB 4D6PA 1YRBA 1KZGB 1DADA 3PEVA 3VFDA 1T9HA 1D6JA 4DZZA 5DIFA 4L5BA 1W0KD 3K9HA 1DTSA 1NLZA 1GVNB 1TF2A 3ASZA 5EE0A 4A0FA 1XU4A 4PXAA 1G17A 1KYIA 3G5UA 4B75A 1GTVA 3OE7A 1OIVA 5KNDA 2VP4A 4A36A 3WP0A 4ZDJA 3WXMA 2W83A 1J7KA 1G3MA 2ZI5A 1G3RA 2CDNA 1NF3A 3EXAA 1XPOA 221PA 3LBIA 2GXAA 3BWDD 3LWNA 4RZUA 3K70C 2F3TA 1Z6TA 4AG6A 1OH8A 4DVGA 4AURA 4XTRA 3NBFA 3GLGB 1P61B 2G6BA 1B23P 2A30A 2C95A 3KJIA 1NY5A 4EFNA 3TMKA 2R6AA 3KQNA 2BKEA 2E9SA 1KNXA 3OZXA 2L0XA 3OIYA 4KAXA 4YLGA 3EPKA 1D5CA 3HU1A 4JJKA 1CEEA 5AK0A 1XTQA 5AUQA 4BE7B 4KBGA 2CHVA 1PLKA 1KSGA 3TSOA 4BZPA 5BW8A 2B8WA 2ZE7A 1P72A 2KE5A 2ZEJA 1QHNA 2Z0MA 5D3QA 1T8TA 3BFKA 1OW3B 3A4NA 3IQXA 1RRCA 4WVFA 1H65A 5JJLA 5JJIA 1XXHA 3BE4A 3KKPA 4GOXA 1ZU4A 5TMPA 4AYWA 4TN1A 2B7CA 3I3SR 1XD8A 3NBXX 4AYTA 5J4YA 4N0EA 4KYIB 1W2GA 2FPMA 3THOA 2CJWB 2EVWX 3K0FA 3RRMA 3OHMA 3ICEA 3K0EA 2JAQA 1W36B 1TF7A 3RWOA 5A4JA 2ZJZA 3KQLA 1HTWA 2XB2A 2GK7A 1G9XA 1XP8A 3ZQJA 1R7RA 3QPWA 3EPHA 4NBSA 1CJUC 2XOKD 1NN5A 1ZM2A 4XWAA 2OCBA 3PXGA 5LDDC 4TL8A 1KSHA 4IRUB 4DDWA 1ELOA 4PPFA 1P2TA 1PLJA 2IYTA 1AGPA 3QPVA 4YONB 4JLJA 3SHFA 4K81B 1SGWA 4X8MA 5J47A 4ITRC 1U0HC 3LAWA 4IDQA 3GLHE 2HF8A 4LC1A 2CE7A 5IK2A 3DOFA 1VYTA 5P21A 3W5IA 2QAJA 4DIDA 1JI0A 5HTKA 2HT1A 5E95A 3W5JA 3K0CC 5L3SB 4DSTA 1E2QA 3CW2A 1K6MA 3L2OB 1DAMA 2ZS8A 1BO6A 1R4AA 2QRZA 3M4YA 1KK3A 3RRZA 2J0UA 5BN3A 1JJVA 1RRGA 2QAGC 3ZD7A 1CR0A 2P6UA 3AUYA 5C2JB 4DCNA 1DG1G 2BCGY 2C8VA 4G1UC 4G5QA 3AQ4A 2PEZA 3F8TA 4NYJR 4PC7A 1E79A 3L8ZA 4JBXA 5L3QA 3X1DA 2QENA 4H9GA 3GJ7A 4UJ5A 3THXA 1LTQA 2WKPA 1PV4A 1NG1A 4EPXA 4K8OA 4GOKA 1MV5A 3P1JA 4QGFA 2D7DA 2ZPTX 4HLUA 4C0AC 2XAUA 1MR3F 1E32A 4IFEA 4C7OB 2JIZD 2ZR9A 2ZE6A 3HP1A 3MUFA 1MO5A 1NBMD 2DFKB 2FU5C 5FI1B 3FPAA 1U94A 1UFQA 4NCNA 2ZRFA 4JL6A 2OESA 2QE7A 4S35A 4DWJA 3GCGA 1X6VA 2G88A 4NTZA 5CJ2A 3SBDA 2AFHE 5FOTA 1WP9A 2ZJBA 1I4DD 2X8AA 3L0SA 4PPQA 3GJ8A 2AWNA 3UMSA 4NDZA 3LFUA 4ZCMA 2TMKA 2WJVA 4PO9A 5DLQC 3CIOA 2WOOA 4NMMA 1QVAA 1CLUA 4RZ2A 3CONA 4TMKA 5KSPA 3A37A 4HDQB 2PX3A 4C0SA 4QJ4A 5EXPA 2FJUA 2KB0A 1MO3A 3Q5EA 4H1UA 4HZUB 2OLKA 2PMDA 5FTMA 1P9RA 3RS3A 3K70D 2FSFA 1WA5A 4RD1A 1WCV1 4L16A 1KDOA 3WRXC 4A0RA 4M8NE 1Q3TA 4B71A 4BLQA 2OLJA 1EFHA 3P26A 3EC1A 4Z8XA 3ZS9A 1KOFA 2A3RA 2CLDX 3QVUA 1YZKA 2IS1A 1SVIA 2F1JA 2A9KA 3PVSA 5FTLA 2I3BA 4OBEA 1TUIA 2BMFA 3QXHA 3O8DA 2QUZA 1UBGA 1BS1A 1IXSB 1U2RA 3K09C 3NVAA 4JYBA 4URXR 1O3YA 1IN8A 5FOUA 1F2UB 1JPNA 1DBSA 5JRZA 1MT0A 1VCIA 1Z8FA 3H1TA 4JL8A 1ZIPA 5DH9A 4PO8A 2FFBA 2PH1A 5DISB 1DS6A 1ODFA 4LGMA 4BLSA 3BFXA 1HE1C 2MMCA 5KO2A 3G0HA 5AR1A 3FKSD 2D2FA 3ZYCA 5JWOA 2GA8A 1GWNA 1E1RA 3THYA 4BGDA 1TX4B 3AEZA 4X8HA 3ZDQA 4V0MA 3K8YA 3AKEA 3NXSA 3B2EA 4EFLA 2GCPA 1W4AA 4UQOA 2G77B 4G0NA 2VEDA 4A6PA 2IC5A 5KU1A 1M7HA 4D4JA 3GJ0A 3UK6A 3I5XA 4JKIA 5TB5A 2BJWA 2VP5A 3L0IB 5CYOA 2JCSA 2NO6A 1VCNA 2AK2A 3EZ2A 3U2QA 3AKYA 3CNLA 3AGQA 2ZM5A 2CVFA 3OFND 1ESNA 1E9RA 1HQCA 1K5DA 3IO3A 4NCKA 2CNWD 2AD5A 1XD2B 1L8QA 3HPRA 5GJVC 4P0TA 3BH6A 3U4QB 2O52A 4BLPA 4TZ0A 4BZXA 2JLSA 1OYWA 1XNJA 2JGNA 1JXMA 1HEIA 2ZYUX 5L3RA 3QBTA 1SZPA 1II0A 1NIJA 3DM9B 2HJVA 1G8HA 1TADA 3SFVA 3G82C 1HA3A 1UBEA 3LY5A 4I81A 2ODNA 3AVWA 5JS7A 3R9WA 1OKKD 1JR3D 5C4GB 2I1QA 3VAAA 3GJ3A 3E5HA 1GFIA 5K8TA 4URZR 3K70B 1S2MA 4DLVA 3CRMA 4BFTA 1W48A 1SKYE 3TW8B 2WICA 4DXAA 3WYAA 2VBCA 4Z54A 2BVNA 1H8HD 3C5CA 1DAGA 2VLIA 1KI2A 1KY3A 1RKBA 3RS5A 1UPTA 2QQ0A 4II7A 3I8XA 4BLRA 1ZBDA 1XMSA 3L43A 4TLCA 2GXSA 2A78A 4B33A 3ZJYA 5D3MB 4IDNA 4LOAA 1NKSA 2V9PA 3K1JA 4LUCA 1ZMXA 3EPJA 5FH9A 1LF0A 1NVXQ 2FSIA 4LC0A 2EFHB 4RKFA 1FFHA 3SQWA 1GRRA 2X19A 4KSBA 3BC1A 3RS0A 2WWHA 4PC6A 4LJ7A 1ZAKA 5CB8A 2ANCA 2OFXA 1QG4A 4YQFA 1Z28A 1A2KC 5DHFA 4F4IA 2OCAA 4G5OA 4URUR 2ZUCA 2ANBA 4BFWA 4EJSC 1KKMA 1Q3HA 2BOVA 2G0TA 4MRPA 4YXWD 5H8WA 4QKQA 4IEIA 4OYHA 1M7BA 1OIWA 2GZHA 5HZKA 2RGEA 1XTRA 3QF4B 2VYFA 2YWEA 4AG5A 5KDDA 1KNQA 2Y8EA 3MG9A 2OSBA 3Q8XB 4OQLA 2F55A 1GRNA 3REFA 1YR8A 3MWJA 5L8VA 1TU4A 2G1JA 1X8LA 1QHIA 2CLCX 3J81k 1Q1ZA 1S9HA 4FN5A 4PZYA 2BMDA 4AKEA 4A2QA 1AKYA 2QORA 1JECA 4O2RA 3U7EB 3CRW1 2NO7A 4QGAA 4DEXA 4QC2A 2ZSBA 4UJ3A 5F9FA 2QP3A 2QAGB 3M1IA 2QMUA 3A1UA 2FDCA 3VHLB 2ZI7A 1WDTA 1CKEA 1HURA 2QSZA 4Q4AA 1KI9A 5FL7D 5JECA 5J4LA 3CPJB 4HAYA 3TAUA 1EWQA 2ZYVX 1K5GA 2OG2A 2ZR7A 4Q1DA 2FG5A 4XIGS 4XVUA 2WV9A 2JLUA 4MDEA 3EZFA 3GLFA 4F38A 4EUNA 1XB2A 1YHNA 4NZYA 2ZETA 1NN0A 1FMJA 2WAYA 1NLYA 2BM1A 3TLXA 1G6HA 2PJZA 3LD9A 4KU4A 4TL6A 4C4PA 3BJIC 1CXZA 2P6NA 3SEAA 3LXXA 2EQBA 5E4FA 4EPTA 4CF7A 3FGNA 2JLZA 2DWPA 4OHVA 1JXOA 1CS4C 2HF9A 1NL3A 4URWR 4BUJA 1QHGA 1SXJC 2Q3FA 2R9VA 3GLIE 3LW8A 1WBDA 1Z0AA 2X2FA 2NG1A 2J0QA 2C03A 1KDPA 2X77A 4ESVA 3C7KA 3ZVLA 5TARA 1KO8A 2VHQA 2P5SA 1XMIA 2QU8A 4QL3A 2CBZA 2NOAA 2QY9A 5IRCD 3GJ4A 3NEYA 1GKIA 3BB1A 2W0MA 1LV7A 2F1RA 4AKIA 4GDFA 5FUYA 1C4OA 1DO2A 1YR6A 1JBKA 3IIMA 4I1UA 1DVRA 2JATA 1TEXA 1YQTA 4DDTA 4E22A 4MRNA 3VTKA 5EUMA 2HYIC 4O0MA 3KXIA 1KSFX 4D4LA 2ORIA 2BMJA 3MCAA 2LWIA 3PUVA 4RY2A 2IYRA 4FMBB 4LBZA 4DLSA 4PHGA 2FH5B 1ZM7A 1OFIA 1VG8A 4LJ6A 2XSZA 3CUEF 2OEPA 1HE8B 1G5PA 2ZE8A 2W00A 5AJVB 2GAOA 3B9QA 5CITA 4QBFA 2O8DB 1Q21A 1BMFD 1Z08A 1PUJA 4A2WA 2JLRA 2WPDD 3CRRA 2GZAA 3B1ZA 1AZSC 3SQXA 2O0JA 4LYAA 2O8EB 4Q4HA 5DI3B 2AL7A 4CDGA 1ZM3A 2BM0A 3QEOA 4LV8B 5CJPA 4I1VA 3SYNA 1Z63A 3AVVA 1CJTC 1ZINA 2QI9C 4IXNA 2FNAA 1NKTA 4ARZA 2DWOA 3QKSA 4HI0E 3SJBA 2HLDA 3RHFA 1NMYA 4TSFA 1BKDR 5AJZA 1DOAA 4R2HA 1VHLA 1R8SA 2QMOA 1P9NA 3F3YA 4F4JA 1M1YE 4PX9A 4F4CA 2WMNB 3BS4A 2OCPA 1E2DA 4H1VA 1G19A 3LLUA 1YR9A 2AKYA 2GHIA 3OE7D 3FDIA 4DJTA 1VG1A 2H1LA 3LNCA 4DUGD 1Z0DA 1OLOA 2AX4A 2OILA 3SYLA 2QT1A 2O8BA 2QBYA 1EGAA 5GJBA 4JLMA 2KBFA 1GUAA 1NN1A 1RVDA 3CLVA 4HDCA 3ZQ6A 3VR6A 2Q3MA 3R8CA 2VL7A 3PJRA 1CJMA 1QHXA 3LX5A 5EZ6B 3W9YA 1W2HA 3QXSA 1IJFA 4P3YA 5CDFE 2G0NA 1GNRA 3KKQA 4M1MA 2XNDD 2EWVA 4MUAA 2V3CC 1GNQA 2J41A 1Y63A 1RRPA 4TYNA 4XJXA 3DHWC 1BYIA 3EZ6A 1ZYUA 2EYQA 721PA 1N6KA 2FMXA 4NYMR 3FHCB 5JMTA 4AK9A 3KQHA 3BERA 5KPJA 3SNHA 1HT2E 1AN0A 4B3XA 3TVTA 4JYCA 1UEJA 2LCFA 4ZKEA 2QEQA 2IF2A 2QP4A 3DVLA 1OHHD 1GRQA 1GM5A 1EFUA 2PJRA 1OXTA 3C41J 3FHTA 3B1XA 4DT1A 4QGGA 2GILA 4G5RA 2F9LA 2ZRGA 1SXJD 2O8FA 1GOTA 1FMLA 3TJZA 4PZZA 1MH1A 3GLGE 2W2TA 2XX3A 2D06A 4P4TA 1AS0A 5TXGA 5DSZA 1GIAA 2D7CA 4GP7A 1EFRD 3N2IA 1JNYA 5ELXA 1KTVA 4IW3B 2QSYA 4A0GA 2KWIA 2GKSA 1W7AA 2RGCA 3EZ9A 4RKEA 5FI0B 4F91B 1KI7A 4PFSA 4TWZA 5KSYA 4KCGA 4EIWA 1E2LA 3B13B 3I62A 1BOFA 1JQJC 2ERXA 2IUSA 3E70C 4L9SA 4EJSB 4P4SA 3RS2A 2W0SA 1VYUA 2V4ZA 4ASUD 4MYUA 3AB3A 3DOEA 1A5TA 1DPFA 1VDZA 5G53C 3U44B 4MDFA 1E0AA 3RABA 5BYJA 3B6EA 4N3NA 3B8HA 1DAKA 1CIPA 4LX0A 1M8PA 3TVDA 1UKVY 5B30A 1E2PA 4HB2A 4B6FA 1KAOA 1SVLA 1U9IC 1W0JD 2AXPA 1RW4A 1TF5A 2XZPA 4TLDA 1JB1A 2CCGA 2VTKA 1P6XA 5EP3A 4QG7A 1ZIOA 2HXSA 5SZKB 3QG1A 4K46A 4B6EA 3LLMA 1N0VC 2JJ1D 2GCOB 2V6JA 5SZHB 1COWA 2G1KA 1CR4A 2RGGA 4PAQA 4N1AA 2PT5A 4Q9HA 5DHAA 4Q1FA 5J4KA 4IOJA 3WHKA 3KFVA 1U99A 5DI9A 2GXQA 4BFUA 3VKHA 1XTIA 3WNDA 1AIPA 3K9NA 1WB9A 2IYWA 2R6DA 1KGDA 5J4HA 1EXMA 3VHXA 3ZGXA 2JJ8A 4TTRA 4HSEA 3DZ8A 2RGBA 4XVRA 1JJ7A 3K0SA 2JDIA 1RYHA 4U02A 2C78A 4V0KA 4DLTA 4OI0A 1U0JA 1AS3A 2NTYC 4OHZA 1CP2A 1N6IA 2YC4C 3AF0A 1GZSA 2DY1A 1PVOA 1SHKA 4J0QA 1VYVA 3UMFA 3X1XA 3QKRA 4HUQB 2YKGA 5DE3A 1SXJB 2FGJA 3QXXA 2IEZA 3SE0A 3OEED 5JHHB 1XMJA 2BHRA 3NTUA 2A2ZA 5FBRB 4EFMA 3GP8A 5KDLA 4V0NA 1N0UA 3AVPA 3CWZA 3WYFA 4AYXA 5F9HA 1US8A 3SZRA 3WNBA 4OKSA 3GEEA 4AKHA 3NH9A 1Z6XA 5IHPA 1P2SA 1ONBA 3EIEA 5C4MA 5JCPA 1FUKA 1AJEA 3OAAA 1XD9A 4ZIRA 3C14C 4LYHA 1XMVA 1OH6A 3R7WB 2VO1A 3KKNA 4CT5A 1ZVQA 5H70A 2B92A 2QQEA 2GVDC 2XTMA 3ZIAD 1GKUB 1EWRA 2FEOA 3R9XA 3U61B 3VMFA 2W6IA 2J0UB 3HDTA 4KVGA 3NG1A 3HR7A 2QT0A 4QOSA 4A2PA 1EG7A 1KMQA 1E2HA 4NONA 4A82A 1QDEA 4Q4JA 1D9XA 2XZOA 4QM7A 2P2LA 3M6AA 1Z6YA 1R0YA 5J40A 2OO7A 2GEDA 3VKGA 4FMCF 2GXUA 1P9WA 1T3LA 5L3QB 5HE9A 2V1XA 3IEVA 4Q4LA 1XEXA 2QROA 4LV6A 3WMFA 3D3QA 1SVSA 1Q20A 2QTFA 4HB4A 1IN5A 2FPLA 1R5BA 4MGYR 4KXFB 4RD6A 4Z1MA 1W47A 3CH4B 4PHFA 4W7SA 1RJ9A 1YRAA 3DPUA 2BMEA 5CM8B 3FFBA 4NCJA 1NN3A 5TY0A 1A4RA 3IO5A 4LRWA 1BYUA 1DELA 2MMGA 3UMRA 1UBFA 4CEHA 3TR5A 1I4LD 1ZUHA 3Q7PA 4GI7A 1GAJA 4B3BA 1ZNXA 2W58A 2WOJA 4AD8A 4EQ6B 3AVYA 3QUSA 5CDFA 2UZIR 4QBIA 4B35A 1TNDA 1XEWY 4LHYA 3QXCA 4M1YA 3IGFA 4W5JA 3I4LA 2XITA 5KOYA 4P32A 4KYUA 5ANRB 3KL4A 2CLSA 2DWQA 1G21E 4RFSA 1Z5ZA 5JLJA 2G83A 1ESMA 2J7KA 3KJEA 1R0WA 2C9YA 2H18A 1ANKA 1NMXA 4IEEA 4BFVA 4FWIB 1NG9A 3EAQA 1OYYA 4DCTA 1T4GA 5G40A 4TQ9A 4JMPA 1RC8A 2ZI9A 3ND9A 4A8JC 4A4DA 1KDTA 1Z83A 3UWKA 1KI3A 1TPZA 2V7QA 1SQ5A 3ZZUA 4UNRA 1NBME 3NC1C 2NPIA 2JEOA 3JVUA 3D6TB 2ERYA 4JIMA 4CEIB 4LJ8A 1UDWA 3NBZC 4NE2A 4TQUS 4Q01A 4OQMA 4C2UA 1YZGA 1WMSA 3CPHA 1E3MA 4IJMA 1N6RA 1YZNA 4Q1BA 5IT5A 4TL7A 1E4YA 5FUXA 2JLVA 5JZVA 3T12A 1KK1A 3OF5A 3VR3A 1JPJA 3VU9B 1LVGA 2VHTA 1NVUQ 3QVVA 1N6OA 4FMDF 5EZ5A 2NPFA 2ZI3A 1AS2A 5FR2A 2XTNA 5EUQB 1KHTA 1G5RA 1P62B 1U8AA 2IT1A 3UIEA 3THYB 1HT1E 4P31A 1Z07A 4L15A 4KSCA 1E94E 1RRFA 3T15A 5G3YA 4DLXA 2QG6A 1QRAA 421PA 4HLCA 4G3XA 4B44A 4JL5A 4ESHA 4M2LA 1EK0A 2WTUA 4GMDA 2CJWA 1GSIA 5DGXA 5EP4A 5G41A 3NBYC 2JLWA 3ONWA 1E6CA 1I2MA 5FOSA 2QA5A 4RSGA 2FA9A 4Q00A 1Z0KA 5J4VA 1E96A 2RB4A 3QNUA 4TTQA 4GP6A 1FNNA 1F6BA 2GBLC 3RNLA 4KLZA 2X2EA 2V55B 3AF2A 3B78A 4NCIA 1FL9A 1UADA 4OQNA 4UNPA 5CM9C 1NSTA 1S8FA 2R62A 1YR7A 5EXSA 2IXEA 5FOWA 2GJ9A 1TQ4A 2P6RA 2ZJ5A 3PEUA 2EWWA 1KK2A 2QMHA 2UZ3A 2CCKA 3B60A 3EC2A 3ZVNA 1OT3A 3DKVA 5HZHA 2QP9X 1E9CA 3ZLJA 2J9RA 1H8EA 1KJWA 5L3SA 2F1IA 2J59A 2WZQA 1S96A 1G7RA 2WKQA 2CCJA 2IS6A 1XTKA 3LX8A 3TGPA 4MKHA 2QNRA 2AK3A 4V0LA 1SULA 3I61A 4CZ2A 1QHHB 1D9ZA 2BDTA 1NVVR 3RSLA 1UBCA 2P3SA 4LV5B 2WHXA 1Z2CA 1G3UA 3A4LA 3AF1A 3C4JA 3B7GA 3NC0C 2JLXA 5B58C 1P3JA 1KDRA 1MKYA 3REGA 2PL3A 4EKDA 3I1FA 3QY0A 4KITB 3T34A 2R8RA 4C0HA 1P73A 3PCRB 1XJ0A 2VA8A 3B1VA 1OV4A 2FSGA 2ODWA 1OXVA 2G3YA 3RYTC 1XPUA 4ZCLA 4C7OA 4FXPA 2HDNB 2IYZA 2XJ4A 3NHAA 2A5YB 4PSKA 3WHLA 1G7TA 4D4MA 2V6IA 4HYYA 4Y0AA 1G4UR 4OK5A 5EXTA 4DC9A 4TMTA 4LPSA 5FUVA 4C9BA 4IVRA 1ZC3A 1JR3E 5GVRA 4XD7A 5LPNA 2E1RA 4KO8A 1T5IA 5EP2A 1ZNYA 1P2VA 2PBRA 2Q3HA 1GDDA 1XTSA 2W2XA 2PEYA 4CIDA 2GTPA 3N70A 2ZSDA 2ZE5A 4F93B 4ABYA 2REXB 3U3MA 3WMGA 3OESA 3OIWA 1RE0A 4DLZA 1S1MA 1DAFA 3CPEA 5EE3A 5C1BA 5IF9A 2XSZD 1FNMA 1MO6A 4JLNA 1TTTA 3GEIA 5F98A 4LYFA 2NIPA 4MRSA 5KSZA 1D2NA 3I92A 2GF9A 4NYIR 3SOPA 2QTHA 4XWKA 1NLFA 4JT2A 1IN6A 1P60A 2RGNA 4O25A 3EPLA 1WF3A 2ATVA 3BORA 1NP6A 1MOZA 4I1SA 2ZRNA 2ZJAA 3DMDA 2WSSA 3IPYA 4EAQA 2J1LA 4YC7A 3U7FB 1P2UA 3EASA 2NQ2C 1OH5A 5BYKA 1JEEA 1G7SA 2IL1A 3QIAA 1F2UA 1E2JA 4Q5IA 1LFDB 3L0PA 2GDJA 3CB4A 3K53A 1Z0FA 1MABB 2OBLA 2NO9A 1U98A 4TSFD 4GPTA 1Z3IX 1XWIA 3BK7A
chains in the Genus database with same CATH superfamily
4UAVA 3WLRA 2VJLA 5HFAA 2BJVA 1TT7A 1CDOA 1EVQA 2DQSA 4RVDA 1H2YA 2H92A 3UAWA 2ZM6B 3MD9A 3ROEA 8MHTA 3GMSA 1ZH2A 5I7RA 1BA3A 3EEQA 1MZVA 3ZV5A 4ZYVA 1GO2A 1LS1A 2IU0A 1ZCFA 4D81A 4M1OA 1TT5B 1PRYA 2YS7A 3DB2A 5TRTA 3IODA 1YNSA 3JQBC 4RD0A 1KK0A 4NU6A 1NATA 4ITVA 4FFDA 4ROTA 1RQ7A 1R00A 1W4RA 4UCQA 1GNTA 1UOPA 3A04A 4PX2A 4X7PA 3AIIA 5JT1A 3VJLA 3FGPA 2OFOA 5TQ0B 3HVRA 2HCJB 4XCVA 1VL6A 5CNMA 4PINA 1CS0A 3RCBA 2LR0A 4Z8YA 3FPLA 5DULA 3WGMA 1GU0A 1ZH0A 4EPYA 3ZU5A 2CMKA 4A0QA 4A9AA 2R44A 3OD5A 4LHZA 1RRKA 1EE1A 1Y6RA 2DT8A 4WK4B 5ARCA 3WGJA 4IILA 1QFZA 2PYZA 3LQ2A 3PD7A 4HL6A 1SXHA 3C6BA 2IFTA 3BD6A 4PPYA 2VNKA 4Q02A 1TTQB 4CMIA 3E0XA 1N8SA 5JJBA 1AMUA 5J58A 1XPRA 5DN6A 2YRWA 5KNLA 4G2NA 3RJMA 4OMUA 1L7XA 1SHJA 1N5RA 4ENTA 3VH2A 3WP1B 4CL2A 5L51A 3VZPA 3CLTC 3H84A 1SOWA 3DYIA 1CEYA 4OHFA 1HYQA 2C7VA 4YJKA 1M1NB 5E9QA 3HP4A 4FS8A 3EVGA 2HH9A 2VRWA 2ZJ8A 3A3NA 1UZLA 2WZCA 1LH0A 3FFTA 2ZUDA 4WOJA 2XVXA 1FU8A 5FUQA 2CT8A 2AFHA 2XXAA 5TT0A 3FTCA 3HYSA 1KO1A 3FWHA 1XVUA 1T0JB 2JGIA 3UPTA 2WA1A 1UFKA 4L5YA 2C99A 3CIFA 2IP4A 3CVWA 5JU6A 3IBYA 4HNTA 1CQPA 2FZWA 1QYVA 1YDFA 2HREA 5DTIA 1PFKA 2YN2A 3NAMA 1UC4B 1W88A 2CK3A 2HBQA 3IILA 3AI7A 3C1TA 3ZE7A 1S01A 3H8JA 3P0FA 5ENZA 4Q21A 2ZROA 4RPIA 2X0DA 3TLJA 5B12A 1D4AA 2CN1A 4L9WA 5K8UA 3H1AA 4OGGA 3L77A 3LUKA 3V00A 4LXGA 4D7AA 1W5FA 3PPIA 3ZOKA 3HA7A 5AM3A 1GNSA 2Q0XA 3KEQA 3WLJA 2FFAA 1PL7A 4OEHA 1E3QA 1QZZA 1FOEB 2MCFA 2C4WA 4RD2A 1P8AA 1J9EA 3I1JA 3IDZA 2R2AA 3Q4GA 1XQYA 1DEHA 1LXCA 3U7QB 2XWSA 1I8TA 4LRQA 4JOSA 4KZPA 3F5FA 4UXIA 4PGMA 1VIAA 3FKSA 3THSA 3JAKA 3RUHA 4OVKA 2E4YA 4B32A 3SXPA 4DVJA 3JQDA 2OBFA 4R69A 1OYVA 2AOWA 4C4YA 1NZJA 3C2QA 4KFTA 1I3CA 4XQGA 4W7IA 3RB8A 1GD1O 2GBIA 4GKAA 4WJZA 3SLKA 5JANA 1Y7LA 2B37A 1UMDA 1PT5A 3CR7A 4M6WA 3FD8A 1UMBA 1W4LA 4DLRA 1OI3A 4E08A 3H17A 1QYRA 2XNJA 5BSHA 3CVUA 4Q7LA 1XLTC 4IGIA 1HDYA 5GONA 3BKWA 4JDUA 4BAUA 4OKIA 3BJRA 2RHHA 4JI7B 3RT1A 3J81A 4DW8A 5KVSA 3ANLA 1N0WA 4QT0A 4WLUA 5FOVA 2OHXA 4ZVLA 1Z4NA 2QUIA 2OKCA 1H94A 1BMTA 1Y8QB 4MWGA 4DPKA 4FCWA 1NZFA 4D0LB 3W8RA 4J0HA 1SC4A 4X9XA 5AW0A 4YLEA 2J3KA 3TRHA 4BVHA 1DKUA 1JQLB 1YZUA 1U28A 1TUBB 1Z88A 3WYDA 2X5KO 3INYA 3ZI0A 3M4ZA 4S1TA 1ADFA 4DGQA 5DHUA 1C30B 5C5DA 2HA7A 4XPZA 3UHOA 2AMJA 3K8ZA 4LJKA 4Z51A 3LLVA 3VNVA 4ND3A 3T9DA 1IOVA 2PT6A 3CR8A 1P5HA 3FWYA 4OHWA 5FPSA 1VG0B 1T3SA 3KYCA 1O89A 4BEJA 3H9GA 1W5EA 3CS3A 3M70A 1Y3DE 5AKKA 3V8MA 4P08A 3WHPA 3ZWBA 1NJGA 2R68A 3B53X 1LW7A 3NHLA 2A4KA 4RH0A 5HBGA 1IUNA 4C4XA 1EJ6A 1XOIA 3ZV4A 4GI3A 1E2IA 3FRJA 4GU5A 1GRCA 4OQXA 4Q9IA 4X8LA 4KN6A 2ZUSA 4B2PA 5FUMA 4UATA 3L7JA 1N2HA 1H8HA 3OD1A 4U7TB 4PICA 4TYQA 3P96A 3TXYA 3V8RA 4DNPA 4ZCIA 1ORRA 4E4RA 5F52A 5FWXB 3KLNA 1H5QA 1JUDA 1T4CB 4DV3B 3N28A 3PFGA 2OHVA 4RSMA 4REQA 4EY4A 1KZ4A 5BWOA 3K8OE 3L6UA 4LZWA 3AJAA 1RT9A 1IY1A 4QPDA 4GP9A 3S6JA 3WZ2A 1C9KA 5EJ5A 2C2BA 4RK1A 4G84A 4HXFB 4M3NA 5FPHA 3L7NA 3K4HA 4D8YA 4YMUA 1E8MA 5MN5A 2Z2ZA 3J80A 3EG5A 3F5QA 4I2VA 2C3YA 2TMYA 4KXVA 3CNNA 2LW7A 1RFGE 2NU7B 2HFKA 1C41A 2HA3A 3G59A 2QUAA 1ZCZA 2H16A 1ODIA 3GGDA 4DAEA 1E3MA 1XDZA 4E1BA 4KODA 2J67A 4KG7A 3KB1A 5INTA 1SZCA 1PDOA 4QHTA 1E2MA 1X3LA 3E7FA 1MGOA 3RSCA 3F73A 3CLTD 1IQPA 2JLVA 2AMVA 3V9PA 2UUCB 2F8TA 1EFCA 5AXDA 1XQ9A 1W2WB 1SXJE 3EW9A 1RKUA 1YK0A 2HX1A 2J3LA 3MCUA 1YCFA 3D6AA 3D31A 4YJ2B 2WJGA 1URPA 2I2FA 4P5EA 3C43A 3NRJA 3U17A 621PA 1PR9A 4M4SA 5K1ZA 4B2YA 4RJTA 2ZQZA 4IX1A 4BP1A 3AHFA 2YOHA 2H2AA 4FFVA 4NY1A 1CIVA 3T3IA 2VK2A 1JG3A 3UVEA 3A9SA 2WSBA 1WY5A 3NFRA 4L8YA 4YWHA 4QU5A 3WYBA 5JQGB 4BMCA 4JC0A 3QA9A 4HG2A 1L6IA 1T9AA 2QN6A 2WJZB 3A14A 3QPDA 4L95C 4NECA 5CXUA 1DG9A 2GN8A 2I2BA 5DOVA 2E49A 2O8DA 1LGYA 3DE7X 4FJ2A 2EBUA 2WFLB 3QH4A 4RK6A 3VSEA 2Q4TA 2M1ZA 1QQ7A 5ALMA 3IBCA 2OPHA 1YIOA 4R6XA 1THTA 2B69A 3MINB 3EXIB 4DA0A 3TIIA 1MJNA 1ACLA 3EG9B 2XWPA 3PXBA 4TV9B 4V0SA 3ZW8A 4DA7A 3O8RA 2O8EA 3CRZA 4YRPA 1A2BA 1YRWA 2ZW9A 5MN4A 3C24A 2PX8A 3TTSA 1OX4B 4UNNA 4XIJA 3U16A 1THGA 5JS8A 3KOZA 5BT8A 3A9RA 5FBVB 1P1KA 4EVRA 1F7UA 4FYXA 1QCDA 5L4LA 4GUAA 2Q27A 3TINA 2BEJA 4PX5A 3WKEA 4DB2A 4AY2A 2OZEA 2Q3BA 3RM3A 4BEWA 4DR5B 1CIJA 3PXXA 4OU5A 1T1JA 4S1PA 1K5PA 1NSFA 5HW0A 2GN6A 2L69A 3DNFA 3N8IA 4NICA 1EWYA 3LF1A 3OU2A 4Q9JA 1U8UA 1I6KA 2ASEA 5H59A 3FUXA 3WB2A 2OHHA 1G0OA 2VQDA 3QY9A 4O4IF 4QEDA 1MJHA 3N2NA 4UBNA 4TWJA 4MS1A 2ZWPA 4YMSA 4H15A 3KYDA 2LKDA 1OOEA 3MZ0A 3VDRA 1IWOA 2GRUA 2VJDA 4Y9SA 4EATA 4EL5A 5M5BA 2G76A 3BVPA 1JF8A 4JR1A 3SS7X 3Q9LA 1DI0A 4KQEA 5D8DA 3KC2A 3MK31 4LVNA 4NFSA 3PQ4A 3TKAA 4CUKA 4YV7A 4CIAA 4O59O 1YS4A 4DSOA 1MRSA 3GNSA 2H8GA 4B80A 5EZQA 3N5KA 1TU3A 2FUCA 5A05A 2ODAA 1U0LA 2FDXA 3JASA 4C4ZA 1OIXA 4AWAA 2CUZA 2PSJA 3L04A 4K6GA 4RTSA 5E7JA 1OFTA 4IMIB 3UB3A 3RRYA 2QIPA 3MGKA 4ZCRA 4HQKA 4ZYUA 5GJWC 2GEFA 4F5ZA 1R74A 4RPJA 3SI7A 1G7CA 1FUUA 4XVCA 3QNWA 4QODA 1M7GA 4F7DA 3AEQA 5DFAA 4KJXA 4B4WA 3ZEIA 4C5AA 2PLWA 2Y0CA 4YDHB 3K5HA 2Q5IA 2LDXA 5EKUA 3D43A 2GFHA 1XXHB 4QFBA 4HNVA 4YPFA 2I1LA 4MVYA 1JFLA 2ZU0C 4S3MA 3H6KA 1YQXA 5E9JA 3UFBA 1RWXA 2D0IA 4YT5A 4TZ6A 3VOAA 1S7GA 2DTXA 2P0EA 2QLFA 1UZUA 1F5SA 3D3EA 1QG2A 3GQVA 4K9PA 4TMVA 1K27A 2C2OA 2GPBA 4L5AA 2NGRA 4TTPA 2Q5CA 1K8QA 3VISA 4H1TA 1QYCA 4KP7A 2QRJA 4HADA 3R8XA 1BMFA 2QRKA 3G0IA 3T1YB 2G71A 2QM7A 3FMOB 5K8CA 2GVZC 2N9UA 5L9AA 3BWBA 4HDRB 3LS2A 4DLYA 3PGKA 2HIMA 3MHPA 1KY5A 5I7SA 5CD1A 1C4XA 3AY3A 4LDNA 4HB0A 3HL0A 5E8RA 5KOHB 1U0GA 2J0VA 2CFIA 3OZFA 3G2JA 1Y7PA 3OM1A 1M74A 2ETVA 5BSVA 3HY4A 1TMKA 4PLWA 2PE5A 3N0XA 3B52X 1V8BA 2JJMA 4GVXA 2JFXA 1EK2A 2H06A 4CCWA 3VDXA 3L0OA 1A9XB 4Y6PA 3U60B 4B48A 1UXIA 2CEAA 3VNRA 3EW7A 4LZPA 3QEBZ 1JAIA 3VPFA 3U44A 1HBJA 3FE2A 3MT9A 3ABZA 4OOEA 5JPCA 4GPBA 3WIDA 4D3XA 4V0QA 5JAOA 3G5MA 5TEWA 3I4CA 1DWPA 5ES3A 3QOYA 3LC1O 3RQSA 4E11A 2VQSA 1RAHA 3LBFA 4B74A 1VM6A 1IFXA 4JI3B 2R11A 1D2CA 1HFWA 4PFKA 4OHMA 4M21A 3AKCA 4IHJA 2CV0A 7YASA 4ZI7B 1CEXA 1H5UA 5ARDA 2B1JA 2GHTA 4R8LA 5IW8A 1E1RD 5A9SB 5I3CA 5JI3E 5K6TA 4X65B 3IDOA 2BGWA 2IOFK 3WGTA 1I4OA 3QNMA 4MH0R 3WBBA 4Z53A 4OBBA 2OXTA 3DDSA 1QANA 2SNIE 1DKOA 1Q2XA 2BEUB 1UAYA 2QJOA 3HVJA 4K0RA 5LA6A 3DEIA 4IDOA 2R5NA 1FFBA 2O2DA 1EGMB 3TF5A 2H9AA 2G1UA 2IDMA 2XNDA 2WKSA 5DLEA 1IBKB 5MF6A 5A2QA 1XQVA 3ZCVA 2EIXA 2C9ZA 4YAUA 1JEAA 1J70A 3UJ3X 2HQSA 4P35A 1CNMA 3G9UA 5EUBA 3HR8A 3MIIA 4XD7D 3URKA 1RYEA 1JG7A 1U2ZA 3G7SA 4JQCA 4UXJA 3I9V1 3TTXA 4RL6A 3QHAA 3E0QA 3UAGA 4JP5A 1AKNA 1RACA 1X42A 3C6XA 5T4HA 5A0TA 3P19A 1FVXA 1AKVA 1E6UA 2PUWA 2PZJA 4ZDIA 5BSFA 2XXBA 2AI3A 3RUPA 1Q17A 1XCJA 4X8OA 2JHGA 3OEHA 3CF4G 4OI4A 2Y4NA 2HRBA 4R1MA 1SG9A 4F4DA 1H5NA 1D8TA 4B3RB 2QPTA 3P0RA 1LVHA 3CWQA 4KXNA 2XNSA 1JR2A 4NPHA 3M6UA 2OCYC 4PG6A 4X7MA 4DJJA 1MZPA 2G9ZA 4NHEA 1MA0A 4RXMA 2QTBA 1JAHA 1O7JA 4L73A 1UK6A 4DXHA 2BFCA 1FYVA 1Z12A 1A04A 1X7YA 1NW5A 3IRUA 4XM2A 1NX6A 1TJYA 3TAHA 2AIRA 3DL0A 3KVRA 4F4FA 4EMTA 4MVXA 8AT1A 4LHXA 3V8VA 4D25A 3N2ZB 1Y9DA 3JCZA 4HLDA 1RS0A 2BKAA 4EEKA 2BLLA 3H99A 1G2OA 2WSSD 3OOJA 4Z7JA 2GETA 2LP4Y 2YWDA 4OY3A 4R3UC 3VNBA 5FLEX 4QHSA 3GK3A 3R7WA 3H83A 4YT8A 2YHSA 5KMGB 3NKVA 2FZ4A 1I0LA 4UNIA 2NU8B 3SYMA 3WGHA 4BWYA 4W6ZA 2PTGA 5ALNA 2XECA 1N77A 4AKGA 4PXSA 5IASA 3L46A 5EJEA 4X66B 3RVRA 1KBZA 2IYAA 4G4SP 3IMCA 4Y9UA 3SKVA 4ND2A 4AN0A 2W8BA 3QVOA 4ZOEA 5JLAA 2WM3A 3E5MA 4NL4H 1IG3A 2P1ZA 1YNOA 4IGKA 4DRXB 4O3MA 5JMWA 2CFCA 2LTAA 3QYAA 4MXDA 1OWNA 1S5PA 3RNOA 1DEAA 1LNZA 1KKLA 2BJHA 2HMSA 1B8VA 3GAFA 1EX7A 1WMDA 4QGHA 4ALIA 3GA0A 2UVPB 3LYAA 4FEAA 3VDMA 1QCYA 5LIPA 5EIOA 1H1LB 2A58A 3FVVA 4I9UA 2IELA 5DU2A 2AD1A 4ZYLA 3ZWPA 1E2BA 5LQUA 2H4ZA 2DLCX 4B3CA 2LD4A 2WAXA 5LQKA 3HG7A 3ZWDA 3PEYA 2BRUA 1XE3A 2C5SA 2ZJYA 1T13A 4OM8A 4ZQHA 4BXOA 2IS4A 4GEKA 3SVZA 3EBLA 4M53A 2PJDA 1YRHA 3IMFA 1EB9A 2Y05A 3R7DA 2DM6A 3QEMB 2Q46A 1Z8NA 4TTVA 4XCXA 4CXMA 1N75A 1EESA 2WJJA 3JATA 2YHAA 4TWAA 4BNXA 1YZTA 2C7PA 1SCBA 5CA0A 1CF4A 1XX6A 2IPNA 4JI8B 1NVKA 2IZ6A 4X95A 4CTNA 1RR6A 4PHCA 5BQOA 5LLDA 3ZZNA 4EQ6A 1M1ZA 3DJYA 3AI3A 3GLFE 4OMDA 3D6FA 2DHEA 2WV7A 2OWDA 2HRRA 4GBED 1RIIA 3VR2A 4FI3F 3P20A 3QOFA 5DN6D 4MYTA 4EPRA 3Q11A 2OCIA 3LBYA 3FUTA 2LKCA 2XDWA 3V1UA 3QE0A 3VVCA 2WF9A 1U65A 4U0JA 3M1LA 3PEWA 1I3OA 5CH5A 2IXAA 3LZDA 4GFDA 1LPBB 2PMCA 4BVAA 4D0NA 3WWOA 3HUEA 4MMYB 2HT6A 1AGNA 5BPHA 4RANA 3DZBA 3BA6A 3BFVA 1O8BA 1W0KA 1GT6A 3C45A 1EVZA 2ZR0A 4J75A 4K03A 4MQBA 4Q03A 3W6PA 1QH0A 3AUUA 5ALPA 5JAIA 5CYGA 2PFGA 3E1GA 2P9EA 4AJLA 2PQMA 1Y3CE 3C97A 3IEMA 2A14A 2HBRA 2CK3D 3LWZA 4ND7A 3WNCA 3SLRA 3HMQA 2PS1A 2MYNA 2IGTA 2W90A 4KVAA 1TRHA 3EIHA 3A25A 1NULA 1X0VA 3DPIA 2IWRA 3IAFA 2ECQA 1F5NA 2YWBA 3EARA 3AFIA 3SHOA 3G0HA 3AY6A 1DJNA 3QI2A 3UM9A 1POWA 5I6DA 4HB3A 4D3YA 1VI2A 2FMFA 4DIBA 1PYOA 1ECLA 3IHLA 1KVRA 2ZSJA 1PO7A 4OLJA 5ALIA 3WQRA 3B3GA 4L57A 4TS3A 5K8JB 1J2JA 5DYGA 3DEYX 3JYQA 3FN4A 3AESB 5LLSA 2O8CB 3GLHB 4J90A 1VKHA 3M82A 3PJFA 4J16A 2GK3A 3EFOB 2EZUA 4D9EA 2WVHA 3U6KA 1M2OB 1K86A 3HDQA 2WUWE 2C5BA 4XTCS 2E4VA 3ML1A 3BE8A 2KQUA 1N7HA 4JLDA 3KTAB 4WI1A 4XX0A 2ZTMA 4JH0A 4XPIA 1UT8A 3U7RA 3R7AA 4DNFA 1GV0A 2GN0A 4RD3A 1R0XA 1SNYA 1SPBS 3FMPB 3FIUA 3BGWA 4G9GA 5JAPA 4EWLA 2J0SA 4OREX 3U4MA 3OQBA 3DC7A 5LOVF 2W2KA 1XFDA 3TQIA 4G97A 1XL1A 4P84A 5A7GA 3TD9A 4CHGA 3X1YA 2WJIA 3W5BA 2FFJA 3V2UA 2A5JA 3RWMB 5JARA 2GJSA 4WXPA 3UHAA 1YAHA 2GESA 2IU6A 4XSGA 4Q7QA 1KQ3A 4RZXA 1U9IA 3JVEA 3PHBE 3LVRE 1KI4A 3HKCA 4S2EA 2NN3C 4QDXA 4S2UA 2UZ1B 3DWEX 1KJZA 3UHFA 3TW0A 3NCTA 4X62B 1L5HB 2XUKA 3PA8A 1EK6A 1M5TA 2ZSUA 3TCXB 4F46A 1II9A 3Q3CA 3ISTA 1SRRA 2HHAA 3QLVA 4Q4AB 3FVQA 4QGBA 2W2MA 4N0DA 3U48A 4OQQA 5LM3A 3LI2A 3KHSA 3IVGA 4XRGA 1UEIA 5GTDA 2RKWA 2AZ4A 2LZ0A 1W5TA 5D00A 3D8TA 1X19A 3JR3A 1MHTA 1YU9A 4QBGB 4LZAA 2GZ1A 3U3XA 1E5QA 1JHAA 1T0BA 1B8PA 2WUGA 5H68A 4MUBA 1EM8B 2JK1A 4AJ4A 3T35A 1IBMB 4M8KA 1F51E 2PZ8A 2VWGA 4BNMA 3FCUB 5HDQA 1A72A 1BVYF 2QW1A 2FFHA 4CKWA 3F6YA 1HFKA 1G16A 2YH2A 4IDDA 5IJXA 1XVTA 1U8YA 2O23A 3IBGA 4MGKR 1V5WA 1FRNA 2Y0BA 3Q8WA 1RWWA 5EJ2A 1EQAA 5LB4A 1YULA 3GGJA 4TYWA 4QUDA 4FZ5A 4R84A 5BW5A 2CNDA 2GEVA 3R9IA 2VP9A 3HUUA 4CJXA 2WINI 3B9PA 1ATIA 4IKEA 2HJGA 2PCLA 3ZV7A 3GDOA 2CNNA 2FPIB 2HA5A 2OENG 4UTZA 2JFUA 2I66A 2RI1A 2YXDA 4RELA 5CMLA 1DO0A 2CNKA 4I1OA 5F2KA 4FFMA 3RBAA 2NPOA 4ZDWA 1N2CE 4AMUA 3DFFA 4GL2A 2AN4A 2DC1A 1X1QA 1Z13A 2H1VA 5IARA 5CCBA 1YFZA 1WO8A 3QW4B 3AF4A 4NBUA 3EMVA 4XB1A 1Q1NA 3E2MA 3DD5A 1J8YF 1AKEA 1XP5A 3NEJA 4JJZA 5EP1A 3VOSA 3OCYA 3TOSA 2HHJA 2R751 4RM3A 3ZGZA 1JDBC 2VXYA 3T1QA 1U0EA 4UVDA 4BVGA 4EY8A 2WG1A 4FDAA 4CN8A 3MGAA 4E46A 2NU6A 4MYHA 4KE7A 1JHDA 5F2EA 4D8UA 3FPBA 4PYNA 2CJXA 2VNIA 4N5LA 2BZSA 3ZD6A 3F3MA 4QEKA 4LSGA 2Z6VA 4HAUA 3BQ9A 1NI4A 4AUNA 3TUZC 2D2IA 3KVOA 4RZHA 4YP9A 3TTVA 2O54A 1DAIA 3CEJA 5AI6A 4ZV7A 5IDQA 4Z0NA 1WZCA 5JRJA 4V39A 4N3BA 3S40A 3QLEA 3RU7A 1WUKS 3I9NA 2GM4A 1Y8RA 1RLUA 5BWLA 1UJ5A 2JASA 4LJLA 3UUFA 4KSYA 3F9IA 4P0PB 4KQCA 1R5NA 3KQTA 3U4IA 3V4VB 1S4QA 2NSHA 3GUVA 4BATA 3KR0A 1S02A 1Q7RA 2B78A 3FF1A 3GXBA 5HBRA 1ISMA 3RVBA 4CF3A 2V65A 1KJJA 1SKBA 3QKSB 2VA9A 5F2NA 2ZPAA 4C14A 1TM3E 4O6VA 1HRKA 1WQ1R 3NETA 1CJKC 4Q66C 4QU8A 3ZBUA 3VPCA 1DIAA 5IDVA 3T4UA 4CDMA 4Q3EA 5TV2A 2Q4EA 3UC9A 1Y8AA 1WXWA 2FPOA 1R10A 2QI9F 3IT0A 1IM5A 4IFIA 4NCIA 1O6CA 3WK7A 1GUBA 1X94A 3CSSA 3BIXA 3HNPA 2K5UA 4H6XA 3CX6A 4FYHA 2ZDHA 4KX3A 3UBTA 2QXUA 2R65A 3N8NA 3BH7A 1UR5A 5C5IA 4GXNA 5JSFA 3DOHA 4BEVA 1C3LA 4LI0A 4B34A 3DA8A 1ND6A 1CQIB 3OT5A 4OHXA 4PLTA 3AW8A 1ISRA 3DEKA 4Y3UA 3QF4A 1CUUA 1GGHA 1XRQA 3CSDA 5HCIA 3KKMA 1L3IA 1JLHA 5DW0A 5TQ0A 2BR3A 2AWOA 4LCEA 3SG0A 2REBA 1UBHS 5DNEA 2OMEA 3T4XA 1RYZA 2WWVD 3HPQA 3OQNA 2AGVA 2AJCA 4R9UC 1Y1RA 2PUJA 2HSEA 3PWKA 4YFYA 3T3EA 4G2TA 3VYVA 1FDIA 4R8VA 1INLA 3H0CA 4BGEA 2PA3A 5BSRA 3OLCX 3UOAB 4AY5A 1FS4A 2GEJA 3P9SA 3IEUA 4G5SA 1J1ZA 3H4TA 5IBCA 3T3MB 1JSLA 2OXRA 1MORA 3UATA 3Q15C 4G0OA 4UVEA 1YA4A 2H54A 4WL0A 3P2OA 1SKAA 4ZEVA 2OYCA 1UIRA 3A7EA 3Q8LA 2C7RA 2AXNA 2XMRA 1JWBB 3H8VA 4JVOA 5CEJA 4BX2A 2H65A 2FZKA 3ORRA 3CUSA 3QKTA 1SZJG 4J7AA 4QBTA 5A04A 1AUOA 3GN2A 3I6MA 4K1XA 4NCBA 1E89A 4UOEA 1M1NA 1QYXA 1SIWA 2CB9A 3ECAA 1ZD1A 4MKIA 3FR8A 2EG9A 1P75A 4AJKA 2AJTA 4KKVA 3KQKA 4N47A 2Q1TA 3WQSB 4G1VA 2P5YA 4AO8A 4CT0A 3OE5A 2FEXA 2ECKA 4XR9A 4CM9A 1ADYA 3T9CA 1OFUA 1XEFA 1QF9A 1DBIA 4PSVA 3TX6A 1IN7A 2XB4A 3TNFA 3ZQ4A 4FW9A 3QPBA 4KTTE 4V03A 1KTIA 4ICIA 4JP2A 1Q7TA 2PKWA 1FTSA 2BRUC 4YRNA 1NQAO 1UM9B 4FTWA 4GS5A 4EG1A 2I3AA 4RHXA 5AVJA 2CVOA 1OSNA 4W1RA 1PYDA 4AX8A 5GZ3A 5EE9A 4O02B 4QQKA 2XXJA 4ZVVA 3ADOA 3RTGA 1TTHA 3SSOA 2Y77A 2GGSA 4HDSB 2O3TA 1LF5A 4GUDA 3I2IA 1JSZA 1FJXA 1AK2A 1FZQA 3EXG1 4OL0A 1LNQA 1RJEA 4LG1A 3U7QA 3UAXA 5ALVA 1NT4A 4P3OA 4G8BA 1YDMA 2PZFA 1MGPA 2H5IA 3EWSA 2GZSA 4KK4A 4IIVA 2VDMB 3DFUA 2R8PA 2IUUA 1KXZA 4EHBA 4F92B 5K6AA 3BL6A 1PVDA 2O8VA 3C7DB 2EDAA 4G4SO 4EKEA 2ZRAA 3G2IA 1KL7A 3O26A 5GOTA 4DMRA 1G8GA 2I7XA 2CHGA 2GBLA 2IDKA 2OCXA 3SJUA 3SYRA 2O50A 5AUNB 3VQTA 2PXCA 3OTOB 1BHJA 3UAOA 5HMLA 1ST2A 3ZE9A 2K87A 1YMQA 1EZ1A 1WR8A 3KE9A 4AB1A 4MQEB 2E6KA 2A6PA 5UKDA 4AT1A 4CKBA 2RBEA 3PVCA 3LUFA 5I8PA 3ON5A 2VRCA 2WIBA 4IINA 2R6ZA 4AMZA 2R00A 2Z1DA 4I3GA 4YJFA 1R64A 4EG6A 3K8QA 1Y8QA 3G2KA 1O87A 2AZMA 3SEZA 1TAQA 1II8B 1ZI6A 2E21A 2FZ5A 1LI4A 4US1R 3MMPA 5FTJA 3TQRA 3WIBA 4QHYA 3RGGA 1VIMA 4XWOA 3GJQA 2Q9CA 5H02A 3TUJC 1TUBA 2VHUA 2VS1A 1R15A 2BCEA 2ZTLA 4J2HA 2X4GA 3GT4A 2PZGA 5AJWA 1G8MA 1Y48E 2PMKA 4QVIA 3VHXB 4W8GA 1C30A 4QJ5A 4PC2A 3WK5A 3IMGA 3F8WA 1KI1A 1H6CA 2A9QA 3LKZA 2FN8A 3SR0A 5KDOA 3BAFA 4FK8A 1ACJA 3VA7A 5F5LA 2NXCA 4H3HB 5BY2A 1PD1A 2Q3LA 2FSSA 2Q1XA 4N7BA 4EKNB 4NZPA 3ER8A 1UQTA 3OQ6A 4AJOA 3HACA 2WIKA 5B1YA 2YASA 3FYSA 4IH1A 2ZK7A 1V5GA 4E5UA 3QG5A 2BSQA 2FUEA 4M1KA 4E2ZA 3RAPR 3OEHD 4C4SA 2IIBA 3BRWA 3A4IA 1H2EA 1XYVA 4E14A 3H1PA 2QDKA 3MBIA 1H23A 2ZYGA 3M8KA 2WR8A 3UHJA 3PQCA 2OUKA 3NOXA 4LCBA 5F9MA 2BFBA 1HZZC 3Q85A 5FWXA 4JVSB 4NATA 2BC9A 3RYHA 1T4CA 5FNVF 3RADC 3DV2A 1DEXA 3WLTA 3CKLA 4IFTA 3PEFA 4UAJA 1DWQA 2BR5A 3NRCA 2Q2WA 2WKRA 4J0IA 4WY8A 5A3SA 4CIVA 4CKYA 1ZD3A 4JJ4A 1B8UA 1NXVA 2PAFA 4DF3A 4YTEA 3C3EA 2X2PA 1SU8A 3BXZA 2ZAOA 2GO1A 3AHJA 3RVSA 1PTJA 4RCYA 3F7TA 4JT4A 4CNQA 4LYGA 4JEHA 3I9JA 1VIDA 4X6XA 3SHWA 1A9RA 3F98A 1DTEA 4JBYA 1RAFA 3VZBA 1J8QA 1AGRA 5EHIA 5AOBA 2CXPA 5FX2A 4OKNA 3TLGB 2B8JA 4EJ2A 1H4QA 2Z9BA 1JDPA 821PA 5HOQA 3LOQA 1IHYA 1X86B 3TZLA 5K8IA 4YJ2A 5HTOA 5F3DA 4G4JA 3B1WA 4FEYA 1KMHB 3U3OA 5LQAA 3DE6X 1QBKC 2A1UB 4WXRA 3ZIUA 1Y7TA 2YS6A 1TJ4A 3VYWA 3FNBA 4NFLA 4KWEA 2VYVA 4I5DA 2C84A 2C4MA 2WI8A 3RYIA 1ZJJA 3AKZA 5EIFA 4XJTA 4D8VA 1F2TB 3MA0A 4DQVA 1T5HX 2QZJA 1O0SA 1I2BA 1LPAB 5JQGA 5F3WB 1PR5A 3AVTA 2P4SA 4JKYA 4EUKA 3P9ZA 2O2CA 2D00A 1B0AA 2NADA 3PQ7A 3VKUA 2P11A 4F45A 4CETA 2FUG6 3ITEA 1G5IA 1JMYA 4MDYA 5FWDA 1T4DA 1YDGA 2PWAA 4PQFA 5FYDA 3ZHUA 5HUJA 3NHWA 5LQNA 2QKYA 4D96A 3C6QA 3HCWA 5DEIA 4H7KA 2FSPA 3MINA 4RA6A 4BU0A 5CDUA 2HHCA 1PQWA 2ARKA 5IFKA 4TV9A 5HF5A 5JD5A 4RTPA 3GJSA 4KRFA 3EQZA 3CH7A 1H22A 3KFXA 2OGUA 2YZ2A 5G4LA 2QW8A 3KX2A 1OX4A 3FWKA 4IIJB 2E4XA 3HN7A 3WL4A 4M1WA 4KBYA 4WRRA 4LOHA 1ADCA 1BKSB 1VZ2A 2AV6A 3D4LA 3VR2D 2DB3A 4RZIA 4EJ6A 2EFDB 3D8BA 1Z7EA 2C9OA 3B5JA 1TK9A 1XN4A 3AIMA 4KLAA 5AI0A 1IM2A 5I4BA 2DETA 4CEJB 3M0EA 4JBHA 1X1SA 3BFJA 1B4DA 5HE8A 1LVUA 4WA7A 1YB7A 1L1QA 1FTNA 4RFSB 2EX0A 4UEOA 5I9MA 3UK7A 3LL4A 2IHJA 1T9HA 1XMQB 1D6JA 4DZZA 1BMQA 3IERA 4QOHA 4L5BA 2R4UA 1W0KD 4P5DA 1PFVA 3VSDA 5JO0A 4TTJA 1NLZA 3EMBA 3RSSA 5EE0A 3QK7A 1O96A 2QVYX 4RYDA 4XJVA 1HDGO 4ZVNA 1H0KA 2Z5VA 4F0JA 4RU1A 2VP4A 4S1NA 3WP0A 5LMCA 1GPKA 4QRDA 3IMEA 5AW7A 1G3MA 2AH5A 1F06A 1G3RA 1AB5A 4TV8F 1QP8A 3EXAA 1XPOA 221PA 4K9SA 2EJVA 3FY4A 1T9ZA 3IPRA 1W19A 2VQ6A 1NBIA 3Q7RA 3K70C 1OH8A 3PQ2A 4TUYB 4G8CA 1XRPA 1NY5A 2R6AA 4PNZA 1TKBA 5I5EA 4Q16A 1N78A 5IABA 3H2BA 4C78A 4BJHB 3OZXA 4KAXA 3OCWA 3HJBA 1QMGA 1UOQA 4I9GA 4I50B 2Q99A 1CEEA 1VCHA 5AK0A 4D9KA 2V7XA 5AW4A 2EJCA 1Q83A 1XZGA 4RVNA 1QIHA 1DLIA 3T7JA 3HO8A 2FZVA 3BTSA 4X71A 2ZEJA 1IULA 3HB1A 3QVKA 4WDRA 2FN7A 3AUFA 2PSEA 3QYJA 1T8TA 3IQXA 3A4NA 2HLPA 4Y67A 5D6OA 3WIEA 1CY0A 2H00A 2PPVA 3OMXA 2M9MA 1N2ZA 1UL1X 3SVTA 5JJIA 1XXHA 4GOXA 1CHNA 3K7EA 1DB3A 1M33A 2HJWA 1SY7A 1UBRS 3G88A 2Z3ZA 3I3SR 1Y6GA 4KYIB 5SYAA 5EJGA 3ZLVA 2B1GA 4TOIA 3GUZA 4IG9A 1U63A 3OHMA 2BEWB 3AF5A 1W36B 2W93A 4E5PA 3UKJA 3W9SA 3ZXSA 1D04A 2ZT7A 1G9XA 2XNHA 2FW0A 3QPWA 4HDRA 2VVTA 3K9WA 3VPSA 3GZNB 4PN3A 2BTQA 4P93A 3V1MA 4FU0A 4BNGA 9ABPA 4ZOQI 2QU7A 2MTBA 5KNCH 4UZSA 4FDMA 2HMYB 3OVMA 1GPDG 1P17A 3EB9A 4QPZA 3F74A 2VT7A 3LWBA 5JTUA 4K81B 1SGWA 1A9XA 4JXXA 5J47A 4ITRC 2WT9A 1U0HC 3IUMA 4MNTA 1W29A 1KQGA 1B0ZA 1KEUA 2CE7A 2FLKA 2MIIA 4ID9A 4LC1A 2GUGA 3DOFA 3DDWA 3IRVA 3PC2A 4MARA 3PC3A 1RXYA 5ALKA 5P21A 3W5IA 2HT1A 1B6RA 3W7BA 4D5GA 5GIPE 3P2MA 4MW2A 3W9UA 1L8OA 1WSBA 5ALRA 1D4OA 1F2VA 4CTKA 4F6RB 4I4TA 2FP4B 5BR1A 1P8JA 4ZI7A 4NDNE 3O2SB 4HN4B 3IAAA 1W35A 5A9SA 1SVNA 1V0JA 3I2HA 4DCNA 1CUVA 2J3MA 2C8VA 4IQ8A 4G5QA 4YBRA 1EZZA 3NWEA 3DWIA 1CG6A 1NPTO 1Y8CA 3F8TA 4C04A 1I32A 4PC7A 3L8ZA 4EHHA 4JBNA 4OJNA 3S2ZA 1H2BA 3RHTA 1NWCA 1EA5A 4Z4CA 2WNSA 2YNMC 4P36A 1KU0A 5K0NA 3DKKA 4OSEA 4HDAA 3P1JA 4QGFA 5LXTB 2ZPTX 1BWSA 2EATA 4C0AC 1OV6A 3BXEA 1F1JA 4C7OB 1FNSA 5ADUS 2JIZD 4Y2XA 3SIXA 4E21A 4R8KA 4L9AA 3H0EA 5HKLA 2DFKB 4AJEA 4DV5B 2IOQA 3V1YA 3FPAA 1U94A 2VKQA 4JUCA 1J9ZA 1MG5A 1FTWA 2YWCA 4JL6A 3N05A 4CDRA 1X6VA 5EJMA 2ZJBA 4ZJYA 3GRUA 4J03A 4ENSA 4RPKA 3A1FA 3VTAA 2HK8A 2D5CA 1VJTA 4ZCMA 2IXTA 2XQIA 4RM2A 2WJVA 3WV4A 5IUJC 7GPBA 4CM8A 3CIOA 4KR9A 3LDHA 3UMMA 4NMMA 2I7VA 2XE4A 2XGOA 5K6AC 4OAQA 2HBYA 1XZ8A 3S44A 3WJ1A 4EYQA 1FLDA 5KSPA 1FP4B 5EXPA 3NHRA 3G85A 1Z8DA 4HZUB 4TKZA 4YRCA 1D1PA 1WUIS 2RC6A 3SF0A 5FTMA 1H93A 1P9RA 3RS3A 2V7BA 3K70D 1BX1A 1RP7A 3NS7A 1UIMA 1KDOA 4L16A 4RD1A 4A0RA 4JGGA 1Q3TA 4KOEC 4BLQA 4B71A 5BQXA 4AS3A 2L82A 4DV7B <