4QM7A

Structure of bacterial polynucleotide kinase bound to gtp and pdna
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLMSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of bacterial polynucleotide kinase in a michaelis complex with nucleoside triphosphate (NTP)-Mg2+ and 5'-OH RNA and a mixed substrate-product complex with NTP-Mg2+ and a 5'-phosphorylated oligonucleotide.
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Transferase/dna
molecule keywords Metallophosphoesterase
total genus 64
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qm7A00
1OB2A 2QMUA 4LPKA 3I8SA 4OI1A 4CEIB 2O52A 4AI6A 2FZ4A 1XWIA 1Z6XA 2PH1A 2ZRJA 3RRNA 4NPHA 1RJ9A 3I5YA 1JQJC 3CUEF 1C4OA 1XEFA 2ZR9A 1GITA 2QM7A 4ILEA 3UKDA 2FSHA 1RKBA 3OIUA 4XWKA 2VH5R 3RSOA 1GAJA 3OAAD 4HZIA 3LQQA 4PQFA 1GFIA 3QEJA 3ZGXA 1R10A 3Q9LA 4PQYA 3U2QA 3D8BA 2PX3A 2QPTA 2XAUA 3THWB 1X8LA 1K6MA 5EUQB 2B8TA 1R5OA 2JLZA 4L8GA 2DFTA 2CCGA 1GRNA 4ASUD 1X8KA 3HDTA 2GXUA 5JCZA 2FPKA 3FYHA 4QJ4A 3KJGA 1XXHE 4MRNA 3SFZA 4RD6A 4TYYA 3QY0A 1TF7A 1S0UA 4B48A 2ZJOA 2X2FA 4KSBA 4TL9A 2FMXA 5FOTA 5KSPA 4CEJB 2D7CA 1ZUIA 1G64A 1N6OA 4LGMA 1ELOA 3PITA 5HE9A 4Q7MB 4DLXA 5KTYA 1CR1A 1JBKA 2H17A 2JLUA 1P9NA 2QM8A 3A37A 4D25A 1JEDA 3ADCA 3QPUA 3WP0A 1VCNA 1N5KA 2XEXA 1EWQA 1BO6A 1KOFA 1KI2A 1J99A 2JATA 2ZE8A 2YHSA 1YZKA 2P5TB 621PA 1G18A 1KMHA 3BS4A 2EWWA 1CJVC 3ZZTA 3PXGA 1O87A 2QENA 3RSLA 2GZAA 5DISB 3CLVA 1G17A 1N6NA 3SEAA 1T8TA 4KLZA 2C98A 4LYFA 5DNYB 4TLBA 2RGAA 4BRWA 1E2PA 3ZJYA 3SJBA 3TQCA 2P3SA 4NU0A 2PJZA 4QKQA 2OT3B 1TEVA 4NYJR 1G291 2V6JA 4HLQB 4G5OA 4OQNA 3U61B 2QMOA 1KI7A 1ANKA 1PLKA 1SZPA 5E7IA 4A0RA 4JBXA 4UXJA 2BM0A 5JECA 1KNXA 3OFNA 1U90A 1TAGA 2YWGA 2VP0A 4B71A 3HYRA 2RGCA 3THXA 1UF9A 3NVAA 1MABB 1DE0A 5JZVA 4IVQA 1E98A 2BJWA 2B6HA 4FINA 5FBQB 2O8CA 3QBTA 3KKPA 1TF2A 1E2EA 4PC7A 1VYTA 4AYXA 4IFEA 4R2IA 3ZZ0A 1T3LA 2VHJA 1SQ5A 1AQUA 2EVWX 1I4LD 4HUQA 2O8FB 2IYWA 1KDTA 5FOVA 3U7GA 2VSXA 1T5LA 5FBLB 4OK3A 4UNSA 1E96A 1X6VA 2O0HA 3Q72A 3IEVA 2LKCA 4JMPA 4US0R 4NCIA 3BD9A 2KWIA 4P33A 2IYTA 1EXMA 3PV0A 4LSGA 4JLVA 2B7BA 2ONJA 4EJSA 3B1YA 4D0LB 4DIDA 2GHIA 2GK6A 3CPEA 3KJEA 3NEJA 2BEKA 3OIWA 3PEWA 2WTUA 3NHBA 3TW4A 5IK2D 3AF3A 2WWIA 3SNHA 1FW6A 5JI2E 2Z4RA 3T5GA 3RRZA 1D2NA 3IQXA 3NXSA 1IM2A 1S2MA 2AK2A 2GZDA 2ORVA 4Q9IA 3L0IB 1HYQA 2KBFA 5B2ZA 4DEXA 4OHYA 3QKRA 1JXMA 221PA 1NBMA 2GWHA 5FOXA 1SVSA 2D74A 2EFGA 1XCMA 5JWHA 2BHRA 2OM2A 2OUKA 4ESVA 4IHQA 4H9GA 1VIAA 3RC3A 1XPRA 1P9WA 3K9LA 4DJTA 4R71A 1JPNA 1KSGA 3OEHA 1KO8A 3H2YA 2QAGB 5H70A 1ZAKA 4M1MA 2BBWA 1Q57A 3AEZA 1E4YA 4JSYA 4URUR 4UXHA 1HT1E 2Z0MA 4IRUB 1RE0A 5EP1A 4DSOA 3AVTA 4LJ6A 2OILA 3O8DA 1SVLA 3KQNA 4TLDA 2G83A 1N6LA 2IYUA 2YNMA 3BH0A 3AKEA 2KI5A 1G6HA 1II9A 4HLUC 2DPXA 4YDSA 4EPXA 1NIJA 5EZ5A 1DO0A 2I3BA 2O0JA 2GZHA 3BK7A 3CR8A 4M9ZA 4DSNA 3U7HB 1W4BA 2ZI3A 2BBSA 4AD8A 3ZZUA 4B35A 1F60A 4C0LA 4D2IA 4R98A 1S1MA 3Q85A 1GP2A 4B3BA 3KX2A 3W8NA 2F43B 3NBXX 5FTLA 1NMYA 3F0TA 3IO5A 5L3QB 3BXZA 5EP4A 1Q1EA 3WYFA 2OXRA 2UZ3A 3LBNA 3MMPA 3QXHA 1H8ED 5BN5A 2J0QA 4IJMA 3IIKA 2IYYA 3TR0A 3FMPB 1IHUA 4M2LA 1CTQA 3UATA 1W4RA 2REBA 2YVUA 4IDNA 4NYMR 3ZVRA 2XXAB 3K9HA 3T1QA 1KJWA 1E2KA 2GCOB 3FHOA 4ZDIA 2ZU6A 3B1ZA 1UKYA 2XZOA 3GFTA 3W34A 4JYCA 4F93B 2G1KA 1CU1A 3X1YA 4A0FA 4PO9A 3U60B 3R9XA 4YXWD 1IQPA 3LAWA 1KY3A 2Q9AA 3PEYA 3H1TA 4YXWA 4Q1EA 4BPBA 3B9QA 3LX5A 1E79D 1IBRA 3IILA 5AJVB 5JMTA 1G8FA 3KUDA 4TLAA 4A6PA 3L0OA 1LS1A 4FMDB 3M6AA 1NP6A 1I2MA 1F2TB 2ZRDA 1DVRA 4QC2A 2CNWA 1NN5A 2NO6A 3AP1A 5G53C 1S3SA 1S1CA 1EFRA 1Q1ZA 1RRPA 2O8EA 2JJ1D 2WVJA 1DADA 1E4VA 4CT4B 2C9YA 4M1OA 2Q9CA 2R6GA 2R8RA 3QXSA 1MR3F 2XX3A 3WYAA 1OIWA 5J40A 3FTQA 1R8QA 4ASUA 3LY5A 4Q9HA 1FP6A 3ZVNA 1GL6A 3CB4A 1NN1A 2YWFA 1CF4A 1PLLA 2QMEA 1J2JA 3MLEA 4BLSA 1F3OA 2OFWA 5KNDA 2HF8A 3UG6A 1KGDA 1OFIA 1S4QA 2BBTA 4YMTA 2VO1A 3A1WA 3BB4A 3E1SA 3L8ZA 3LW8A 1L8QA 1CJKC 3CZQA 2C99A 2QN6A 1NVVR 3K0EA 1FNMA 4H1VA 1D2MA 2GF0A 3BB1A 2OBLA 2DFKB 3PR1A 4LJ5A 4TQ9A 1F5NA 1SHKA 1Y63A 4MGYR 2FFBA 4JZKA 2QPOA 3B82A 3IDQA 3EXAA 4HB2A 1NG9A 3QUSA 4LHXA 1IY0A 4QM6A 5D3QA 2C03A 4HAVA 1AM4D 3LX8A 4C7OB 1NSTA 4Q02A 1XTSA 4EPVA 2WHXA 5D3MA 1E9EA 4WXRA 4BLPA 1YR8A 1G16A 2ZR0A 2ZUDA 3TIFA 2F7SA 3WNDA 3GJ5A 2QNRA 1XNJA 2GCNA 1SXJA 3B1WA 1KK2A 1GILA 4AKGA 3BH6A 5ELXA 4TTRA 4GT1A 2A5JA 5DLQC 3KFXA 1W4CA 1G1MA 2D7DA 4AY2A 2E1RA 4RZXA 3T06B 3MSXA 4BLRA 1IONA 2H92A 4FMCB 1F48A 1U0JA 4QM7A 4JLKA 4BEJA 1T8UA 2BOVA 4KCGA 2C5LA 1Z6GA 2JJ2A 1E9CA 4PPGA 2NTYC 3HU3A 3KFVA 5GJCA 2GETA 3N2IA 2C04A 2ZS7A 1XXHA 1P5ZB 2H8KA 2IBMA 3EZ7A 1NVWQ 4DKXA 4OQFA 4Y0VA 4POAA 2J59A 2XSZD 2ZSEA 1Y3AA 4RZ3A 2DR3A 3VR1A 3SOPA 3NDPA 4C0AC 3P20A 5CM9C 1JAIA 2OZEA 1GRQA 5GJVC 1Z0JA 4MUAA 4YONB 2HJVA 4LZZA 5FL7A 3ND9A 4NTZA 3QEOA 4OHVA 1NLFA 1N5LA 4TTPA 4F92B 5DYGA 3T15A 2XOKA 4XJXA 3ICQB 2A78A 2EYUA 4PTLA 4G5SA 2VHTA 5KOYA 1AS0A 1HH4A 1Z63A 1VTKA 5HPYB 1Z6YA 1TU3A 2WSMA 3CO5A 4NCNA 5G40A 1GNRA 2PT7A 1E1QA 1BIFA 3EIQA 1U9IC 1CR4A 1NN0A 1OIVA 3K09A 5CIQA 4XD7A 3U4QA 1XEWY 3K70B 3I62A 4EFLA 1ZD9A 1AK2A 4Z1MD 2JGNA 2QORA 5DHAA 1KNQA 2DB3A 3RS5A 3UWKA 3CX7A 4HLUA 4E03A 2UKDA 1BKDR 3WHLA 4BZXA 5JRZA 1OH7A 1E0KA 1UBCA 4PZYA 3W3ZB 2IYLD 1KO1A 1VDZA 5J4KA 1XTQA 2GCOA 3I72A 1ZU5A 3QJYA 1NLZA 1T0HB 1GM5A 1E9BA 5C1BA 1Z08A 4BFSA 3LBIA 4X8LA 2WWFA 2F1JA 1KZGB 2WKQA 4EQ6B 4JL8A 3AVXA 1Q12A 3AVPA 3EWAA 3K0SA 2L0XA 5EXXA 3WY9A 1M7BA 4ZPXA 2WIBA 4KITB 4A4DA 2D2FA 4MYTA 1DS6A 4OBEA 2ZPTX 2DY1A 2GJSA 5AJYA 3PUYA 1NY6A 3PFIA 4CYMA 4URVR 4CEHA 5L3VA 1OXTA 4M21A 5HTKA 2FFQA 4OI2A 2IXFA 1S9DA 2FSFA 2RGDA 2QQ0A 1FUKA 2ZREA 4MYCA 1EGAA 2NO0A 1PV4A 2ATXA 3AVOA 5KNBA 3AVUA 4JIMA 2YZ2A 2ZR7A 4DLYA 3IHWA 2PMKA 2SHKA 4TL6A 3B1XA 4HLDA 5FPYA 4UJ5A 5JBQA 3RWOA 2J0UB 3MAAC 4V0OA 2JLWA 5JJLA 2HLDD 1KY2A 3VX3A 4LV8B 3U3JA 1ZNZA 3AF0A 3OAAA 3THOA 3RRYA 1RVDA 2GJ9A 4V0NA 5CJ2A 5HE8A 1H8HD 2EFHB 4A15A 4HLCA 1W47A 4RVCA 3EPJA 2BMEA 3EARA 2HV8A 1H8HA 1KDRA 4M9QA 3HU2A 1AGRA 1WCV1 1CP2A 4JLBA 4QJ3A 3FMFA 2ZRPA 5FL7D 4JKYA 4PZLA 3EWSA 1HT2E 2J7KA 4M0LA 2BIFA 2MSEB 4AYWA 4TMXA 2QSYA 1KO7A 5FBVB 1D8TA 2XJ4A 3FKSA 1LV7A 3UMSA 2Q21A 3K70D 1YRAA 4NH0A 1WE2A 4M1WA 4EPWA 3I32A 1UPTA 1MOZA 1M1YE 1E2JA 2IYSA 4BLQA 2ZS9A 5TY0A 2AXPA 2BV3A 3ETLA 3K70C 2ZE6A 2QT0A 3GFPA 1CBUA 4M8NE 1N0VC 4A0HA 3HR7A 4QGGA 1CIPA 1ZINA 1NVUQ 3L82B 4FD2A 4FI3C 2J5XA 4BLTA 1XMJA 4CW7A 5FBRB 2OCYC 1IY1A 3NBZC 3SYLA 3G82C 4TTQA 2WJHA 2OLKA 2ZYUX 2J0SA 5LD2B 1Z07A 4OJQA 4D4KA 1UEIA 2OFXA 5AR1A 1CR0A 3HJNA 4GPTA 2GTPA 3T35A 3EG5A 4AG5A 3JZMA 4RZ2A 5BQ5A 4PAQA 3LRPA 3HR8A 5CB8A 5JWOA 3WMEA 2HT1A 3JVVA 2ZSAA 4EPYA 2RHDA 1ZNWA 1SKYE 2FX3A 2ZRCA 2IYVA 5CLLA 5LBIA 1Z22A 3IGFA 3G0HA 2QRNA 1G7RA 3ADDA 4LPSA 4C2TA 2G88A 1TX4B 4JBYA 2WKPA 2JLVA 1KJZA 1A7JA 1ZIOA 1XFAA 4HZUA 1QDEA 1UDXA 4BLOA 1OV4A 1QHHA 3OZXA 2ZJZA 1XTRA 1U8AA 3AF4A 4JLNA 5AUOB 1W4AA 2OESA 1CKEA 2WAXA 5DIFA 3EZFA 2AWNA 3D31A 3DEFA 1VYUA 2P6UA 4JKIA 4MA4A 3X2SA 2BMFA 4DCUA 4E5UA 5JWRA 1K5GA 4H1UA 3IBYA 4EFMA 1V43A 1DTSA 4BFVA 4QJ5A 4R2HA 3THYA 4G5RA 3CF0A 3MJHA 3V4FA 1UBFA 5B57C 3MGCA 2GXAA 2MMGA 3R9IA 1HURA 2ZJ5A 3WP1B 4BZQA 1T3HA 1E99A 4NYMQ 1R0XA 4Q4HA 3IPYA 2GJKA 1G3MA 2JCSA 3S1AB 3NHAA 4QL3A 3FFBA 4PAMA 4M1YA 2J3EA 1JI0A 5CK4A 1LF5A 4OL0A 1G41A 3GJ6A 2CNWD 2W0MA 2AR7A 1KO4A 3BWDD 4IXMA 2FG5A 3GJ4A 4P4TA 1C9KA 1DAHA 3K53A 5FUVA 1XTIA 4HEJA 4PC2A 4RCYA 1RYHA 3VHLB 4ARZB 3C15C 4S35A 5JCPA 1UKVY 4MRVA 1E79A 3AVVA 2WJYA 4MUBA 4WZBE 1WBBA 1TPZA 4DLSA 1BYIA 1KMHB 3LXRA 4I99A 2CL6X 1IOZA 4OK5A 3NBFA 2B7CA 2ZRHA 1EFRD 1KI6B 4F38A 4G5QA 3I8XA 3FMIA 2REXB 3N70A 2KJQA 3RS0A 1TMKA 2A30A 4ZKEA 1YU9A 4QG7A 4DUGD 3I3SR 4JS0A 3X1ZA 1DAEA 3T34A 1ZM3A 2QAJA 3V4RA 5FH9A 5A4JA 3C41J 1NBME 1OSNA 2ODNA 5CK5A 3WNCA 1GZSA 2PZEA 5L3QA 4DRZA 1OF1A 3ZVLA 3PEVA 2VP4A 4UKDA 4WA7A 1COWD 2W6ID 1P7CA 1TL7C 1Q3HA 3BFVA 1MABA 3R8FA 4B32A 4JSTA 1KI6A 1YKSA 1WBDA 3GMTA 1W36D 4MRRA 2O0KA 3DKVA 4B3FX 1E2DA 5FPHA 1RJ9B 4CVNA 4D26A 2GA8A 4AK9A 5TDHA 1RC8A 2P65A 1ESNA 4C0JA 3AVWA 1KI3A 3KTAB 1FMJA 3A6PC 1ESMA 2FEMA 2F3TA 2VF8A 3BIFA 2WJVA 1KIMA 1QBKC 1FZQA 4NONA 4QBFA 1Z0DA 5JSZB 1KAGA 3TAHA 3ZIAD 1SVOA 4V0KA 1L7VC 1DARA 3UK6A 2XZPA 4XVUA 3TUIC 1X1SA 1KKMA 5SZJA 4JVNA 4Q1CA 4QGAA 1CR2A 1XJCA 3L0SA 4L4UA 4CT5A 1R2QA 1OXXK 2CHQA 4QHTA 5AUPB 2HEIA 2R65A 1QHNA 1W46A 2A5DA 4JLAA 1A5TA 1TUEA 1NY5A 2V4ZA 3D6TB 3DHWC 1UBEA 3OEEA 4NCHA 4A2PA 3T1OA 1XMSA 1T6NA 1MRSA 1YZNA 4WVFA 2QTHA 2DYKA 3QBVA 5CYPA 4ACBA 4Q19A 421PA 1Z47A 4KODA 2V55B 3K0FA 3GP8A 1G3QA 1UBGA 1NRJB 1COWA 2W6IA 4RSGA 1JR6A 2CHVA 4HAWA 3LDAA 2CLSA 5AK0A 4DCNA 2ZSFA 2WV9A 1NKTA 1HY3A 1E1QD 2ZIAA 2Q6TA 4U5XA 4EUNA 4B74A 1JR3A 5TB5A 3BOSA 5KUTA 4PSAA 4I1UA 4CGZA 3LW7A 3B13B 2F9MA 1TUIA 3W8RA 4PPFA 3C14C 3QG1A 2PBRA 1Q21A 4B33A 4XIGS 5B30A 1MO5A 2VPPA 1YE8A 4ZKDA 4O3MA 2VHCA 2HUPA 2A9KA 3FHCB 3G5UA 2GRJA 2XNDD 5G3ZA 2VQSA 3W6NA 1RPZA 1W7AA 1I2DA 1KDPA 3SHFA 4B2IA 4YQFA 1G9XA 3THWA 2JLQA 1H65A 2IUSA 4TYQA 2ZRFA 1G7TA 2V54A 4TL8A 4TQAA 4ZCLA 1JALA 3GLGB 3W90A 1SHZA 3OE7A 4XVQA 3Q7QA 5CIWA 1IN5A 3QKSB 2ZU0C 1R6BX 3AP2A 3UXMA 1S3GA 3EASA 4Q01A 4B34A 3UPUA 1E2FA 2CEAA 2UZIR 4N3NA 2HXYA 2WPDD 4AKEA 3OFND 1XCPA 1OXSC 1FX0B 4I4LA 3CF6R 5K8UA 1CS4C 1BH2A 1FL9A 1UM8A 1E69A 2XTZA 2ANBA 2V1XA 4DCVA 4DVGA 3KB2A 3QG5A 1G7CA 1US8A 2ZYVX 3N5CA 4M22A 4ZDJA 1IJFA 1A82A 1KK3A 1OKKD 4DDWA 4Q9KA 1NJFA 2J1LA 5JEEA 3MFYA 4LCBA 2GEDA 3IPXA 3C4JA 1XMVA 5FOWA 3PUWA 1OLOA 4TZ6A 2VHQA 1OPXA 1HV8A 1VYVA 2ZRKA 2ZSBA 4C4PA 1E9FA 3GEHA 2F6RA 4RD0A 3IUYA 3UWOA 2G1JA 4NYJQ 3TMKA 1VPLA 3AGPA 1ZM7A 4CF7A 2ZEJA 5F2EA 1U0HC 4WAUA 3PENA 3Q3JB 2WMNB 5DE3A 3QKRB 4Q18A 2V6IA 3CRMA 4GBMA 4PHFA 4E07A 1K8RA 1NF3A 5KPDA 1TQDA 1MRNA 1Z83A 3TW8B 2ZRLA 2XOKD 4DLTA 5E4FA 5HZKA 1UADA 4DT1B 1ZU4A 1JECA 5TV2A 1AZTA 4GNKA 2YWEA 2N46A 4WW0A 5EXSA 1YJ5A 3SHWA 3GLHB 4PO8A 4Q9LA 3ND8A 2Z43A 3VQTA 4EJSB 2IS6A 3P4XA 2PX0A 3GLIA 4Q1DA 2O8FA 2FOLA 2YINC 3K0AB 3K9NA 3R9WA 2ZE7A 4AKIA 2YKGA 1P6XA 2VF7A 1Z5ZA 2WWHA 4DZZA 4RFSB 2A5FA 3VMFA 1RRFA 1TADA 2DWPA 1JB1A 1GL7A 5LD2C 1X8JA 2F1RA 4TSFD 1RYFA 1BYUA 2VBCA 1JNYA 5CLQA 3QVUA 2G0NA 1W5SA 2NQ2C 2QU8A 4B47A 4L9SA 2XNSA 3EW9A 4NBSA 4D4MA 3NC1C 2JLYA 1CRPA 5FTKA 1KSJA 2HF9A 1E9RA 1N2CE 2ONKA 3MUFA 4ZO4A 2C8VA 2A3RA 3ASYA 3FMOB 3LFUA 4RD4A 5JLJA 5J4LA 5IRCD 2WKRA 2FE4A 4LJYA 1KSFX 3WRYC 2X19A 3SC3A 5C18A 3X1XA 2IK8A 3MG9A 3F8TA 1T0JB 1DG1G 1OYWA 3B8HA 4MKGA 1LVGA 2H16A 2HCJB 4A9AA 2AK3A 1GUAA 3FKSD 1OB5A 2ASEA 4GP7A 4EQ6A 2ODBA 4G3XA 2BWJA 3DVLA 4PFSA 3X1WA 3PJRA 2DCUA 5J4YA 1D2EA 3TUZC 2GKSA 1UEJA 1Z2AA 1OKKA 2YOGA 5KPJA 2Q0HA 3TE6A 2JLRA 4Z8XA 2J46A 2QEQA 4LOAA 1QVRA 3EC2A 1XRJA 2F1IA 4KBFA 2ZRNA 5KYKA 4NE2A 1XF9A 1DOAA 1P61B 3KDSE 2VYFA 4QNMA 1GVNB 1H8EA 2QP9X 3L8YA 3QKUA 4GOKA 4GSYA 2DWOA 2ZRAA 2O8EB 5AJXA 4PX9A 5FUYA 2GBLA 2O5VA 2W2XA 2F3RA 2GAAA 4IW3B 2RGGA 3SZRA 4WOPA 3MWYW 3NWJA 1IAQA 3T61A 2FH5B 3CPHA 4JVMA 4XD7D 5EP2A 4B43A 4JYBA 3EZ6A 1JXOA 2D62A 3F3YA 5J47A 3OEHD 4V0MA 2NZJA 3ICEA 3CW2A 4IOKA 2RGBA 4JT4A 4DLZA 4GFDA 2H18A 5JS8A 3MJRA 2NPFA 2WWWA 2RB4A 1G19A 1JPJA 5FI1B 1E9AA 2VSFA 2ZRGA 3R7WA 4KSCA 2XZLA 3U7EB 1UFQA 4XTRA 3ONWA 4TT3A 4W5HA 3AP3A 2R6AA 1U0LA 1E1RD 1U81A 2Q3HA 1XX6A 3W5IA 2IYRA 4LYJA 3VTKA 1X3SA 2GVZC 4URZR 2XGJA 2X2EA 4K81B 1E2HA 1WP9A 3KKMA 3DO6A 4OQMA 1R7RA 1VCOA 2NZ8A 1P3JA 1D6JA 2OXCA 3AV0B 3TJZA 3A4MA 5FR1A 3VU9A 1GKIA 1NJGA 3NH6A 5G41A 5BXQC 3TGPA 4BFXA 4GMXA 3EIEA 4CDGA 1Z29A 2ZYTX 3CF2A 4DDTA 3TR5A 1NKSA 3TAUA 1QG2A 1Q0UA 1XBTA 2QE7A 2BMDA 4LI0A 4EAQA 3AF1A 4RKEA 4ESHA 2NO9A 2IS1A 1T9HA 4ZCMA 3NEYA 4ITRC 4D4LA 4ZCIA 4W5JA 1EX6A 2RGXA 5EE1A 2MMCA 4LC1A 3F5FA 4XWAA 5M04A 3GCGA 2QROA 2WAYA 2V7QA 4Q4JA 3VU9B 4W7SA 4V0LA 3ZDQA 1E0JA 1S9HA 4B6FA 1OHHA 3PEUA 4LRWA 1DAGA 1E2IA 2ZRMA 4TYWA 4IFBA 1QHIA 3QIAA 4ZI3A 3NH9A 4G01B 2JJ2D 3TH5A 1UJ2A 3CNLA 1G20E 3RLFA 3TLXA 3T12A 3N2EA 1JAHA 4EPTA 4DLRA 1ZVQA 2D06A 3MCAA 2HYIC 1KTVA 1NN3A 4R7ZA 2ORIA 3KZ1E 3R20A 2JEOA 3WMFA 3DM9B 1G8PA 1VECA 3CRW1 3P27A 3L2OB 5JHGB 4D0GA 4LJ9A 2O8DB 2XSZA 1W2HA 2ATVA 3SS8A 2R6CA 1U8YA 2VP6A 3GJXC 3U3MA 3WHKA 1TQ4A 3CZPA 2GXSA 4PPQA 4PSKA 4DT1A 5KO2A 1P72A 1U99A 2KSQA 1AQYA 2AHOA 4FWIB 5JS7A 1PJRA 1FQJA 2JJ1A 4JLMA 1W0KD 4RD3A 5F3WB 1OW3B 2QY9A 4KHZA 2F43A 4PHGA 2C77A 1PLJA 3BFXA 1UKEA 1RRCA 2WZQA 3KKQA 2XB4A 2KBEA 5FOUA 3GEEA 3SJAA 2WOJA 2W58A 2Z6VA 4TT3D 3FB4A 2IEYA 4TLCA 121PA 1DELA 4OJKA 5FL3A 2NMVA 4LHZA 1VCMA 2QG6A 3Q8XB 3TVTA 3AM1A 5JJIA 4X8HA 1P2SA 2ZRIA 3B2EA 5FTNA 4W5WA 3TQFA 2KB0A 3O8CA 1KI1A 2HCBA 4GRAA 5FI0B 5G3YA 2O8DA 4QBIA 3VNUA 2WJIA 3RS2A 5D3MB 1SXJE 3RS7A 3V9PA 3VX4A 4PXAA 4JVLA 2ZVPX 5EQTA 4QHSA 3AH8A 3DL0A 1PUJA 3DMNA 5DI3A 3FOZA 4DB2A 4C0HA 1E2GA 1D9ZA 1M7GA 2BVNA 1XJ0A 3DOEA 4TSFA 3REFA 1BMFD 4OI4A 2J7PA 3U6KA 2ECKA 2LKDA 4MKIA 2R44A 3SYKA 1ZUNB 4LJAA 4K46A 2RH5A 1CXZA 2AFHE 2C96A 5BYKA 2Z83A 3EPLA 1TU4A 3GFOA 3TSZA 3QF7A 1IXRC 1L4UA 3RHFA 1GNPA 2ZAOA 1QHYA 1WXQA 2VL7A 3C8UA 3MRSA 4HAZA 3TKLA 4F4CA 2MSDB 1YZTA 3M0EA 2WSSA 4OQLA 3IIMA 1YZUA 2YJTD 5E95A 2WWGA 1XXHB 3RRMA 4KXFB 3LD9A 3SE0A 2ZUBA 2IYXA 3VKWA 4DLVA 1G8YA 2ERYA 4Q48A 1X1RA 3ZD6A 3SBDA 1LNZA 2XTMA 4AWXA 2AWOA 4X8OA 4XWOA 2P6RA 1YVDA 3A1VA 2BEJA 2ZANA 1FNNA 3U44A 1U8ZA 1YR7A 3CPJB 2DWQA 4A2QA 5HKKD 3AF2A 1G3RA 4DLWA 4Q4AA 2ZI4A 3HPQA 1OXUA 5AJWA 1D9XA 3LBHA 4RD1A 3CX8A 5LB4A 4JVSB 1RFLA 1LF0A 1QF9A 5UKDA 1AN0A 3NC0C 2GJ8A 1N6HA 2WIAA 2CE7A 3CIOA 1ZCAA 4KAXA 3GEIA 3CNOA 3GQBA 2QP4A 1OT3A 4Q4LA 4PQRA 3A4LA 2IF0A 3JZAA 1N25A 4BFTA 1R8SA 3W6OA 3H0KA 5A0FA 3K1JA 1S8FA 3FHTA 1CRQA 4NHOA 2O8BB 2ODWA 2G9NA 1G7SA 1ZW6A 4HDCA 4MKFA 1ONBA 2FGJA 4Q5IA 2G6BA 5IT5A 4EKDA 3HPRA 5BWMA 4LWZA 2ZE5A 4QFMA 4NCJA 2OBMA 3BRWD 3H86A 4ZIRB 1J8MF 1WMSA 1Q22A 4GZMA 1TEXA 1DO2A 1L2TA 4D82A 1XZQA 3BBPA 1KI4A 3KL4A 3HU1A 4TLEA 2QZ4A 4IKEA 2ZROA 1P75A 4Y0AA 4YMVA 3KQKA 2O8CB 3WRXC 4IOMA 3WBKA 1YZLA 4DBLC 4RY2A 1KDOA 1ZCBA 3BJIC 5DI3B 2BCGY 3ZLJA 4KI0A 3C7KA 3KB1A 4UNNA 4ZDWA 4Q1AA 2IWHA 5BN4A 2CBZA 3SDZA 3B85A 2OCBA 4DHEA 1N0WA 2PMDA 4UQOA 4MDEA 2J7PD 1DPFA 3SYNA 5L8VA 2W83A 4YLGA 2N1BA 1PVOA 3EIHA 3QQ5A 1SVWA 3I61A 2AXNA 5CJPA 1Z6TA 1PUIA 1JJ7A 3AKCA 1LB1B 1U98A 1JQLB 4GOXA 5BYJA 1XDBA 2P6NA 4HAXA 3THYB 1XD9A 5FUXA 3PIRA 4L16A 2IWRA 4BFZA 2VP5A 1AZSC 4KFRA 3ZQ6A 1Q20A 1VHLA 1QHGA 5C4GB 1JR3E 1OFUX 2CLCX 1KMQA 2IYQA 2Z5FA 5KHOC 1B0UA 3I4LA 4RFVA 5H8WA 2CK3D 1I4DD 3VHXA 4URYR 4GDFA 3UMRA 2ANCA 1ZYUA 3U6BA 1SGWA 1IJEA 3QENA 4HAYA 4ZIRA 1DEKA 2WBLC 4S2EA 3DKPA 5AUNB 1IN6A 2WWXA 3QF4A 4PZZA 2J9RA 3FDIA 4A6XA 1XD2B 1NSFA 3W6PA 5TMPA 1RIFA 4XOIA 3ZIAA 3ZH9B 3R8CA 2V7QD 5AUQA 3ZQJA 2BKEA 3J81k 4Q4HB 1DAMA 3M4YA 4K8OA 4XSHA 1AGPA 4TMZA 4BQSA 4O2LA 4TYPA 1KK0A 3KJIA 4YC7A 1RZ3A 3NTUA 3CH5A 1W2GA 4P31A 1VKJA 4A1FA 1WDTA 3UG7A 5J4VA 1MO6A 2QGNA 3RYTC 3O8BA 2QP3A 3AKDA 4V0ME 1ZM2A 1XTKA 4TYNA 2CL0X 4EDHA 3SN6A 4MYHA 4GMDA 4YMUA 1EFCA 5C46F 2Q3MA 2EFEB 4Q4AB 3A1SA 2IA5A 1JJVA 5F98A 2ZYWX 1HTWA 3H4MA 3VR6A 3CRRA 1G8GA 3MWJA 3TSOA 1GL9B 2DHRA 2OHFA 3U3KA 3KQLA 2OFOA 4FN5A 2RMKA 1BMFA 2WICA 3K0AA 3AVQA 1G5PA 3QI2A 4NYIR 1II8B 1YRBA 2XXAA 1NVXQ 4WBSA 1KZ7B 5KU1A 1E9DA 4OHZA 1GSIA 4HSEA 2NO7A 5HCNA 4OHWA 3MWLA 2CJWA 3ASZA 4U00A 1Q3TA 1XCGB 2I1QA 5BN3A 1BOFA 3U3RA 1EESA 1KAOA 1K5DA 2WMOB 2E9SA 4KBGA 2RGNA 4LJ8A 3GLGE 1E2NA 4P3YA 1NMZA 2CE2X 4ON9A 4ACAA 4KYUA 3B7GA 2GNOA 3PQCA 5CDFE 2IX3A 1EFTA 4NL4H 3LLUA 2ZQ5A 3QXXA 4C3ZA 4CEIA 2F9LA 2LWIA 2V9PA 1Z0KA 1KYIA 1G5RA 1BS1A 4GP6A 3RVBA 4Q1FA 3O8RA 2BC9A 5CYOA 2X1VA 4Q7JB 4BRUA 5HR5A 3OIVA 5K8TA 2FFHA 1DG3A 4URWR 4M1TA 1XP8A 4G0NA 4I81A 3RS4A 4M4SA 4LBZA 1CJTC 1A4RA 3DPUA 3BAFA 1UKZA 5KDDA 5GJWC 4LHYA 4QRHA 2OLJA 5KNCA 2PLFA 5FFMA 1R0ZA 2ZJ2A 4AG6A 3GPLA 1XZPA 4TQUS 4OK6A 4IXNA 4YMSA 4CIDA 1OHHD 5FPTA 1G4AE 3GD7A 2R6FA 2QTVB 2WJJA 2OAQ1 5H68A 3KJHA 3L43A 1SVMA 5L3SB 4ZV4A 2DBYA 4XH9B 1QHHB 2FV8A 2OCAA 2QTFA 3CR7A 2VP2A 5JFGA 4V03A 3ZS8A 1P2UA 4D6PA 2R2AA 2ERXA 1DAIA 2K5UA 1UAAA 3KXKA 4KO8A 4EIWA 4LBYA 3A36A 3VKGA 5CDFA 1Z8FA 4MKHA 4P0TA 4Q7KA 4NKRA 4F4IA 3LO5A 4OHXA 4A92A 3DZ8A 1FQKA 3P32A 1GOTA 3QXCA 4JL6A 2UVQA 4C0BA 1SXJD 3KTAA 1P73A 5LPNA 1JEEA 3K9GA 3DMDA 2FN4A 4M9SA 5EZ6B 4D81A 1T3SA 5LB2A 3SJZA 1US8B 2ZVQX 3GLFB 5JSZA 4WZAE 4LX0A 4B3DA 1OE0A 1VG9B 1SXJB 4J0QA 3QSYA 4DEYA 3UMFA 3GLGA 3OEED 2OV2A 3RABA 5JI3E 4AIIA 1YR6A 2ZAMA 1ZC3A 4BFWA 2W0SA 3LVQE 1GNQA 4QBHA 1V5WA 1F2UA 2J41A 4C30A 1ZJ6A 4FIDA 2A5YB 5K8IA 5DO9A 4Q03A 5K8LA 1F6BA 1N0UA 2AKYA 5J4HA 3U3OA 4LC0A 3TNFA 5B64A 2F55A 4HAUA 1UDWA 3SQXA 1MT0A 2BBOA 3TUJC 3QPVA 4FMCF 1FMLA 2PZGA 3QNUA 4DUGA 1E0SA 1EX7A 3OE7D 2QSZA 1DBSA 1J8YF 1N6IA 1U9IA 3K09C 3T5DA 2IF2A 3VR3A 3SR0A 2ZJ8A 1Q1BA 4HB0A 3IKJA 2A5GA 4PANA 3K0FB 4A82A 3DOFA 5EE3A 1ZP6A 2YV5A 1QG4A 3CWZA 4IDQA 4UNPA 2EWVA 4LJ7A 1R5BA 2FF7A 1N6PA 4KU4A 3EPHA 3VKHA 2IC5A 5EJEA 2JDID 1CEEA 3NIBA 1EG7A 2GDJA 3AUXA 1SULA 1G6OA 1YHNA 3CBQA 2QA5A 2ODEA 3BORA 2P0EA 1ZUHA 5EP3A 1XTJA 4CZ2A 1X86B 2J87A 1KK1A 1ODFA 2H7VA 5FPKA 1ZIPA 1OH8A 3AGQA 2PJRA 2FJUA 1M7HA 4U7DA 1R0YA 2A2ZA 2QAGA 2P67A 1GWNA 1FFHA 1XMIA 4UNQA 1KO5A 3TBKA 3FWYA 3A8TA 1AKYA 4I1SA 2FSIA 3EAQA 3RAPR 3TRFA 4B3XA 5HZHA 3ADBA 3EZ2A 2W6JA 2GILA 4L9WA 4WZ6A 5KSZA 1YQTA 2BKUA 3IBGA 2FU5C 2J0VA 1W0JA 1OYYA 2Z4SA 2GCPA 3FE2A 1GDDA 4BZPA 2FA9A 3GJ0A 3LVRE 4PSVA 1E0AA 4L5BA 2EYQA 4B3GA 5GJBA 4WXPA 1IXSB 2FPLA 5IK2A 2ZJYA 3Q5DA 3TSWA 1LFDB 2IS4A 2YC2C 4IDHA 1G8HA 5EUMA 4PAOA 2N42A 1Z3IX 3SBEA 3CONA 2VHUA 1YR9A 3QOFA 2ZUCA 4C0SA 2P2LA 2E87A 3E5HA 5CITA 1HQYE 2JAQA 2PZFA 3RC8A 4KV9A 3SU8A 4ABYA 2YYZA 4JLOA 4QGFA 3I1FA 4GOJA 5BW8A 2ZETA 3V00A 2RGNC 1W36B 4MGKR 1T4GA 1NLYA 3IEUA 5GVSA 2QPAA 3TVDA 3BERA 4PHHA 4PHTA 1GKUB 4FW9A 4UJ3A 2CXXA 3B78A 1W44A 5FPSA 1ZM9A 4YMWA 3WNBA 1R0WA 1KJYA 2PT5A 4O2RA 4JBWA 5C2JB 4AC9A 2GK7A 2RKOA 5F9HA 3VR4A 3TK1A 2J0UA 3PUVA 8OHMA 4HB4A 4P4SA 1M2OB 3OHMA 4DB4A 5TARA 4B75A 3A4NA 4IDPA 2OSBA 1W36C 2GF9A 4KJZA 2D2EA 2H57A 2GVDC 3GLIE 1G4UR 2ZRBA 5B58C 2FFAA 4B3CA 3Q7PA 4IOJA 4KYIB 4RFSA 1MO3A 3GLHA 3K0CA 4EFNA 2QMHA 4D4JA 2VEDA 2R62A 2JLXA 3H84A 1J70A 1AS3A 3UIEA 1XJQA 5JEDA 1U94A 4A0GA 2W6JD 1IXZA 1FPMA 3BFKA 2IEZA 2ZITA 3CX6A 2B92A 3KKNA 4P4SB 5C4MA 1VIYA 3Q5EA 2IT1A 4A8JB 5DH9A 2NOAA 5CB6A 4LHVA 2B8WA 2Q9BA 4Q9JA 2PEYA 2P5SA 1A2BA 1OIXA 1ZRHA 3W5JA 1A2KC 3RWMB 2I4IA 2CK3A 5A5GA 1MV5A 1E2QA 5DN6A 2CL7X 4BASA 1TTTA 2FSGA 1Z28A 4IOLA 3MD0A 4PO1A 1EWRA 2V8OA 4HB3A 4DC9A 3D3QA 1G3UA 1N5JA 4LUCA 1J90A 1XEWX 2AFIE 2OAP1 3AB3A 3CRQA 5JRJA 3GLFA 1LTQA 2OEPA 4B73A 4O0MA 2V1UA 3NKVA 4UXIA 1XPUA 4CEJA 1GKYA 4OKSA 4A36A 4QBGB 1NG1A 2ZSDA 3BE4A 5DGXA 4XSGA 5HKKA 1P4SA 2OCPA 4U02A 4PC6A 2WWYA 2AN9A 4LYHA 5EE9A 3ZS9A 1AKEA 521PA 3W9YA 4MH0R 1IN8A 1T91A 3ZD7A 2VA8A 3JVUA 1PZNA 4C2UA 2VSOA 3FVQA 4IVRA 4V02A 4TZ0A 1G3IA 4BWYA 2CHGA 3LV8A 2ORWA 2J45A 4G5GA 1Q44A 4NYIQ 2GXQA 4A2WA 4BGDA 1P2VA 2YWHA 3KXLA 3B9PA 4HUTA 4LYAA 2C9OA 2H5EA 3VR2A 2ZM5A 1E9SA 1Z0IA 3OF5A 4BECA 3U4QB 1W48A 3THXB 2F1HA 2GAOA 1E32A 4IEIA 4W9MC 2BDTA 2DFLA 5SZKB 4LDJA 1E6CA 4M1SA 1RW4A 4B76A 1TQ6A 4YDHB 3PG5A 4XVRA 5H1YA 2BCJQ 4AURA 2EFCB 4KVGA 4AKHA 4DDUA 4Z51A 4Q00A 3GJ8A 3A1UA 1OJLA 2XTNA 3DDCA 4P4UA 1J7KA 4JL5A 3B1VA 4B44A 2QRZA 5KDLA 1Z2CA 3B6EA 3QVVA 2JIZA 1M74A 4Q7LA 4F7WA 1E94E 3HP1A 1FUUA 1VCIA 2V3CC 3ECCA 1NMXA 1TQ2A 4E09A 3PCRB 2QAGC 5P21A 1ZD8A 1OFTA 5E7MA 1P2TA 2PL3A 1T5IA 1MKYA 2ZI5A 3EA0A 3LA6A 3P1JA 1Q1QA 1LY1A 1AIPA 1KHTA 4MQBA 4DIEA 5JHHB 2ZS8A 4ERNA 2JASA 4OQXA 2QT1A 3EA5A 4C7OA 1P60A 1II0A 2FWRA 3FFAA 2PCLA 1KSHA 2R6DA 2VTKA 4NDZA 5KDOA 2IL1A 2H1LA 4TMTA 3I92A 4NMMA 2EQBA 3PVSA 1AJEA 2EW1A 3AKYA 4FMDF 4Q4JB 1RRGA 4E22A 2QBYA 5SZHB 3RDPA 3VAAA 1WQ1R 3ZYCA 1ZBDA 3QKTA 2MSCB 4IEEA 1L4YA 1NIPA 2I1VB 2HXSA 3EZ9A 1HEIA 1CULC 2GEVA 1OH5A 5IHPA 2W2VA 3C5HA 3QKSA 1XPOA 2TMKA 2ZI7A 3WMGA 4IDOA 2C95A 2IW3A 3LXXA 1Z06A 1IN7A 2FGKA 2RHMA 1QHXA 4KFSA 2BM1A 2X8AA 5DI9A 3O47A 1E2LA 2Y8EA 2NIPA 4PR0A 3IQWA 4HATA 2G77B 3OESA 4M1KA 1A1VA 2CMKA 2NPIA 4GI7A 3AVYA 1WRBA 4LV6A 4QOSA 5GADl 2FDCA 1ZNXA 3QE0A 1P9RA 3VNVA 1HUQA 3SI7A 1DAFA 2WPDA 4N0DA 1ZNYA 3A1TA 4FMBB 4Z54A 1E1RA 1E2MA 4N1AA 1NVVQ 2A7QA 1GRRA 3KQHA 1ZM4A 2REOA 1II8A 5JJKA 1HE8B 4WIAA 1HA3A 4LBWA 5ANRB 1MO4A 1NBMD 2WSSD 3I5XA 2HT6A 2HYDA 4US1R 4HDOB 5J5CA 5E7JA 2BMJA 5EXTA 5IF9A 2YOHA 5TVKA 4LV5B 4Q66C 3UANA 3K0CC 3SJCA 4B2LA 3R7WB 2XJ9A 1B23P 1QHSA 1OH6A 1GG2A 1EFUA 1S96A 4CRWB 2YC4C 4FWTA 3W3AA 1I4TD 2D4HA 3T1VA 4A8JA 4DXAA 4JLDA 4JJZA 2BJVA 2FEOA 3B60A 2JDIA 1N6KA 1XD2A 2JJ8A 2RGEA 3AUYA 3LWNA 3ADKA 5DYIA 3SFVA 4II7A 1N3BA 4NCKA 4GZLA 4HDQB 1FTNA 2OE2A 2G0TA 2QUZA 2ZI6A 3VR5A 3RNLA 2O8BA 3KUCA 1W5TA 3K8YA 1DAKA 2WOOA 4FCWA 5KSYA 2IHYA 4L15A 3C5CA 3NG1A 4HZUB 5FUWA 4FCTA 1W1WA 3B5JA 1YZGA 5DN6D 2JA1A 3E70C 1VG1A 2VP9A 5F9FA 4I1OA 3P4YA 4UNRA 5KSOA 5DSZA 4MITA 4C9BA 5L3RA 5FTMA 4C0QC 4P32A 3X1DA 3MWKA 1SXJC 4HI0E 4QGHA 2HJGA 3U5ZB 1QZXA 5DHFA 2LCFA 4RD2A 2C78A 1XEXA 5FBWB 1FX0A 1VG8A 2OO7A 4PPNA 4R9UC 3HYTA 4Q21A 1AS2A 3CRVA 4D0NA 3NBYC 3LH5A 4KVAA 5AJZA 2RCNA 3U7FB 3NDBB 2HDNB 3IIJA 5GVRA 2C9CA 2IHBA 4Q1BA 1F2TA 1ZD1A 2W2TA 4DSTA 1SKQA 1HE1C 4KFUA 3IO3A 1SVKA 5EE0A 3CNNA 2IXEA 1OXVA 2FPMA 4TN1A 3FPAA 4JLJA 4MGZR 3KQUA 1GIAA 2R9VA 3RS3A 2YOFA 1QRAA 4DSUA 2IS2A 1TNDA 1P62B 3GLFE 4IVPA 4TMWA 4OYHA 3E2IA 1XU4A 4MDFA 2X77A 3ZVMA 2CLDX 3LQRA 4HYYA 4D80A 4OI0A 1KI9A 2CVFA 3BH7A 4B2PA 1GTVA 3FGNA 3RANA 4DCTA 2CDNA 4C0KA 2RAPA 4XTCS 4G1UC 1KKLA 2NO1A 3GLHE 4F4JA 5CM8B 2D3WA 4QHYA 3DM5A 3KKOA 1R4AA 5FR2A 4LHWA 2IYZA 1MH1A 5EE5B 2GJAA 3GLIB 1U2RA 4BE7B 1NNEA 4M9XA 3WXMA 2ZTSA 3BGWA 2ZJBA 2FZLA 2EU8A 4DWJA 2CCJA 4PC3A 2AL7A 3P26A 2Q3FA 1D5CA 1VMAA 1W49A 1NI3A 1YZQA 3A58B 3SQWA 3M1IA 3D7MA 4FCVA 1N6RA 1LW7A 5L3SA 1FP7A 3GJ7A 4KFTA 4TMKA 1E3MA 1WA5A 2AD1A 1G5TA 2EFDB 2AX4A 1FTSA 3GJ3A 2IUUA 1KI8A 1AA9A 2OG2A 4NZYA 3IHLA 4BFYA 1R5NA 2QBYB 1CLUA 4AYTA 1C1YA 4BEBA 2GESA 2QL6A 2WM9B 2GBLC 3L0PA 3LLMA 1M8PA 4EJSC 3EX7C 2XB2A 1G21E 2GEUA 2QQEA 4Z1MA 4LK2A 5FOSA 1Z6AA 4MGIR 4RZUA 1VHTA 4F91B 1FOEB 821PA 3WBJA 3OIYA 2KE5A 1XD8A 3REGA 1M34E 4MRSA 5HCIA 3I73A 4URXR 2IXGA 4LJ4A 1TF5A 2QE7D 2AKAB 5TXGA 1ZC4A 4PC1A 2IUTA 4B6EA 4HUQB 4JLPA 3QF4B 4GL2A 1Z0FA 3U44B 3LNCA 1W0JD 2FNAA 3CKLA 1O3YA 3QPWA 4KLNA 4DLUA 4M53A 1CJUC 4DDVA 1XB2A 1M6NA 2G3YA 3C16C 1ETUA 4N0EA 5EXPA 4O25A 1QVAA 2XNDA 2ZXUA 1VG0B 2JLSA 4QNRA 3BC1A 3FKQA 3S1AA 4MYUA 1CJMA 1IY2A 3AQ4A 4I1VA 1LS6A 1EK0A 1XEXB 5AWFC 1JR3D 2PEZA 4QXAA 5LDDC 4US2R 3CH4B 4ZDKA 2DFNA 1IN4A 2VIIA 3CM0A 3PUZA 6Q21A 4JJKA 1OFHA 4TWZA 2OBNA 2AD5A 4Q47A 4ARZA 2PCJA 4LBVA 2HLDA 4TMVA 1NL3A 1N5IA 4RKFA 2WJGA 3VFDA 3KXIA 4LY6A 4BFUA 4A8JC 4EPRA 4TL7A 1HQCA 2CCKA 4Z8YA 2ZJAA 4JT2A 4ZI2A 4X8MA 2CVHA 2NGRA 4NP6A 4CEHB 1Z0AA 1SVIA 1W0KA 5SZIA 3WYGA 4DCSA 1WF3A 2XITA 3EPKA 2PLRA 3EC1A 2CJWB 3BB3A 3PUXA 4FXPA 2NG1A 5FTJA 2B21A 1WB9A 2JIZD 5E3HA 3T1TA 2C2HA 2QGZA 3QXJA 4RCZA 2VLIA 2W00A 1F2UB 1ZMXA 2QI9C 1EFHA 721PA 2ZI9A 3CWQA 4RJLA 4MRPA 5IDVA 1SKYB 3DZDA 4BUJA 3HWSA 2VRWA
chains in the Genus database with same CATH superfamily
2X7XA 4P22A 5DCUA 1OB2A 4CEIB 4F3YA 4I50B 2RJNA 4HWRA 1XWIA 1U8EA 2PH1A 2ZRJA 2H63A 4BAZA 3AHJA 4PZ0A 4ZK2A 2YYAA 3NHYA 1GITA 3I2IA 4L1KA 3PLAE 1WDMA 3UKDA 1ZNQO 3R8XA 5A0TA 1RKBA 3TG2A 1DUSA 4N8EA 2VH5R 2EC5A 4MI6A 5FTWA 5JW6A 4C6RA 4HZIA 3FR8A 2N9UA 1GFIA 1WV1A 2L82A 2VWPA 2XYHA 4MUJA 4NDNE 2X0EA 4AMUA 4PLVA 3D8BA 2PX3A 5F4ZA 2XAUA 4HG2A 3THWB 4RC9A 1X8LA 2WUWE 3JQAD 2GM4A 2C5GA 3TS1A 1KJQA 2VQ6A 1I7PA 1JQAA 2DFTA 2FRXA 2CCGA 4X90A 3KHSA 1USIA 2V58A 4S3MA 3R5FA 3VH2A 4QOIA 2VDKB 2JG3A 1XXHE 4Z4IA 2AC2A 4MRNA 1UODA 2GA9A 3QLTA 3SFZA 2YR0A 1TF7A 1S0UA 3N8HA 2ZJOA 5DZSA 4KSBA 2C97A 4B48A 1E7QA 3TD9A 2J9FB 2OV4A 1SA0A 2FN9A 1G64A 4OHPA 3RGWS 2JC3A 1M1ZA 1XAJA 1SJ9A 1YK0A 4DLXA 4G0XA 2DULA 1VB5A 2IU6A 1TZJA 2AZ4A 3BMCA 4LHSA 2X23A 4NVRA 5KTYA 2B4YA 2JLUA 2QM8A 1BGVA 4CIBA 3ZHQA 1U8CB 2WR8A 3A0UA 3OCJA 3UY4A 3EEOA 2RGYA 3D1VA 4F8JA 1N5KA 4TSKA 1KC1A 1KOFA 1L5YA 4L27A 5LYJF 1Q95A 2GBIA 3ZJTA 3IP9A 6LDHA 2YHSA 5LYJA 2H1WA 2JA2A 3EHEA 1USVA 1FRNA 1G18A 2VTEA 3Q98A 3GN2A 5IN4A 3W5DA 4C20A 3CLRC 3NWOA 1CYDA 4KGVA 2QENA 3FNHA 1QYXA 4IJKA 3EW7A 1C9JA 2XV1A 3M4NA 2BFEB 1N6NA 2Q0SA 3SMQA 4KLZA 1Y1KE 4LYFA 2XOXA 2X0RA 4YRPA 2DH5A 2PV7A 3H9GA 1GCGA 2Q1WA 3NONA 1TEVA 1ZUWA 4MUGA 2YN2A 3NP7A 4FS8A 2QMOA 3A4VA 1EB9A 3KQQA 4OB7A 5E7IA 2ZZNA 1FVOA 4HH4A 1XTVA 4N7RA 2BM0A 4UXJA 1AKTA 1PHPA 1TAGA 2VH1A 2YWGA 4B71A 3HYRA 2RGCA 4I9GA 4UNIA 1UF9A 3GPIA 3GRFA 3NVAA 1CNFA 4Y2PA 4E2FA 1PR5A 4LOJA 1DE0A 1HLPA 1O95D 4EI7A 2PRZA 4FINA 4KDCA 1F3LA 2HSGA 4RK4A 1HKUA 2MYUA 3MMNA 4HDSB 4IFEA 3H2GA 2G70A 4R2IA 2BGRA 4AYXA 2GZ3A 5CT5A 4EJ0A 1BKYA 4HQRA 2HRCA 1ZR2A 3DNMA 1AQUA 3JSXA 3DBLA 4HUQA 2C9BA 1YA6A 5B1SA 2Q4BA 3QVGB 2XMDA 1E8NA 5ALRA 1E96A 1Z15A 4CL2A 3HJAA 3TOZA 4GYWA 3Q72A 4D9NA 1K6XA 2IDKA 4KQEA 3FNRA 1QPGA 2IHVA 3E4CA 4JMPA 4RTNA 1H6CA 1GPAA 1WXEA 4IL5A 4NCIA 4TV8B 2WSBA 3BD9A 4PLPA 5K8JB 3C6BA 2IYTA 3ENVA 3PV0A 1UJNA 2JBAB 3C74A 4ND2A 4C5BA 5AKEA 3HUDA 3PS9A 4ZZ0A 3L7KA 5HUHA 3B1YA 1BSVA 1U3WA 3PFBA 2BEKA 3P0JA 4BDSA 4E2XA 2I71A 3HI6A 3OIWA 3PEWA 2BSQA 5EIFA 3F6SA 2IJGX 4NE9A 4OCZA 2ZOSA 2JEZA 3IBFA 3IQXA 4NMHA 1IM2A 4Q9IA 1OGYA 2ORVA 3ZDXB 3ZGOA 3L0IB 5B2ZA 2DPLA 4KC0A 1N8NA 4L4YA 1VSQA 1P7YA 4O1IA 1NJ2A 1JXMA 221PA 2ZVDA 2GWHA 5D1NA 2E2WA 1ECBA 1Q0RA 1SVSA 3COYA 4OATA 5DNWA 5JE8A 1MFZA 4F3RA 2EFGA 4WBNB 5FOQA 1NX9A 2Q5LA 2BHRA 2OM2A 2PFGA 5BR1A 3BILA 1XRMA 2BGIA 4ESVA 1JA9A 2CXNA 4UZFA 4PHCA 1P9WA 3OQHA 3KJXA 2Y1OA 3DTNA 5CIYA 3O1LA 1KZYC 1YIDA 3H2YA 3KM0A 3GCXA 2Q46A 2YJ4A 3HM2A 4M1MA 3RU2A 4MVYA 4BFLA 3AEZA 4JBIA 4C6TA 2IOYA 4UXHA 4E5SA 2Z0MA 4IRUB 1RE0A 5F5NA 5JANA 2PK3A 2YS6A 4LJ6A 1JYSA 2OILA 3O8DA 1SVLA 3PFCA 4NBTA 1YJCA 4J3FA 4PCVA 4RETA 2VNSA 1Z4LA 2C84A 3HCBA 3AEXA 4M8SA 3BXOA 3FG9A 2G76A 4I46A 3TEFA 4C01A 1F4PA 1P29A 3DWIA 4MVJH 5E4YA 1T2NA 3BK7A 4IXTA 2R5NA 4FFBA 1E77A 3ES9A 3LRTA 4YQZA 2DWUA 4EZIA 3FLEA 4JEIA 4AD8A 1ZR4A 2O2IA 4CQLA 4DLLA 3DOUA 4MHTA 1X39A 3TZHA 1UEXC 1FEZA 4R98A 3WK6A 1V7PC 2XUGA 1RCFA 4YI5A 5CDTA 5EIBD 3W8NA 3W78A 2F43B 5BR8B 1KXZA 1G8SA 1NMYA 4XM1A 3HSSA 1JA0A 1I8TA 2XCRB 1IZYA 1MZPA 4MVWA 4LXIA 3WYFA 3QFSA 4QXRA 1H8ED 3GD5A 4OMUA 1SXHA 3FMPB 2WNIA 3OOYA 3A4IA 3V48A 2E5WA 4HNAB 1FLAA 2F17A 1HZZA 4E88A 2RHRA 2YVUA 4IDNA 1HL7A 2W4MA 1QV6A 1CQZA 2H29A 1PVVA 4NYMR 4XD2A 1UBOS 4IZHA 2XHEA 3IEPA 1SQGA 3H19A 1NTOA 4U2GA 5C34B 5B2FA 1UJCA 5BN3B 2GCOB 4BMZA 5TEVA 2E18A 4OSEA 5FLXA 1UQUA 2FMUA 3P8ZA 1DBIA 2ZUEA 3H42B 4X6YA 2ZU6A 4HD8A 1Q0PA 5LA6B 4DA0A 3AOEA 3UAVA 1NXXA 1N77A 2FR8A 1YS4A 2G06A 4ISBA 3CVYA 5TQ2B 5I9BA 5IF3A 3LUJA 1UXHA 4PRZA 1QIDA 4WOKA 1C7JA 3OPVA 2GN6A 4KE6A 3WBBA 3K5PA 3NBQA 4BPBA 4L9AA 1LDYA 3LX5A 1QXSA 1E79D 1IBRA 5EJ8A 1J5XA 2ZWIA 1G8FA 4I4TA 1FLNA 4ARAA 4U9IS 2PQ2A 3O94A 4AJLA 1NP6A 2XQJA 3K5WA 5BVHB 5I4KA 3QOWA 3MM4A 3TQTA 1O89A 1RKXA 4QC2A 3T3GA 4FZ3A 3HK2A 4E13A 2FDRA 5CTJA 5F21A 1I4WA 2J31A 5DTJA 2JJ1D 2WVJA 2GD1O 4KIFA 3IPLA 1N92A 2AKEA 4JV5B 2YHIB 4W9NA 1YI8A 1UXJA 4IX1A 4M1OA 1ORHA 1OBOA 2Q9CA 1B6GA 1D2CA 2R8RA 1XA4A 3QXSA 2C2GA 3CLSD 4RZQA 3DE7X 1Z6PA 4EJ6A 1REQB 3WYAA 3HP7A 1OIWA 2GNAA 4OHRA 3OVMA 4G1FA 3LY5A 1FP6A 2XUAA 4YDRA 1K2VN 4TTAA 4COOA 1GL6A 2XB6A 3EXIA 5C32A 1L9XA 3CB4A 4PX3A 1WY5A 1BX1A 4Q82A 4ILKA 4DEVA 4Z4EA 4AY3A 2WWTA 5NULA 5KNDA 2HF8A 4WLFA 1B6TA 4MCAA 1OFIA 1S4QA 2BBTA 4YMTA 2ZJ7A 1Y8QB 5HOEA 3IPRA 3NV9A 3CINA 3ODGA 1SKUA 2EJTA 3KLPX 3LW8A 4U9HS 5D51S 4IFTA 5F23A 5KVSA 4X84A 3LMKA 1BAPA 4H1VA 3VR4H 5THXA 3KZNA 1GGJA 1CUCA 1OLXA 4MV9A 3FDFA 2GO1A 1CEXA 2QJFA 2X9NA 3PR1A 3T1YB 1TZBA 2FFBA 4QU8A 5C37A 5U4QA 3X44A 5H9WA 1QVZA 4HB2A 2GVNA 3QUSA 1C2YA 1WUYA 3GNLA 4IH4A 3E6AA 3SF8A 4J9UE 4CQJA 4FR0A 4QM6A 2C03A 5JPCA 1P7VA 2QN1A 4FP9A 4WFIA 2DBVO 4Q02A 4RNCA 5FA5A 2NTEA 1Z5GA 4F8EA 1L5GB 4EATA 1E9EA 1G16A 1W94A 2HLPA 2WU0A 2XWBF 3AU8A 3CT6A 3DV0B 3K2BA 3PFWO 4GQIA 4HMPA 2F7SA 3HBMA 3GJ5A 3HVKA 2QNRA 3OWXA 3B1WA 1SU7A 1ZH4A 1F4LA 1PZHA 4JDPA 4LYGA 4ITUA 1PYGA 5AM4A 4TTRA 2HWUA 4JUFA 5DLQC 2Q8QA 4Q4CA 2FVXA 3KFXA 3PWZA 2O1EA 4U9UA 3IAAA 1DPGA 3SSOA 4C7MA 5AVTA 5FQOA 4NAVA 4RZXA 1NTRA 4OJTA 3TLJA 4B2YA 4PYJA 1IONA 4RA6B 2H92A 3DC2A 5KQPA 4FMCB 4EG6A 4CU5A 5AESA 3WWDA 3TFWA 1GJRA 1IEXA 2CDRA 4WKNA 4TKUA 2WIKA 1JKJA 4COKA 4JLKA 1EJ2A 1JKMA 2EKPA 4GR4A 3AY7A 2WAOA 1XEAA 3WB2A 4AJNA 1AKRA 1T8UA 2WYOA 4GHWA 2C5LA 2JJ2A 2GQ0A 1E9CA 3CPSA 3JAWB 1AV6A 1YD7A 3DZKA 1I30A 4BB0A 5GJCA 2O19A 2GETA 1ULBA 3N2IA 3Q2KA 2C04A 5K8CA 2JGMA 2H8KA 3LDGA 4CM8A 1ABEA 1NVWQ 1WXXA 2LDBA 3HACA 3LYAA 4K9OA 4OQFA 4Y0VA 4EF4A 4YR9A 2EHJA 4POAA 4B6SA 4RPGA 1Y3AA 4NK4A 4RZ3A 2DR3A 2H2IA 3BSYA 3SOPA 1R6TA 2JFWA 1U11A 4HRAA 1JAIA 5GJVC 3HR4A 4H7EA 4MUAA 1YL6A 2GYUA 1LI7A 3FZYA 3LOUA 4WKOA 4Y7CA 1BJKA 2R6JA 4OHVA 2ARKA 4HH1A 3D7LA 5DYGA 1DEHA 1G60A 2I29A 2JAOA 1EAMA 2XOKA 5IVIA 5TPZA 3T15A 3ICQB 2EYUA 5HW0A 4WKCA 4HT3B 1L5ZA 3MBIA 2D0DA 2VUUA 3EQ2A 1FVHA 4LJRA 2IHUA 1SC9A 5HPYB 4DWVA 1Z6YA 5G0SA 4ZYUA 4FYYA 2WSMA 1YQGA 2BFDA 2H1HA 1GNRA 4UEOA 1J8VA 5KYUB 4H2DA 1O95C 2GASA 4HTAA 1U9IC 1XZGA 3N6RA 5F33A 5CIQA 1PYOA 5EJ2A 2NZUG 2NACA 4RSMA 4WOJA 4LZNA 1ORDA 4Y2HA 3FLMA 4IRXA 1AK2A 4N40A 4O4JA 2JGNA 5DHAA 2H65A 4O2BF 3KEGA 4TXHA 1ONNA 4OD0A 3RS5A 2I0FA 3K4PA 5C3MA 1J25A 2UUCB 2R4QA 4HLUA 3KVYA 4E03A 3L07A 5JRZA 1ID8A 3ROTA 1JU9A 3I6ZA 1E0KA 4FQ5A 2JNWA 3IESA 2OGUA 4BKPA 4IO1A 4QU5A 5J2UF 4A5OA 4BTLA 1XTQA 4DTIA 4YLYA 1EINA 3CVUA 3N39C 1ZU5A 4HWGA 2JI4A 4BNDA 4YRNA 4DIBA 2C2XA 4IMIB 1JS1X 1T0HB 5E0KB 2HWYA 5E3JA 5HK9A 4BFSA 3RBAA 1AMUA 1PEDA 3IKMB 4KBYA 4P7KA 4Y1RA 3GLSA 3ROEA 1S8AA 3U0BA 5DEIA 2WKQA 1Q12A 5C7YA 1AUOA 2COUA 4RDIA 2HXGA 4MIYA 1UZAA 4OUDB 3UQYS 3WGUA 4GSKA 1RLIA 2FVYA 1WNTA 2CVQA 2D2FA 2FR8C 2YL2A 1I6MA 4MYTA 2DY1A 4BNTA 4EQZA 5F7XA 1ECCA 1CETA 1JTEA 2BGWA 1WG8A 1SCQA 2GJ4A 3L4BC 1S9DA 2E4VA 2FSFA 3AM4A 1EX1A 3DEYX 2QL7A 3FYCA 1YCDA 4TXNA 4QOEA 2NO0A 1LQTA 4BO2A 3FPHA 3AVUA 4CM9D 3IHWA 1X0XA 4RA9B 4YAKA 5KNBD 2FR0A 2ATEA 5D5PA 3LLCA 3A6HA 5H5JA 2DT8A 2IBSA 4OIMA 4DIKA 3DB2A 5EI5A 5D6OA 3EXHB 3L02A 3MGKA 3DE0X 1COZA 2WFLA 3RWOA 1EP9A 2J0UB 1TQHA 4HEA6 4L6AA 3S70A 5K8VA 5ERYA 1LLFA 2Q5EA 1REQA 3QE2A 4HPWA 3AJAA 3U3JA 4GX5A 2B5OA 1RI4A 1S7GA 4KNVA 1E8DA 2H5IA 4FLFA 3AEQA 4HQ6A 1GLGA 3SX0A 4Z4QA 3BEDA 2GJ9A 4BWGA 5HE8A 1YNSA 3G2MA 1F14A 2Q3BA 1GZDA 2XCOA 1W47A 1Y80A 3GG2A 3C3JA 1M1NB 1MVLA 3CLSC 3EARA 1JHXA 4MWGA 4D3DA 1ZOLA 3HRKA 3IAS1 1CP2A 3ILSA 1JKXA 3AW8A 1VL0A 1PG2A 2NYVA 2ZRPA 3FMFA 5EFZA 2JK1A 2AYYA 5FL7D 2Y77A 4LXYA 3ZEAA 4BBPA 2HSWA 4CJXA 3P2OA 4EG4A 3CC8A 3SJ7A 2WFAA 1RXSA 2DGDA 2IUFA 2C31A 3AEKB 3AR6A 4GICA 2QRPA 2Q5OA 3RHTA 3RTCA 3QK7A 3NR2A 3FKSA 1XU9A 4UVDA 1YRAA 4MLCA 1WE2A 3HYNA 4M1WA 3I32A 1UPTA 4NH0A 4V0RA 5F1KA 1M2VA 2GM9A 4E7PA 1E2JA 1IPHA 1UWCA 3TM5A 4BLQA 2AXPA 1XQYA 4DF3A 2CGEA 4ALIA 2VJBA 1V11B 3PGKA 3K70C 2QT0A 1GT6A 3RSZA 1XOIA 4OH1A 1CBUA 1E0DA 1N0VC 1ZXXA 4QGGA 1L5RA 3UWDA 4UBKA 4UULA 5I7HA 3KWJA 4FD2A 1N9GA 1K68A 2VXOA 4FIZA 1XMJA 1GPJA 3FI9A 4IIVA 3UK1A 4BLTA 2BH9A 1IY1A 1EP3B 5T41A 3GRYA 2VYND 1RZRA 2O05A 3CEHA 5BRNA 5HXAA 1SZCA 1Z07A 3GJTA 4OJQA 3VYSB 3GXOA 4EVRA 1CR0A 3HJNA 3KTOA 5FYQA 3UHJA 4YEDA 2OQ2A 2EJWA 3BTOA 2GTPA 4R2WA 4AAYA 4EHJA 3FTCA 1E7WA 4JB8A 4LDPA 3LRPA 1U0EA 4P5PA 3PHIA 2RGUA 4BTVA 5MGBA 2HT1A 2YCBA 2OHVA 4EPYA 3C8HA 4P3OA 5AJHA 4C7VA 1SKYE 3TZBA 2O3JA 4O4HA 2Z9DA 2GPJA 1EMDA 5CLLA 3IGFA 3G0HA 4WFJA 2ZBGA 1O77A 2QJWA 3GW8A 4LPSA 4C2TA 1UOQA 3ADDA 1V26A 3OT1A 3MS2A 4JBYA 1OU4A 4D9JA 1DAOA 5EHNA 1EFLA 1M1NA 1KJZA 3A4YA 3DQQA 4MEBA 3VDXA 3WLRA 4M8IA 3T4UA 1R9GA 3SR4A 4NCAA 1WSAA 5AK3A 3INRA 5JYCA 1XTRA 1U8AA 1SK8A 3AF4A 1RHRA 4CR8A 1GPMA 2ATIA 5DIFA 3F5MA 1VYUA 5JWRA 1RMYA 2R8OA 1DC5A 4H1UA 2RHLA 4NOJA 1V43A 1DTSA 2XQGA 3F9RA 1JLRA 4QJ5A 4R2HA 4YJ3A 4B6OA 4S1OA 1P7PA 2RAFA 1XRSB 2AXEA 3MJHA 3DHEA 1BMTA 3EHDA 2MMGA 3FYUC 1HURA 1RPNA 3FWKA 4QZVA 4IIJA 1AU9A 4EG1A 1PNRA 1E99A 4ODIA 4XYGA 5IXJA 3MA0A 5MF6A 3IPYA 1NQUA 2QV0A 2HIGA 3LF1A 2FXIA 2GEJA 3DLBA 2I6SA 3Q3CA 3NHAA 4QL3A 3SFTA 2NADA 2PTGA 4PAMA 1JI3A 1NOIA 1OZHA 1J9EA 1U6IA 2J3EA 4ENPA 5BV1A 1CUEA 5EQFA 4OL0A 4WBNA 3GBPA 3N3BC 5LDHA 1G41A 4PGFA 3N7AA 1JUDA 1VP3A 2HLHA 2AR7A 1E5TA 1KO4A 3G2LA 3R44A 4IXMA 4LOHA 3ZE6A 3SIPA 4RAQA 1XZAA 3ET4A 3QFHA 1EVQA 3K53A 4UEKA 4JYAB 1P4AA 1CHDA 1QGUA 3AILA 4PC2A 4XE5A 5T4FA 1UKVY 4MRVA 4DG5A 2YDYA 5IHXA 4MUBA 3F5SA 3BTSA 3RF6A 2JFUA 4P6VF 1URPA 3B1KA 4S24A 4DV6B 1TPZA 3FGPA 3PNBA 1E3WB 3AJDA 3SXUB 1C50A 3LXRA 2CL6X 1DOZA 3IVAA 3FCUB 1RJGA 5EIOA 2REXB 3RS0A 1CUVA 2A30A 1YB2A 3I2GA 2PYDA 4ZKEA 4DUGD 3CZ5A 4KXWA 3I3SR 1D6SA 1TO6A 3AIIA 3X1ZA 5IKMA 2ACWA 2WE7A 3D0KA 4G97A 1NW3A 1GTG1 4JOCA 4OFWA 5FH9A 2PX4A 5D5HA 2PMWB 1IWOA 1NBME 3GRZA 4RCVA 5CK5A 5F35A 1KE2A 1FDUA 1DFGA 2PSSA 3WNVA 5CLJA 5KIAA 1X15A 2JCGA 3H2IA 3ZY2A 3BA6A 3S55A 4ZHQF 3HCOA 3ZVLA 4A10A 5DIZA 2QK4A 2VP4A 1ZN8A 1Z62A 3S0JA 1GNLA 1YQUA 3PXUA 1Y7TA 3TYXA 1TL7C 4DGSA 8LDHA 3UFBA 1VGRA 4WNIA 3TPZA 4B32A 5FUMA 1KI6A 1WBDA 2ZQYA 3C3KA 4N82A 5MN5A 3CRNA 5ALVA 1Y4AE 3AZQA 2CXSA 1PJAA 3SOZA 2O0KA 1DDOA 1PKXA 1RJ9B 1U6JA 3F9IA 3MYRA 2GA8A 4AK9A 4DIMA 5TDHA 2H1RA 3KKLA 1XDSA 3EOAI 3D4IA 1M6VB 2EGHA 3OEYA 2X9LA 5DOVA 1VE5A 3V1NA 1QCCA 2BDUA 4E14A 3AVWA 2JPDA 1JVNA 2BKLA 2OAEA 1BXKA 4PBSA 2VF8A 3BIFA 2X41A 1YI0A 2WJVA 4ZVRA 3I6QA 5CFNA 1QBKC 5EPUA 4B3MB 2G72A 2H3EA 3RPEA 4CTNA 4PY2A 3LC2O 4CIXA 3KLMX 3PHBE 4WK6A 3GN1A 1Y81A 1T5HX 2HA6A 1DARA 5BSRA 1A5BB 5MFPA 4XVUA 1CY8A 1RYYA 3BIJA 3LRXA 1PJ4A 4HMQA 4JVNA 3BCUA 3LT4A 4JX8A 1H22A 1XJCA 1I3CA 2QUAA 4QG3A 1QAOA 1NBIA 1R2QA 1TW2A 4D9KA 5LQDA 3IEMA 4FN4A 4BNGA 3U48A 3C7DB 4TS9A 2AYXA 2X4DA 2A5DA 2RBKA 5AVSA 4JLAA 3USZA 1JF8A 1NY5A 1WEKA 2A1IA 2NT3A 1UBEA 3L9XA 5A7GA 2YJ6A 4A2PA 2VJYA 1RKQA 3FUUA 3T1OA 3KKKA 1T6NA 3WWEA 1YZNA 2DYKA 3QBVA 4UM8B 5CYPA 1DKQA 1SN7A 2W8BB 3UH0A 3RK4A 3WYBA 2C4MA 3LQFA 1KJIA 3C4VA 3NEPX 3VDMA 5CCXA 1M2EA 2V55B 5T5QA 2BFCB 1HETA 5KAPA 3VSBA 4EI2A 4M9UA 4RSGA 2CHVA 1PP4A 2NYRA 4IDAA 4S1WA 2ODQA 2ZSFA 5EA2A 4RENA 1NKTA 1VZ3A 4RXTA 4UHDA 4B74A 3DV9A 5TB5A 1TM7E 4B6JA 3LL7A 3L79A 4L4RA 4PSAA 5KUTA 4F1JA 3MZ0A 4CGZA 1P5FA 3B13B 4CTJA 1FZTA 2D3TA 2C0PA 5AIBA 3NCHA 4OUKX 3VV3A 3TZCA 4B33A 2Q4TA 4XIGS 4EVSA 3DLTA 4CN9A 2OBXA 1X8XA 3KOZA 3AETB 3ME5A 2VYQA 4OHFA 4XA8A 5G3ZA 2VQSA 3BMOA 3FSGA 3QVOA 4KI7A 5B12A 1IFXA 5LZ8A 1I2DA 1SRRA 4PCUA 4B2IA 1HK7A 3DWEX 2JLQA 1U3UA 3FZQA 1VYHA 2ZRFA 2HW8A 3Q8WA 4P34A 2HN9A 1QM5A 3IOCA 3OE7A 4JI8B 2CD7A 1F9AA 2I8LA 1ZL2A 4GEGA 4MJ7A 3D3NA 3QKSB 5ALJA 3TLKA 1OTXA 4N6NA 1R6BX 3UXMA 5EWLA 1KORA 2QRVB 1OWOA 1ZD5A 4D5EA 4RIEA 1KHHA 1MORA 3PI7A 1SUWA 1E2FA 5AQEA 1HNNA 2CEAA 2Q0XA 2UZIR 1T2CA 4DC0A 4E70A 1KRHA 2Q5FA 3WGOA 1FX0B 4DWOA 1PTJC 1BH2A 1GXSB 2VJLA 1UM8A 4JKOA 1E69A 4GVPA 1QMGA 1PDVA 1SM4A 1TJ3A 2NSJA 3LHKA 5TMDA 4DCVA 3KB8A 1QFMA 1MD9A 1FCJA 1US8A 3E8SA 3V1TC 1KFBB 2FRDA 1KXJA 1M6VA 2BTQB 2E37A 4G37A 4GG1A 3MJ4A 3VKUA 2UUBB 2FLKA 2EHDA 1QRSA 3TSAA 5ALZA 1V1MA 1VBFA 1JHOA 1VKOA 4LCBA 2GTHA 5FOWA 1Q0QA 5H3HA 1XSEA 3EZNA 3P9ZA 4TKZA 2VHQA 2PSJA 4JBGA 3I9MA 1L9KA 2WMYA 2TMYA 3GEHA 1F8XA 1P0QA 5J63A 4NYJQ 4DFDA 2G80A 1MJFA 3S3TA 2QD5A 3GB9A 3ZWYA 1RRCA 3EIWA 1U0HC 3BD7A 1BS9A 2CMFA 1X19A 3PENA 1JG2A 4XAQA 4YMHA 2WMNB 1VKRA 4J90A 2D00A 3CRMA 1QC5A 3MTBA 4Q3DA 4E07A 1H5NA 1XLVA 4WK4B 5IULC 5KPDA 5F1PA 1FE8A 1TQDA 3T0FA 1U9YA 2QYHA 2XYGA 4ETIA 4P82A 2GWRA 1M1XB 1SBTA 3A10A 3KBBA 1JECA 3MTDA 1R88A 4UC0A 5TPWA 3SCZA 5BP7A 2WD8A 5E0OA 1AURA 4F06A 2CUZA 2GPSA 1D7OA 2HRBA 1J1ZA 4WW0A 4CG1A 1S3IA 1JSZA 1N1DA 4B5KA 1BN6A 3E9CA 3VQTA 3ND8A 2IS6A 2QN9A 2BHSA 1AY0A 3GLIA 2O8FA 2V7WA 1MLDA 2GMWA 3OJEA 5JTUA 3UB4A 4WEQA 2XD4A 2FPXA 4QEDA 2FOLA 3SEFA 2H4WA 2Q7DA 3RUEA 3MS4A 2ZRQA 3RS8A 1HMYA 1UKAA 3AYXB 3PFFA 4UMDA 1I5RA 5JSHA 2JIBA 1TCUA 4YJHB 1UFOA 5DW3A 5JU6A 1OTYA 1TADA 1LDMA 1P8AA 1X8JA 3CXUA 4BTEA 2WUEA 1Y6FA 1HE4A 4OXIA 2BP7A 4G4SP 1C0LA 4Z4GA 5DMHA 3ZQUA 5I9LA 3CW8X 3S8MA 5HS6A 1RYZA 2NQ2C 2C4TA 1CCWA 4L9SA 1QJ4A 4D4MA 1PL7A 3H9QA 3HGQA 3OJXA 1DQRA 1SUSA 2HF9A 1YJAA 3HADA 4O2AA 3MUFA 2Q2QA 5CLHA 5ABPA 5KYTA 4GMGA 1MUUA 1SY7A 3R0ZA 4ZO4A 4Z9YA 1UK9A 3Q6NA 2PKEA 3R6DA 5DM60 1B76A 3B36A 5JSQA 3FMOB 3WYDA 5J4LA 4MW4A 1GSHA 4LJYA 2FE4A 5JO9A 4QSHA 4YV2A 5A5VA 3O4FA 4MWDA 2POCA 2Q2NA 4K9QA 1KSFX 3IB6A 2X19A 3O2QB 2M6KA 1RCTE 2IK8A 3C6KA 5C18A 5J2TB 2NXWA 1KYTA 1T0JB 2OXEA 3MYYA 3NRBA 4IHJA 4B80A 3B8HA 2KLBA 5JG7A 1NJ8A 3D59A 4ZZ1A 1H6AA 1YRLA 1X1TA 2HCJB 2NU7B 5I3CA 5C8VA 4Q3CA 4C05A 1CRLA 2UVDA 4UTPA 1NOKA 1WBJB 1EJBA 1IOWA 1K97A 4EBBA 2BWJA 1U04A 3VYUB 5EESA 4AP6A 1YHZA 5IT4A 4R68A 2EX1A 2DRIA 3X1WA 3PJRA 2DCUA 1D2EA 2QQFA 4MS4B 4HVCA 2GKSA 1UEJA 4JWKA 5I6DA 5GINE 5KPJA 2Q0HA 2ALJA 4Z8XA 2EKQA 3L8DA 1ONOA 1QFJA 5ENVA 2WG1A 3I2YX 2QEQA 3ZY6A 3RJTA 4AJ2A 1QVRA 2OYSA 2JZCA 1TK2A 1T9CA 3K73O 3K1ZA 4IJVA 4CG3A 4IH9A 1MB0A 3D6MA 2EX4A 1CS0A 1XF9A 1QRRA 1DOAA 3O8OB 4UMVA 5CMLA 3Q8KA 3ZXXA 4QNMA 4CI0B 1H8EA 3ONDA 3EVDA 4IQ0A 4GXNA 4QQ8A 1FF9A 2QYTA 3BUSA 2DWOA 4K9KA 1CUZA 1FRQA 1ZH2A 4P2BA 4Y6RA 4YP0A 2OHIA 3X1MA 4AVYA 3KVOA 3SQDA 2GBLA 1H3EA 1KRWA 4MUEA 2W2XA 3CXRA 5BMOA 5AW4A 4ZALA 4IW3B 4L2IA 3TRDA 3W2HA 2J3IA 1TK9A 4R2XA 1IAQA 4RGQA 1XRPA 3CX3A 2PX6A 4KPUA 5DXJA 3A27A 3KSBC 4CTMA 4NFHA 3WGKA 4EB6A 1V1RB 4JVMA 4X91A 2PRSA 4JYBA 3V2UA 1JXOA 3HM9A 4A15A 3F3YA 1JEOA 2CHEA 3I6BA 5K03A 3ICEA 4KIWA 1PKEA 4OBXA 3VJKA 4X6UA 6ADHA 2NZ2A 4GFDA 2H18A 1U8UA 3MJRA 1V95A 4OOFA 5CPBA 2NPFA 2WWWA 3VH3A 5IS2A 2C3MA 1G19A 1Z8NA 5TT0A 4EW3A 1BDBA 3HJUA 2ZYAA 1E9AA 3SQLA 2QY6A 3R7WA 2XZLA 1RWVA 3U7EB 2P4EA 3WTCA 4XTRA 5DN9A 4LNAA 2R6AA 2FP3A 5JBIA 3WB1A 2X0NA 2CF5A 2R79A 3KLBA 4JP8A 1T34A 3K72B 3H3FA 5T64A 3VTKA 3O3OB 4N7MA 3GNQA 1X3SA 2V6MA 2XGJA 3K15A 1DRWA 2W48A 1R7RA 4F04A 2OXCA 4R2JA 3V46A 1QFZA 3HKBA 1GKIA 3CG4A 1JMKC 3DBRB 3TPCA 1G9SA 3MRVA 4Y3UA 3TGPA 1GKKA 3ORYA 4GMXA 3E9RA 1MC4A 4YV7A 3BK2A 1SQFA 2WJ3A 3UUFA 1N2SA 1PZXA 2BKAA 3LPLA 4RKRA 2YBEA 4BVEA 4NG4A 3GXBA 1X74A 3TAUA 2VT2A 2PLNA 3AF1A 4EB3A 3H6GA 1P77A 5B1EA 5KQSA 1QIHA 1T9HA 2JI8A 1SWWA 4ZCMA 1HOTA 4BL5A 1CUSA 1A77A 3IBTA 4KLRA 3NOXA 1A8SA 4D4LA 1EX6A 2QG9A 3VZPA 3Q0IA 3MCUA 5BUQA 5C5CA 5CX1A 7ABPA 5SYAA 2ZT7A 4NHEA 3RYCA 2AG6A 3EK2A 4XQGA 3SHVA 1RYEA 4HWSA 2EF1A 1CZHA 4Y2XA 4YJFA 3IPAA 3INYA 1J22A 1GU7A 2JBWA 3PIDA 4Q37A 3UYLA 3ZDQA 3WB9A 4TYWA 4Z49A 1QGOA 3K9WA 3GRAA 2QW0X 3QIAA 4M54A 4G01B 2JJ2D 4QELA 2VP3A 4PRYA 3TLXA 3E8MA 3ENQA 3PC7A 5AKJA 4EPTA 1EK5A 1JV2B 1YDWA 1J0DA 3MCAA 2PYZA 3GPCA 3PZRA 1BJRE 4F6RB 2IEDA 4RKWA 2YIJA 2JEOA 2VJNA 3G2JA 4R3WA 3WMFA 3P27A 4Q0MA 5ALTA 3S7TA 3O4IA 1GGKA 4I9HA 4P08A 4K2HA 5FKJA 5D5QA 2ATVA 1XAIA 2VP6A 4S1PA 3OJFA 3CZPA 2WNHA 4IFIA 1UT6A 4DT1A 1LXCA 3KIPA 3C7TA 1O2DA 2KSQA 2OCIA 3H1EA 3KU1A 3L06A 3RU3A 2JJ1A 3T7SA 3CX4A 3F4LA 1SC6A 2WILA 4HDNA 3RQSA 3BFXA 1EA5A 2G4VA 5TQ0B 4NENB 5EMNA 3W1WA 5BNTA 3IP8A 3KV1A 2KBEA 3LCRA 3D4NA 4BNKA 1B0ZA 3C3PA 3GEEA 2WOJA 4H3SA 4FJ2A 1PR6A 2W58A 4JB0A 2A58A 4QUDA 3FB4A 121PA 4ICIA 2H8GA 4OJKA 1TJPB 4LHZA 1AHHA 1EHCA 4YRFA 2OPBA 1NMQA 2ZRIA 3Q9SA 1DHRA 4W5WA 2XDWA 2FEKA 2AR0A 1Z0UA 3EGIA 1NUHA 1KI1A 1NE2A 5EPEA 4ARCA 2O8DA 4QBIA 2HDOA 1NFQA 1X70A 1WNFA 3EEYA 1AF7A 4MCIA 4OG2A 4OREX 4RMHA 3RS7A 3V9PA 4PXAA 2ZVPX 4EL0A 1YBMA 3E3OA 2RB5A 3AH8A 1F4VA 3DL0A 1ZI6A 1TD1A 3KUXA 5EIXA 1FFEA 4C0HA 2H2FA 1M7GA 3BD6A 3NFYA 3AG5A 3DOEA 4TSFA 3V4SA 5J1TB 5L7YA 2ZIWB 2CYBA 3EMBA 4Z9BA 1SUIA 3D6AA 4FBMA 3UQZA 1A8IA 4KAJA 2LKDA 4LRQA 1VQ1A 2R44A 4OH7A 1GPNA 2JFHA 5G1NA 3SYKA 1RJFA 1CXZA 5AVJA 2ZSJA 2R97A 3N8KA 1R27A 2V65A 2C4NA 2WB4A 2Q9UA 2L2QA 3KJZA 1WMAA 1BE1A 3RT7A 3VTZA 3TSZA 3AHDA 1N9GB 3GAMA 3RHFA 2XTJA 4GBJA 1QHYA 1V9SA 4Y2VA 1UXKA 3IIIA 3ZW7A 3RJZA 3OQVA 3IOBA 3FAZA 3LP5A 4RZHA 1TKBA 2H1SA 3K8QA 3ICVA 1CY4A 3E15A 2Z6AA 4FSHA 4PBRA 3ZU6A 1PG5A 1F8GA 5TT1A 2YJTD 4KMOA 1YOBA 5KYUA 1QPBA 2JRLA 4W8GA 4G4JA 1SURA 1MC5A 4P9NA 3ZTYA 2JH9A 5CPFA 4Q6BA 2UXBB 3UPDA 3II6X 1P2BA 3TTUA 3CZ9A 3WWYA 4GPEA 1X1RA 1MU0A 3H0CA 5IARA 2EKZA 4AWXA 2B7LA 1RI5A 4XWOA 1B8PA 2W2MA 3KV3O 4ALNA 1OY1A 4XSVA 2ZANA 1QYRA 3U44A 1U8ZA 1YR7A 3RSHA 3MINB 1DUIA 3PC3A 3QLVC 1JU3A 5HKKD 1G3RA 1T2FA 2ZI4A 4HWPA 5C52B 4KWIA 3PNQA 5AJWA 3K1AB 3MJTA 3LBHA 4BV8A 2NVOA 1TGYA 5CXUA 1FMCA 4FFNA 1QF9A 3AJ9A 3CKMA 3FYUA 3N2ZB 4RQTA 1AN0A 4ID3A 4DR1B 1N6HA 1T5BA 3CIOA 1W85B 1ZCAA 1PR9A 3GA7A 2BY4A 3KFLA 4XUEA 2QP4A 4L5JA 1MEEA 2GEKA 2X9GA 4Q4LA 4PQRA 3A4LA 1OC2A 1J8DA 4FKMA 1IJKA 1LDEA 1E2UA 1HWYA 5AKHA 4CDMA 1CDOA 1FYWA 3H0KA 3K1JA 1CRQA 5IAOA 2CFOA 3GGDA 2O8BB 1G7SA 1ZW6A 4HDCA 1KR2A 1ZD3A 3CY6A 3QVXA 2FGJA 3HVJA 2HA5A 3HPRA 1BX0A 4G8DA 5AVUA 5T67A 4GBED 3TG8A 1OR8A 1GARA 3S6JA 1U1EA 2G5GX 2OO5C 3E81A 3H86A 3X2EA 4DC1A 1J8MF 3ZYZA 4GZMA 1TEXA 3I01M 4YWHA 3LY9A 1CQJA 5F5LA 4D82A 3KL4A 1KI4A 1K92A 1W5EA 3HU1A 4YX9A 5IBCA 4IKEA 4OB6A 2ZROA 5JZMA 4YMVA 1L3CA 5F9MA 1WETA 4W1PA 1D1QA 2ZTUA