4QM7A

Structure of bacterial polynucleotide kinase bound to gtp and pdna
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLMSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of bacterial polynucleotide kinase in a michaelis complex with nucleoside triphosphate (NTP)-Mg2+ and 5'-OH RNA and a mixed substrate-product complex with NTP-Mg2+ and a 5'-phosphorylated oligonucleotide.
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Transferase/dna
molecule keywords Metallophosphoesterase
total genus 64
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qm7A00
1ODFA 1SVMA 2RGAA 3I73A 3QPVA 1ZIOA 3S1AA 3SJCA 2CNWA 2F1HA 2Z43A 1R2QA 1UKEA 1JJVA 2V6IA 3DPUA 4GRAA 2AHOA 2X19A 2OM2A 3CWZA 4GP6A 3QPUA 4HI0E 1KK0A 4QXAA 1IXRC 3Q3JB 2R6FA 4YDHB 1DVRA 4HSEA 3OFNA 4XWAA 2C9CA 4M21A 1AS0A 1FX0A 1WE2A 3ZH9B 2WIBA 5DLQC 1Z63A 2C5LA 3HPRA 1OXUA 1QRAA 2GXSA 2X8AA 3EXAA 4URUR 1XP8A 3VU9B 2C03A 2J46A 4DT1B 3CX7A 3D3QA 3K70C 3HYTA 4JJKA 1UBCA 2IEYA 4RCYA 3ZIAA 5KNCA 1KSHA 5LB4A 1NMXA 3B2EA 1Z0DA 3NC1C 1QVRA 2OEPA 4OQFA 1Z3IX 2MSDB 1KI9A 1OXXK 1E0KA 2J59A 3QOFA 2NZ8A 2R2AA 3PIRA 4TZ6A 4LCBA 3A1SA 3W5JA 1TU3A 4R2IA 3D8BA 4CEIB 2HXYA 4DZZA 3CPEA 4TL7A 1YZKA 4IOLA 2QM7A 3DZDA 5JCZA 5ANRB 1ZVQA 1MV5A 2CCJA 4JMPA 1DOAA 2PJRA 5FOVA 2C95A 4U02A 2OT3B 1IY2A 4PHGA 4NYMQ 4FCTA 3SJZA 5JS8A 1UJ2A 4KU4A 4TLBA 1TEVA 5AWFC 3G5UA 2AWOA 2CHQA 1OFHA 2DR3A 2LKCA 4Q47A 1KO1A 2WHXA 1DO2A 3WYGA 4PO8A 3RS0A 1ONBA 3WP1B 3ZQ6A 3ZVLA 1W4RA 2AR7A 2W6IA 4MGIR 4OHVA 1BO6A 3QKRB 2RGEA 2TMKA 4ERNA 5IK2A 4WA7A 4MRNA 2CLSA 2ZYVX 821PA 4HLQB 3LBIA 5CDFA 1FTNA 1XD8A 3RWOA 4G01B 1JQLB 6Q21A 1J70A 1ZW6A 3B7GA 4GMXA 2W2VA 2QZ4A 2PMDA 3R7WB 2CCGA 4GOKA 4RSGA 4Q4HB 3TKLA 3T15A 1ZRHA 3Q8XB 4X8OA 3TSWA 5FI0B 2P3SA 2CDNA 3PCRB 4JBXA 3DZ8A 2VHUA 3NH9A 1P9NA 3RSLA 1L4YA 1FNNA 3BK7A 4PPGA 4RD6A 4II7A 2AKYA 4M1WA 1E32A 1US8B 2AD1A 4DLRA 1F2UB 1HQYE 1QHGA 1II8A 4MYHA 3ZD7A 4KODA 1LW7A 1KI6A 2JCSA 2I1QA 4PHFA 2BOVA 4S2EA 5JRZA 3MFYA 5CIQA 1M1YE 5AK0A 3C16C 4OK6A 1IN6A 1YZQA 2PZGA 3R9XA 3TW8B 1FFHA 1Z2CA 1M34E 3NH6A 3SJAA 5ELXA 4UXIA 2VYFA 2PLRA 5AUPB 2D4HA 1JR3D 3TNFA 1KJYA 3NG1A 3FMOB 3O8DA 2N46A 2V54A 2YZ2A 1E96A 3N2EA 2J0QA 2QRZA 3I61A 2P65A 3BIFA 3VU9A 4DT1A 1FW6A 1DG1G 4ZO4A 4ZCIA 2EYUA 3N70A 1Z08A 4AD8A 5FUXA 1QBKC 4G0NA 5BN5A 1JR3A 5F3WB 4IDNA 2FFAA 4Q1CA 2O8CB 3K0AA 1SKQA 3ZS9A 5KSOA 3GLFE 1Q12A 5HE8A 4MYUA 1YZTA 4QBIA 1KY3A 4GP7A 4M9QA 1CP2A 3CIOA 2W0SA 1V5WA 1KK3A 1RC8A 2R65A 4DEYA 1QHHA 2WJJA 3U60B 2R9VA 4LK2A 3MWLA 4BZXA 4B3FX 4C0AC 2IX3A 1YR6A 3AKYA 4DDUA 5HCNA 5A4JA 1Z6TA 1Q1EA 2CJWA 4R98A 3FHOA 1BOFA 1P6XA 2WWHA 5KOYA 2QN6A 2ODWA 3B1VA 3VAAA 1S2MA 4B6EA 4PZYA 3K0EA 4JYBA 1AA9A 3V4RA 4EPWA 1CTQA 4M1KA 2A5JA 4LWZA 3E1SA 3PJRA 1X1RA 4OI2A 4DB2A 5CK4A 3UPUA 2WWIA 1RZ3A 1V43A 3BORA 3FTQA 5FBLB 1HEIA 4BWYA 4JJZA 2AFIE 4LPSA 1NF3A 2NZJA 3A4LA 4U7DA 3THXA 3LO5A 1GKUB 2NG1A 4OQLA 4KHZA 3ADBA 4US0R 3SBEA 4HLCA 1R0XA 3TW4A 3X1YA 2F9LA 2IT1A 2R62A 3GEHA 1R4AA 3TAUA 5KPJA 1ZU5A 1SVWA 2VQSA 3PQCA 5BW8A 2DFTA 4OYHA 4TYPA 1N6HA 2XITA 1SZPA 2EFDB 3ONWA 4HUQB 2C77A 4XVUA 5IHPA 4HAYA 2B21A 5LD2C 3IHWA 5FI1B 4J0QA 2WMNB 4PPQA 1HQCA 3CX8A 3DM5A 3VHLB 1W2GA 2WOOA 4MKIA 3NEJA 5AR1A 1Q1ZA 3AM1A 1E79A 4JL5A 2WJGA 4B2LA 5IF9A 3D31A 3JVUA 1E9DA 1G3RA 3HYRA 4WBSA 4YDSA 4B74A 2L0XA 3AUYA 4Q4AA 5FL7D 2ZRNA 2HCJB 1G8HA 3QKSB 3T35A 1Z8FA 1PUJA 1S4QA 1DE0A 4BFSA 2GXUA 2ZI5A 5GVRA 4D0LB 4AKHA 4PX9A 2EFEB 1RJ9A 2PEZA 2NMVA 1ETUA 3K0CA 1E2FA 2QGNA 1GZSA 4NYIR 4QGGA 1SXJB 5HCIA 1ZP6A 2JLXA 2YC4C 2GZDA 4FWIB 4G5GA 2GCNA 3AV0B 4FI3C 4G3XA 4RD1A 4Q4LA 3C5CA 4EFLA 2CMKA 3FWYA 1UAAA 1COWD 3AKDA 3RVBA 4WIAA 4ZCMA 4MKFA 4V0NA 4LPKA 1Z6AA 2OG2A 1ZCBA 1P2UA 1CR0A 2WWXA 3A1UA 3KDSE 1MH1A 2IHBA 2C04A 2O0HA 2QORA 1P72A 4XTRA 3OHMA 4EJSC 5B57C 2IYVA 5EJEA 1H8HA 2IC5A 1U0HC 2O52A 2IS4A 1X8LA 3CH4B 4QJ5A 4CEJA 2GKSA 3MD0A 2QSYA 3EC2A 3LQRA 3M0EA 3G0HA 4A8JC 2F55A 1CU1A 4QHSA 2BBWA 3CLVA 2P6NA 3GJ3A 2JLSA 1GL9B 4OQNA 4QGFA 2FV8A 5JHHB 1GWNA 2BKEA 4URWR 3KXLA 1BKDR 1E2DA 2O8EA 3QJYA 3WXMA 4Q1AA 3GLFA 3WBJA 3MWJA 4BGDA 5KSYA 3CRRA 4TL6A 2OAP1 5KSPA 1GL6A 2OFXA 4PQFA 1W49A 4N3NA 3FKQA 4N0EA 2REBA 3BGWA 3LFUA 2RGNC 1T6NA 3LW7A 1GSIA 2BDTA 3CNNA 3KKOA 4XTCS 5GADl 4HEJA 1E9SA 3K8YA 4RD4A 3RS3A 1OE0A 2ZS9A 2ZRDA 1IN5A 2GK7A 2JLQA 2G0NA 3OFND 4UNSA 1P5ZB 3TMKA 2B7BA 2FGKA 5EP1A 1OH5A 2V8OA 2OESA 3QPWA 3ADCA 3UMSA 1GDDA 1ZYUA 2XSZD 4ARZA 2QUZA 4QC2A 2JJ1D 3ZIAD 2ZUBA 1EWRA 4LBVA 1J7KA 2AL7A 4A2QA 3I3SR 2JLYA 1SVOA 4JVMA 3VMFA 2JJ8A 2ERYA 4I81A 2WZQA 2MMCA 4FIDA 3Q72A 2VHTA 3CZQA 2QE7D 2IYZA 1WF3A 4KYIB 3TUZC 4HUQA 1MABA 1RFLA 3PITA 2DB3A 1VKJA 3GQBA 3VQTA 4RFVA 4KAXA 2HJVA 1OH7A 1WA5A 4LYFA 2PZEA 4C0QC 1U0JA 2CHGA 1FOEB 2ZU6A 4TMWA 3ZGXA 4D26A 4LJYA 1NN3A 3QF4A 2MSEB 3SDZA 1OV4A 4C0SA 4ZIRA 3AF0A 2OHFA 3DEFA 3B1XA 3HU2A 4YMWA 4TL9A 3QY0A 3BFKA 3KKPA 3V4FA 5H8WA 3ZLJA 1X8KA 1Z5ZA 4Q5IA 3VNVA 2FNAA 3VX3A 5E7JA 3Q5EA 3AVOA 4A2WA 4UNRA 1E3MA 3SR0A 1P62B 1TPZA 3CRQA 2PBRA 5TARA 3PG5A 2ANBA 3D7MA 1G3UA 1Q0UA 4JZKA 4PHHA 5BYJA 1CEEA 5FTJA 5JBQA 1JI0A 4IHQA 1M2OB 2CL6X 2QENA 2ZETA 5DE3A 2FEOA 4TQUS 1WXQA 1W47A 3Q7PA 2I3BA 4DSUA 5JEDA 3VTKA 1BMFD 5E4FA 2IS6A 4B73A 2ZM5A 1DPFA 1W0JD 2F3RA 4Z8XA 1HTWA 4E07A 4A15A 3MWKA 1AK2A 2A78A 4GFDA 3I4LA 3VR2A 1KMHA 3W6PA 3BFVA 4MDEA 3CB4A 1L7VC 2UVQA 3PEUA 3ZVMA 5F9HA 3BFXA 4Q1DA 1XD9A 2WJIA 3OIVA 5DHFA 2ZS8A 1X3SA 1NNEA 2BIFA 1MRNA 4P3YA 3WYAA 4LJ9A 1GG2A 2WBLC 4CGZA 1NLZA 5HZHA 3MJRA 1K6MA 2SHKA 4LGMA 2ERXA 1R5BA 1N6KA 2FE4A 5DNYB 4DSOA 4BLTA 1NN5A 2Q3FA 2R6AA 5EE3A 2O8EB 2IXFA 1AKEA 2R44A 4DLUA 3GLFB 1YVDA 4M22A 1SQ5A 3EPJA 5TVKA 5H68A 3PVSA 5JI3E 3P20A 3MSXA 5KYKA 2JJ2D 5DN6A 5BN3A 3SS8A 4CIDA 1TADA 4BPBA 4PC6A 4P4TA 5M04A 1U2RA 4Q1FA 5A5GA 4OQMA 4RFSA 2OZEA 2ZJAA 3IKJA 2XJ4A 2ZRPA 2P0EA 5GJCA 3T5GA 3TAHA 4ZKEA 2KWIA 4LV6A 3KL4A 1G5TA 2HYIC 2J0UA 2I1VB 2WV9A 2JLVA 1Q1BA 2V7QA 5J4HA 3CW2A 1NIPA 4P4SA 2XXAA 1G5RA 4XIGS 4F7WA 2CE7A 4L9SA 1K8RA 3B1WA 2C98A 2BBOA 2GRJA 4GZMA 2VA8A 2EWWA 1CKEA 2ZSBA 2QPAA 4NCHA 3U7FB 2IS2A 2ODEA 3SFVA 1SKYB 4TYQA 5L3SB 2HT6A 1ZC3A 2FSIA 2H5EA 2ZPTX 4C2UA 1OLOA 2OBMA 4FW9A 1CXZA 3PUWA 3SC3A 1CR4A 1M7BA 2PCLA 2EW1A 1TX4B 1K5DA 3W3AA 2WAXA 5LPNA 1J8YF 5JMTA 4Q48A 4AWXA 2J45A 1G3QA 2ZRHA 1XF9A 4KFSA 1Z22A 4QHYA 1MO3A 3N5CA 1NLYA 1AM4D 3OF5A 3AB3A 3NKVA 3QG5A 4EKDA 2QNRA 4I1VA 3WBKA 3IIKA 4QM7A 2GCOB 3E70C 1KNXA 4IOMA 4PZZA 1AS2A 4UQOA 4BFUA 5DHAA 3FMFA 3EA5A 3SOPA 2QT1A 1LV7A 1CJVC 1LFDB 2V1UA 2PJZA 2VSXA 5DH9A 4G5QA 3P4XA 1EFCA 4TLCA 2ORVA 5FUVA 4DDWA 2A5FA 2FFBA 3SJBA 4M9ZA 4A6PA 3NHAA 1Z6YA 4UJ5A 3EPHA 1H8EA 2DYKA 4Q21A 3CUEF 5JSZA 3ZD6A 4AY2A 1R0ZA 3KTAA 1IN8A 1ZM3A 4NTZA 1Q3HA 4DLXA 3TSOA 3EAQA 4HAWA 2WJYA 3RRYA 1XXHA 4RZUA 2OUKA 2WJVA 4O3MA 3HDTA 4RKEA 5LBIA 4M53A 3BB1A 2ZR9A 1SXJE 2AX4A 4A1FA 1Q22A 1Q44A 1Z83A 5JLJA 5DI3A 4EJSA 2GEUA 5SZKB 1COWA 2H7VA 2AN9A 3GLGA 1II8B 1I4TD 2ZU0C 3X1DA 4PSAA 3H2YA 1E2JA 1H65A 1KI6B 3B1YA 1FQKA 2IHYA 1DELA 4W5JA 5BXQC 3NIBA 4KO8A 4M8NE 4CT5A 1AQYA 2IXGA 4F4CA 2NO9A 1G7TA 3IIMA 2WWFA 3PUXA 1BS1A 1NN1A 3B85A 2XZPA 3SE0A 1AS3A 1XMIA 3CM0A 3EZ7A 4QNMA 5G53C 2PT5A 1S1MA 2IYUA 3L8ZA 3UWKA 4R9UC 2XNDA 2WKPA 2ZRAA 3RAPR 1NY6A 1KZGB 4ASUD 3EPLA 1OYWA 1T0JB 3THWA 2ZTSA 4LX0A 4HB0A 3LA6A 4XWOA 4TWZA 2A5DA 2ZRFA 1ZC4A 1IM2A 4PO9A 1JPJA 3K0FB 4AKEA 1TF5A 2A2ZA 1NVVR 3F0TA 4DBLC 2VH5R 1MRSA 1XWIA 3D6TB 2PT7A 5EE5B 5JFGA 1OIWA 2MSCB 4DCVA 1IN7A 3P26A 4RZXA 2A5GA 4CF7A 1I4LD 3T34A 5HKKD 4WZAE 2BM1A 2Q0HA 4KYUA 4OJQA 1P60A 2WPDD 2WMOB 3X1ZA 4XSGA 2QMHA 1I4DD 1KO7A 1T4GA 4FMCF 2GF9A 5C4GB 1TU4A 4D4JA 3NDBB 2V7QD 221PA 1XFAA 2N42A 1Z29A 4FCVA 3ASYA 2QEQA 3MLEA 2OSBA 3DKPA 1R0WA 3IPYA 1OFUX 3Q85A 3H4MA 1W48A 2JIZA 2OFWA 1NVVQ 1W1WA 1AKYA 1OPXA 4L8GA 1YRBA 4A2PA 2QAGA 2GAAA 5FH9A 4LHZA 3LWNA 3QXSA 1UBGA 3FMPB 3REFA 5EXSA 1OF1A 2WICA 1G4UR 2RGCA 4MQBA 5TMPA 1FX0B 1ZD9A 4NKRA 1GRRA 2QMEA 1SXJC 2QTFA 3KXIA 4Q00A 4Q9HA 2QSZA 2IYWA 4TLAA 2G1KA 3FYHA 4IFBA 1GRNA 4AG5A 1XD2A 3REGA 3K9GA 1T8TA 1W5SA 1IJEA 4YXWA 3K70B 4DLVA 3R8FA 1U90A 2JA1A 4C0HA 3F5FA 1DARA 2C9OA 1KDRA 4RJLA 4EDHA 4FMDB 4C3ZA 4EQ6B 2WWYA 3ZVNA 4A4DA 5B64A 1Z0FA 3OE7A 2IYSA 4HAZA 4TMZA 3J81k 1T0HB 2GZHA 4Q7LA 2NPIA 3VNUA 3GLGB 1TQ2A 4QOSA 4JLPA 3CH5A 2B8WA 4EPTA 1F48A 3L2OB 3B78A 4V0KA 5DISB 4ACAA 2CCKA 2P5TB 4FWTA 1HT1E 1A2KC 3HWSA 3RRNA 1UEJA 3HP1A 4W5HA 1XXHE 721PA 1U8YA 2CL0X 4TZ0A 3SYLA 2H8KA 4MUBA 4GBMA 4TMTA 1T3SA 3GLHA 3IGFA 2XB2A 1SXJA 3A8TA 4B43A 3SU8A 1XJ0A 1O87A 4A82A 1IOZA 3T06B 2BBTA 1NBMA 2QQEA 1E69A 2D7CA 4QBFA 1KI3A 2J3EA 4P32A 5AUOB 4C2TA 4JLDA 3VR1A 2J7PA 4R71A 4URYR 1S8FA 1VG1A 4JLVA 3V9PA 5J4VA 3LAWA 3PENA 4YMVA 1I2MA 2FWRA 1E2NA 2VHJA 4B2IA 2FX3A 4HAUA 3L0IB 1AIPA 4AURA 3W6NA 4BUJA 2GVDC 1G7CA 2A9KA 4QG7A 5B58C 3EX7C 2ZSFA 121PA 2VSFA 5EQTA 1W0JA 3AVXA 1EGAA 4C7OB 3BXZA 3QNUA 1G9XA 2XX3A 5H1YA 3GEEA 3IILA 1PV4A 3CPJB 4OBEA 4QBGB 3AGQA 4F4JA 3HR8A 4HB2A 3B13B 2O8FB 2QP3A 1DO0A 2W6ID 3WRYC 4ZV4A 3QIAA 5FPHA 3WY9A 2F3TA 1HT2E 4MA4A 1XB2A 4U00A 5FPTA 2QE7A 4L16A 3CNLA 4GT1A 1LTQA 1XZPA 2OCYC 2R6GA 1IJFA 4B33A 5F9FA 3Q9LA 3FDIA 3LBHA 4DEXA 1L2TA 2WJHA 4LHVA 2HT1A 2RHDA 2JJ1A 4XD7A 4MRRA 1G64A 1Z07A 1IONA 2ECKA 2IYYA 3QUSA 2IYXA 4HZUB 2NQ2C 4PC1A 5EE9A 2GJ9A 1VHTA 1FQJA 4U5XA 2ZYTX 2Q3MA 4K81B 2KBFA 3GJ4A 4FCWA 4OI4A 3U7EB 1KK1A 1KDTA 3DMNA 3EZ9A 1E2EA 4Q4JB 1D2MA 2ZI7A 1W44A 2FSFA 4XJXA 3A37A 1Z6GA 1EFRA 3CF2A 5CIWA 4A6XA 1YE8A 1KSGA 3QE0A 1H8HD 1CIPA 2VP5A 3OEHA 5AUQA 4B44A 1DAKA 4OK3A 5KDOA 4NCNA 1CRPA 1O3YA 2CVHA 2F9MA 1D8TA 3KQNA 4Q4HA 2YNMA 1OH6A 5F98A 4UXHA 4NMMA 4ESVA 4P0TA 4QRHA 2HF9A 4D80A 3AKCA 1MO4A 2ZS7A 4N0DA 1G19A 5SZJA 5TDHA 3VKGA 5EZ6B 1G8FA 3THYB 1N6RA 3CF0A 4HDCA 3AVWA 3OESA 4MGZR 3W34A 5JS7A 2J5XA 2ZUCA 4IEIA 3I32A 1US8A 2IA5A 2LCFA 1XNJA 5CK5A 4BFYA 1EG7A 3QSYA 2PEYA 3IQXA 1TF7A 1G3MA 2H17A 2CLCX 1E0AA 1AJEA 1JAIA 3CPHA 1GNRA 4YMTA 2XZLA 2YWEA 3Q7QA 4H1VA 3TVTA 1D9ZA 1IHUA 4LJ5A 4ESHA 3QKTA 3IEVA 4XVQA 3EIQA 5L3RA 2GBLC 1S1CA 1ZCAA 3C41J 3L8YA 2ZRMA 3THOA 1T5IA 5P21A 2V4ZA 2FEMA 2PZFA 4RKFA 2BJVA 1NL3A 4PPNA 1XMVA 1CR2A 2D7DA 1NG1A 4B3CA 1J8MF 2FZLA 1GKYA 1MABB 4CT4B 2G88A 4BZPA 1U8ZA 2C78A 3IO5A 3P1JA 4JBYA 1NG9A 1T3LA 3NHBA 4BEJA 4C7OA 1FMLA 3NWJA 3DOEA 3FB4A 4FINA 1KJWA 4BASA 1KK2A 5C46F 1VHLA 4NPHA 5HTKA 3AGPA 1XTIA 4B76A 4ZPXA 3TSZA 1G7RA 1E9BA 4Q03A 4Z8YA 2HF8A 4UXJA 3O47A 1A7JA 1UKVY 2GJSA 2ZREA 4CEHA 4IXMA 3EIEA 2W6JA 5E7IA 2GEDA 1X6VA 4POAA 2GESA 2VL7A 3RDPA 3KXKA 5CJPA 4OHWA 3H1TA 4Y0AA 1P9RA 1Z2AA 4M1SA 1XJCA 1E2KA 3KKQA 2XEXA 3QKRA 4AYTA 2J7PD 3AQ4A 3GFPA 4ZDWA 5KTYA 4BLQA 4MRSA 1QG4A 2PCJA 1LNZA 3MGCA 2ZRLA 1OSNA 3PUZA 4AYXA 2QP4A 3BBPA 3GLIE 2VSOA 4ACBA 5C18A 4A92A 2AXPA 1N5JA 1U99A 3P32A 4YLGA 5G3ZA 5BQ5A 4PZLA 1TL7C 2V3CC 3TLXA 2OBLA 2C9YA 3LD9A 2YKGA 3OEEA 3TE6A 3EC1A 1J90A 3RLFA 3U6BA 2IF2A 2WSMA 5DYGA 1UPTA 3T12A 4OL0A 3IPXA 1GFIA 5TV2A 3KQKA 1X86B 5HZKA 2HEIA 1E98A 2KJQA 3BOSA 2BHRA 3T1OA 2ZITA 3EZFA 4B2PA 4F92B 3CR7A 5D3MA 4B34A 2GHIA 3DHWC 1E4YA 1W0KA 3K53A 1Z06A 2ZSEA 3KJGA 3LLUA 1KI8A 4WW0A 3KB2A 2YC2C 2BVNA 1NN0A 3AVUA 1DAIA 2FPKA 1F60A 1FUKA 2RGXA 1PJRA 1UM8A 3HJNA 1EFHA 2FJUA 2F7SA 3EPKA 2YWFA 1NKSA 1W7AA 2EQBA 1C4OA 4IDHA 2VTKA 4M4SA 4RY2A 5FTLA 4NYJQ 3SN6A 3WNBA 2I4IA 1QVAA 5FBVB 2J0VA 1EX7A 1R8SA 1XXHB 5K8LA 2BMEA 1QG2A 2OLKA 4IVRA 2HCBA 1F6BA 5FR1A 2WWGA 3A4NA 5EP2A 2QTHA 5HR5A 4L15A 1KI7A 4Q9LA 2DWQA 5JCPA 3K0AB 3HR7A 2WPDA 4NYMR 1KI1A 1G18A 4PO1A 1ZUNB 2QROA 1HY3A 1ZM9A 3PEVA 2KI5A 1E6CA 1VYTA 2ZRKA 1S96A 1KO8A 1W2HA 3CONA 3AVPA 4M9XA 3TK1A 2YV5A 4QJ4A 1TMKA 1GVNB 2CL7X 3IBGA 5AJXA 1VCNA 4YMUA 1SVKA 5L3VA 1XPUA 1SVLA 5JJLA 1N6IA 3KQUA 2X2EA 1KSJA 1KIMA 1YHNA 2OE2A 2OLJA 4TLDA 1KKMA 3UATA 2ZRCA 4GI7A 2ZI6A 3RS5A 2B7CA 1TQ4A 3TQCA 2X77A 4ASUA 3AF2A 1P2TA 3EA0A 1T91A 5DI9A 1N0UA 3S1AB 4ZI2A 3IEUA 4NP6A 5J4LA 1ZMXA 2ZRIA 1GL7A 2XNSA 4JVSB 4A36A 1QHXA 4D4KA 3EASA 1RYHA 1WRBA 1Z47A 3ND9A 2O8BA 1WB9A 4D6PA 3NVAA 1G17A 3OIYA 1U94A 3W90A 2BC9A 3L0PA 4TQ9A 2IUUA 1Q3TA 2BWJA 2PMKA 1R8QA 5G41A 3SI7A 3TRFA 3ZZTA 1ZD8A 3E5HA 1Z0AA 1JNYA 4LI0A 3Q5DA 3RS2A 2YHSA 3AVVA 4JKIA 2AXNA 2F1JA 4TLEA 5FBQB 1G291 2WIAA 2Q9CA 1G7SA 4TTPA 2VRWA 1D9XA 4ILEA 4MH0R 1H8ED 2YOGA 1GIAA 4HLUA 2OAQ1 3C8UA 3H84A 1HYQA 2Q9AA 3BB4A 3RWMB 3GP8A 5DI3B 4QJ3A 2OV2A 3R9WA 4LJ7A 3GLIA 1HE8B 3EZ6A 1VG8A 5D3MB 2WVJA 2H92A 2EYQA 3TH5A 1OHHD 1ZM4A 4PPFA 5EP4A 1XCPA 5B30A 1S0UA 2YVUA 3SFZA 3LXXA 3ETLA 3RYTC 4DIEA 5B2ZA 3HU1A 3IUYA 1MO5A 2VEDA 1DBSA 3CRVA 2GAOA 2UKDA 1UDWA 1YU9A 3CRW1 4DJTA 3EARA 1MR3F 5KSZA 5FTNA 1EFRD 5J5CA 3R20A 2IYTA 2Z4RA 1LS6A 2E87A 3QEOA 4D0GA 3IQWA 3NTUA 3I5XA 3GJ5A 3I72A 3PEWA 4K46A 1AGRA 2DCUA 3CBQA 4PR0A 4DXAA 1NVWQ 4TQAA 3K09C 1BYUA 2O5VA 5CITA 2VLIA 2BV3A 3CKLA 2NIPA 1CULC 3BERA 1OKKD 3LQQA 3LDAA 1XD2B 2CXXA 1PLJA 2ZVPX 4JT2A 4IOJA 4LSGA 4D4MA 4F38A 1NP6A 421PA 4KVAA 1JAHA 2P67A 2P2LA 4DLSA 4ZDIA 4IW3B 2GCPA 1E9RA 1CLUA 4NZYA 1E2LA 1Z0JA 4V0ME 1A1VA 1QDEA 4KI0A 2AD5A 4TYNA 1D2EA 4IDOA 3AVTA 5J4KA 2B92A 5K8TA 4ABYA 2QL6A 2C2HA 3GJ6A 2PH1A 4G1UC 4C0KA 2NOAA 3TUIC 3SZRA 5DYIA 3RABA 1WQ1R 2XTZA 4JLBA 2FDCA 4P31A 4QHTA 3BS4A 2X2FA 3U5ZB 1NI3A 1AZSC 2EVWX 1GILA 4DWJA 1CBUA 2BM0A 3K09A 1PZNA 1YQTA 1SKYE 3RC8A 4I1OA 5GJWC 1G5PA 2WKRA 3C14C 3LXRA 2QU8A 4OJKA 1R7RA 3AP3A 4Q02A 1ZIPA 4MITA 5LD2B 4DCTA 1J2JA 1ZU4A 4Q19A 3C7KA 2ZE5A 2Q21A 4BE7B 1G1MA 3THXB 3ASZA 4DC9A 2KB0A 1L4UA 2VP2A 3KTAB 4OI0A 2CE2X 2YJTD 2JDID 1U81A 2IYRA 4UKDA 3A1TA 3C5HA 4F91B 2RMKA 3K70D 3GJ8A 1SXJD 2F43A 2FFQA 1GOTA 4V02A 1KAOA 3GJ0A 2XOKD 3SEAA 3QXCA 1JXOA 4LJAA 5EP3A 1VG0B 5TB5A 5CDFE 2XB4A 1NMYA 3OAAD 2JJ2A 4AG6A 4IOKA 1ZBDA 4EJSB 4JL6A 4LHWA 3QG1A 4DLWA 3BC1A 1IY0A 2QMOA 4CDGA 3R7WA 1HV8A 1NBMD 1F2TB 1G3IA 1IN4A 3H86A 2G0TA 3VR4A 5FOSA 2EU8A 1IXZA 4Q01A 3P27A 3U3JA 1NIJA 1A82A 1NJGA 4IEEA 4C0JA 4HAXA 1BMFA 3WMFA 4AIIA 1ZM7A 3I1FA 3A36A 3KJHA 3ZZUA 4I1SA 4LBZA 4DDTA 4A8JA 4DHEA 4KJZA 4OK5A 2BMFA 4MUAA 4OQXA 1YR8A 4Z1MA 1OFIA 2RB4A 2DWOA 2JLWA 4US1R 5G3YA 4BFWA 3AVQA 5LDDC 1E99A 1U9IA 3QKUA 4MYCA 2QBYB 4PAMA 4MDFA 2VBCA 4GOJA 3MMPA 4OHXA 4B35A 3K9NA 5BWMA 1GM5A 2ATXA 4OI1A 4CVNA 1TEXA 3W9YA 3DL0A 4NCJA 2FZ4A 1E4VA 2P6UA 4YXWD 3PXGA 1B0UA 5FOXA 1MOZA 1E1QD 3CNOA 4LYHA 1YJ5A 2XSZA 4JLNA 2ZE7A 1Q57A 3PV0A 3BD9A 4D2IA 3WYFA 2YOHA 1XZQA 1NVXQ 5CB6A 4LUCA 2GJ8A 4TTQA 1E2HA 2ZJYA 1DG3A 2ZE6A 4TSFA 2ZRBA 2G1JA 1VECA 2ZI4A 3SHWA 4C4PA 2P6RA 2F1IA 1M8PA 4QNRA 5CYPA 5IDVA 3SYKA 1DADA 1KDPA 1TAGA 2FMXA 4TT3D 1KZ7B 3B60A 1OIVA 2V9PA 3GFOA 3NXSA 1BH2A 4LHXA 4LC0A 3T1TA 4EIWA 1AZTA 5GVSA 2VP6A 2FGJA 2YINC 1P9WA 4KLZA 3EIHA 1K5GA 1KI2A 2NO0A 3QBTA 1RVDA 5CM8B 1GRQA 1TQ6A 3EZ2A 3ZZ0A 2J0UB 4F4IA 1W4AA 3DDCA 1YZGA 4M2LA 5HPYB 1P7CA 2J7KA 2ODBA 1R5NA 1R6BX 1UEIA 3U4QA 2GJKA 4N1AA 1XEXB 3AP1A 5IT5A 1YR9A 1ZINA 4HB3A 2WM9B 4MRPA 3U3KA 2QP9X 2OCPA 3KB1A 2ZR0A 1XDBA 2JLUA 4BFTA 1GKIA 3TUJC 3M6AA 1A2BA 3GEIA 2LWIA 5JWOA 3CO5A 5L3SA 2PX0A 2NO7A 1Y63A 4ITRC 5L8VA 4G5RA 4DCNA 3K0FA 2VP4A 3H0KA 4XD7D 4W9MC 3BJIC 4JLMA 2FPLA 3GJXC 3FKSA 3L0OA 1T8UA 2FU5C 4QL3A 3KUCA 5EE1A 4TYWA 1XJQA 4PSKA 2OFOA 4WAUA 3WP0A 4DUGA 1A4RA 3QI2A 5UKDA 2W83A 1OHHA 2V1XA 4W5WA 2ZIAA 2XTNA 1G4AE 2QMUA 1E79D 2GXQA 1LY1A 3U7GA 5DSZA 3K0CC 3GLGE 1LF5A 5DIFA 2QA5A 1ZNZA 1GP2A 5FOUA 4A9AA 2C96A 4G5SA 4QKQA 1FP7A 1LB1B 1F2UA 4B3GA 1ZNXA 1ZUHA 4M9SA 1VG9B 1VYVA 2H57A 2X1VA 4Q4AB 5KO2A 4HB4A 3QF7A 4Q9KA 4DUGD 3KKNA 1DTSA 3UXMA 3QEJA 5D3QA 1IBRA 3CWQA 3KJEA 2BKUA 2R6DA 1XCMA 1N6NA 2GETA 3VFDA 1EFTA 1NJFA 3ICQB 4DSTA 4QGHA 3ADKA 3FFAA 4C9BA 3UIEA 3M4YA 1OJLA 3JZAA 4MKGA 4OHYA 1DEKA 3F3YA 1B23P 5EUQB 1KTVA 1NY5A 2AWNA 2J41A 1XEFA 3E2IA 5FL7A 4QM6A 5SZHB 3KFVA 1HURA 3NBYC 2GBLA 2JAQA 4EFNA 1G21E 1UBEA 1UKZA 3GLHE 2IL1A 2FSHA 4JBWA 5C4MA 3I8XA 3LLMA 5L3QA 3UK6A 1CR1A 3SHFA 4NE2A 3LBNA 4MYTA 1KJZA 2RKOA 4FMCB 3KZ1E 5J4YA 3MAAC 1NLFA 3I8SA 3IIJA 3F8TA 4NBSA 1BIFA 2ZSAA 2IK8A 4Q66C 1F3OA 5C1BA 3ZS8A 4Q1EA 3ICEA 3ZQJA 1ZUIA 2VF7A 2W58A 2G3YA 4KV9A 3PUYA 3FHTA 2BMDA 2HLDD 3OIUA 3THWB 3SYNA 1CJTC 1TUEA 2YWHA 4H1UA 1KOFA 2YYZA 1AGPA 2OCAA 3BE4A 4B3BA 2IXEA 1FP6A 3QXHA 2IUTA 2REOA 2A30A 1KAGA 3QBVA 4LDJA 3I5YA 4CRWB 1N0VC 2REXB 3X1XA 2MMGA 1OXSC 2EWVA 1G8GA 2PL3A 1ELOA 1Z28A 2QAJA 3DOFA 2ZYWX 1E1QA 1KMHB 1JJ7A 2Z6VA 5H70A 4ARZB 4TL8A 1KDOA 4KXFB 1II9A 5DN6D 4DCSA 4KFTA 2ONJA 3NBFA 4M1YA 1XTQA 2ZUDA 1PUIA 1U0LA 4I1UA 1VIYA 2GK6A 3AF4A 3QENA 2F1RA 2RGBA 2IF0A 4DRZA 2DBYA 4GZLA 4LJ4A 3RRMA 2JIZD 4WVFA 1W0KD 1QHIA 1MT0A 4Z1MD 5GJBA 3UWOA 4NDZA 4X8HA 3TGPA 2P5SA 2V6JA 2WTUA 3WNDA 1NRJB 2OCBA 1RRPA 2ZJ5A 4HYYA 4HZIA 1GNPA 4ZI3A 1E2QA 3TBKA 4B75A 1JEDA 1PLKA 4WOPA 4B3XA 1GTVA 3A58B 3U3MA 4GSYA 3T5DA 3VX4A 4PQRA 4DSNA 2XZOA 3VKHA 4JSTA 2RGDA 3PR1A 5TXGA 3U44A 1T9HA 5EE0A 2ODNA 2AKAB 1NMZA 2AK2A 4V03A 3QKSA 4RVCA 3CF6R 4YQFA 2C99A 1W36B 2FPMA 4I99A 1ZNYA 1OXTA 5FPKA 4KBGA 4NYJR 1G6OA 3U3RA 3UG6A 2FFHA 1KMQA 1M6NA 3OEED 4BQSA 2NTYC 2HJGA 2XOKA 5IK2D 2CVFA 3X1WA 1OH8A 1XMSA 4MGKR 4HATA 1QZXA 2DHRA 3AF3A 2NPFA 2QY9A 4B47A 2OO7A 4DVGA 1G6HA 2QPOA 1LVGA 2ORIA 2XNDD 4IRUB 1RIFA 4Q4JA 3EG5A 3QQ5A 1FMJA 4IDPA 3I62A 1II0A 4RZ2A 2G83A 1CJKC 4JLOA 2O8DB 2CJWB 2ZEJA 4DCUA 1G20E 5J47A 2NGRA 5KPDA 4LOAA 1YR7A 3AF1A 4C0BA 3R9IA 4MRVA 1HUQA 2FSGA 1RRFA 1YKSA 4JLKA 1YZNA 1ZNWA 4JVNA 4UNPA 3UANA 1UBFA 3I92A 1GNQA 2B8TA 1XTSA 1WMSA 2AK3A 2GTPA 2RGGA 2IYQA 1S3GA 3KKMA 5JWRA 1LF0A 5A0FA 2O8BB 521PA 1FL9A 1ZD1A 3T1QA 1G8PA 2E1RA 3GPLA 5FTKA 1MKYA 3NBXX 2OILA 3OIWA 4DLZA 5EUMA 3FVQA 3OEHD 3VR3A 2OBNA 1XTKA 3A4MA 1JALA 1WP9A 3JZMA 2VPPA 2KBEA 2JATA 1L8QA 2DFNA 2ZAMA 4DKXA 1ZJ6A 1YZUA 4JSYA 4BECA 3LVQE 1T5LA 1JBKA 1SVIA 2PX3A 5FPYA 1U9IC 3ECCA 2XXAB 3RS4A 3EW9A 4NU0A 1Q20A 2W2XA 4GOXA 1PVOA 4DB4A 3GLIB 2KSQA 3RS7A 3CRMA 2WSSA 1FTSA 1VCOA 2O8CA 1OKKA 3JVVA 4BFZA 2HV8A 4IFEA 2ZJOA 4E5UA 2IEZA 3O8BA 4AKIA 2W0MA 3BRWD 1RE0A 4CEIA 3GCGA 3VKWA 4URVR 3N2IA 3TVDA 1VCMA 3AEZA 1OIXA 2J87A 2ASEA 4HDOB 1RKBA 3ZYCA 2WSSD 2IYLD 4DLYA 5JJIA 2QAGB 2QM8A 4RCZA 3U2QA 1N2CE 2FOLA 4PANA 5K8UA 2A3RA 4NHOA 4B48A 1J99A 1VMAA 4MGYR 3A1VA 4TSFD 2IWHA 1GAJA 4BLPA 5KUTA 3WHLA 4HZUA 1KSFX 3DMDA 2RCNA 3WNCA 4EPVA 5TY0A 3LY5A 1XRJA 4PAOA 4Q18A 4AKGA 1D5CA 4F93B 1W4CA 5KDDA 3DM9B 2G6BA 4V0LA 5IRCD 4KVGA 2BEKA 1CRQA 2D2FA 1SULA 4EFMA 4X8LA 2OXCA 3O8CA 2YWGA 3A6PC 4TTRA 3B82A 1P61B 3NDPA 4B32A 2FG5A 2ZRJA 1RYFA 2EFGA 4FN5A 4TMKA 1ANKA 4PFSA 5KNDA 4JYCA 4YC7A 5JEEA 4GDFA 4EUNA 2VIIA 4CYMA 2ZROA 2DY1A 2IBMA 4DLTA 1UF9A 3CZPA 3WRXC 2GF0A 1M7HA 2Z0MA 4KSCA 5AJZA 4D25A 4KBFA 4IVPA 2CLDX 1RRCA 2QPTA 1QF9A 4P4UA 4JT4A 1N5IA 1XMJA 3K1JA 1Q21A 1OB5A 2Z4SA 3AH8A 3GLHB 2GJAA 3LX5A 4PXAA 1FZQA 4UNNA 1E9FA 3BB3A 2EFCB 2H1LA 1ESNA 1N5KA 2ZE8A 2ZJ2A 5FTMA 2EFHB 5FBWB 1XBTA 4A0RA 5BYKA 3DVLA 2OXRA 1N25A 4JLAA 4W7SA 4XVRA 3BH0A 3FHCB 5EXXA 4B6FA 4B3DA 1CJUC 1WCV1 1XX6A 5FR2A 3IDQA 1XCGB 2ZVQX 3B6EA 4PAQA 1E9AA 5KHOC 4EPXA 5JZVA 2Y8EA 4NCIA 4RZ3A 1GUAA 2W2TA 4YONB 3KJIA 4BFVA 4FMDF 4JLJA 4JIMA 3UMFA 4WZBE 2QT0A 3VHXA 2F43B 3MRSA 1R0YA 1R10A 4NH0A 4L9WA 4ON9A 3AVYA 2BJWA 2GVZC 5FFMA 2FN4A 1IY1A 2CK3A 3ND8A 3A1WA 5DGXA 1N6LA 3CR8A 3ZDQA 5K8IA 4JVLA 4P4SB 4K8OA 2DPXA 3FOZA 3OE7D 2E9SA 2D62A 2BBSA 1A5TA 4Q1BA 2IW3A 4ZIRB 1T3HA 3L0SA 4DDVA 1PLLA 1VPLA 4EQ6A 1UFQA 4DIDA 4JL8A 4HAVA 4PTLA 3FE2A 2VO1A 1LS1A 4CEJB 1FPMA 3ADDA 1NSTA 2CHVA 4LHYA 1QHHB 2ZYUX 5JRJA 1TNDA 3DO6A 1E2MA 1KHTA 2XAUA 1NVUQ 3TIFA 1U98A 4PHTA 3MWYW 3LX8A 1Q1QA 3RRZA 4LC1A 1UADA 2ZSDA 4BRWA 4M1TA 3AP2A 2QQ0A 1VDZA 4XH9B 2ZXUA 2K5UA 3QXJA 1QHSA 3SBDA 2ORWA 3RNLA 3WHKA 4E03A 1N5LA 1RW4A 2GWHA 1W4BA 3HU3A 4NONA 3R8CA 2HLDA 4V0OA 1EESA 3P4YA 2JASA 4PC2A 5FUWA 2GCOA 4D0NA 3T61A 1E94E 4IVQA 3V00A 4KLNA 2ZQ5A 1N3BA 1KO4A 2JEOA 2WOJA 4IKEA 1G8YA 4TN1A 5FOTA 4QBHA 5FPSA 1G16A 3VR6A 1XU4A 1C1YA 3LNCA 1VIAA 5CM9C 4Z54A 4AI6A 4AK9A 2R8RA 2O0KA 2Z83A 2DWPA 2BCJQ 4BEBA 4PC3A 4LRWA 4FMBB 1JPNA 1SHKA 3QXXA 5JJKA 2JGNA 3MUFA 4IDQA 3W6OA 1QHYA 3GD7A 2GNOA 1KKLA 5HKKA 3IBYA 1KI4A 3CX6A 5KU1A 1C9KA 1JR3E 2O0JA 3KUDA 3FMIA 3DKVA 4LV8B 1F5NA 1KY2A 3MJHA 3W5IA 5FOWA 1HH4A 5SZIA 1EX6A 2GXAA 3SQWA 4LYAA 1JB1A 2O8FA 1U8AA 3QF4B 2D74A 2QAGC 4ZDJA 2BCGY 5CLLA 4BLRA 621PA 4L5BA 3U7HB 1E2GA 3NEYA 1NSFA 4AYWA 4JKYA 2CBZA 4XWKA 3C15C 4Q9IA 4Q7KA 2VP9A 3FPAA 2H16A 2ZANA 2W00A 4V0MA 3TR0A 3LV8A 3L82B 3BH6A 1UKYA 2ZI3A 1NKTA 1D6JA 1S9HA 4XOIA 3U4QB 1E2PA 3B9QA 2VHCA 4P33A 4NL4H 2XGJA 4GPTA 1RJ9B 5AJVB 5J40A 1ESMA 2ZJ8A 3UMRA 3O8RA 3NBZC 5AJWA 3MCAA 3IHLA 4LYJA 1W36D 3UKDA 4TYYA 3TQFA 1RRGA 2JLZA 4LBWA 1N0WA 3IO3A 2RHMA 3W3ZB 1P3JA 1TQDA 2ZRGA 4NCKA 4HUTA 2G77B 4XSHA 1P75A 3RSOA 3KX2A 1Y3AA 3LVRE 5E95A 5EXPA 3B5JA 1RPZA 4AC9A 5HE9A 4BRUA 1DAEA 1Z6XA 2Q9BA 1R5OA 1JQJC 4PC7A 3VR5A 5JHGB 1X1SA 1SVSA 2VF8A 4WXRA 3BH7A 1XTRA 2G9NA 3THYA 2D2EA 2QG6A 1S9DA 3FKSD 1YRAA 4D81A 3K0SA 2F6RA 4L4UA 1EWQA 3QVVA 1XTJA 1XEWY 1DAGA 4URZR 5E3HA 4FD2A 4PQYA 2N1BA 1DS6A 2WWWA 1GITA 4Y0VA 1OYYA 4QGAA 1EXMA 1YZLA 1Z0KA 4OKSA 5JSZB 1P4SA 3W8NA 4FXPA 5E7MA 3RHFA 1AN0A 5BN4A 2NO6A 1IAQA 4R2HA 4RFSB 1XEWX 2GDJA 3LH5A 2PLFA 2QI9C 4HLUC 4UNQA 5EXTA 2J1LA 4BZQA 4Q7JB 1X8JA 1JXMA 2ZAOA 1OFTA 4Z51A 1KNQA 4M1OA 2ZJZA 2ANCA 1N6OA 2B6HA 2RAPA 2ONKA 3ZVRA 2JLRA 4Q7MB 4D4LA 1OB2A 2CNWD 5CLQA 4RD3A 2HUPA 1BYIA 5FUYA 4G5OA 4BFXA 1W36C 2QRNA 4KCGA 1IXSB 4HDQB 4LBYA 4ZDKA 5C2JB 2IS1A 1KGDA 2XTMA 5L3QB 2Z5FA 1DAHA 1P2VA 4JS0A 1M74A 2GA8A 4X8MA 4IXNA 4CEHB 1D2NA 5JWHA 4HLDA 4E22A 4O0MA 3AKEA 2LKDA 2NO1A 2H18A 1E9CA 2DFKB 3LW8A 4URXR 4BLSA 1W46A 1TF2A 3EWSA 2YOFA 4LY6A 4KITB 1Z0IA 1TTTA 3T1VA 1XPRA 3B8HA 4TT3A 4S35A 4GL2A 3WMEA 5LB2A 2RH5A 5G40A 3BWDD 4GMDA 2VP0A 2BMJA 3KQLA 3GFTA 2WKQA 2DFLA 5CYOA 1JEEA 3B9PA 3W8RA 2CK3D 1AQUA 2A7QA 3MG9A 4YMSA 5GJVC 1P2SA 5FL3A 3RC3A 4ZKDA 2QBYA 3QVUA 1W5TA 1XPOA 3GJ7A 4LJ8A 1IQPA 1E1RA 5AJYA 3ZJYA 3PEYA 2FA9A 2J0SA 1MO6A 3U3OA 4LJ6A 1E0JA 4MKHA 1HE1C 4I4LA 1QHNA 1WDTA 2O8DA 4US2R 4EPYA 2D06A 4O2RA 4B71A 2UZIR 1I2DA 3PFIA 2AFHE 2J9RA 2Q6TA 2BEJA 3UG7A 4ZCLA 2ZI9A 4Q9JA 1CJMA 1E0SA 1EK0A 2Q3HA 3OZXA 3KQHA 5KNBA 1S3SA 1VCIA 2CEAA 1JECA 2XJ9A 4H9GA 2FF7A 1DAFA 1DAMA 1KO5A 2GILA 3SQXA 1E9EA 1FNMA 1SHZA 3KFXA 4C0LA 2GEVA 2W6JD 4A0GA 3EWAA 3FFBA 4QFMA 1VTKA 2GZAA 3NC0C 3OAAA 4E09A 2A5YB 5CB8A 2IUSA 1E2IA 1KYIA 1NBME 4LZZA 4TMXA 3U61B 1UDXA 3L43A 1E1RD 3K9HA 3U44B 4TMVA 4R7ZA 5F2EA 4IJMA 4KFRA 4NYIQ 3C4JA 5EZ5A 2QGZA 4M0LA 3LRPA 2QTVB 3TR5A 3TJZA 4CW7A 5DO9A 4RD0A 1ZAKA 4C30A 5JI2E 1G41A 1WBBA 1HA3A 4PSVA 1VYUA 1WBDA 2V55B 4A0FA 1OT3A 1EFUA 2HYDA 3FGNA 3PUVA 3SNHA 3X2SA 2UZ3A 2HXSA 1XEXA 4OHZA 2IWRA 3RANA 1M7GA 4O25A 1CF4A 1TUIA 4RD2A 4A0HA 3AUXA 5AUNB 4EAQA 1OW3B 1F2TA 2ZR7A 4WZ6A 4D82A 1SGWA 1FUUA 4EPRA 4CZ2A 5JECA 2JDIA 4LV5B 2FH5B 3BAFA 8OHMA 2ATVA 2D3WA 1P73A 2VHQA 2ZJBA 1CS4C 3B1ZA 4WXPA 3G82C 3M1IA 1ZM2A 4GNKA 2RGNA 1N6PA 3GMTA 4KSBA 1OXVA 4M1MA 4BLOA 3K9LA 5FBRB 3HPQA 5CJ2A 2C8VA 2HDNB 1JR6A 4O2LA 4A8JB 4UJ3A 5KDLA 4KFUA 3WMGA 2KE5A 2WAYA 2R6CA 3U6KA
chains in the Genus database with same CATH superfamily
3I73A 2BTQA 2OC9A 4IS2A 4AKTA 4U3JB 2D1RA 3NHLA 3MTBA 3MPOA 4GRAA 5IVKA 1YDWA 4OA5A 4I55F 3DGEC 4DIUA 4G5FA 1PD1A 1QX3A 2XQJA 3IP8A 1O0CA 2J6HA 4TPKA 4GP6A 3UHPA 1EVYA 1IXRC 1JT2A 4D42A 3RIYA 3EIFA 3H2BA 3JWGA 5TMEA 4WESA 4ZQGA 1JHUA 3OHPA 2CMDA 2JIBA 3LBAA 2C8JA 1FDRA 3TOCA 5TPZD 1NI4A 3FPHA 4M21A 1AS0A 4P36A 2B9VA 3BWBA 1H5QA 1YRYE 3EXAA 4M98A 1TTHA 4DT1B 5DT2A 4F4FA 1QH8B 1KERA 1W94A 3O2QB 3M49A 2D5AA 1Z0DA 3B2EA 2AH5A 2OEPA 1EA5A 1RXEA 4NU5A 1E0KA 4I8XA 3F96A 2JIRA 2NZ8A 2J5KA 4TZ6A 4LCBA 3A1SA 3W5JA 4L57A 4WLFA 3D8BA 4B3TB 4CEIB 2HXYA 1N7JA 3OM8A 13PKA 1GXSA 1N0HA 2WD9A 2PKYX 4A7PA 4FQ5A 4UQLA 3KSRA 1L4EA 1O96A 2QD5A 1YKGA 3F9RA 3LY9A 2AOTB 5FOVA 2C95A 5I7FA 1RXSA 9ATCA 1IY2A 3P2YA 5I3CA 1V7ZA 2PU5A 2WD7A 2XMBA 4PHGA 4A8PA 2B69A 5AKEA 2YHUA 4TLBA 4ZT3A 2XCTB 2BDUA 3H8WA 4B7AA 4ZFNA 4AZ0A 2AWOA 1ECPA 4DQXA 4LF6B 3S8YA 2AS0A 1IM5A 3MW8A 5I7WA 2WHXA 2KMLA 2PDAA 3K9BA 5DXFA 3T9BA 4PO8A 3SPXA 3WYGA 3ZQ6A 3C3CA 4JBIA 2RBGA 4CM9A 1ID1A 1W4RA 3FKJA 1KZ6A 4G9EA 1YC5A 4NDNE 3GI1A 1Y3BE 3WTCA 1YOVB 4LYGA 1QPZA 1AB6A 1B7GO 3DBHA 3R3XA 5AHWA 4FEEA 4D0RA 2ZYVX 4RF5A 3JTMA 2G5PA 3D3KA 2VJKA 3H2GA 5AK5A 4PRLA 5K2OA 3N8GA 4OAPA 1XD8A 5JNTA 3BMCB 4HVTA 1T9AA 1JQLB 1P1CA 1RWNA 1G9TA 4LXIA 4IJ5A 3KEGA 2PX5A 3B7GA 1AX9A 2QIOA 2W2VA 2ZTLA 3R7WB 1BC5A 2CCGA 1CQPA 2OOSA 3JRWA 1WSDA 1J9ZA 1V8OA 1T24A 3UQYS 2QUAA 3TKLA 2HF7A 1Y7TA 4X8OA 3T15A 1IQ0A 3GLTA 3P4UA 4ZGGA 5AVVA 5FV4A 3OCYA 4MVJA 3UJPA 4BRSA 3KOWA 4XARA 5B6JA 4IDAA 3CF4G 1NGSA 3PCRB 4JJAA 4DCMA 4GBGA 3NH9A 4LVUA 1P9NA 3RSLA 1L4YA 4LKOA 5E1DA 3U4IA 1TKBA 4ER7A 4RD6A 4BFLA 2PR2A 1XQ9A 1VKNA 1UDBA 3TL3A 5FEMA 5HJ2A 1YBFA 3TS1A 3ZZNA 3BE8A 4LFAB 1TAQA 1EE9A 1HQYE 2C5FA 1RSZA 3A6KA 4MYHA 4R3UC 3G17A 3ZD7A 3QLVA 2OHVA 1ZK3A 2DWUA 3L7MA 4JEMA 4O4JF 1MEJA 4W63A 1MF7A 1FFWA 3X1JA 3AU9A 2I1QA 4H6WA 2OC4A 5DVZA 4GICA 2BKVA 1REQA 5CIQA 3C0KA 5AI0A 5AK0A 2NSJA 4QO7A 1YZQA 5H81A 1RHJA 1EDEA 2SCUB 2I2AA 3AESB 4K9QA 1NC3A 1R0SA 3P2KA 4ZALA 4GL4A 4PAGA 4M6WB 4RKQA 4RMHA 3GWZA 3BDVA 2AEJA 4JXKA 5AUPB 5CM2Z 3U31A 4B6OA 3ZWNA 5AD1A 4DR4B 1PQ4A 1XALA 2N46A 3PE4A 4YFVA 4ZVKA 1WUJS 2V54A 3ESAA 2YZ2A 2ST1A 5CX1B 4EG5A 4RGQA 1NVAA 3FNBA 4CR6A 2ZKIA 1DG1G 1HT3A 2SNIE 4ZO4A 1OLXB 4CM5A 1UZNA 3AR4A 3OD5A 2XRZA 4RPCA 2OXFA 3P0RA 5EIWA 1JR3A 2PR7A 3MUNA 5G4KA 4DR1B 4IDNA 1UMKA 2FWIA 1A4XA 1PFVA 4YECA 4Q1CA 3PXCX 1YK1A 3JASA 2PX6A 3QVXA 1CP2A 3UXEA 3CIOA 1DUVG 2W0SA 3IERA 4CBVA 4L0CA 1LI5A 3CC8A 1RC8A 1JA1A 2B4QA 2WJJA 1DFHA 3A26A 3U09A 4M38A 1NUQA 3U60B 5EESA 2HZBA 1NVDA 1YR6A 3PRJA 4UBOA 4WLOA 4DDUA 1FJGB 1C9DB 1N1GA 4EG6A 4KNVA 4ZVLA 3M6UA 3STWA 2AFHB 2OD2A 4W8HA 5F7XA 1P6XA 1IUKA 4WLEA 3J7AC 2TMDA 3TNYA 5DT9A 1S2MA 3H2HA 1W59A 4NMLA 3FYTA 4JI5B 4JYBA 2YIDA 3FNIA 5CUQA 3LKVA 3C3PA 4BGUA 4M1KA 4HQFA 4LWZA 1W0CA 3E1SA 1X1RA 3NJ8A 5CEFA 4M1EA 1XAJA 4OHMA 2K2WA 4F96A 4GI2A 1F38A 3LCJA 2R8EA 2WWIA 1V43A 1SR8A 2V6FA 3FTQA 4ENUA 3BKWA 2VF5X 2ZB7A 4O6VA 2WY2D 4QOFA 3V8QA 1B2RA 1GYRA 2AFIE 4LPSA 4O1HA 1RMTA 3GCXA 1EBUA 3O3CA 4MRAA 4X91A 1Z6ZA 1GY8A 3KFLA 5AT1A 2IYEA 2Q5FA 4EHLA 3I6BA 2VZEA 2PH3A 3SYMA 4RULA 3LGAA 2NG1A 4KHZA 5D3ZA 3M7IA 1AQ6A 3LP6A 3OKAA 5LDGA 3ZI7A 2Q0SA 3ED5A 1A4UA 3DCNA 3MJCA 4DLPA 3GEHA 1R4AA 2MHCA 2AG6A 2VSNA 1SVWA 4MQEB 5DJ5A 5EKTA 2NUTA 2DFTA 1IWPB 4OYHA 2EKQA 5AKLA 3ONWA 1SZPA 3EPRA 4HUQB 3PXEA 3ST7A 1Y33E 1E8MA 1BS2A 2O3QA 2PRJA 4GI1A 4PGGA 5IM4F 4JB2A 3RAGA 1IH8A 3WMXA 1DCTA 4OGFA 3T95A 2VN8A 3DTVB 3IHWA 2XCRB 4TXMA 2WMNB 1UKBA 1HQCA 4S1VA 2QN3A 3CX8A 1FQOA 1W2GA 1WZIA 3NT5A 4R84A 4K8RB 1U0RA 5AR1A 3WGMA 2LR0A 2C2WA 4JL5A 4BO9A 1RWWA 1C80A 3JVUA 1G3RA 2WP0A 4FBGA 4HDMA 3ZE7A 4BNWA 3AUYA 1JKIA 2QJFA 2ZM6B 5G2OA 1OGYA 5CHYA 2TMGA 3PX7A 1Z8FA 1PUJA 1DE0A 4FC6A 3FG9A 4BFSA 2ZI5A 2JIPA 4X85A 2UVDA 4KHPB 1VC2A 5CDHA 3MRXA 1NXSA 2I4OA 3ILSA 2YHIB 2WJAA 2NMVA 3Q12A 5JSUA 1M9NA 1ULSA 3KSMA 5F51A 2KM1A 4HH0A 1ZP6A 2I87A 4OXYA 3SHTA 4AS3A 4S1OA 3ZWMA 3ANMA 4LVCA 3DR3A 3AV0B 6YASA 3G5AA 4EHAA 1I2AA 4EFLA 1GDTA 3KHSA 1UAAA 4CLDA 1COWD 1A9ZA 4MS3A 2V45A 4WD3A 3U4DA 3EVZA 2JCXA 2GPWA 2DE0X 4V0NA 4BO5A 2WWXA 3FCXA 3KR0A 1C9NA 1CR0A 3DMGA 2EKZA 3PGXA 2O0HA 4UATA 1VIMA 4PSUA 4XTRA 4YP9A 5GWXA 4EJSC 5EJEA 4R51A 3BL6A 1H8HA 1LZLA 4IMRA 4PYMA 3VVMA 1Z7WA 4HN4B 5B53A 3NHPA 1MORA 3M0EA 1ZI6A 4BB6A 1EFDN 2NUAA 2DPGA 1CU1A 2VRCA 4X1YB 1EUDB 1LSSA 2F55A 1E59A 5CFZA 3CLVA 3CZMA 2XQVA 4O63O 5FT9A 3UYKA 1PK8A 2JLSA 1TUGA 1XVVA 3UW3A 4QGFA 5BOSB 5JHHB 5D5PA 4URWR 4JBGA 1L9XA 2VKQA 1BKDR 3UMCA 1V8ZA 2O8EA 2P2YA 3RYFB 3QJYA 4N3CA 1D0IA 1RLOA 1C1XB 5A9SB 3MWJA 5JAQA 1JDJA 2JFHA 3CRRA 2Q5IA 3G9ZA 4UVGA 5J2TB 3FKQA 1ML4A 1QUEA 4K9MA 1E92A 4TUYB 5DXJA 4CV2A 1T6NA 1U0EA 3G1UA 3ONEA 2QN1A 4V1CB 1GCIA 2AJLI 2A58A 3T8YA 1E9SA 3KQMA 5FNVF 5BN3B 3TZEA 3SR3A 1XE3A 3UA3A 4UUAA 2ZS9A 1Y9DA 1PYOA 4AJKA 5F5XA 2XVYA 2FGKA 3FUWA 1OH5A 3WK5A 1I2CA 2OESA 3QPWA 3UMSA 1GDDA 3AY7A 4ZI7A 3TD6A 1C7RA 3GUCA 5HIJA 1V5EA 2JJ1D 3W2IA 3ZIAD 9ABPA 4NZOA 2ZUBA 1EWRA 5DNAA 1A8HA 3REOA 1QF6A 4HQNA 4JVMA 3HJHA 1KY5A 4C4YA 1IDN1 4LXUA 1OZ0A 1V8BA 2ERYA 4FIDA 3KEQA 4OB8A 1BQEA 3Q72A 3UBMA 3CZQA 3E9ZA 2QE7D 4MQEA 1X0VA 1X7GA 1UXGA 4KYIB 3GLQA 4KAFA 2F3UA 2H7CA 1RZRD 2DB3A 1VKJA 3VQTA 2IOYA 1UZAA 2C9ZA 3B6ZA 3FX2A 1YB7A 2AI3A 1YOBA 2B8JA 2X8WA 2PZEA 2ZYIA 3GLRA 4KAXA 4F2GA 1Y4UA 4TMWA 3ZGXA 1QQBA 3MINA 1RPJA 5HFJA 3CZ5A 2OGSA 1L7PA 3R7SA 4C0SA 3AF0A 1OT5A 3DF9A 3GDOA 3HU2A 3JD1A 3QY0A 3BFKA 3T7SA 2JK1A 3OX1A 3R1IA 4HQRA 2J9ZB 4WXMA 4Q5IA 1SC6A 2PV7A 5DP1A 5H8WA 2VAWA 1H9CA 1RBYA 3W6UA 1NWHA 3I01A 1HLDA 1RDFA 2C2ZA 1S8OA 3AVOA 4H7KA 3G13A 4EMBA 2ADOA 3SR0A 1TPZA 5CNIA 2BGGA 2X41A 3GXBA 3DYVA 3PG5A 4N3GA 1RAEA 3WQSB 1NI5A 3BGOS 3K32A 4JZKA 1OZHA 1SUPA 2ZP1A 4UTPA 5JBQA 1N2XA 5JAOA 3T3EA 1Z2PX 1Q19A 1FMTA 5KQRA 2XE8A 4TQUS 3BXOA 1H23A 3SR4A 4EJ0A 1PKEA 3VTKA 2NSLA 1U8XX 1W0JD 3TZHA 3DO8A 1FTWA 4E07A 4A15A 3MWKA 4OHFA 1SHLA 4XGQA 1WZUA 4QTZA 1M1YB 3VR2A 3W6PA 3G88A 1DAPA 3BFVA 1A0OA 4PYNA 2XB8A 5ABPA 2D2VA 1AO0A 3ZVMA 3BFXA 3ZNQA 2DUJA 4RJTA 2WJIA 4WZBA 1QDLB 2ZUFA 2J3DA 2C54A 2P9YA 3HUTA 1UDAA 6NULA 1Z5WA 2O3RA 4RACA 2FUCA 2WBLC 3FFWA 2YXNA 1YD7A 1CYEA 2PKRA 1VMKA 1RTKA 1U7WA 4CGZA 3PDHA 1NLZA 1RHKA 3HVHA 3S29A 5A71A 1YK0A 3K20A 2EG9A 3OECA 4M0EA 3EVTA 4LGMA 4O4IA 1TJ4A 5DHPA 1V3VA 1N6KA 2JCVA 2BGLA 2V7BA 3AFIA 3DT9A 5CPBA 5F7JA 3HBAA 4BPRA 4DSOA 2OYRA 5IAAA 3RODA 1NBIA 1UC8A 4DM4A 4FUTA 4ONEA 1AKEA 4QSHA 3JQRA 4YAFA 2I3GA 3GGJA 3MRTA 4G63A 1JZQA 1ULZA 2YVKA 1WEHA 4NBLA 2GR9A 2CJFA 4QLBA 2GNPA 4PLFA 4D99A 2HRBA 3FJ1A 2VT6A 3EGIA 1GUBA 1RWXA 3NWPA 3H42B 4I8DA 1V96A 4HRXA 4DMKA 1H4VB 5JANA 3O83A 4A23A 1CR6A 1IULA 2X6TA 1UIMA 3FTNA 1IMOA 1U2RA 5A5GA 1V39A 1RBMA 2UYGA 1Z0UA 2OZEA 2PGJA 3CW9A 1NWCA 2FETA 2ZRPA 3O74A 4NFYA 1U0SY 4MHTA 3AHDA 4P80A 1V4NA 2PKWA 4CNBA 4LV6A 4NXNB 1NXVA 2J0UA 2I1VB 5KC9A 4HX5A 1Q0TA 2Z3ZA 3AHIA 1WU8A 2XXAA 1NIPA 4P4SA 4ZJZA 4XIGS 3R3SA 4F7WA 1W581 3HYLA 3IRUA 3WWYA 4AQYB 2DQZA 4L9SA 2HM7A 1K8RA 2A0KA 3T1NA 3NWEA 3R7NA 4EKIA 2HA6A 1NF2A 1M2KA 2C98A 2VK4A 1KOGA 1QU3A 3FZYA 4LA4A 1OMOA 1VIDA 3QWFA 4GZMA 3DHNA 3AFNA 3GLSA 2ZSBA 1YJCA 3WSWA 4P92A 5HHTA 3CX4A 3JARB 3D6HA 2FMTA 2IS2A 1HPLA 3WLOA 5L3SB 4C2UA 1JA0A 3RD5A 2C0PA 4QJBA 1VBNA 2JGDA 1Z4IA 3RYHA 4FILA 3QE4A 3U1VA 1ISRA 4IMIB 3WLSA 3HEAA 3WLKX 1K5DA 4NEQA 1EB8A 4EVQA 3WWZA 5JXIA 5CCDA 5I9LA 5JMTA 1SC1A 3NOVA 2J45A 1AQIA 1Q0HA 2ZRHA 4NZ9A 1XF9A 1GCAA 1ODJA 4HMOA 4EG4A 2B2NA 3OF5A 3VSBA 3GNTA 3KAKA 4UUNA 1MJFA 2I66A 3NKVA 2H2AA 4EKDA 3GBVA 1FMCA 3W05A 4J6EA 5HQ3A 3CO0S 3IIKA 3IUBA 3JSAA 3E70C 4YVFA 1KNXA 5IZCA 1ZY2A 5L45A 3M6MD 1AS2A 3UGQA 4LF5B 5EJFA 3EA5A 3EXFB 2IP2A 2QT1A 3H2JA 3SOPA 4EZBA 3IL2A 2UYYA 3MFQA 1BDBA 4RS4A 1FSPA 3MHPA 1PR3A 3PXUA 3T7TA 5DH9A 4IIFA 4U9HS 4DDWA 2CD9A 3B9RA 3OWOA 1E1YA 2FFBA 3PRYA 1KBOA 4A6PA 3FCAA 2WIKA 3ICCA 4QUEA 5K4HA 1NR1A 3KR2A 4IDDA 4RE6A 1T1EA 1V3QE 5LSAA 1BX1A 2VJPA 3PRKE 3HQ4O 3REQB 5A0TA 1JEJA 3H1EA 4B7UA 2WJVA 4O3MA 2OD7A 5J9FA 1P4HA 4AWAA 1SCIA 3IB3A 4RKEA 4Y2YA 4OX9B 1J7JA 3TQQA 3EISA 3PHCA 4PZ0A 1Y7PA 1SXJE 4L4XA 2JIMA 4RF2A 1EM8A 2HLNA 4L4YA 3R9KA 2HJRA 2DSTA 4QUJA 4QYSA 1MO2A 1PW5A 2C42A 3BYZA 4P81A 3T9DA 3V4SA 5SZKB 1PK9A 3NGMA 3CVWA 1COWA 1FDUA 1ADBA 4UZSA 3SHOA 1I3OA 3IJPA 2Q2QA 1Q5PA 2H4JA 1I4TD 1TM2A 2ZU0C 1O6ZA 3U3DA 1EXNA 2R11A 3X1DA 3H2YA 1ZN9A 3T9AA 4LOKA 3D4LA 2QTAA 4ZT7A 5EHXA 1K75A 2O1XA 4LOIA 5REQA 1ETHA 4W5JA 3RC2A 3WB2A 3M2TA 4FN4A 1AQYA 3FDXA 3G7NA 4X1KB 4DMUB 4LY3A 5HS4A 2E48A 5BPFA 2WE7A 1PQPA 3NX4A 3PUXA 2YXEA 3UZUA 2NUBA 1AS3A 3CM0A 3KJZA 4QNMA 5G53C 4E4RA 4K28A 4FHDA 3QWHA 1F7VA 2IYUA 1Y3FE 2MYTA 1SB8A 3CJRA 1RYBA 4QQFA 4XQGA 4R9UC 3ZWYA 1KS9A 2DT5A 3LC0A 1JSXA 4PIVA 4QDJA 3RAPR 2I34A 1U3FA 4NLLA 3GGDA 3PSHA 3EPLA 3THWA 2ZTSA 4LX0A 4HB0A 4XWOA 1JQ3A 1QQTA 3G8DA 4TWZA 5CRIA 1ZC4A 3U4HA 1IM2A 1X94A 2VZ0A 1Z4PX 3LP5A 1QO9A 2WUVA 2WKWA 4QDKA 1IWBB 1PEKE 4GMFA 3HCPA 3W9UA 4EO7A 5D3KA 3PKJA 4YDQA 2VH5R 5IJ9B 3VSCA 3IEIA 4BJHB 2PT7A 5EE5B 1GNSA 5JFGA 1YRLA 3H6HA 3PQEA 1IHDA 3N3BC 1IN7A 3Q88A 4UM9D 5AOAA 5AVJA 5C1PA 1G2IA 1PFUA 4Z53A 4KYUA 4OJQA 1OU4A 3PPYA 3TMAA 4O33A 2XNKA 1N57A 1U9ZA 4AN1A 3C3EA 4Y30A 1V0JA 4KZPA 1NNSA 3PGMA 4O4JA 3X1ZA 2HHHB 2FPOA 2VHEA 3M1AA 2FEKA 1KO7A 1T4GA 3CA8A 3I2HA 1S2OA 3EQZA 4FMCF 4MUXA 3QZUA 4C4TA 4D4JA 2IOFA 4WDQA 4B6GA 3NDBB 3T7RA 1LBTA 2EGUA 1Z29A 2N42A 1NFFA 4ZMSA 4FCVA 4RTLA 4LJRA 4YA6A 4ZI5A 2OSBA 3DKPA 1CB7A 4HWKA 1NPYA 3UAOA 2HRRA 4RAOA 5CIYA 3GVPA 2OFWA 1NVVQ 3QPBA 4M60A 1AKYA 4TKUA 2QN7A 3WISA 4WJZA 2NYRA 3IAM6 1QGOA 1UCFA 2GAAA 2K6GA 5KJEA 4RIIA 3ROXA 3LWNA 1L4BA 3PLRA 1YS2X 1C0KA 4Q6BA 1FFSA 2FEXA 4W5TA 2I99A 1ZKMA 3ZG6A 3WA6A 4MW4A 2QT9A 3C6QA 3EFOA 3FMPB 3D0KA 5H3LA 1OF1A 5EIOA 5KYYB 3JATA 4D8WA 4UM7A 1FJHA 2E4ZA 2B2CA 3G9XA 4ZXPA 1SXJC 1MQAA 4Q00A 1YHZA 5F1YA 1NQVA 1U3VA 1X9IA 1L5MA 1GRNA 3OFKA 3PNKA 1XD2A 4QPZA 4EKYA 2IODA 2OPBA 3K70B 4M7WA 4Y1EA 4MKXA 4E5PA 3R8FA 3IIEA 2QLFA 1WUYA 3F5FA 3GAMA 4C0HA 4EQ6B 1KOLA 4XM0A 3MT9A 3IAXA 4I4CA 3RU7A 4FOSA 3OE7A 3TFQA 4PZEA 4HAZA 4TMZA 5EI5A 3E1KA 1JW9B 4J4BA 4FT4A 4YMHA 3VNUA 2HLPA 2JEZA 2RHOA 2ZT6A 1CF2O 2JI8A 1TM5E 4FJ1A 1SU6A 3DNPA 1T8PA 4JU8A 2JKYA 2NTNA 4IJUA 4M9RA 1GGMA 1KQOA 3O03A 1UDRA 3GAFA 4HGOA 4ALJA 3A4TA 4D9EA 3B78A 4EPTA 1U8TA 2O7QA 4MI3A 2H4WA 3TYXA 4M0CA 3OPQA 4ETIA 1RXVA 1D04A 1ZHFA 2RFLA 1EGVB 3F47A 1FMFA 3OPXA 2J9GA 1YGPA 2ZBFA 5AOVA 4RORA 3EH1A 1P39A 1XXHE 1U8YA 2EQ5A 3STHA 2YYAA 3TTUA 1KTIA 2RH9B 5BMOA 4B9AA 1CRZA 4GBMA 1Z3CA 3LG2A 1T3SA 3B1JA 2AT1A 1VXOA 3HY4A 5EG5A 2NACA 3DVAB 4MJLA 1ATIA 2Z9CA 1RQNA 4XUDA 1IBCA 4ARCA 2JFYA 2QQEA 5AVUA 4KR9A 4HD8A 1M2JA 3DL7A 3JYNA 1SRQA 3O9VA 4Y6SA 4NARA 3JWHA 1KI3A 2J3EA 3EVEA 4QAJA 4AJJA 2EAUA 1YJ8A 1F4LA 2C9DA 2I3AA 3FLMA 4IP0A 4JLSA 4PRZA 4DR3B 3PGJA 1MAHA 3ESCA 4GE0A 4OSEA 1JEYA 1MBZA 4GOMD 5B1HA 1J97A 2SECE 1S8FA 1VG1A 4CL2A 1QP4A 3H1FA 1I2MA 1E2NA 3INGA 3IT1A 3L0YA 1F9AA 2V7XA 3EZYA 4HAUA 2Z5VA 3EIWA 2W2MA 4JBHA 1G7CA 3DLPX 2A9KA 2H9AA 5B58C 3CVYA 3EX7C 1VMIA 2ZSFA 121PA 3L5OA 5DTJA 4BNDB 3DZHA 5EQTA 4CM7A 3AVXA 4NV0A 1EGAA 3I0ZA 4DNPA 1YMUA 2BSAA 5KCMA 4C7OB 5LQJA 1MD9A 3ORRA 3OTQA 4L3OA 4DJFC 1AXGA 1G9XA 3FRHA 4OA8A 3GEEA 1PV4A 3O3MB 3CPJB 4NE7A 5CLHA 1GNTA 1UBTS 1A72A 3AGQA 1Z4QA 1I30A 1L5VA 2CJYA 5DTMA 3CUTA 3KQYA 1U3WA 1O5TA 4L3VA 1BOOA 4U7WA 2JH8A 3N6XA 4CR7A 1IOWA 1EDBA 5CBKA 4G0WA 1QK5A 3UFXB 1OXKB 2DULA 4U00A 1U1CA 4PZCA 5AQ1A 4B6QA 1SIBE 3AEUB 3H5RA 2QE7A 4EB6B 1I7LA 4L16A 5DLEA 3CNLA 3EQ9A 3EG9B 1Q1GA 4KQ9A 1IPEA 3SIXA 3SS7X 3QOYA 4Q7EA 4YNBA 4BNXA 3C1TA 1NVBA 3A25A 2MSNA 3FZQA 1OWMA 4RDXA 1DP4A 2HT1A 2RHDA 1BE8A 1NP7A 4XD7A 4WXHA 3L0CA 4EY7A 3CNHA 3GZJA 3MTAA 5K0JA 2ECKA 1IONA 4DPKA 5I5GA 3UHAA 1GUZA 3FHJA 4V38A 4WH0A 4IVNA 4I9NA 5JAHA 1JLHA 2ZYTX 4BNGA 3LDUA 4K81B 2OCDA 2BP7A 2KBFA 1G63A 3GJ4A 1EK1A 1M34B 3JXEA 3K5WA 3N6RA 2OZVA 4NQZA 4OI4A 1DC7A 4QYIA 2H5IA 3U7EB 3EGXA 3LUGA 3K73O 1J33A 1AK9A 1JFLA 4ZVMA 1SU7A 5BWCA 1UPUA 1I0IA 2H2HA 1NQAO 3AOGA 4U6NA 4A6XA 2TECE 3N2LA 4E13A 1UP7A 1FK8A 1CIPA 4OGKA 3DDHA 5A7GA 2VP5A 1K27A 1TM3E 3EDQA 5AUQA 1DAKA 2MSWA 1MZVA 3DVRX 3ETEA 3KALA 4FNAA 1KVUA 4L51A 4OK3A 4E51A 3AWDA 5P8WA 5TS2A 3C8DA 4FYIA 3RFCA 1ZITA 3WL3A 4BN5A 1JWLA 4DA7A 2VWPA 3QVLA 1OH6A 1U28A 2JEYA 3G2OA 3G8AA 3S5JA 3VAZA 3EA4A 3FPJA 3PYLA 2FZKA 3QA3E 4FZVA 1OWOA 4D80A 5AIBA 2HQBA 4CG3A 2XLBA 4R9SA 4JGIA 3FOCA 3LDHA 3BFJA 3NGXA 3OUTA 3THYB 2VDRB 3W34A 1V26A 1X19A 3BHMA 4E7OA 1FEZA 2ZUCA 5AI9A 4BZWA 3DBRA 5ULLA 3TN7A 3F97A 1H3NA 3CZ4A 3HCEA 4G9GA 4OQ4A 1JHQA 4RHTA 1XNJA 2YZMA 1W76A 4XLLA 1JIQA 2IHKA 5EYPB 4XYMA 2PEYA 2Z6QA 3V4ZA 4LNUB 4GR5A 1G3MA 4WDRA 5A5DA 1N2ZA 3T99A 2BY4A 1KU0A 4MPDA 1G5IA 1E0AA 3ZCTA 4YMTA 3A1NA 4O4HB 5D5QA 3Q7QA 3K1ZA 5E4TA 1WPGA 2R84A 1CQIB 1D9ZA 2QNIA 3O26A 1IHUA 4LJ5A 5G1PA 4GSLA 3U7QA 2G25A 3UEOA 4ZK6A 3RU9A 3EIQA 1ZI8A 5K6RA 1I9GA 1QG0A 1ZGBA 5FLEX 1V8FA 1T5IA 1SG6A 1H05A 2FEMA 4R8VA 2Y9PB 3ZOKA 1NL3A 1P2FA 1XMVA 1CR2A 2CUNA 2GX6A 4X41A 2EBFX 2CSUA 5H4HA 2A33A 3A4YA 4N8SA 3R74A 1GKYA 1P9LA 5B6IA 4D46A 1ITZA 2CLOB 1CZHA 2W2NA 3PF9A 4N9QA 3IO5A 4YAEA 3KEFA 4W4TA 4X6LA 4JBYA 5EHNA 1T3LA 5FBVB 5MFZA 5IX8A 1YRQA 2H2DA 1FMLA 3KOUA 3NWJA 1DX4A 1PR2A 2I9PA 3FB4A 1KJWA 2GM9A 4FS3A 3NT2A 1JIXA 3AR9A 3EEYA 4BLUA 2VXOA 1X3LA 4IIBA 3MS4A 1LDBA 1ONNA 1ZQ9A 3AGPA 4MW7A 5HTKA 5KAMA 1BVHA 1ODTC 2BLNA 1GPKA 4KXYA 1VE9A 5JDCA 3LC1O 4Z8YA 1DKRA 1YIAA 2R751 2HF8A 3C1OA 3HE3A 5K2MA 3CBGA 3HB9A 3O47A 5GOZA 4H15A 2GJSA 4WZAB 4IXMA 1ST2A 1T4MA 2QJRA 1AO3A 3EIEA 4HNAA 2QG4A 1MG0A 1G60A 2QLLA 4QZVA 8ATCA 3HK2A 5KYXB 2GESA 4OHOA 3KXKA 3Q9UA 4OHWA 3H1TA 3BJRA 2I0FA 3PNLA 4AUKA 4BIIA 2QRVB 2WHRA 4ZGBA 4M1SA 4NULA 1QRDA 2G08A 3LX4A 5F64A 3FGZA 3FTPA 5KTYA 3L46A 4R6WA 4F56A 4QVIA 2YTZA 3L40A 1K92A 4PNPA 4R9VA 5J1TB 5K3FB 1L8LA 2FQYA 1VZ3A 2XRFA 3FPBA 3MGCA 3N39C 5E9WA 2O7SA 4JBLA 2E3JA 3CY6A 2BP7B 4QUHA 3DQQA 5C18A 2V59A 3GJRA 3U1BA 2I29A 2GBFA 3F6YA 4GDMA 5JS6A 4W1SA 5M2QA 1U99A 4JEUA 4DV5B 1T2EA 1VLVA 3DT6A 4BE4A 5AJUA 2YKGA 2QOEA 2VG8A 3TE6A 3BSWA 2PQMA 3EC1A 3U6BA 1YFZA 2WSMA 4CT0A 4QICA 3T12A 3UT5B 1LK0A 2XCOA 3IPXA 1USWA 4FP9A 1IYZA 4OSPA 4RABA 4ARBA 1XZLA 3FYCA 4X1YA 1YZYA 3RASA 1Z4MA 3I23A 2DUNA 4MWBA 1UOEA 4B34A 3BJEA 3ON5A 1W0KA 5TMBA 2J3IA 4BWVA 4CWAA 3K53A 1NQ5A 3LLUA 1KI8A 1JL3A 1EP3B 1OWLA 1U9JA 3G8YA 3H97A 3L7YA 5BQOA 4MQ5A 4YREA 3AI7A 2JF0A 4X92A 3W1VA 5IYZB 1KEKA 4BL5A 4DY4A 2VT2A 2EW2A 3K4HA 5DM0A 2IRWA 2HPVA 4FYHA 3L8EA 2FJUA 3GAAA 3QTBA 4J1TC 3VZRA 1W7AA 5DCUA 2EQBA 1B0AA 1C4OA 3HS3A 5LOVB 1X1QA 4YJGA 4ZAYA 3BRSA 3CE6A 1T0BA 3EZXA 4FKMA 4G89A 3E23A 3SN6A 2NPOA 3OE1A 4DR6B 3TX2A 5A5FA 3V8MA 5AI4A 3FFXA 2EKLA 5IJ0A 3BCHA 1C7JA 1R8SA 2JFGA 5K03A 1ST3A 5AW9A 2YIVX 4X7MA 1MG5A 2MWMA 3CRNA 4F5ZA 4Z0PA 2AI2A 1F2DA 4UD6A 2CWWA 4MQ4A 4Z86A 4IUBS 4L15A 5HR5A 1KA9H 5JT1A 2WWRA 3K0AB 2LDXA 5J63A 3M1YA 3HR7A 5LP6B 4RTRA 1C0IA 3PDCA 4Z6KA 5JJBA 4AJNA 2J3LA 1E1MA 4D98A 1E61A 5CBPA 3LM8A 1LTKA 2BZ1A 3WWPA 2ZRKA 3CCBA 4OUDA 1KO8A 4I5DA 2EGHA 3CONA 4Q3OA 4MA5A 1GXSB 2YV5A 4AP9A 1TMKA 4CKEB 2AN5A 3IBGA 1VCNA 4YMUA 3NLLA 2ZT5A 5L3VA 1YRHA 2P3QA 4GMGA 3DUFB 1W29A 2X2EA 1EINA 2SICE 4KXXA 4XIFA 4EFDA 1DGQA 4LG1A 1E60A 2W4MA 5BR8B 4JI1B 4M3NA 1HYHA 1M0TA 1LWNA 2OQ2A 3F7MA 3G2QA 2D1FA 1WG8A 3GRKA 4AMBA 4BKMA 4D9MA 5ESDA 1KC1A 3TINA 1CQJA 1JFTA 4PX3A 4FC7A 2YN4A 5A3QA 3IEUA 5JCOA 3TXYA 2ENWA 4FNGA 2XNSA 1RAFA 3CT4A 1L4GA 1SCNE 2XHZA 2HMSA 3BICA 1WRBA 3QX8A 4Y7CA 3U1TA 5EJ7A 3K71B 1WB9A 4P7JA 1IIRA 3QX9A 4RYLA 5C80A 3FYUC 3JQQA 1G17A 5F5NA 4ESOA 1TZKA 4XCVA 5ER9A 3L0PA 3PCTA 4DCPA 2ZB8A 4AF8A 2B78A 1XAIA 1I6WA 4W1RA 1JSZA 3FTCA 1ZEMA 1ESDA 5IZCC 1ZAYA 1R6TA 3U80A 1QIEA 1CF9A 3LZCA 4OTZA 1AQLA 1RAAA 4K1LA 1JNYA 4LI0A 3R5FA 5JBNA 2YHSA 4M99A 4AJHA 3AVVA 3C48A 3D6UA 1Y34E 3RVJA 2X9NA 2AXNA 3EOAI 4NJMA 5FBQB 5JNUA 1G291 2ATEA 2Q9CA 2WIAA 4FFLA 4J03A 4BCDA 2ZB4A 1ADYA 2QRPA 1D9XA 4HDAA 1EM6A 3VBEA 2NVWA 1H8ED 2YOGA 1UOOA 3FWPA 3NTVA 4HLUA 4MH0R 7AT1A 3WYCA 1MJ5A 2OAQ1 4INOA 1ZICA 3MK31 5D1HA 1I1QB 4QJ3A 3PXDA 4B85A 4G07A 1Z5PA 3MGGA 5IF3A 4XWYA 5K3DA 5CH5A 3VYVA 2BFFA 1O97C 1QR6A 2YDYA 4OQZA 1WZCA 4WLUA 1UR5A 3GFRA 2ZAGA 2GO7A 1XHFA 1Y0BA 2VKTA 1JQAA 2ON6A 3SFZA 1DEXA 3W2GA 2XVXA 2OY0A 3WNQA 1MO5A 3H11B 1DBSA 2GLTA 4HK4A 4YTEA 2V98A 1NR7A 2X4LA 2H11A 2R1ZA 5IVDA 1QHFA 2Q8QA 4ZICA 3CRW1 5BT9A 1KOJA 1MR3F 3EARA 3OSUA 5FTNA 3F67A 3EHEA 1MGOA 1XHEA 4IIDA 5M3BA 1LS6A 3UPDA 4JA0A 4OB6A 4RUKA 2D8AA 3LL7A 2PGNA 3M4JA 1AGRA 1QOPB 2DCUA 3OTHA 4G0OA 4K46A 2L18A 4TQAA 2VPTA 3K09C 3WKCA 3L7CA 1HKHA 1RLJA 3DE5X 3BCSA 5CITA 1UBMS 3UGTA 5HRCA 3D1JA 5ELMA 1RCUA 2BV3A 2AZDA 3C5EA 2NIPA 1CULC 1TTPB 3FPCA 1EB9A 4MZXA 5L51A 1PYGA 2I6GA 1QPGA 3E9QA 1DQPA 1U6IA 4L9RA 3ZCPA 1X7XB 4F38A 4D4MA 2BONA 2D5LA 2VDWB 5F73A 1M2GA 4ZZ3A 2CXHA 4U39A 3B6JA 4N7RA 1RJWA 5EHGA 4V0ME 3S44A 1OTHA 1QDEA 4KI0A 1CY1A 4EYQA 3ZXIA 2I2BA 2Q4TA 4QYXA 4E11A 1BMDA 1NI4B 1D2EA 4IDOA 2IJGX 2Y1DA 2ZJFA 5I8ZA 3ZJTA 3WGZA 1U7TA 3TLEA 4QQNA 1Y8RA 5K8TA 2WIFA 3GNSA 5B4UA 1SXHA 2L2QA 2O50A 3ICWA 2C2HA 3DUFA 3IMEA 4G1UC 2WFAA 2NOAA 3QITA 3TUIC 4C0KA 1WCIA 1CZKA 2WA1A 5C5IA 1WQ1R 3H5IA 2WF5A 1XL1A 3BS4A 1JIVA 1YB5A 4C4XA 4BMXA 1NI3A 1AZSC 2EVWX 1GILA 2XDAA 2ZPUA 3PHBE 4DWJA 3OZIA 3RRJA 1PR1A 2BM0A 1AV6A 1YU6A 1ARZA 1SKYE 3IHTA 4I4NA 3QYAA 3CURA 5FDFA 1SKAA 2IUFA 4YWHA 3ZGYA 1HG0A 3QEBZ 3AEQB 1OBFO 4AJLA 3D4BA 3M9XA 3A9WA 1G5PA 2RK4A 3GRFA 3C14C 1A9SA 3JRXA 4HAIA 2QU8A 4G0YA 1R7RA 3AP3A 3DAHA 3LIIA 3O38A 4MV9A 4OJKA 4P86A 4Q02A 4IIEA 5LD2B 1JBEA 2BGWA 2ZSKA 3MS7A 4JX8A 4MQLA 3L7BA 3L0BA 2VHXA 1CUBA 2JAUA 4IYJA 2OQRA 4Q19A 3SOZA 3Q11A 5JH7A 4C6SA 1QIDA 4LQDA 1G1MA 2MOKA 4INJA 4YROA 5JNSA 4CF5A 2YJTD 4BDTA 3FY4A 5DOZA 2OORC 2VQEB 3KYDA 3WGLA 4F91B 3B5IA 3GJ8A 1SXJD 4YJ3B 4ZV9A 5BNIA 2F43A 5T64A 5AVWA 1GOTA 3CCFA 4M55A 4V02A 1BW9A 1N1MA 4UUBA