4QMZA

Mst3 in complex with sunitinib
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
287
structure length
286
Chain Sequence
b'MQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE 24
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 100
structure length 286
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qmzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qmzA01
1YKRA 3ZSHA 3C50A 3UDBA 2X2KA 5CT7A 4FMQA 3TNPC 1V0BA 3KKVA 5EDQA 3R9RA 3RP9A 3TNIA 3LMIA 4RJ8A 3QC9A 3UG1A 3DK7A 3VRYA 2HOGA 4Z7GA 4C35A 4PTEA 3NW6A 2VN9A 2WTJA 3EQDA 2UW0A 4P5ZA 4GRBA 3R2BA 2PVFA 3DZOA 4UYNA 3QQFA 4JBQA 4CQGA 5BMSA 3DCVA 4CCUA 1JNKA 5HNBA 3RHKA 2V22A 2XNBA 3Q9YA 4CCBA 3VS2A 3KCKA 3DBEA 1YDTE 3U6HA 3A7JA 3R0TA 5A3XA 4O1OA 4C61A 3BEAA 3DQXA 4QP2A 3KXHA 4K1BA 3RCDA 5FM2A 5HTIA 4UB7A 3QFVA 4B9DA 3EYHA 2RL5A 4BI0A 1ZYLA 3O23A 2QOCA 4J52A 4GCJA 3W55A 4BI2A 3ZTXA 1H1RA 5DEYA 4EQCA 5LMKC 2HWPA 3VUHA 1VEBA 4EHZA 3HV5A 2V7OA 3JUHA 4F1OA 2CKOA 4I4FA 3MA6A 4O7RA 2HXQA 1W82A 4GS6A 4LRJA 4ZTQA 5KE0A 5CF6A 4GVJA 1H26A 1OL7A 2IVUA 2Z7LA 4Y8DA 3TZ9A 1DM2A 3WILA 3TTIA 4AXAA 3UYSA 5AR5A 3SD0A 3MVMA 4ZZNA 2XIKA 1ZYJA 3FZRA 4FSRA 1U5QA 3TV7A 3ZUUA 4EOIA 3FMEA 4AZFA 4BKZA 4D9TA 4IDVA 2C3KA 1XH9A 4IW0A 1W84A 2OI4X 2OK1A 4MXXA 3SX9A 4YJSA 5JH6A 5CU6A 2OXDA 3C9WA 3IGGA 3OCGA 1GAGA 3DFCB 3EMGA 5J87A 5HIEA 1JSVA 5AP0A 5K0XA 2WMSA 1H00A 3PVUA 4YTFA 4IJ9A 4D28A 3EKNA 3O96A 4K2RA 5IKWA 3C4CA 3ORNA 5E8ZA 2OZAB 4GH2A 5HVJA 4EK8A 4WBOA 3SVVA 1ZOHA 4R8QA 5EHLA 2WTIA 3VBWA 3KN5A 4RIXB 4ZLZA 5IISA 3NUAA 3BV2A 4M7IA 4FX3A 3CS9A 1XKKA 1ZY5A 5EH0A 3ZRMA 2WTKC 5C1QB 2RFEA 4GYIA 4HZRA 5AV1A 4NTTA 5EM5A 5I3RA 4PDSA 3QHRA 5L8JA 1NVSA 2CKPA 2O63A 4CXAA 2V0DA 2C4GA 2DQ7X 2BIKB 4D55A 3FQSA 3OCBA 3MY0A 4YZNA 3TZ8A 1PYXA 4EEVA 2XBAA 5CF4A 3F3ZA 4KRDA 3VF9A 4QP7A 4AW1A 2UVXA 1PKGA 2X8DA 4H3BA 1WBPA 3AMBA 3CPBA 2UZLA 3QZFA 4MNEA 2XUUA 4BKJA 2CNQA 3Q4ZA 3Q52A 5AR2A 3VW6A 3U51A 4BFMA 2Y4PA 3DJ7A 3KMWA 4BWKA 1VZOA 4MWHA 1YHSA 3UIXA 3F88A 4CGAA 3OHTA 4R3RA 5CU3A 2JDVA 4S31A 1REKA 3V5WA 3OD6X 4XV2A 2XCKA 5E91A 2QOIA 3ZU7A 3U9NA 4C4IA 5I9ZA 4RWLA 4MTAA 3IW4A 4IVAA 1OVEA 1MRYA 4ZY5A 4DINA 3SOCA 3CQWA 3A7HA 4EONA 5AADA 1OPJA 3QTUA 3EQBA 3R28A 4XEYA 4Y95A 4BHZA 3WOWA 3Q4CA 2QR8A 2GTMA 3HRFA 4EH2A 3TNQB 3IDCA 5HI2A 3IDBA 4FV7A 4O0VA 4R77A 4QMSA 3ITZA 4LMNA 4CYJA 3BQCA 3UJGA 4BBEA 4EH8A 5BYYA 2HZ4A 1WBWA 2E9OA 3LFEA 2OF2A 3BHUA 3SLSA 3THBA 4ZY4A 3S00A 4BCQA 4ZSEA 3U4WA 5BVWA 4F6WA 4MAOA 2NP8A 4IAYA 5E8UA 2GNFA 1YOJA 2JEDA 3NNWA 4RGJA 1PMEA 2YAAA 4JX3A 4RVTA 3F82A 2VWWA 3DNEA 4QT1A 4MH7A 3V5LA 3F7WA 4U97A 3F7ZA 5L2IA 1KOAA 2SRCA 4PTGA 2VNWA 4N6YA 3OVVA 3ZLXA 4C7TA 4FL3A 4EH3A 4XG6A 5KHWA 4DG0E 1XR1A 4KS7A 4D4YA 4R7IA 4CNHA 3UZPA 5DNRA 5BVFA 1O9UA 4WUAA 5J5TA 4FKRA 3EFKA 5KKRB 3M42A 4KS8A 5GHVA 5IDPA 2QCSA 3GU5A 5AX9A 3OXIA 4RRVA 1ZZLA 4X2GA 3TL8A 4II5A 4B99A 3FL5A 3GU6A 5DA3A 4NJDA 5TOZA 1FVTA 2RG5A 5EKOA 2WELA 3MVJA 3K54A 5FTOA 3ZCLA 5KMLA 1UU7A 4AZSA 3A7FA 4ZZOA 5CAPA 4WOVA 1IR3A 4E93A 4ANQA 4TYJA 4OW8A 5JT2A 3VULA 3KY2A 2QOQA 5EW8A 2X8IA 5CVGA 2I0HA 5A4EA 3MTFA 3D7ZA 1H1PA 4FZ7A 4ACHA 3PXZA 5E8SA 3D4QA 3F61A 1B6CB 5AP7A 5E90A 3V8TA 4D4SA 4XV3A 4XP3A 3PXYA 3ATSA 5KBRA 3EFJA 2PZIA 3PJ2A 3UOHA 1B38A 3IO7A 4I5HA 4D2VA 4HVGA 5C4KA 3UC4A 4UV0A 3QQLA 3LMHA 1RQQA 2R3GA 5CSPA 3MB7A 3F69A 4GG5A 1KE8A 2PVJA 3RPVA 1YXXA 2F7EE 3KQ7A 4M13A 4WA9A 4DEAA 5IMXA 1J7IA 3LM5A 4D1ZA 4FV3A 3DBFA 3GU4A 3BBTB 1FGKA 3GOKA 2W4JA 5D12A 3QZHA 4YHFA 3VBXA 2BTRA 1SMHA 3FMMA 3T3UA 4I94A 2GS6A 4EOPA 3CIKA 3K2LA 5KMNA 1Q8TA 5EI2A 4TWPA 4O7VA 3ZEWA 4Y73A 4BICA 5KMOA 4Y46A 4M69B 3QCXA 4RPVA 3D9VA 4XNEA 5AV0A 1ZMUA 4YJUA 4CZTA 5EG3A 1FGIA 3Q9ZA 4GV1A 1ZYCA 2O64A 4TL0A 5F4NA 4ARKA 4NJ3A 2ESMA 2PUNA 1X8BA 3Q60A 4PMMA 3O8TA 4A9RA 3G51A 1YXTA 4A06A 1YI3A 4FICA 2I0YA 2PZYA 4DH3A 4EHEA 3MS9A 3OUKA 5CQUA 2YM5A 2HXLA 4M66A 4FTKA 2GNJA 3KL8A 5E8TA 4QMVA 5IA2A 5L4QA 2VTQA 5AP4A 4BCIA 5TE0A 2PTKA 3KVXA 5JFVA 1PF8A 4UXLA 3HECA 4PQNA 2GNHA 2W1GA 3EZRA 2VX1A 5JGAA 4RMZA 3F6XA 1YDRE 3PIXA 5A9UA 5LOHA 3LXLA 2Z8CA 4FSNA 4FVRA 1PXJA 3DAKA 2R7BA 4R3PA 4TTHB 4Y83A 3ZOSA 4AZTA 4I0RA 4QTEA 5FGKA 4QP8A 2PMOX 2Z7SA 3VS7A 4DEIA 2RKUA 3KU2A 3ORPA 5C8MA 1MQBA 4BB4A 3ZSIA 3UIMA 3QWJA 4TN6A 3C0GA 2JKMA 2R3JA 2YJRA 3EN5A 2OO8X 4CFFA 2BKKA 4ASDA 4JRVA 3PRFA 5EYKA 2G9XA 4MQ2A 3MY1A 1IG1A 1UNLA 1F3MC 3LE6A 4FIGA 3UIUA 1JSUA 4HCTA 1J91A 5DRDA 1O6LA 2QLQA 4G5JA 3JR1A 3RM7A 3TNWA 2B4SB 4L3JA 4ZMFA 4QD6A 5IA1A 4ALUA 5HIBA 4BCPA 5AUYA 2JBOA 3TJDA 3U6JA 3ZO3A 2WEVA 4J95A 4FV2A 3UIBA 3ZHPC 4V01A 3MH0A 2Y6OA 5CU0A 5KMMA 1JOWB 5HE2A 3VQHA 4DH1A 2UVZA 4M84A 4PL3A 2B9JA 5L6OA 4R1VA 4UY9A 2XNOA 3CLYA 4L9IA 4WO5A 4LL0A 4CRSA 2PVLA 3RPSA 4NM3A 4ZTSA 4DCEA 5IMEA 2ERZE 3TV4A 3PVWA 4GL9A 4U7ZA 4FF8A 4EWQA 3HV3A 5A54A 3WF9A 2Z7QA 3UOJA 2XEZA 5FXRA 4J99A 4TKSA 3BLRA 3I4BA 2IVSA 5IQBA 2NO3A 4L52A 4ZY6A 3LFDA 3QKLA 4QYYA 5BVDA 5HNIX 4XRLA 2BHEA 3DLZA 2ONLA 4O91A 4J71A 1SYKA 4NKSA 3GOPA 4D0WA 2CN8A 5FM3A 5EYMA 2J90A 2CKQA 4DH7A 4FI1A 4O0SA 3UQFA 4NWMA 4O82A 2OFVA 3P4KA 4CG9A 2CKEA 1O6KA 4EBWA 2LAVA 2PUUA 5LCJA 4FG9A 3R9HA 3VHEA 4DFBA 2JAVA 5IUHA 3HZTA 2X7OA 2BZKB 4D2SA 3NMUF 4XUFA 5LCKA 2F2UA 3OROA 4L43A 4QTDA 4DTBA 4FIFA 4IBMA 3H9OA 1AQ1A 5AV4A 3GGFA 4Z3VA 3R1QA 4ITIA 3D7TB 3DPKA 3L9LA 1U54B 3PVBA 2C0IA 4UMQA 5AM7A 5CANA 1WMKA 3E88A 5IQEA 1GY3A 2W1IA 5D11A 3QUPA 2R5TA 2YM7A 3R8PA 5JQ8A 1P4OA 4IZ7A 1STCE 2CGVA 3PDTA 2A19B 2QKRA 3R21A 3DT1A 5HG7A 2B53A 1XJDA 4I22A 3FV8A 3GVUA 3NZ0A 3LCSA 3TG1A 2QO2A 3KRLA 2E9PA 2ITTA 4CV9A 3LCOA 5K0KA 1LUFA 3UNZA 3UPZA 3R9DA 3NIZA 4QYFA 2W4KA 4YHTA 5AMNA 4JBPA 3IONA 4R7BA 3LFCA 4TPTA 3MA3A 5ANIA 4BYIA 4PDYA 2REIA 1F0QA 2B55A 1P4FA 3HL7A 2HW6A 3SOAA 1RJBA 2WOUA 3KF7A 4FKJA 4J98A 4QQJA 5CENA 3SXSA 5DMZA 5L6PA 2WD1A 2RSVA 3H3CA 4IAFA 4W8EA 2Y4IB 4R5SA 4EOKA 3HP5A 4FT5A 5E1SA 4EQUA 3N4TA 2R3KA 4TRLA 1OGUA 3B2WA 2E9VA 3SV0A 4QP6A 4R7HA 3PWYA 2IZSA 2OKRA 2OZOA 4I3ZA 3QTXA 1R0PA 3NS9A 5CT0A 3ZXTA 5J7BA 5AR8A 3V3VA 5IU2A 3LM0A 4A07A 4Z7HA 4PP9A 3FXXA 5HVYA 2I6LA 5M57A 4FV4A 3F5UA 4O84A 4EJNA 4EYMA 3OG7A 3DQWA 3JXWA 5IQGA 2OFUA 4LUDA 3EFLA 3ERKA 3SXRA 3ANRA 4BWXA 4XLIA 2J5FA 4HVIA 3ZO2A 3UVPA 4AA0A 5JMSA 4AACA 3N4VA 3QZIA 2QR7A 3PE1A 3HDNA 3MY5A 4U79A 1ERKA 3S4QA 4JDKA 3BHHA 3IPHA 4QMWA 5EOBA 4BHNA 2O3PA 3EN9A 2HY81 3ZO4A 3H0ZA 1Q8UA 1TVOA 3CC6A 2QOLA 3LIJA 3WI6A 4CMOA 1G3NA 5EW9A 3PTGA 2BVAA 2CDZA 5IH5A 4NW5A 2XB7A 4LG4A 1UA2A 3EOCA 3FLSA 3FYJX 1JWHA 3CPCA 3I79A 4YPSA 3QRKA 5AUXA 1NXKA 3NUPA 4LOQA 5CAOA 3ORMA 4ANOA 4TYIA 3ZYAA 1OBGA 1Q61A 1R1WA 3WF7A 5A6OA 4MKCA 3QQGA 4K6ZA 5CTPA 3LAUA 2BFYA 4ZLOA 5L3AA 1UU3A 3NYOA 4YJRA 3PPKA 4RIYA 4XBRA 3PY1A 4H1JA 4O7NA 3RMFA 1PXPA 3CKWA 1PHKA 4MX9A 5K5NA 5J8IA 5M09A 4HGSA 5FDXA 3R8MA 3PA4A 5E92A 2QO7A 1K2PA 4YC3A 3UE4A 3D5UA 4FV8A 1YWRA 3RVGA 5CI7A 5J9ZA 2C3JA 2R3HA 3FMHA 2IO6A 3WZDA 5AUVA 2P55A 3P0MA 1YXSA 3R8UA 5I4NA 3DGKA 3UOLA 1U4DA 2EXEA 2VWXA 3P9JA 4EOOA 4DH8A 2W1HA 5CAUA 4F9WA 5EI8A 5K5XA 3IK3A 3VBQA 3WIKA 2VWIA 3MJ1A 4OTWA 1HCLA 3OY1A 4J8MA 5KUPA 1G8AA 4ZTLA 4L46A 3OEZA 4FSQA 2BHHA 3R1SA 5HEZA 3Q04A 2WMTA 4JS8A 2JLDA 5E9EA 3TN8A 3Q5IA 4FKVA 4KKHA 3FMJA 4C02A 1OIRA 5C03A 5LXMA 1UKHA 3O51A 4OBQA 4DLJA 2VUWA 2YHVA 2O5KA 5LWMA 4QP1A 5JFXA 5ANEA 4G3EA 3ATTA 4WUNA 4JDIA 2YZLA 2CGWA 2BRHA 1JQHA 3L9PA 3NGAA 4HVDA 5KMIA 4DA5A 4FZFB 4KIKA 4F6UA 3E3PA 3ROYA 4MF0A 2YLEA 3COMA 4RG0A 3BQRA 3GC0A 4AE9A 1A9UA 3V8SA 4DN5A 4FEWA 3DKGA 4O7LA 3UG2A 3CR0A 3F5XA 3R7IA 4W4VA 4DEGA 4R5YA 4IVBA 4ZSLA 2GNLA 2Q0NA 4OAUC 3BE9A 4CTCA 4OTQA 3Q4TA 4IMYA 3VNTA 4RWIA 3W2OA 3ANQA 3RGFA 3ZFMA 4DCAA 4N4SA 2GDOA 3QAME 3QX4A 3VVHA 4PPCA 3FZPA 2J6MA 3R7GA 2OIBA 3OY3A 4AW0A 3QTIA 2UW6A 5FBOA 1OMWA 5HNGA 2XNGA 4ALWA 3QZGA 5ETIA 3NWWA 5E1EA 4ANNA 1V0OA 2R64A 4IACA 5CF8A 4C4EA 3RWPA 4BC6A 4AZEA 4DGGA 4DEEA 4I6FA 2WMVA 5M53A 3E63A 3KK9A 4GT5A 3R02A 3V6SA 3ACKA 2VWZA 3R1YA 4A4XA 2BUJA 5JFWA 4I6HA 4EC9A 4NIFB 1HOWA 4UMRA 2C6DA 2XK4A 4NFMA 4JIAA 4V05A 3MI9A 5EOLA 3EN4A 4XV1A 2ZV8A 2PVRA 1LEZA 4YTCA 1IA9A 1OIYA 4TZRA 3SRVB 4IAAA 2G15A 3LFFA 4KABA 2VO6A 2XRUA 3WZKA 3S2PA 2B9HA 2VTLA 3JY0A 4O7ZA 4YNEA 3TNHA 3R8VA 5HU9A 4QMZA 3IW8A 4WT6A 4D4VA 2R7IA 2YM3A 5IQAA 2W4OA 2UZOA 2Z60A 2IW6A 3OBGA 2XNNA 4I4EA 4RIWB 4ZEGA 2QOKA 1DS5A 2VO7A 4G16A 4CQEA 3MPAA 1XO2B 3CGFA 3FPMA 4F0IA 5B2KA 4YTIA 3DXQA 4XP0A 5DBXA 1GIJA 3TM0A 3GQLA 5HO7A 3LJ0A 2BCJA 2C6MA 2V62A 4K33A 2W9ZB 4ACDA 4CYIA 4QYEA 5DVRA 5C27A 5JRQA 4CRLA 1WBNA 3HV4A 4KNBA 5EW3A 3W2CA 3TDWA 3V6RA 2ONLC 1PMNA 3NPCA 4AUAA 4DYMA 2XJ2A 4HCUA 3CTJA 2VTHA 4Y85A 1QPJA 2JDRA 2R3QA 4G3DA 4ACGA 3E7OA 2C5VA 4F63A 4KB8A 1J7UA 3HAMA 3OWLA 4UMTA 4FTUA 2ZDTA 4F1MA 3NSZA 4IWDA 3NRMA 4HYUA 3C13A 1Y6BA 4FEVA 2FA2A 2UVYA 4AWIA 4L01A 4HZSA 5EM8A 1OI9A 5J1WA 5BVEA 2VTNA 1OITA 2W5HA 3Q5ZA 4IADA 3E87A 4LGGA 5JN2A 1E1VA 4RJ5A 5HO6A 4FKLA 5HX8A 3QYZA 2C6OA 4DGLC 4OTPA 1NVRA 3FZSA 3HAVA 3LFNA 3VJOA 3FUPA 2ITZA 5JFSA 4I1ZA 5HTBA 4AOJA 5GIOE 3A7IA 1UV5A 3WE8A 2YLFA 3D94A 1QL6A 2XKFA 3A4OX 3PJ1A 2XKDA 2PHKA 4EZ3A 3EQHA 3I60A 2H9VA 3FSFA 4BTJA 1P14A 3SHEA 4CT1A 5JK3A 3OT3A 4FK6A 5C01A 5CEPA 4BBFA 3ORZA 3UQCA 2JDSA 4KD1A 2EUFB 1DI8A 1KWPA 1XBCA 3AOXA 2J5EA 3FKNA 4PDOA 2WTCA 3A61A 2OXYA 2G2HA 2IW8A 4AT5A 3DDPA 3GCSA 4ALVA 5GNKA 1MUOA 5IPJA 1ZZ2A 1YDSE 3VBYA 4QMLA 4CFVA 2VNYA 4E4NA 2F2CB 4BCNA 2FSOX 4BDEA 2VWVA 4D1SA 4W8DA 3HRCA 2QI8A 1U46A 3MTLA 3W2PA 5H8BA 4EHGA 4WRSA 3HMIA 4KUJA 2VO3A 3MJ2A 2W5AA 2QOBA 2FSLX 4X3FC 4XG7A 3I0QA 4USEA 1H27A 2Z7RA 3G6HA 3PLSA 4APCA 2C68A 4TYHA 5GJGA 3T3VA 3ODYX 2X8EA 5AP5A 5H3QA 3RK5A 3OW4A 2HYYA 3K3IA 1YXVA 5IEVA 3A2CA 3L8VA 4C8BA 3ZUVA 2OF4A 3ZBFA 5IH6A 4GKHA 4YGAA 4QQCA 4GK3A 4JDJA 3R73A 4KKEA 4QMPA 2H96A 2UW5A 3BWJA 3Q4UA 2FVDA 4MHAA 4IWQA 4LV8A 3GU8A 5FEDA 2WZJA 2C5NA 1KV1A 3QC4A 4O7TA 3DB6A 1H0WA 3H30A 4BDKA 2JIUA 3RJCA 3QCQA 2RFDA 3T9TA 4B8LA 4OBOA 4QYGA 2P3GX 1Z9XA 2YISA 4G31A 5I5ZA 4MQ1A 4F9BA 1OL2A 3GFWA 4M3QA 4PMSA 2XP2A 4M0YA 2IW9A 2Y6MA 3DLSA 5AUZA 3WZUA 3S3IA 1BYGA 5CXHA 3LQ3A 4PUZA 2J51A 4V0GB 2LGCA 2CJMA 2X1NA 3OCTA 2CLXA 4AOIA 4E6QA 4M67A 4L44A 3TI1A 5I3OA 3ZFYA 3UP2A 4O7YA 3RZFA 3BU3A 4JVGA 4GK2A 5KBQA 5I9XA 5AIKA 1ZOGA 3NW7A 4DG2E 4NSTA 4HGTA 5EKNA 1J1BA 1LP4A 3OFMA 3MIAA 4FOBA 3AGLA 4OT6A 3FQHA 1BKXA 3OTVA 3HA8A 2XIZA 4ZK5A 1L3RE 3NNVA 4NKAA 3UVQA 4WBBB 4RJ4A 3QQUA 4K9YA 4QTAA 5CSWA 1R78A 3G6GA 3D15A 2ZDUA 1WFCA 3F3VA 4AFEA 4DE4A 3VUKA 3NNXA 1V0PA 3FJQE 4IANA 4NCTA 4U8ZA 5BX0A 2OJFE 3F2NA 2C3LA 4G3CA 5CI6A 4EK4A 1ZMWA 1FVVA 2O2UA 2RG6A 4FK3A 4IM2A 3R04A 4X0MA 4EOJA 5FQDC 2W17A 3R9OA 5CU2A 1BUHA 4NUSA 3MWUA 5ACBC 3EL8A 2EB2A 4FTLA 3E62A 2YWPA 4R6VA 4AGDA 3PXKA 3SC1A 4TY1A 4D2PA 4Z9LA 3RAHA 4C0TA 3VS4A 5CAQA 3Q53A 2H6DA 4FNYA 2BIYA 2BKZA 3ET7A 1ATPE 2ZVAA 4GU6A 4BIBA 4G9RA 1CTPE 4Q9ZA 5JGDA 3BYSA 4UYAA 4WSYA 3UZRA 4C38A 3CXWA 4RX9A 4PP7A 3D2IA 4S30A 3NAXA 4F09A 5ANOA 3KRWA 4GG7A 2ZM4A 4J8NA 5AR4A 1FINA 4GFMA 2FB8A 4EBVA 4ZIMA 2XMYA 2CLQA 2J0KA 2UW9A 4FZ6A 3COIA 4IWOA 1Q8ZA 3NEWA 3R7OA 4U3ZA 2X7GA 5HVKA 3E5AA 2EU9A 3CJGA 2F4JA 1YVJA 2WMXA 4AN3A 2X4FA 4E1ZA 4YBKA 1WBTA 4H3QA 1DAYA 2VTRA 5CASA 2R3PA 3U6IA 4OT5A 4L68A 2JKKA 3OW3A 4JOAA 4AAAA 3DY7A 4I5MA 4U81A 5JRSA 4GEOA 1YXUA 4HPUE 4YPDA 3OF0A 4RX7A 3GXLA 1OUKA 3RINA 5EQPA 2OJ9A 3V5TA 2VX0A 3HLLA 1M2RA 4L7SA 3TKHA 4YLKA 3HUCA 2W0JA 3ALOA 5BPYA 3BHYA 3PZEA 4RJ7A 4YTHA 4QTBA 4QNYA 1ZMVA 3G15A 2E2BA 5JSMA 2C0OA 2C5XA 5BUEA 4F9CA 4IC8A 1GZOA 1ND4A 4FKQA 4EK6A 3NYVA 2IJMA 4HJOA 4IAKA 2R3IA 4ZZMA 2IZRA 3EQIA 2I40A 1QMZA 4BN1A 4W4WA 3SG9A 3PJ3A 4MD7E 4X7QA 5JGBA 4N0SA 2YFXA 5CEIA 2BRMA 2YCSA 3V01A 2PSQA 5DGZA 2EVAA 2WMWA 3U87A 3ZRKA 4DLIA 5I9WA 3IQ7A 2P4IA 5E8VA 3C0HA 3NUNA 4PNIA 3R7EA 1J3HA 4L45A 3ZLSA 5J9YA 3C7QA 4XG2A 3RAIA 1JKTA 1PXNA 2YCRA 4FNXA 4UWBA 5DE2A 3PSBA 1APME 4DFLA 3FYKX 3TKUA 3ZDUA 5FBNC 3EQRA 2YA9A 2J0MB 2X0GA 3UMXA 2PY3A 4G3GA 2HW7A 3POOA 3FI3A 2J9MA 2R0IA 3EFWA 4FV1A 4C62A 1TQPA 4RJ6A 4CMTA 4AT3A 4ZJJA 1S9IA 2VWUA 3K3JA 2JDTA 4FKTA 3ZLYA 3GNIB 3BRBA 3MB6A 5K4JA 1CSNA 3F3UA 3WARA 3CY3A 4FG8A 4FZDB 3M2WA 2WEIA 3E3BX 4KIOA 3U9CA 4MYGA 4BF2A 4A9SA 5ETFA 2GQGA 3AT2A 4GW8A 5HCXA 4M97A 4O27B 4D1XA 5CZHA 3TT0A 4M14A 4P7EA 3ZRLA 4YZDA 3HNGA 2ZMCA 4OGRA 2BROA 2QG5A 3D5WA 2QD9A 2OXXA 4LGHA 4O0UA 4L00A 1PXIA 2XH5A 3G9NA 4QPSA 4U41A 5CY3A 4E5BA 4IE9A 1QPDA 4E6AA 4XJ0A 3E93A 2ITPA 5IUGA 4ASZA 4C4FA 3W8QA 4A7CA 3AMAA 2BPMA 3VS1A 1XHAA 3A7GA 3EH9A 1PMUA 1PMVA 2I1MA 1YOLA 1AD5A 5BYZA 4ZJIA 4E20A 3PXQA 5M08A 3II5A 3LPBA 2GU8A 4OTIA 5EHYA 4R1YA 1SZMA 4G2FA 3SA0A 1WBVA 3D2KA 3PP0A 5IQIA 4JL9A 5AWMA 3RK7A 3D5VA 4N70A 2WGJA 3M11A 2JAMA 3N51A 4M12A 1H08A 3V5QA 2WQBA 1KSWA 4DG3E 4P4CA 1PXLA 5CVHA 3D14A 4U80A 5ACKA 4RVMA 4DEHA 4B6LA 2BILB 4DF3A 4BZNA 3BGZA 3AG9A 3UNJA 5BVOA 3WE4A 3TZMA 2QU6A 4KA3A 3MVHA 4EK5A 5JEBA 4AS0A 5C26A 4N57A 2X2LA 3QX2A 4BCJA 2BZIB 2C6LA 1UWHA 3R83A 3RALA 3FXWA 3TZ7A 3G5DA 4C37A 2OICA 4EZ5A 5CEOA 4AN2A 1CKPA 4DTKA 5KCVA 5AJQA 4EH7A 2ZV9A 4XCUA 3MV5A 3C4WA 3MIYA 1PKDA 4RFYA 5M07A 1SM2A 3GEQA 3R1NA 3WZEA 1H4LA 3RCJA 3MGYA 3SKCA 4DT8A 4O21A 4U5JA 1TKIA 2XK3A 1M52A 3Q9WA 3LXNA 5F94A 5T68A 1KE6A 1OL6A 3AQVA 2VTSA 1GOLA 4IQ6A 2ZOQA 3BPRA 3O8UA 1XWSA 1V1KA 2W1DA 1RE8A 4U0IA 3QWKA 4C34A 4OTFA 3ACJA 2J7TA 4GT4A 4ZLYA 3IOKA 3C4XA 2F49A 5CXZA 3CQUA 3DK6A 3OOGA 4U9AA 3OXZA 5I0BA 2IN6A 4FZAB 3F2AA 4UZHA 1ZLTA 2W05A 2YACA 3O17A 2Q83A 3U4UA 4ANBA 5L8LA 2WQEA 5G6VA 3S95A 3GQIA 3BEGA 3QL8A 4LYNA 4ORKA 2BALA 4MBLA 3Q3BA 3EQGA 2I0EA 4KINA 3IS5A 2UZEA 5AUUA 3RTPA 2OIDA 3AXWA 4BL1A 2Z2WA 3W18A 3V8WA 1Q8WA 3DBCA 3SW4A 2J4ZA 3AGMA 1FOTA 3EQFA 2W06A 2UW4A 3R2YA 3FXZA 2C0TA 4ZSAA 3QYWA 4A9TA 4YO4A 3VBVA 3RPYA 3FC2A 2C30A 3BX5A 3QHWA 5DT3A 4I24A 3QD2B 3ZZEA 3LXKA 4MXCA 4AGWA 2UW8A 5M4CA 4FEQA 4O2ZA 3MH3A 5EHOA 4MWIA 4E7WA 4EKKA 3ZXZA 3A60A 3PE2A 5K9IA 2VU3A 3SQQA 4YURA 3LVPA 4BDDA 4EC8A 2QO9A 3K5UA 4FNWA 4XV9A 4XYFA 2YCFA 4BDGA 5A4QA 1M7NA 3LJ2A 3FAAA 1H28A 3WF8A 4KBCA 4FC0A 5HD4A 2V55A 2RFNA 4NZWB 1PXOA 4P5QA 3P23A 2XIRA 4FTAA 3REPA 5CEMA 5E8XA 4LM5A 5HE3A 3I7CA 2J2IB 2VTTA 4ITJA 4MK0A 4XS2A 2VTMA 2A27A 4B8MA 3OCSA 4O81A 4Y5HA 3R01A 3VUDA 2XNEA 3PFQA 3PG3A 3Q6UA 3FMDA 2PVYA 1H25A 4NCTC 4E5AX 5AP6A 2XBJA 2GPHA 3EN6A 3G2FA 4PPBA 1Y57A 1Z57A 1UU9A 2JGZA 3EB0A 3SGCA 3RPRA 4CVAA 1BL7A 1P5EA 4KRCA 1KV2A 2VWBA 1FMOE 2BFXA 3DBQA 3QKMA 3OBJA 4XBUA 1OUYA 4KKGA 5FUTA 3KULA 4EOSA 2A4LA 2V7AA 4X2KA 4TYGA 4FTNA 4CFWA 4DFYA 2W9FB 3MFUA 4ID7A 1JPAA 2ZMDA 4EUUA 4QMXA 4O0XA 5FEQA 4XX9A 3A8WA 3VUTA 4BDBA 3OWPA 3FQEA 4KSPA 1JBPE 4AW2A 5DT0A 4C2VA 4YSMA 4DT9A 5H9BA 2PUIA 3W32A 3CTHA 3QF9A 3ULIA 4AGCA 1ZXEA 3ZFXA 1W0XC 4QMMA 5M56A 3MBLA 3AT4A 2X4ZA 5DEWA 3UQGA 3F66A 1JKSA 3TDVA 3WYYA 2ZB1A 4GIIA 4C57A 1G5SA 4DBNA 4JQ8A 3DBDA 5C4LA 2IZUA 2OJJA 4PMTA 2B9IA 4X3FA 4NFNA 3ZMMA 4CG8A 3S0OA 3LMGA 3HMNA 4U3YA 1XH6A 2DWBA 2UZWE 2X81A 3HMPA 4M68A 5DR2A 4RX8A 5I9YA 4BZOA 2VV9A 2G01A 4FODA 3A8XA 3UC3A 4ENYA 4YMJA 2GCDA 2UV2A 3DZQA 4RVLA 4IB1A 3Q2MA 4BDFA 4CZYB 1R39A 4XOZA 1OKZA 3BLHA 4FKUA 4OAVB 1OBDA 2F9GA 1T45A 3TV6A 2R4BA 2CGUA 3R6XA 3JVRA 4BCKA 3VUGA 3GC9A 3G0EA 5IQCA 4UEUA 4BGQA 3N4UA 3MW1A 3O7LB 4D0XA 3UMWA 1YWVA 3ZLWA 3ZZWA 4XMOA 5ANJA 4FYNA 2WU7A 2Q0BA 2NPQA 1WVYA 3QCSA 5IA3A 1OKVA 4F99A 2ITVA 4GU9A 4M0ZA 4HPTE 4QTCA 5HLPA 4DEBA 3AC2A 3QTSA 4GYGA 5I9UA 3RI1A 3WF6A 1H01A 4EZ7A 2XA4A 4MNFA 2FSMX 5FLFA 4FT3A 4KSQA 3R22A 4XG4A 3C5IA 5DRBA 4BYJA 2RFSA 3NYXA 4YJQA 3BWFA 4HNFA 4LUEA 1WVXA 2EWAA 3H9FA 5AX3A 3BLQA 2JD5A 3TIYA 4G5PA 3QLGA 5C9CA 4RC2A 4ZMEA 5IQDA 2CGXA 4FIIA 5HLWA 3WZJA 4ACCA 2WQOA 5GZ8A 4D5KA 2YCQA 4DFNA 4EI4A 4E4LA 3NNUA 3FPQA 4BBMA 1PY5A 2QOHA 2ITUA 3FMKA 3LCDA 3E64A 2ETMA 4AGUA 2FGIA 4BVUA 1FBNA 3E8EA 5AR7A 3FSKA 5KNJA 3BCEA 3QQKA 4BGGA 3QLFA 1LPUA 4ZTMA 3AT3A 4CKJA 5K4IA 3QRJA 4APPA 3NUSA 4DBXA 3BU6A 1S9JA 5T3QA 4PPAA 4F0FA 3G9LX 1FVRA 3LZBA 2JITA 2PVNA 1UU8A 4DFXE 3DKCA 4PTCA 4RT7A 4XRJA 4F9YA 1WBSA 3MN3A 1BI7A 5L2TA 1AGWA 2BZHB 3EN7A 3HDMA 3AD6A 3QD3A 4BTMA 4CFUA 4G1WA 1Q5KA 3W33A 5IZFA 3E8CA 4BCFA 4AZWA 5AAFA 5IA4A 5J7HA 4GKIA 2UW3A 4I23A 2UZDA 4RA4A 4O7SA 5CNNA 3FHRA 4YUQA 3Q2JA 3FKLA 1WBOA 4NIFA 1XH8A 3GT8A 5F9EA 4XH6A 2PK9A 2UUEA 4L6QA 2WNTA 4OR5A 4RFMA 5B0XA 1Y8GA 3SRVA 5HCYA 2WU6A 3Q6WA 3POZA 2PMNX 4JQ7A 1QCFA 3E8DA 3PRIA 3PY3A 5E7RA 4QYHA 4E6CA 4LRKA 4KBAA 3O0GA 3TCPA 3LCKA 5C8KA 3F5GA 3RWQA 2PVMA 2UW7A 3C4FA 4RIYB 2JFLA 2CMWA 2WTKB 3NUXA 4PX6A 3NLBA 4JRNA 4L42A 4LOPA 2ZAZA 4RZWA 4C4GA 1YW2A 2YITA 3MFRA 4LI5A 3AC1A 4GSBA 4RWJA 4EOLA 2WHBA 3PIZA 3HMOA 3FKOA 2WXVA 2YAKA 4UZDA 4ZSJA 3TUDA 3RK9A 3L8PA 5CX9A 4ZJVA 5TF9A 4WNKA 5DFPA 4MEDA 3S1HA 3MPMA 3TXOA 2CPKE 5T6KA 2B1PA 2AYPA 4FEUA 3BGPA 1XQZA 3OTUA 4TW9A 4I41A 3LFSA 3VBTA 1GJOA 4F7LA 1ZRZA 4TNDA 3QGYA 2ZV7A 4CFXA 3HA6A 1A06A 2FO0A 3VF8A 5DR6A 2Y7JA 4IFGA 4U43A 5JZNA 1BL6A 5CZIA 4W4YA 3DTWA 3Q96A 2ZJWA 2UZTA 4O1PA 5D7VA 4RA5A 4XG9A 3UVRA 5D9HA 4EOMA 1EH4A 3ENHA 2C69A 3U55A 1I44A 2A0CX 3LQ5A 5E8YA 3UP7A 4L7FA 1YHWA 2JIIA 5A4LA 4JG6A 5EM7A 4JQEA 5ANKA 4U45A 1UNHA 1GZNA 3C5UA 2YABA 4DITA 5CSHA 4E8AA 1M7QA 4FL1A 4RC4A 2B7AA 2W1ZA 3I6WA 4AP7A 1IAHA 4KIKB 4B0GA 4S2ZA 2H8HA 1RDQE 2O65A 4FT9A 4W9WA 4YLJA 4FEXA 2C6IA 5CLPA 3P7AA 1YRPA 1Z5MA 5FEEA 4E73A 3UO5A 5B2MA 5D10A 2C6KA 1OIUA 2BRBA 4QMOA 5DT4A 5HD7A 4C33A 5CSVA 4C58A 4LL5A 1K3AA 5HBEA 1B39A 3CKXA 2HK5A 2G2FA 4FUXA 4FSZA 4E4XA 3H0YA 2C3IB 4LV5A 5BMMA 1ZOEA 2W5BA 2YM4A 1CM8A 3ID6C 1IA8A 4OTDA 2UZUE 2J0IA 2WPAA 1IRKA 1DAWA 1GIHA 2PZPA 2YDIA 3R63A 2R3RA 4PDPA 1H1WA 2YIRA 3ZC5A 2BDWA 4ASEA 4C2WA 5H8GA 2GQSA 2BMCA 3P78A 5IG1A 4AT4A 5CEQA 4Y72A 3VC4A 2WFYA 4F64A 2PU8A 2VAGA 3OUNB 5AV2A 5M4UA 2GHMA 4EHVA 5HCZA 1Q8YA 3DXNA 5BVNA 3BYVA 4FIEA 4D2WA 4DHFA 2WIHA 3HYHA 5DOSA 3UODA 5IDNA 5KX8A 2VRXA 4IX5A 3COHA 4X2NA 3F5PA 4IAZA 5G1XA 3VUMA 3BHVA 5BUIA 1JVPP 5JKGA 4KWPA 3GCPA 4U6RA 4BDHA 2PMLX 2P2IA 3R71A 3CJFA 3TIZA 3ORLA 3NUUA 4FSUA 2CNVA 4GUBA 2VGOA 5IH4A 3B2TA 2UZBA 3R9NA 4O22A 4V04A 2QOOA 3PJ8A 3AC4A 3BGQA 3WIGA 2EB3A 2OJGA 5JZJA 4LMUA 5GIPE 1Y8YA 2NNWB 3SDJA 4O83A 4O0RA 3HUBA 4K8AA 2PE0A 4IWPA 3KF4A 4FKIA 4NEUA 3R8ZA 5FP6A 1NW1A 4V0GA 5BYLA 4FVQA 4NK9A 5A14A 1J7LA 3E8NA 4W9XA 3VO3A 3KXMA 2PPQA 2JKQA 2OZAA 4ANSA 2R0UA 2BAQA 3ORIA 4FBXA 2W1CA 3NVMB 1W83A 3IGOA 1BLXA 4AQCA 4RIXA 1BI8A 2GS2A 4C4HA 2ETRA 4IX4A 4CKRA 4G34A 1NT2A 3DS6A 3DJ5A 3ELJA 3R7UA 2JIVA 4E3CA 1VR2A 4I20A 5HX6A 2HENA 5A4TA 3TWJA 2G1TA 1GNGA 1PXMA 3CD8A 4FA2A 3PYYA 3EQCA 5FRIA 5A4CA 2FYSA 2OGVA 4C3RA 4DFUA 1YI6A 5D7AA 2W7XA 4PL4A 4I6BA 3DFAA 2YDJA 2ZV2A 3TTJA 4YR8A 2ETKA 3B8RA 4IAIA 3ZS5A 5HKMA 2C5OA 1JLUE 5FG8A 4UMUA 2J0LA 2R3FA 2WIPA 1LEWA 3LQ8A 2HZIA 3C1XA 4TT7A 2OLCA 4EORA 3P7BA 4HGLA 4N6ZA 4YJVA 4TYEA 4WNPA 2E9NA 5EDRA 4ZTNA 3RNYA 4DGNA 4UX9A 1IAJA 4GFGA 3QU0A 2VTPA 4PV0A 1PJKA 2W96B 4D5HA 5M4IA 2J50A 2WKMA 2NRUA 4BCGA 4CLIA 4JBVA 3QUEA 1TQIA 3BELA 3IW5A 4HVHA 5AP1A 2ITWA 3PY0A 5D1JA 3SG8A 5M06A 3FL4A 2C6TA 4FGBA 2GNGA 4I93A 4Q2AA 4R78A 4OTHA 4A9UA 3GCVA 2F7ZE 4FNZA 2QG7A 5TO8A 2H34A 3NIEA 4ERKA 4S33A 5CEKA 2GQRA 2Z02A 3JY9A 3OWKA 2BTSA 5M4FA 3Q32A 3H4JA 1MRUA 1XBAA 3DJ6A 4TYHB 4XG3A 4IX3A 4BCMA 3BI6A 4L8MA 4EJ7A 4QMUA 1Q3DA 5FXQA 1UVRA 4X3JA 5KMJA 4NM7A 5LQFA 1G8SA 2BAKA 3GI3A 3KRXA 5M44A 5LVMA 2PL0A 3OMVA 4YJTA 3T8OA 1Q24A 3VS5A 4BZDA 3LFBA 5KMKA 2YJSA 1PW2A 5DHJA 3KXXA 4YZCA 5IA0A 4JR3A 3NCGA 3BYOA 3DXPA 4MXYA 4AA5A 4BY9E 3MFSA 5LVNA 3PJCA 4O38A 4D58A 4BDJA 2KTYA 3A62A 3F3TA 3ROCA 5L6WL 2GS7A 4OTGA 4CLJA 2VWYA 3RZBA 3BYUA 3W2QA 3NX8A 4FV6A 3LJ1A 4KBKA 4KAOA 5F95A 4P90A 5BVKA 4J53A 2XCHA 5M51A 2PVKA 4GIHA 5CU4A 2Y9QA 5L2SA 4Q9SA 2WMQA 1MRVA 4X2FA 3FHIA 3NVKI 4TNBA 3D0EA 4YZBA 5HHWA 4X2JA 4Y5QA 1W7HA 3LLTA 3VWAA 5A46A 2XVDA 4XLVA 4QMQA 3SW7A 2R9SA 4O96A 3MESA 5FXSA 4CMUA 3KXZA 3GCUA 4FT7A 2YIWA 3B8QA 5LJJA 5GZ9A 5HLNA 3H10A 3V5JA 3I1AA 3QRUA 3O50A 3QUDA 5ETAA 2FH9A 4JJRA 4AG8A 4GUEA 3FMLA 4BWPA 3BZ3A 4CT2A 3L9NA 4NTSA 3PXFA 1NY3A 4K11A 4D4RA 5EFQA 3TEIA 3OOMA 4MNEB 4FSTA 4DC2A 3Q9XA 2PZ5A 1BX6A 2YZAA 3AMYA 4HYHA 5FTQA 4QP4A 4E4MA 4Z16A 5AR3A 4UBAA 2C1BA 4NM5A 4XP2A 4C3PA 2GHGA 3N9XA 3UBDA 3DKOA 3FLYA 3TUCA 3E92A 5HGIA 3FWQA 2XKCA 4QP3A 2O8YA 4L67A 3COKA 1CMKE 3FLWA 2A1AB 3AC5A 5CWZA 1DI9A 3U54A 4M69A 3HP2A 4M8TA 3TKIA 4CD0A 5DH3A 4BKYA 3KMUA 5A6NA 5GJDA 1Q3WA 2QKWB 1KE9A 3BE2A 4DH5A 1KOBA 2QQ7A 3EWHA 5I9VA 3FE3A 3NYNA 3CGOA 3RNIA 3FLNC 3PIYA 4H58A 3OT8A 4R3CA 4AA4A 5AAGA 3HV6A 4O6EA 2CHLA 1VJYA 4RJ3A 3V51A 4B7TA 4JG8A 5HORA 3W8LA 3EKKA 4AX8A 5CF5A 2YIYA 3W2RA 3CSVA 2B52A 5GJFA 3QCYA 3UYTA 4HVSA 1R0EA 3OS3A 4RZVA 3QRIA 5L2WA 3IECA 4ZOGA 3KREA 1SVGA 4JR7A 4ONAA 2QC6A 2UZNA 5TR6A 3QTWA 3RKBA 4BDCA 2JFMA 2ZM1A 3UO4A 2EXMA 2AC5A 3QALE 2QU5A 4F1TA 5IQHA 5HU3A 4HCVA 4RX5A 4G6OA 3UO6A 4H05A 1REJA 4FOCA 2ITYA 1F5QA 5ITAA 4J96A 4FGRA 3VHKA 5HBJA 2WQNA 2YIQA 2HWOA 2XIXA 3LCTA 5AP2A 4CZUA 3P08A 5HG9A 2ZYBA 2P2HA 1U59A 1YOMA 3CQEA 3CY2A 5KHXA 2WB8A 3BYMA 1UNGA 4B4LA 3OZ6A 2W1FA 3CBLA 4QOXA 5FDPA 3NCZA 1P2AA 2BRNA 4FIHA 4FUYA 3EL7A 3BV3A 4YO6A 4AE6A 4BCOA 2BAJA 3O2MA 4YZ9A 4RQKA 3RPOA 5M55A 3I5ZA 4H1MA 5CS6A 1ZARA 2BR1A 2VTJA 1PYEA 3H9RA 4TWOA 5EQYA 3NDMA 2XM9A 3QGWA 2XRWA 3QTQA 4G3FA 1VYZA 4FG7A 5DWRA 1YHVA 4IX6A 2VO0A 3O7LD 3E7VA 4CEGA 3IW7A 3FI8A 4CSVA 4EH4A 1OB3A 2YM8A 4JG7A 4E26A 4YBJA 2HELA 4X6RA 4F4PA 1CKJA 3JS2A 4IH8A 4NYEA 4QMYA 4HYSA 4C36A 4FTCA 1H1QA 1QPEA 2C6EA 3EYGA 2ZM3A 2WMRA 4FKGA 5J5SA 2F7XE 3I7BA 3DTCA 3D83A 2F57A 2PVHA 2ITQA 4IB5A 4NW6A 5EM6A 2WAJA 3MPTA 3PZHA 4I5PA 3IW6A 4IJPA 4RSSA 2XM8A 2WMBA 3BIZA 5IUIA 4O7WA 4QMNA 1SVEA 3MH1A 4IM0A 4F9AA 5EQEA 4JDHA 4LRMA 3KC3A 4QQ5A 4F7JA 2JKOA 3UTOA 4YU2A 4DFZE 4GK4A 4D2TA 4YSJA 1CDKA 4AFJA 3FBVA 2VTAA 4F08A 4F70A 1KE5A 4QPMA 2O0UA 3ZUTA 4BTFA 4ZAUA 5HZNA 4CFNA 1UWJA 3MFTA 2E9UA 3IOPA 1WCCA 4HNIA 3G33A 4USDA 3V04A 5B7VA 5CYIA 3PA5A 3ZC6A 3DAJA 3DA6A 4IZAA 4BIEA 2HZ0A 5AM6A 5CVFA 5KO1A 4FSWA 3HVCA 5HESA 1MQ4A 3TACA 4AW5A 3AD4A 4USFA 2B9FA 3D7TA 1H1SA 3P86A 1U54A 1I09A 2R3MA 3QD4A 4S32A 4W4XA 4WHZA 3I6UA 3R8LA 4G6NA 4FTIA 5FWKK 4JIKA 5J9LA 1IEPA 1M2PA 4TXCA 2GMXA 2BDFA 1RW8A 2X2MA 3QQJA 3P5KA 3PVGA 4FYOA 3R30A 4QO9A 3ZO1A 4PL5A 5K3YA 4YLLA 5J95A 3KXNA 4FIJA 2C1AA 2XYUA 1U5RA 4RWKA 1M14A 2OU7A 3CTQA 5TT7A 4MCVA 3GB2A 5HTCA 3LFQA 4MF1A 2YN8A 4IM3A 4S34A 2NRYA 4X21A 4FV9A 3GENA 1E9HA 4AN9A 4RFZA 2PMIA 2OG8A 2RGPA 5H2UA 1A48A 2OW3A 5DI1A 5AUWA 3MVLA 4GFOA 2XNMA 3O8PA 4QMTA 4EYJA 3WBLA 5D41A 5AEPA 3FLQA 3FZOA 1ZY4A 3G90X 4BDAA 3DKFA 4IB3A 4OBPA 2P0CA 4RIOA 1UKIA 3HMMA 1VYWA 2FUMA 4DTAA 1GZ8A 4GVAA 4J7BA 4EH5A 4IC7A 4WG5A 3A4PA 5AAEA 2HIWA 2XJ0A 4PF4A 3HRBA 4LGDA 4OLIA 4WD5A 3PG1A 4WG3A 5HOAA 4JAJA 1E1XA 3AD5A 4IEBA 2VX3A 5EYDA 3NUYA 1OZ1A 4FKSA 3NAYA 4IVCA 4TWNA 5EK7A 3WYXA 4EQMA 1H07A 2XYNA 3I81A 3KRRA 5DR9A 2WO6A 3DDQA 5J79A 4MBJA 4XOYA 4ACMA 5H8EA 1WAKA 1M2QA 4PY1A 4C3FA 2PZRA 1R3CA 5KZ0A 5E4HA 4Q5HA 3IKAA 5CSXA 3MSSA 5LMBA 3MDYA 3PWDA 4A4OA 3QBNA 5DYJA 4O6LA 5DIAA 3VS6A 4FKOA 4QNAA 4PNKA 1OKWA 4CKIA 3UZTA 4U44A 2QURA 4GJ3A 3VS3A 4GMYA 4L3PA 3GC8A 4O0TA 1YWNA 4MXOA 4RBLA 3QQHA 4UWCA 4UWYA 4BI1A 3PLAE 1Q4LA 3I5NA 5IQFA 1H8FA 3L8XA 5KKRC 3O71A 4GJ2A 4Z55A 2QVSE 2GTNA 2GSFA 3GCQA 4GT3A 2QOFA 4F65A 3KN6A 2I0VA 4HOKA 3PPJA 3T9IA 3LOKA 3VRZA 5AFVA 3VN9A 1ZYSA 3W1FA 2XK6A 5AUTA 4FV0A 1H0VA 4YZMA 1HCKA 5AA9A 1BMKA 2VZ6A 3EHAA 4YC8A 3SXFA 5CAVA 4ERWA 3KCFA 2XK8A 3OP5A 4RLKA 5AA8A 5HQ0A 3P7CA 3QA8A 4MD9E 2IZTA 3M1SA 2Y0AA 1OPKA 3F3WA 3DU8A 4UALA 3R7YA 1FPUA 1LR4A 3QTZA 5FD2A 1ZYDA 3OWJA 1FQ1B 4IZYA 3PSDA 2WTWA 3OXTA 4EOQA 1Q62A 4O2PA 4DEDA 3V5PA 2WOTA 4RVKA 3ZH8A 2J0JA 3ZSGA 3ETAA 5ICPA 4FR4A 2ERKA 2BDJA 2IVTA 3LLAA 2XS0A 3ORTA 4YJOA 2W1EA 2VTOA 4FE2A 4JT3A 2YERA 3ENMA 4Q5EA 5LMKA 3NR9A 3JVSA 4PRJA 5LVPA 4ANLA 2C5YA 3KA0A 2WMUA 3KULB 4FTJA 4WNMA 2R3LA 4LQMA 4ZP5A 4NU1A 4ZSGA 5F20A 4FVPA 4EWHA 4O0YA 5BUJA 2XK9A 2PE2A 3FZTA 4EH9A 2JBPA 3KGAA 1OL5A 2X39A 4H3PA 4YP8A 2XF0A 2CCIA 4ZTHA 3TJCA 2QHMA 3W2SA 4F7SA 2KULA 2OH4A 5CQWA 4JI9A 4FSYA 3VS0A 4BIDA 5EDPA 2GFSA 1PXKA 4LFIA 4G17A 2FSTX 5LVOA 3RHXA 2QLUA 5B2LA 3KFAA 4FTOA 5DPVA 5HO8A 4RLLA 1XH5A 1O6YA 3PUPA 4K18A 4ITHA 2JC6A 5HE0A 3IDPA 1MP8A 4X3FB 2PULA 4I5CA 1XBBA 4IDTA 2QODA 4PMPA 1JSTA 1WZYA 4FTQA 3HKOA 3PXRA 3FMNA 1FMKA 1KUTA 4DGMA 2CN5A 3UNKA 2VD5A 5LVLA 4QPAA 3BU5A 1JKKA 3VUIA 3KB7A 5C8NA 2X6DA 4FL2A 4L53A 2RIOA 2HY0A 2WQMA 5AIRA 1GIIA 4A9YA 4I92A 5L2QA 3CCNA 4CV8A 1Y91A 3IG7A 2YM6A 3LFAA 1YI4A 2IVVA 4UXQA 3HEGA 4WRGA 4G9CA 3VAPA 5F1ZA 4HGEA 4UMPA 2R3OA 4NL0A 4IB0A 4WG4A 2XIYA 3ORKA 4EL9A 3SAYA 2OWBA 2IWIA 3QXOA 4FSMA 2BZJA 2HCKA 1JKLA 3MYGA 4O0WA 4AU8A 2R3NA 4MXAA 2B0QA 3ODZX 5HIDA 1KE7A 3KEXA 4ZTRA 4QP9A 2IG7A 3UPXA 2XKEA 4FTMA 3GU7A 3PA3A 1Q97A 4KIQA 4NH1A 4CTBA 3I0OA 3KRJA 3FY0A 4HW7A 4YNOA 4J1RA 2YDKA 3R00A 2QHNA 2GFCA 2WTVA 2OH0E 3PP1A 3CE3A 4FV5A 4D2RA 3ZBXA 4H36A 5HG5A 3C4EA 1Y6AA 1ZAOA 2ITOA 3CEKA 4BCHA 3LW0A 3P79A 2CNUA 3FC1X 1WVWA 3OEFX 4JLCA 4U42A 1L8TA 4JAIA 2VTIA 2UZVA 4F6SA 3C0IA 2AC3A 4MBIA 4WIHA 4C59A 2ACXA 3EJ1A 1SNXA 3QD0A 1XH7A 2XNPA 2C47A 5IEXA 2GHLA 4DAWA 1QPCA 3BKBA 4OTRA 2PUPA 4RQVA 1K9AA 4RIWA 4JXFA 2P33A 3GBZA 4O86A 1SNUA 2XK7A 2QNJA 5LWNA 1URCA 1W8CA 3C51A 3FI4A 1T46A 2HAKA 3NW5A 3LHJA 3RM6A 4ENXA 3FI2A 3HX4A 2B54A 2EXCX 4MVFA 5AP3A 3RBWA 1OIQA 2PE1A 4XG8A 2RF9A 3QA0A 4QQTA 1XH4A 2V5QA 3DV3A 4EH6A 3TUBA 5GZAA 4K77A 4XHKB 4IHPA 4LOOA 3GUBA 4NM0A 4ANMA 4AOTA 4K0YA 5LARA 4X6QC 3ORXA 1OKYA 4MXZA 2XEYA 2ITNA 3QTRA 4JX7A 1JAMA 3HV7A 3VIDA 2QONA 4DGOA 4EKLA 3LKMA 3GFEA 3F2RA 5BNJA 3QRTA 2YWVA 3UOKA 1OECA 4OUCA 5J1VA 5DN3A 2R2PA 4M15A 1NA7A 1W98A 5FP5A 4IZ5A 3OC1A 3ZEPA 4PWNA 4F0GA 4TWCA 5KZIA 2ITXA 3FDNA 3R7VA 4WKQA 2X6EA 3QXPA 5GINE 3GC7A 4YJPA 5HICA 1OPLA 2OJIA 4A4LA 4AF3A 2OSCA 3KVWA 2A2AA 3G0FA 3PSCA 4WNOA 3ALNA 3LXPA 4EK3A 4D9UA 1M17A 4ZXTA 2WMAA 5FTGA 4NT4A 3DB8A 3QKKA 1CKIA 3C4ZA 3A99A 1Q99A 2XZSA 3DOGA 3EIDA 4FT0A 4I0TA 4YJNA 3W10A 3U8WA 4I0SA 4I21A 2HZNA 2DYLA 2CSNA 3KXGA 3VJNA 3F9NA 4FKWA 3PPZA 4C4JA 3L1SA 3DNDA 5L8KA 1URWA 4L3LA 3ZONA 4BDIA 1NVQA 3EQPA 4BR3A 4IIRA 4IFCA 3HGKA 3RAWA 4YC6A 3MH2A 3AC3A 5JQ5A 3CP9A 3KK8A 2DUVA 3AC8A 3JYAA 1YQJA 5E8WA 4IXPA 5LMAA 2BRGA 4ZS4A 4I6QA 2WTDA 5IEYA 4E5WA 4U40A 5TKDA 1PRYA 2IPXA 2YIXA 3P1AA 4J97A 3W16A 2X9FA 2AUHA 3CD3A 2Y4IC 2XJ1A 3JPVA 4FTRA 4KIPA 4RC3A 3ZM4A 3ZDIA 2OIQA 3BHTA 3VQUA 3KMMA 4EUTA 5DG5A 5IF1A 3FZ1A 4E6DA 4G6LA 5ANDA 2CCHA 5AV3A 1J1CA 1OM1A 3L9MA 4FKPA 2X9EA 5EI6A 3L8SA 4AZVA 2JDOA 4MD8E 1GZKA 5HBHA 2VGPA 5ANGA 1TQMA 4IVDA 5HE1A 3RAKA 4BRXA 3DK3A 4H39A 3WF5A 1Q41A 4CFMA 3FLZA 2PWLA 5DLSA 5HG8A 3ULZA 3UGCA 4F7NA 5CNOA 3BBWA 3ZM9A 3VW8A 4P2KA 3DAEA 2G2IA 2ZB0A 4BGHA 3D5XA 2Y8OA 4QRCA 2OBJA 1SVHA 2X7FA 4ASXA 3FEGA 4WSQA 3FY2A 4HYIA 4JBOA 5BQ0A 5ETCA 2I7QA 5IA5A 4BTKA 3K5VA 2DS1A 4ZS0A 1ZWSA 4JNWA 1H24A 1IASA 4FTTA 2PYWA 3GP0A 2GNIA 3EZVA 2YEXA 5EYCA 1OL1A 2W99B 4YHJA 5CALA 4UN0C
chains in the Genus database with same CATH superfamily
1YKRA 3ZSHA 3C50A 3UDBA 2X2KA 5CT7A 4FMQA 3TNPC 1V0BA 3KKVA 5EDQA 3R9RA 4O4FA 3RP9A 3TNIA 3LMIA 4RJ8A 3QC9A 3UG1A 3DK7A 3VRYA 2HOGA 4Z7GA 4C35A 4PTEA 3NW6A 2VN9A 2WTJA 3EQDA 2UW0A 4P5ZA 4GRBA 3R2BA 2PVFA 3DZOA 4UYNA 3QQFA 4JBQA 4CQGA 5BMSA 3DCVA 4CCUA 1JNKA 5HNBA 3RHKA 2V22A 2XNBA 3Q9YA 4CCBA 3VS2A 3KCKA 3DBEA 1YDTE 3U6HA 3A7JA 3R0TA 5A3XA 4O1OA 4C61A 3BEAA 3DQXA 4QP2A 3KXHA 4K1BA 3RCDA 5FM2A 5HTIA 4UB7A 3QFVA 4B9DA 3EYHA 2RL5A 4BI0A 1ZYLA 3O23A 2QOCA 4J52A 4GCJA 3W55A 4BI2A 3ZTXA 1H1RA 5DEYA 4EQCA 5LMKC 2HWPA 3VUHA 1VEBA 4EHZA 3HV5A 2V7OA 3JUHA 4F1OA 2CKOA 4I4FA 3MA6A 4O7RA 2HXQA 1W82A 4GS6A 4LRJA 4ZTQA 5KE0A 5CF6A 4GVJA 1H26A 1OL7A 2IVUA 2Z7LA 4Y8DA 3TZ9A 1DM2A 3WILA 3TTIA 4AXAA 3UYSA 5AR5A 3SD0A 3MVMA 4ZZNA 2XIKA 1ZYJA 3FZRA 4FSRA 1U5QA 3TV7A 3ZUUA 4EOIA 3FMEA 4AZFA 4BKZA 4D9TA 4IDVA 2C3KA 1XH9A 4IW0A 1W84A 2OI4X 2OK1A 4MXXA 3SX9A 4YJSA 5JH6A 5CU6A 2OXDA 3C9WA 3IGGA 3OCGA 1GAGA 3DFCB 3EMGA 5J87A 5HIEA 1JSVA 5AP0A 5K0XA 2WMSA 1H00A 3PVUA 4YTFA 4IJ9A 4D28A 3EKNA 3O96A 4K2RA 5IKWA 3C4CA 3ORNA 5E8ZA 2XAOA 2OZAB 4GH2A 5HVJA 4EK8A 4WBOA 3SVVA 1ZOHA 4R8QA 5EHLA 2WTIA 3VBWA 3KN5A 4RIXB 4ZLZA 5IISA 3NUAA 3BV2A 4M7IA 4FX3A 3CS9A 1XKKA 1ZY5A 5EH0A 3ZRMA 2WTKC 5C1QB 2RFEA 4GYIA 4HZRA 5AV1A 4NTTA 5EM5A 5I3RA 4PDSA 3QHRA 5L8JA 1NVSA 2CKPA 2O63A 4CXAA 2V0DA 2C4GA 2DQ7X 2BIKB 4D55A 3FQSA 3OCBA 3MY0A 4YZNA 3TZ8A 1PYXA 4EEVA 2XBAA 5CF4A 3F3ZA 4KRDA 3VF9A 4QP7A 4AW1A 2UVXA 1PKGA 2X8DA 4H3BA 1WBPA 3AMBA 3CPBA 2UZLA 3QZFA 4MNEA 2XUUA 4BKJA 2CNQA 3Q4ZA 3Q52A 5AR2A 3VW6A 3U51A 4BFMA 2Y4PA 3DJ7A 3KMWA 4BWKA 1VZOA 4MWHA 1YHSA 3UIXA 3F88A 4CGAA 3OHTA 4R3RA 5CU3A 2JDVA 4S31A 1REKA 3V5WA 3OD6X 4XV2A 2XCKA 5E91A 2QOIA 3ZU7A 3U9NA 4C4IA 5I9ZA 4RWLA 4MTAA 3IW4A 4IVAA 4AAYA 1OVEA 1MRYA 4ZY5A 4DINA 3SOCA 3CQWA 3A7HA 4EONA 5AADA 1OPJA 3QTUA 3EQBA 3R28A 4XEYA 4Y95A 4BHZA 3WOWA 3Q4CA 2QR8A 2GTMA 3HRFA 4EH2A 3TNQB 3IDCA 5HI2A 3IDBA 4FV7A 4O0VA 4R77A 4QMSA 3ITZA 4LMNA 4CYJA 3BQCA 3UJGA 4BBEA 4EH8A 5BYYA 2HZ4A 1WBWA 2E9OA 2X0PA 2OF2A 3BHUA 3LFEA 3SLSA 3THBA 4ZY4A 3S00A 4BCQA 4ZSEA 2AQXA 3U4WA 5BVWA 4F6WA 4AXFA 4MAOA 2NP8A 4IAYA 5E8UA 2GNFA 1YOJA 2JEDA 3NNWA 4RGJA 1PMEA 2YAAA 4JX3A 4RVTA 3F82A 3AKJA 2VWWA 3DNEA 4QT1A 4MH7A 3V5LA 3F7WA 4U97A 3F7ZA 5L2IA 1KOAA 2SRCA 4PTGA 2VNWA 4N6YA 3OVVA 3ZLXA 4C7TA 4FL3A 4EH3A 4XG6A 5KHWA 4DHJA 4DG0E 1XR1A 4KS7A 4D4YA 4R7IA 4CNHA 3UZPA 5DNRA 5BVFA 1O9UA 4WUAA 5J5TA 4FKRA 3EFKA 3ML1A 3UDSA 5KKRB 3M42A 4KS8A 5GHVA 5IDPA 2QCSA 3GU5A 5AX9A 3OXIA 4RRVA 1ZZLA 4X2GA 3TL8A 4II5A 4B99A 3FL5A 4AXEA 3GU6A 5DA3A 4NJDA 5TOZA 1FVTA 2RG5A 5EKOA 2WELA 3MVJA 3K54A 5FTOA 3ZCLA 5KMLA 1UU7A 4AZSA 3A7FA 4ZZOA 5CAPA 4WOVA 1IR3A 4E93A 4ANQA 4TYJA 3W0SA 4OW8A 5JT2A 3VULA 3KY2A 2QOQA 5EW8A 2X8IA 5CVGA 2I0HA 5A4EA 3MTFA 3D7ZA 1H1PA 4FZ7A 4ACHA 3PXZA 5E8SA 3D4QA 3F61A 1B6CB 5AP7A 5E90A 3V8TA 4D4SA 4XV3A 4XP3A 3PXYA 3ATSA 5KBRA 3EFJA 2PZIA 3PJ2A 3UOHA 1B38A 3IO7A 4I5HA 4D2VA 4HVGA 5C4KA 3UC4A 4UV0A 3QQLA 3LMHA 1RQQA 2R3GA 5CSPA 3MB7A 3F69A 4GG5A 1KE8A 2PVJA 3RPVA 1YXXA 2F7EE 3KQ7A 4M13A 4WA9A 4DEAA 5IMXA 1J7IA 3LM5A 4D1ZA 4FV3A 3DBFA 3GU4A 3BBTB 1FGKA 3GOKA 2W4JA 5D12A 3QZHA 4YHFA 3VBXA 2BTRA 1SMHA 3FMMA 3T3UA 4I94A 2GS6A 4EOPA 3CIKA 3K2LA 5KMNA 1Q8TA 5EI2A 4TWPA 4O7VA 3ZEWA 4Y73A 4BICA 5KMOA 4Y46A 4M69B 3QCXA 4RPVA 3D9VA 4XNEA 5AV0A 1ZMUA 4YJUA 4CZTA 5EG3A 1FGIA 3Q9ZA 4GV1A 1ZYCA 2O64A 4TL0A 5F4NA 4ARKA 4NJ3A 2ESMA 2PUNA 1X8BA 3Q60A 4PMMA 3O8TA 4A9RA 3G51A 1YXTA 4A06A 1YI3A 4FICA 2I0YA 2PZYA 4DH3A 4EHEA 3MS9A 3OUKA 5CQUA 2YM5A 2HXLA 4M66A 4FTKA 2GNJA 3KL8A 5E8TA 4QMVA 5IA2A 5L4QA 2VTQA 5AP4A 4BCIA 5TE0A 2PTKA 3KVXA 5JFVA 1PF8A 4UXLA 3HECA 4PQNA 2GNHA 2W1GA 3EZRA 2VX1A 5JGAA 4RMZA 3F6XA 1YDRE 3PIXA 5A9UA 5LOHA 3LXLA 2Z8CA 4FSNA 4FVRA 1PXJA 3DAKA 2R7BA 4R3PA 4TTHB 4Y83A 3ZOSA 4AZTA 4I0RA 4QTEA 5FGKA 4QP8A 2PMOX 2Z7SA 3VS7A 4DEIA 2RKUA 3KU2A 3ORPA 5C8MA 1MQBA 4BB4A 3ZSIA 3UIMA 3QWJA 4TN6A 3C0GA 2JKMA 2R3JA 2YJRA 3EN5A 2OO8X 4CFFA 2BKKA 4ASDA 4JRVA 3PRFA 5EYKA 2G9XA 4MQ2A 3MY1A 1IG1A 1UNLA 1F3MC 3LE6A 4FIGA 3UIUA 1JSUA 4HCTA 1J91A 5DRDA 1O6LA 2QLQA 4G5JA 3JR1A 3RM7A 3TNWA 2B4SB 4L3JA 4ZMFA 4QD6A 5IA1A 4ALUA 5HIBA 4BCPA 5AUYA 2JBOA 3TJDA 3U6JA 3ZO3A 2WEVA 4J95A 4FV2A 3UIBA 3ZHPC 4V01A 3MH0A 2Y6OA 5CU0A 5KMMA 1JOWB 5HE2A 3VQHA 4DH1A 2UVZA 4M84A 4PL3A 2B9JA 5L6OA 4R1VA 4UY9A 2XNOA 3CLYA 4L9IA 4WO5A 4LL0A 4CRSA 2PVLA 3RPSA 4NM3A 4ZTSA 4DCEA 5IMEA 2ERZE 3TV4A 3PVWA 4GL9A 4U7ZA 4FF8A 4EWQA 3HV3A 5A54A 3WF9A 2Z7QA 3UOJA 2XEZA 5FXRA 4J99A 4TKSA 3BLRA 3I4BA 2IVSA 5IQBA 2NO3A 4L52A 4ZY6A 3LFDA 3QKLA 4QYYA 5BVDA 5HNIX 4XRLA 2BHEA 3DLZA 2ONLA 4O91A 4J71A 1SYKA 4NKSA 3GOPA 4D0WA 2CN8A 5FM3A 5EYMA 2J90A 2CKQA 4DH7A 4FI1A 4O0SA 3UQFA 4NWMA 4O82A 2OFVA 3P4KA 4CG9A 1OGYA 2CKEA 1O6KA 4EBWA 2LAVA 2PUUA 5LCJA 4FG9A 3R9HA 3VHEA 4DFBA 2JAVA 5IUHA 3HZTA 2X7OA 2BZKB 4D2SA 3NMUF 4XUFA 5LCKA 2F2UA 3OROA 4L43A 4QTDA 4DTBA 4FIFA 4IBMA 3H9OA 1AQ1A 5AV4A 4F78A 3GGFA 4Z3VA 3R1QA 4ITIA 3D7TB 3DPKA 3L9LA 1U54B 3PVBA 2C0IA 4UMQA 5AM7A 5CANA 1WMKA 3E88A 5IQEA 1GY3A 2W1IA 5D11A 3QUPA 2R5TA 2YM7A 3R8PA 5JQ8A 1P4OA 4IZ7A 1STCE 2CGVA 3PDTA 2A19B 2QKRA 3R21A 3DT1A 5HG7A 2B53A 1XJDA 4I22A 3FV8A 3GVUA 3NZ0A 3LCSA 3TG1A 2QO2A 3KRLA 2E9PA 2ITTA 4CV9A 3LCOA 5K0KA 1LUFA 3UNZA 3UPZA 3R9DA 3NIZA 4QYFA 2W4KA 4YHTA 5AMNA 4JBPA 3IONA 4R7BA 3LFCA 4TPTA 3MA3A 5ANIA 4BYIA 4PDYA 2REIA 1F0QA 2B55A 1P4FA 3HL7A 2HW6A 3SOAA 1RJBA 2WOUA 3KF7A 4FKJA 4J98A 4QQJA 5CENA 3SXSA 5DMZA 5L6PA 2WD1A 2RSVA 3H3CA 4IAFA 4W8EA 2Y4IB 4R5SA 4EOKA 3HP5A 4FT5A 5E1SA 4EQUA 1TFFA 2R3KA 4TRLA 1OGUA 3B2WA 2E9VA 3SV0A 4QP6A 4R7HA 3PWYA 2IZSA 2OKRA 2OZOA 4I3ZA 3QTXA 1R0PA 3NS9A 5CT0A 3ZXTA 5J7BA 4AXCA 5AR8A 3V3VA 5IU2A 3LM0A 4A07A 4Z7HA 4PP9A 3FXXA 5HVYA 2I6LA 5M57A 4FV4A 3F5UA 4O84A 4EJNA 4EYMA 3OG7A 3DQWA 3JXWA 5IQGA 2OFUA 4LUDA 3EFLA 3ERKA 3SXRA 3ANRA 4BWXA 4XLIA 2J5FA 4HVIA 3ZO2A 3UVPA 4AA0A 5JMSA 1W2FA 4AACA 3N4VA 3QZIA 2QR7A 3PE1A 3HDNA 3MY5A 4U79A 1ERKA 3S4QA 4JDKA 3BHHA 3IPHA 4QMWA 5EOBA 4BHNA 2O3PA 3EN9A 2HY81 3ZO4A 3H0ZA 1Q8UA 1TVOA 3CC6A 2QOLA 3LIJA 3WI6A 4CMOA 1G3NA 5EW9A 3PTGA 2BVAA 2CDZA 5IH5A 4NW5A 2XB7A 4LG4A 1UA2A 3EOCA 3FLSA 3FYJX 1JWHA 3CPCA 3I79A 4YPSA 3QRKA 5AUXA 1NXKA 3NUPA 4LOQA 5CAOA 3ORMA 3PFYA 4ANOA 4TYIA 3ZYAA 1OBGA 1Q61A 1R1WA 3WF7A 5A6OA 4MKCA 3QQGA 4K6ZA 5CTPA 3LAUA 2BFYA 4ZLOA 5L3AA 1UU3A 3NYOA 4YJRA 3PPKA 4RIYA 4XBRA 3PY1A 4H1JA 4O7NA 3RMFA 1PXPA 3CKWA 1PHKA 4MX9A 5K5NA 5J8IA 5M09A 4HGSA 5FDXA 3R8MA 3PA4A 5E92A 2QO7A 1K2PA 4YC3A 3UE4A 3D5UA 4FV8A 1YWRA 3RVGA 5CI7A 5J9ZA 1XMMA 4QEBA 2C3JA 2R3HA 3FMHA 2IO6A 3WZDA 5AUVA 2P55A 3P0MA 1YXSA 3R8UA 5I4NA 3DGKA 3UOLA 1U4DA 2EXEA 2VWXA 3P9JA 4EOOA 4DH8A 2W1HA 5CAUA 4F9WA 5EI8A 4O4CA 3IK3A 3VBQA 5K5XA 3WIKA 2VWIA 3MJ1A 4OTWA 1HCLA 3OY1A 4J8MA 5KUPA 1G8AA 4ZTLA 4L46A 3OEZA 4FSQA 2BHHA 3R1SA 5HEZA 3Q04A 2WMTA 4JS8A 2JLDA 5E9EA 3TN8A 3Q5IA 4FKVA 4KKHA 3FMJA 4C02A 1OIRA 5C03A 5LXMA 1UKHA 3O51A 4OBQA 4DLJA 2VUWA 2YHVA 2O5KA 5LWMA 4QP1A 5JFXA 5ANEA 4G3EA 3ATTA 4WUNA 4JDIA 2YZLA 2CGWA 2BRHA 1JQHA 3L9PA 3NGAA 4HVDA 5KMIA 4DA5A 4FZFB 4KIKA 4F6UA 3E3PA 3ROYA 4MF0A 2YLEA 3COMA 4RG0A 3BQRA 3GC0A 4AE9A 1A9UA 3V8SA 4DN5A 4FEWA 3DKGA 4O7LA 3UG2A 3CR0A 3F5XA 3R7IA 4W4VA 4DEGA 4R5YA 4IVBA 4ZSLA 2GNLA 2Q0NA 4OAUC 3BE9A 4CTCA 4OTQA 3Q4TA 4IMYA 3VNTA 4RWIA 3W2OA 3ANQA 3RGFA 3ZFMA 4DCAA 4N4SA 2GDOA 3QAME 3QX4A 3VVHA 4PPCA 3FZPA 2J6MA 3R7GA 2OIBA 3OY3A 4AW0A 3QTIA 2UW6A 5FBOA 1OMWA 5HNGA 2XNGA 4ALWA 3QZGA 5ETIA 3NWWA 5E1EA 4ANNA 1V0OA 2R64A 4IACA 5CF8A 4C4EA 3RWPA 4BC6A 4AZEA 4DGGA 4DEEA 4I6FA 2WMVA 5M53A 3E63A 3KK9A 4GT5A 3R02A 3V6SA 3ACKA 2VWZA 3R1YA 4A4XA 2BUJA 5JFWA 4I6HA 4EC9A 4NIFB 1HOWA 4UMRA 2C6DA 2XK4A 4NFMA 4JIAA 4V05A 3MI9A 5EOLA 3EN4A 4XV1A 2ZV8A 2PVRA 1LEZA 4YTCA 1IA9A 1OIYA 4TZRA 3SRVB 4IAAA 2G15A 3LFFA 4KABA 2VO6A 2XRUA 3WZKA 3S2PA 2B9HA 3KIOC 2VTLA 3JY0A 4O7ZA 4YNEA 3TNHA 3R8VA 5HU9A 4QMZA 3IW8A 4WT6A 4D4VA 2R7IA 2YM3A 5IQAA 2W4OA 2UZOA 2Z60A 2IW6A 3OBGA 2XNNA 4I4EA 4RIWB 4ZEGA 4AXDA 2QOKA 1DS5A 2VO7A 4G16A 4CQEA 3MPAA 1XO2B 3CGFA 3FPMA 4F0IA 5B2KA 4YTIA 3DXQA 4XP0A 5DBXA 1GIJA 3TM0A 3GQLA 5HO7A 3LJ0A 2BCJA 2C6MA 2V62A 4K33A 2W9ZB 4ACDA 4CYIA 4QYEA 5DVRA 5C27A 5JRQA 4CRLA 1WBNA 3HV4A 4KNBA 5EW3A 3W2CA 3TDWA 3V6RA 2ONLC 1PMNA 3NPCA 4AUAA 4DYMA 2XJ2A 4HCUA 3CTJA 2VTHA 4Y85A 1QPJA 2JDRA 2R3QA 4G3DA 4ACGA 3E7OA 2C5VA 4F63A 4KB8A 1J7UA 2NYAA 3OWLA 3HAMA 4UMTA 2IF8A 4FTUA 2ZDTA 4F1MA 3NSZA 4IWDA 3NRMA 4HYUA 3C13A 1Y6BA 4FEVA 2FA2A 2UVYA 4AWIA 4L01A 4HZSA 5EM8A 1OI9A 5J1WA 5BVEA 2VTNA 1OITA 2W5HA 3Q5ZA 4IADA 3E87A 4LGGA 5JN2A 1E1VA 4RJ5A 5HO6A 4FKLA 5HX8A 3QYZA 2C6OA 4DGLC 4OTPA 1NVRA 3FZSA 3HAVA 3LFNA 3VJOA 3FUPA 2ITZA 5JFSA 4I1ZA 5HTBA 3AKKA 4AOJA 5GIOE 3A7IA 1UV5A 3WE8A 2YLFA 3D94A 1QL6A 2XKFA 3A4OX 3PJ1A 2XKDA 2PHKA 4EZ3A 3EQHA 3I60A 2H9VA 3FSFA 4BTJA 1P14A 3SHEA 4CT1A 5JK3A 3OT3A 4FK6A 5C01A 5CEPA 4BBFA 3ORZA 3UQCA 2JDSA 4KD1A 2EUFB 1DI8A 1KWPA 1XBCA 3AOXA 2J5EA 3FKNA 4PDOA 2WTCA 3A61A 2OXYA 2G2HA 2IW8A 4AT5A 3DDPA 3GCSA 4ALVA 5GNKA 1MUOA 5IPJA 1ZZ2A 1YDSE 3VBYA 4QMLA 4CFVA 2VNYA 4E4NA 2F2CB 4BCNA 2FSOX 4BDEA 2VWVA 4D1SA 4W8DA 3HRCA 2QI8A 1U46A 3MTLA 3W2PA 5H8BA 4EHGA 4WRSA 3HMIA 4KUJA 2VO3A 3MJ2A 2W5AA 2QOBA 2FSLX 4O4DA 4X3FC 4XG7A 3I0QA 4USEA 1H27A 2Z7RA 3G6HA 2XANA 3PLSA 4APCA 2C68A 4TYHA 5GJGA 3T3VA 3ODYX 2X8EA 5AP5A 5H3QA 3RK5A 3OW4A 2HYYA 3K3IA 1YXVA 5IEVA 3A2CA 3L8VA 4C8BA 3ZUVA 2OF4A 4O4BB 3ZBFA 5IH6A 4GKHA 4YGAA 4DHIB 4QQCA 4GK3A 4JDJA 3W0MA 3R73A 4KKEA 4QMPA 2H96A 2UW5A 3BWJA 3Q4UA 2FVDA 4MHAA 4IWQA 4LV8A 1ST0A 3GU8A 5FEDA 2WZJA 2C5NA 1KV1A 3QC4A 4O7TA 3DB6A 1H0WA 3H30A 4BDKA 2JIUA 3RJCA 3QCQA 2RFDA 3T9TA 4B8LA 4OBOA 4QYGA 2P3GX 1Z9XA 2YISA 4G31A 5I5ZA 4MQ1A 4F9BA 1OL2A 3GFWA 4M3QA 4PMSA 2XP2A 4M0YA 2IW9A 2ZFYA 2Y6MA 3DLSA 5AUZA 3WZUA 3S3IA 1BYGA 5CXHA 3LQ3A 4PUZA 2J51A 4V0GB 2LGCA 2CJMA 2X1NA 3OCTA 2CLXA 4AOIA 4E6QA 4M67A 4L44A 3TI1A 5I3OA 3ZFYA 3UP2A 4O7YA 3RZFA 3BU3A 4JVGA 4GK2A 5KBQA 5I9XA 5AIKA 1ZOGA 3NW7A 4DG2E 4NSTA 4HGTA 5EKNA 1J1BA 1LP4A 3OFMA 3MIAA 4FOBA 3AGLA 4OT6A 3FQHA 1BKXA 3OTVA 3HA8A 2XIZA 4ZK5A 1L3RE 3NNVA 4NKAA 3UVQA 4WBBB 4RJ4A 3QQUA 4K9YA 4QTAA 5CSWA 1R78A 3G6GA 3D15A 2ZDUA 1WFCA 3F3VA 4AFEA 4DE4A 3VUKA 3NNXA 1V0PA 3FJQE 4IANA 4NCTA 4U8ZA 5BX0A 2OJFE 3F2NA 2C3LA 4G3CA 5CI6A 4EK4A 1ZMWA 1FVVA 2O2UA 2RG6A 4FK3A 4IM2A 3R04A 4X0MA 4EOJA 5FQDC 2W17A 1W2CA 5CU2A 1BUHA 4NUSA 3MWUA 5ACBC 3R9OA 3EL8A 2EB2A 4FTLA 3E62A 2YWPA 4R6VA 4AGDA 3PXKA 3SC1A 4TY1A 4D2PA 4Z9LA 3RAHA 4C0TA 3VS4A 5CAQA 3Q53A 2H6DA 4FNYA 2BIYA 2BKZA 3ET7A 1ATPE 2ZVAA 4GU6A 4BIBA 4G9RA 1CTPE 4Q9ZA 5JGDA 3BYSA 4UYAA 4WSYA 3UZRA 4C38A 3CXWA 4RX9A 4PP7A 3D2IA 4S30A 3NAXA 4F09A 5ANOA 3KRWA 4GG7A 2ZM4A 4J8NA 5AR4A 1FINA 4GFMA 2FB8A 4EBVA 4ZIMA 2XMYA 2CLQA 2J0KA 2UW9A 4FZ6A 3COIA 4IWOA 1Q8ZA 3NEWA 3R7OA 4U3ZA 2X7GA 5HVKA 3E5AA 2EU9A 3CJGA 2F4JA 1YVJA 2WMXA 4AN3A 2X4FA 4E1ZA 4YBKA 1WBTA 4H3QA 1DAYA 2VTRA 5CASA 2R3PA 3U6IA 4OT5A 4L68A 2JKKA 3W0OA 3OW3A 4JOAA 4AAAA 3DY7A 4I5MA 4U81A 5JRSA 4GEOA 1YXUA 4HPUE 4YPDA 3OF0A 4RX7A 3GXLA 1OUKA 3RINA 5EQPA 2OJ9A 3V5TA 2VX0A 3HLLA 1M2RA 4L7SA 3TKHA 4YLKA 3HUCA 2W0JA 3ALOA 5BPYA 3BHYA 3PZEA 4RJ7A 2XALA 4YTHA 4QTBA 4QNYA 1ZMVA 3G15A 2E2BA 5JSMA 2C0OA 2C5XA 5BUEA 4F9CA 4IC8A 1GZOA 1ND4A 4FKQA 4EK6A 3NYVA 2IJMA 4HJOA 4IAKA 2R3IA 4ZZMA 2IZRA 3EQIA 2I40A 1QMZA 4BN1A 4W4WA 3SG9A 3PJ3A 4MD7E 4X7QA 5JGBA 4N0SA 2YFXA 5CEIA 2BRMA 2YCSA 3V01A 2PSQA 5DGZA 2EVAA 2WMWA 3U87A 3ZRKA 4DLIA 5I9WA 3IQ7A 2P4IA 5E8VA 3C0HA 3NUNA 4PNIA 3R7EA 1J3HA 4L45A 3ZLSA 5J9YA 3C7QA 4XG2A 3RAIA 1JKTA 1PXNA 2YCRA 4FNXA 4UWBA 5DE2A 3PSBA 1APME 4DFLA 3FYKX 3TKUA 3ZDUA 5FBNC 3EQRA 2YA9A 2J0MB 2X0GA 3UMXA 2PY3A 4G3GA 2HW7A 3POOA 3FI3A 2J9MA 2R0IA 3EFWA 4FV1A 4C62A 1TQPA 4RJ6A 4CMTA 4AT3A 4ZJJA 1S9IA 2VWUA 3K3JA 2JDTA 4FKTA 3ZLYA 3GNIB 3BRBA 3MB6A 5K4JA 1CSNA 3F3UA 3WARA 3CY3A 4FG8A 4FZDB 3M2WA 2WEIA 3E3BX 4KIOA 3U9CA 4MYGA 4BF2A 4A9SA 5ETFA 2GQGA 3AT2A 4GW8A 5HCXA 4M97A 4O27B 2X0QA 4D1XA 5CZHA 3TT0A 4M14A 4P7EA 3ZRLA 4YZDA 3HNGA 2ZMCA 4OGRA 2BROA 2QG5A 3D5WA 2QD9A 2OXXA 4LGHA 4O0UA 4L00A 1PXIA 2XH5A 3G9NA 4QPSA 4U41A 5CY3A 4E5BA 4IE9A 1QPDA 4E6AA 4XJ0A 3E93A 2ITPA 5IUGA 4ASZA 4C4FA 3W8QA 4A7CA 3AMAA 2BPMA 3VS1A 1XHAA 3A7GA 1G8KA 3EH9A 1PMUA 1PMVA 2I1MA 1YOLA 1AD5A 5BYZA 4ZJIA 4E20A 3PXQA 5M08A 3II5A 3O5AA 1G8JA 3LPBA 2GU8A 4OTIA 5EHYA 4R1YA 1SZMA 4G2FA 3SA0A 1WBVA 3D2KA 3PP0A 5IQIA 4JL9A 5AWMA 3RK7A 4DDGA 3D5VA 4N70A 2WGJA 3M11A 2JAMA 3N51A 4M12A 1H08A 3V5QA 2WQBA 1KSWA 4DG3E 4P4CA 1PXLA 5CVHA 3D14A 4U80A 5ACKA 4RVMA 4DEHA 4B6LA 2BILB 4DF3A 4BZNA 3BGZA 3AG9A 3UNJA 5BVOA 3WE4A 3TZMA 2QU6A 4KA3A 3MVHA 4EK5A 5JEBA 4AS0A 5C26A 4N57A 2X2LA 3QX2A 4BCJA 2BZIB 2C6LA 1UWHA 3R83A 3RALA 3FXWA 3TZ7A 3G5DA 4C37A 2OICA 4EZ5A 5CEOA 4AN2A 1CKPA 4DTKA 5KCVA 5AJQA 4EH7A 2ZV9A 4XCUA 3MV5A 3C4WA 3MIYA 1PKDA 4RFYA 5M07A 1SM2A 3GEQA 3R1NA 3WZEA 1H4LA 3RCJA 3MGYA 3SKCA 4DT8A 4O21A 4U5JA 1TKIA 2XK3A 1M52A 3Q9WA 3LXNA 5F94A 5T68A 1KE6A 1OL6A 3AQVA 2VTSA 1GOLA 4IQ6A 2ZOQA 3BPRA 3O8UA 1XWSA 1V1KA 2W1DA 1RE8A 4U0IA 3QWKA 4C34A 4OTFA 3ACJA 2J7TA 4GT4A 4ZLYA 3IOKA 3C4XA 2F49A 5CXZA 3CQUA 3DK6A 3OOGA 4U9AA 3OXZA 5I0BA 2IN6A 4FZAB 3F2AA 4UZHA 1ZLTA 2W05A 2YACA 3O17A 2Q83A 3U4UA 4ANBA 5L8LA 2WQEA 5G6VA 3S95A 3GQIA 3BEGA 3QL8A 4LYNA 4ORKA 2BALA 4MBLA 3Q3BA 3EQGA 2I0EA 4KINA 3IS5A 2UZEA 5AUUA 3RTPA 2OIDA 3AXWA 4BL1A 2Z2WA 3W18A 3V8WA 1Q8WA 3DBCA 3SW4A 2J4ZA 3AGMA 1FOTA 3EQFA 2W06A 2UW4A 3R2YA 3FXZA 2C0TA 4ZSAA 3QYWA 4A9TA 4YO4A 2XARA 3VBVA 3RPYA 3FC2A 2C30A 3BX5A 3QHWA 5DT3A 4I24A 3QD2B 3ZZEA 3LXKA 4MXCA 4AGWA 2UW8A 5M4CA 4FEQA 4O2ZA 3MH3A 5EHOA 4MWIA 4E7WA 4EKKA 4FJVA 3ZXZA 3A60A 3PE2A 5K9IA 2VU3A 3SQQA 4YURA 3LVPA