4QMZA

Mst3 in complex with sunitinib
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
287
structure length
286
Chain Sequence
MQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE 24
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 100
structure length 286
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qmzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qmzA01
4PX6A 3GI3A 3Q2MA 3O71A 1S9JA 1M2RA 3EZRA 3HEGA 5CQWA 3S4QA 4F08A 3QCYA 2PTKA 3V5LA 1OUYA 3HMPA 3LJ1A 4AZEA 3JXWA 3F88A 4DYMA 1VZOA 3ZSGA 4EI4A 2UUEA 3ZYAA 3IW6A 4GUBA 3DBQA 4J95A 3R00A 4Q2AA 4M0ZA 4O21A 5DHJA 4IJPA 2QO9A 1M52A 1E1XA 4XHKB 3U4UA 4MX9A 4XBUA 5A4QA 4RRVA 4BFMA 4KUJA 3PA4A 5EKNA 3R04A 4DEAA 1P14A 2OICA 2ZV7A 3E8CA 1B39A 2XJ2A 5AP0A 4ZTHA 3W32A 4APCA 3RM7A 3DOGA 3OT8A 4BCMA 4JDIA 5LOHA 4EQMA 1WCCA 1WBWA 4LYNA 5JGAA 5AAEA 3SOCA 2QONA 4LGGA 2QI8A 2GNFA 3ZFYA 3G9LX 5CY3A 3ATSA 3CTHA 3DK7A 3GQLA 3QCXA 5HNGA 4M84A 4QYHA 4Z16A 2VTQA 3UIBA 2P2HA 2YWPA 3WYYA 5KMNA 1XH9A 2ETMA 3E64A 4U97A 3BLRA 3DNDA 4JG8A 3QHWA 5L2QA 3I5NA 4BRXA 3Q96A 5HO8A 2FGIA 3SVVA 2YDIA 5CVHA 4N6ZA 4QQCA 1OKYA 1RQQA 3P4KA 2C1AA 4C2WA 3AG9A 3S2PA 1JSVA 3Q6WA 5E90A 4AW1A 4UMQA 4CKIA 3BQCA 4IWPA 3NW7A 5E1SA 4NFMA 4HVDA 4JQEA 1XH4A 4ZSAA 3IG7A 1Z9XA 3HP5A 1YW2A 3GFEA 4W4VA 3EIDA 3VF8A 4M69A 5L6OA 3LFBA 3EN9A 4CYIA 1IAHA 2ETKA 2QOBA 1OL1A 2BIKB 1Y57A 4CFXA 2R3JA 3UG2A 3NNVA 3FXWA 4HZRA 2E9NA 2J5FA 3FMKA 3F69A 3OHTA 3DFCB 5K4JA 2VTIA 5E8XA 4G1WA 4O6LA 1OITA 3F82A 3ODYX 5IDPA 4GJ2A 1F3MC 3WZDA 4TL0A 2X4ZA 3R7YA 4USDA 4M7IA 4XX9A 3MESA 1JKSA 5HIDA 5J5TA 1UVRA 1LEWA 2I7QA 3H9FA 3M2WA 4QMPA 2OJFE 2VWXA 5CF8A 1VEBA 1MRUA 4XV1A 3HECA 4F09A 5DA3A 3E92A 3SXFA 3ZLSA 3BELA 2OSCA 5J79A 3TWJA 5K3YA 1E9HA 2HK5A 3S3IA 4BIEA 3N4TA 5JH6A 4ZS0A 2FA2A 2YCQA 3PP0A 4QD6A 4FC0A 4O86A 4EC9A 3HRFA 2F57A 5DRBA 2OGVA 2VO7A 4N57A 2HELA 3NVMB 1OMWA 3ORIA 1BI7A 4EBWA 2OZAB 2WIPA 4U0IA 5M4FA 5LWNA 2VV9A 4WNOA 4ALWA 4YTCA 3DXPA 3HX4A 1WBTA 2NO3A 4G6NA 3TL8A 1QL6A 3WIGA 3F6XA 3VW8A 3WZKA 2BILB 2ITYA 4HCUA 3ZDIA 2GHGA 1PMUA 2V7AA 3ZHPC 4Z7HA 3C4ZA 3O96A 4FNZA 4GW8A 3Q60A 4BIBA 4PUZA 4QMWA 4RG0A 3MDYA 3LCTA 3DLZA 1J1CA 1OIRA 1FBNA 4HYHA 2G2HA 4YPSA 5HQ0A 3TZ7A 4NK9A 5J9ZA 3P5KA 4PP7A 3IGGA 5AUZA 2ERZE 2EB2A 4CGAA 4MXOA 3LQ8A 2W1ZA 1GZOA 3QTSA 4UMRA 4U6RA 3QUEA 3R28A 4U8ZA 4F9AA 4BICA 2PVJA 4FTNA 4ZMFA 4MNFA 1FINA 2BZHB 4YZNA 4P90A 4B0GA 3G6GA 5IA1A 4RC3A 2X1NA 3ZO4A 4ANSA 5IQGA 3VS6A 3UC3A 2RFEA 4ZLOA 5HTCA 4YR8A 2A1AB 5JRQA 3OG7A 3TZMA 3Q4ZA 2VNYA 2C3IB 1BL7A 1CMKE 3A7GA 4OAVB 4D28A 3EL8A 4EK4A 2O8YA 4PPBA 4EWHA 2X7FA 3MFRA 3NYNA 5HEZA 2QODA 3U8WA 4FZAB 3BHUA 3DBCA 2NRYA 4AA0A 4TWNA 1ZYJA 3U51A 1K3AA 5J9LA 2J7TA 3AT4A 3AMAA 1BI8A 4BDGA 2F49A 5G6VA 5HCZA 2YM4A 3EZVA 4YUQA 1HOWA 5AM7A 4FZFB 2QOFA 4GVJA 3UODA 4G31A 2UZVA 3UYSA 2GS2A 2HIWA 2JLDA 2WQBA 2XA4A 3FI4A 4FTCA 5TO8A 3E93A 4P2KA 4ACGA 3U6IA 3BU5A 5EM7A 4D9TA 5L4QA 5FQDC 3BYUA 4LUDA 4RIYA 3ZM9A 5IEYA 4FK3A 4JOAA 3GUBA 4JR3A 2I0EA 5EHLA 4FSNA 3FUPA 5FXQA 2GTMA 5J1WA 2WIHA 2PMNX 4YZBA 5EI6A 4DFXE 3MGYA 5J7BA 4A4LA 4DTKA 4F99A 3FWQA 3T9IA 3MH0A 5AP7A 4S33A 4WBBB 1T45A 1KV2A 3MPAA 4I92A 1H1RA 3UNJA 4TTHB 1KWPA 2Y7JA 4XOZA 5F1ZA 5KMIA 3VNTA 4UYNA 5FDPA 1IAJA 4AN2A 3FY2A 4LL0A 4RGJA 3D2IA 3NCGA 5FGKA 1S9IA 1SYKA 4QMMA 4EBVA 1PF8A 2B55A 3OY1A 2HZNA 5JGDA 5AUXA 3L8SA 1GZNA 4APPA 4USFA 3SHEA 4IFCA 2AYPA 2DS1A 1PXLA 3UZPA 3VUHA 1J7UA 3V8WA 3ZU7A 3L8VA 5HTBA 4GT5A 3L9PA 4X0MA 1CKJA 5CEOA 3LW0A 4RIWA 3V5TA 4HZSA 3TUBA 3FKNA 4C4EA 1BX6A 4LRMA 5M55A 5CX9A 2OFUA 4HW7A 4O0UA 3ENMA 4H39A 4QPMA 4WBOA 4EH5A 2WGJA 3IONA 3QTIA 3IQ7A 4X2FA 3G0FA 4RA4A 1W0XC 1BKXA 2OK1A 3G0EA 4UYAA 1Q99A 2R7BA 1PXKA 1XJDA 3W2SA 3UPZA 3ZO1A 2VTOA 2XUUA 4D1XA 3CLYA 1ZARA 3FQSA 3M1SA 3PSCA 2I1MA 3FC2A 1Q8YA 1YXVA 1YHWA 2BALA 3GCQA 3BEGA 4BI0A 4E1ZA 2YZLA 2CN5A 4E4NA 3WF9A 1PHKA 1YOLA 3KGAA 5AV3A 3UIUA 3QGWA 1G8AA 1CDKA 3OUKA 1OL6A 3EKNA 3EH9A 2GPHA 3E62A 3B2WA 3PJ3A 4IZ7A 4KIQA 5C1QB 3UO5A 4D0WA 3AC4A 3C4FA 3K5VA 2BZJA 2YAAA 4OTHA 2OZOA 3FI3A 3ORKA 4FV5A 4U5JA 5ACKA 3GENA 3KVWA 5E8WA 4A9YA 1Q8UA 3Q4CA 4FSQA 4IMYA 1QPDA 3DB8A 3RTPA 2V22A 3II5A 1YI4A 3PXZA 1Y8GA 4I0TA 4YZ9A 5CU4A 3S95A 2OBJA 3VBQA 3VS7A 2A19B 2I40A 2QURA 5HLPA 4F1MA 4E4XA 4RPVA 2QQ7A 4FICA 4FTIA 4GKIA 4EH4A 3E3BX 2UZEA 1OI9A 3R63A 2UV2A 3PSBA 1SNUA 5KZIA 3AGMA 2R3LA 3BGZA 5CEKA 1ZAOA 3ZS5A 1SM2A 2PVKA 4Y5QA 5DT3A 3RNIA 3WBLA 1IEPA 4KINA 1FPUA 3D4QA 4M12A 2Y6MA 3D94A 3ZZEA 2YZAA 3C7QA 4LV5A 4RFZA 3RP9A 5KMMA 3QD4A 3LMHA 4FT3A 4IC7A 5HICA 3W2RA 5CT0A 3ELJA 2REIA 4YU2A 4F64A 2B9FA 2HY0A 4QNYA 4CYJA 4X21A 3ZOSA 4JBQA 3BYSA 3RWQA 1SMHA 5LCKA 1YWRA 4QYFA 5F9EA 4FBXA 4FT9A 5DI1A 1PKGA 4RQKA 4RX9A 2VTSA 1UU3A 4RSSA 2JBPA 2VTLA 4C37A 5K9IA 5L2IA 4L68A 5EDPA 3VF9A 4EK3A 4GG5A 4FTOA 4FKQA 4FSMA 3RZBA 3QTXA 3RAWA 4JJRA 1ZY4A 1FQ1B 5CYIA 3ZO3A 2YN8A 4R7IA 3RAHA 5L3AA 4OBPA 4MXXA 2W1IA 3QQJA 1VJYA 5BYYA 4RFMA 3COMA 1GIHA 4AFJA 4UZDA 4S30A 4YNEA 5JFVA 3OP5A 4BCKA 5LWMA 4JX3A 4FIGA 4QRCA 4IAAA 3MA3A 4WUNA 3GEQA 3BLQA 5F20A 3UBDA 4O7ZA 3TDVA 4XG8A 4BCHA 4CSVA 4CZUA 4I5CA 5AP3A 3TIZA 3QQLA 1V0OA 2OO8X 4U79A 3VC4A 3VQUA 3RPVA 4OBQA 4RVLA 4WNMA 4DG2E 3CJFA 3LIJA 4MF0A 4RWLA 2DQ7X 4J8NA 2YJSA 2J9MA 1TQMA 5GJFA 3SG8A 3H9RA 3UC4A 3Q9WA 4DAWA 4Z7GA 1DS5A 1W84A 4BHNA 2QHMA 5B2KA 5I9YA 2X8IA 4ZTMA 4FL2A 2UW0A 4ITJA 4K2RA 1OIUA 3MFSA 4KKEA 5IISA 3QD3A 3W1FA 2CJMA 3DU8A 5JZNA 3V3VA 1OBDA 2BR1A 1KE7A 4NW6A 1GIIA 4HPTE 4U81A 4F7NA 1WVWA 4F7SA 5IQFA 4R8QA 4FUYA 4RJ5A 4E3CA 1O6KA 2YWVA 2OF4A 4KAOA 3NPCA 4IX3A 1XBAA 1AGWA 2VO3A 4A07A 4FKIA 4GU9A 5K5XA 1HCLA 3A4OX 3S00A 3FMEA 3QRKA 2XJ0A 5HG9A 4FV1A 4YO6A 3NW6A 3ZC5A 5BQ0A 5BUEA 3RMFA 1DAYA 5KMOA 2YIYA 5FM3A 3IO7A 3ORPA 3EQCA 5JMSA 4J96A 4D55A 3OC1A 3EYGA 5TOZA 5HI2A 2YHVA 3TM0A 4NH1A 4RIXA 3HGKA 2GNIA 5CF4A 2J51A 4G5JA 2Z7LA 3WZEA 4F1TA 5IQEA 3MA6A 4EQUA 2WQMA 2OJGA 1NY3A 5AP5A 2R3KA 5AP4A 4G9RA 4HYUA 5FEDA 3TTIA 5AJQA 3HDMA 3NW5A 3R2BA 5H8EA 2BTSA 3FMDA 2ZVAA 1LP4A 3VBYA 2WU6A 1U4DA 5HBJA 2WMTA 1UNHA 4TYEA 2YM3A 3W33A 2AC3A 3JR1A 3R9OA 4QMYA 4FIEA 3EL7A 3VUTA 3FLZA 2PZRA 3MJ1A 3ZM4A 3Q9XA 5M4IA 4AFEA 1I44A 2X7GA 4BDJA 1BMKA 3WF6A 4IAZA 4U44A 2HYYA 3LFNA 2XK4A 2O2UA 3A7HA 3W2QA 5K5NA 3U55A 3EKKA 2HOGA 2OJIA 4BWXA 3W16A 2OU7A 3SXSA 3BU6A 2HZ4A 5EOLA 1STCE 3KU2A 4G5PA 4C33A 4C62A 3UZTA 4CCBA 3QALE 1XHAA 3ORMA 3ZXTA 2G1TA 4EHVA 3KCFA 4EORA 2IW6A 3NUXA 1IRKA 2W4OA 3QA0A 4CTCA 4FV7A 2R0UA 4X3FB 1FVRA 3LM5A 3V5JA 5H2UA 3GB2A 3PIYA 3OZ6A 1JPAA 2GFCA 2JIVA 3C4WA 3QCSA 3VN9A 5HO6A 5HD4A 2C0OA 4R77A 3H30A 4G2FA 3VUDA 4FG7A 3RVGA 1Y91A 3FPQA 4ACHA 1KV1A 3TNIA 3A60A 4QMVA 2XNGA 2RGPA 2EXMA 1H0VA 2CNQA 4TT7A 3KMWA 4C3RA 3GP0A 5IA2A 2Z8CA 3SQQA 4RZWA 3OEFX 3EQIA 2BMCA 1UNLA 4WNPA 3QC4A 5JZJA 2GU8A 3F3ZA 5A3XA 4RMZA 3PP1A 2WTVA 3F3VA 5CSWA 4UMTA 2VN9A 4DH3A 3POOA 4K8AA 3KRRA 5LCJA 3LFAA 4A06A 4TWOA 4OTPA 4JAJA 3Q5ZA 4O83A 4CV9A 2JAVA 5EFQA 2OXXA 1B6CB 3EN5A 4EZ5A 5KMJA 4GCJA 3U54A 4XG6A 3NYXA 1Q24A 5CSXA 4IAIA 2C3LA 4FKRA 5EW8A 4BCIA 2XNPA 3D0EA 3AGLA 1W7HA 4OR5A 4E5WA 2JFMA 5J8IA 1R0PA 2G2FA 2RFSA 3TUCA 4E73A 1XH7A 3ORNA 3SLSA 3VUKA 2GS7A 2PK9A 4BZOA 3R7GA 2R2PA 3LXKA 5FP6A 3ZFXA 4IIRA 4M13A 5CU0A 4L42A 3ZFMA 3R8UA 4AAAA 2W1GA 3POZA 3TJDA 4O7VA 3TV6A 4EZ7A 4CT1A 1QPEA 3HMNA 4M8TA 3KXHA 3R8PA 2Z7SA 5I9XA 4C57A 5LXMA 4FKJA 4Y46A 2QOIA 3WZJA 2YM6A 2R9SA 2P33A 4K0YA 3IDBA 5ANKA 2YDJA 4EOPA 3FPMA 4FR4A 4QYYA 3VJNA 4GL9A 3EJ1A 2XYNA 4FTAA 4X2NA 2HENA 1AQ1A 4AOTA 2WTJA 4B8LA 3FLWA 4C34A 4FV2A 3SV0A 4FMQA 3GQIA 4C38A 4HYSA 4AOIA 3CPBA 1JSTA 3OFMA 4KRCA 5I9ZA 4C3FA 4KWPA 3PLAE 5DRDA 1PXIA 3F2RA 4I5MA 1YOMA 1UWJA 4DFUA 4FV8A 5I3RA 4JX7A 2X81A 2C6MA 3BHYA 2YIQA 3OTUA 4YJUA 5DFPA 3WOWA 4AOJA 4O1OA 5M08A 5AUVA 2QOLA 4RJ3A 5HTIA 5HU9A 4BZDA 3NAXA 4PWNA 5HG8A 1W8CA 4YBKA 5ICPA 3AT2A 5HOAA 5J95A 4CTBA 2QKRA 5EHYA 5A14A 4YJVA 4C61A 3ZLXA 2WQOA 4UXLA 5HBHA 4ANLA 2I6LA 4XG2A 4GKHA 2PZYA 2CKQA 2XK7A 3GCVA 2ITZA 4IAYA 3NUAA 1MQBA 2C6TA 3IW7A 4FG8A 2IVSA 4NM7A 4XEYA 1L3RE 4ZJJA 2QD9A 3TKIA 3KFAA 4RLLA 4KNBA 2C1BA 5KBRA 2W99B 4WRSA 3L9MA 4CLIA 3IDPA 4UY9A 2VWZA 4NKSA 4GT3A 5E8ZA 5HO7A 5M53A 2VO0A 4YTFA 3CQWA 3RPSA 2YEXA 4O7RA 4R5SA 3COKA 2VX0A 3PTGA 3MIYA 4DTBA 1FGIA 5JQ5A 3IS5A 2ITNA 2B9HA 2QC6A 5AX9A 1URCA 3SA0A 4AN9A 3NNXA 5EH0A 1H0WA 4YHFA 3ACKA 3FE3A 3QA8A 2W1DA 4QP4A 1E1VA 3ANQA 4I3ZA 4FNYA 4MYGA 5ETIA 3JY0A 5JGBA 1PKDA 1YVJA 4L3PA 2W0JA 3UOHA 3VUIA 3QHRA 3UVRA 3DXNA 4ZY4A 3ZMMA 3PRIA 5DT4A 4GIHA 4IC8A 5LQFA 3OCTA 3GC0A 4RWKA 1ZYDA 1FMKA 3BEAA 3OBGA 1KE8A 4O7NA 2QHNA 3H4JA 5FTGA 2J2IB 3KK8A 4IHPA 3LFEA 3BU3A 3KCKA 5AR4A 5IH6A 3HUBA 4MNEB 5E8TA 4XP3A 3UMXA 2FSOX 4F4PA 4H3QA 4CD0A 4II5A 4XP0A 4ZZNA 3G5DA 3Q6UA 4AZVA 1W98A 3ORTA 3L8PA 1OVEA 5CQUA 3EQDA 4L8MA 2W5AA 3L8XA 3TXOA 3QZFA 4QP8A 4AE9A 4HGEA 3PIXA 4AZWA 4YO4A 1OUKA 4WG4A 3FZOA 4FGBA 2PE2A 2C5OA 5DR9A 3HMIA 2IW8A 4KRDA 2PE0A 4C7TA 4ANMA 3G33A 4XS2A 4FL3A 2EUFB 1QPCA 3UMWA 5LJJA 4D1ZA 2PYWA 2ZV8A 4ANBA 4QP1A 5EW3A 2ETRA 2XNEA 4IB1A 3E8NA 4DG0E 2QLQA 3NRMA 3KY2A 4RJ6A 4CG8A 2WO6A 3DY7A 2FSTX 1FOTA 1YI3A 4PDOA 5C8MA 4JR7A 2B54A 1XWSA 3MJ2A 3P78A 4R3RA 4OTDA 1REJA 2XKCA 3ZBFA 2RL5A 4WKQA 4BKJA 3ID6C 5CENA 2W96B 4CFVA 4QQJA 3R8LA 3OXTA 4S34A 1IASA 3OW3A 1WZYA 4CFUA 4IE9A 4R5YA 4RVKA 5CI6A 3BYMA 4PL4A 3CBLA 4ALUA 1JNKA 4EQCA 4JQ8A 4QYEA 2LAVA 3BWFA 2RFNA 2WU7A 4I6QA 4LOPA 3RHXA 3QGYA 2ERKA 4C0TA 3VS1A 3LLAA 2GQGA 2PZPA 3HAVA 2WXVA 4MXCA 5KZ0A 3QBNA 1OPJA 5BVFA 3Q9ZA 2XKDA 4CFNA 2VTHA 4TNBA 4O7SA 5FXRA 2JEDA 1KE6A 5T3QA 3UPXA 3GGFA 5IUIA 4A4OA 4E93A 4YLKA 1KOAA 1YOJA 4FT0A 5I9UA 4EWQA 1IR3A 5I4NA 4G3FA 1ZOGA 5M4UA 3RWPA 3O50A 5CU3A 5FLFA 3KL8A 4G3CA 1LEZA 2W4JA 4L7FA 3OROA 3DGKA 2ZB0A 4PTCA 4R6VA 3KMUA 3SRVB 4M14A 2CCIA 3H10A 3AMYA 4NIFB 3IPHA 4LOOA 5J87A 3TZ8A 5IEVA 3MN3A 2XH5A 3P86A 3QFVA 5DH3A 2HAKA 3OMVA 4O22A 4LM5A 4ACMA 4M69B 4Y83A 3V51A 4C36A 1H1SA 3OXIA 3CEKA 3VHKA 5A4LA 2BVAA 3VHEA 3ZO2A 5K0XA 3RNYA 4MWHA 2QU5A 5A4CA 5GINE 2H34A 1ZY5A 2C6LA 4NTSA 4FODA 2RF9A 5L8LA 4FV4A 4IWOA 3O8TA 4O7TA 2J4ZA 3DBFA 2Z2WA 5GZAA 3C9WA 3NYOA 3C51A 3RAKA 3FYJX 2F9GA 3JYAA 4BDFA 1YXSA 1UKIA 3MY5A 3MYGA 3DNEA 4GUEA 4GS6A 4X6QC 5CASA 1TQPA 2ZV9A 4LQMA 2YABA 5I5ZA 1ZMUA 5CZIA 3QRUA 2JIIA 4CG9A 1MUOA 4UMPA 2BDWA 2PMOX 4MXAA 3JUHA 3CIKA 3K3JA 3U9NA 3ORZA 3NUNA 4KS7A 2XB7A 5DN3A 5AAGA 5KKRC 2J0IA 2VWYA 4QMTA 5BVKA 4FEXA 2BFXA 4ZSLA 2XBJA 3FMNA 1Y6AA 3R0TA 4R1VA 4K11A 3CJGA 5DR6A 4UN0C 2PUIA 4I94A 2QKWB 3MVHA 3KKVA 2P2IA 4BTMA 3FZ1A 3SDJA 4PNIA 4GK4A 2A0CX 4FSUA 4LV8A 4AGDA 2Q0BA 2OZAA 4D2RA 1XO2B 4BCJA 2XIRA 2CKPA 2JGZA 1JLUE 3PVGA 4BHZA 4L46A 4YLLA 5E8YA 3MI9A 1H4LA 2A27A 2QCSA 3D5XA 2WTKC 4DEEA 2BRNA 2GQSA 2C5VA 2XK6A 3QQHA 5IQAA 2ZOQA 3KXMA 2FUMA 3ORLA 4RBLA 1FMOE 5CNOA 2JFLA 2W7XA 1R1WA 4MBLA 3ZUUA 4W4WA 3QQKA 3UOKA 3A7IA 4JBVA 3VBXA 4CMTA 2F2UA 4Q5EA 3RKBA 2G01A 4DE4A 4ZMEA 2WMBA 2RKUA 3RALA 3OD6X 3QRIA 3O0GA 4EJ7A 2JAMA 4AW0A 2GS6A 5AEPA 2E9VA 3BCEA 2ZB1A 3SW7A 5ANIA 2Y6OA 3CXWA 2C6DA 4JAIA 2X39A 1XH5A 3N4UA 3QXOA 4QT1A 5T68A 4BN1A 5JT2A 2J0MB 5FP5A 3EFLA 4B99A 2WMVA 2FSLX 3KN6A 4AA4A 2VWIA 4FEUA 1WFCA 4L00A 3LCKA 2JBOA 3NUSA 4J53A 4L3JA 3UQGA 5DNRA 5A6NA 4NM0A 1I09A 4F7LA 1O9UA 4QMSA 3HV4A 3K2LA 3W18A 3CP9A 4ZJIA 4EOIA 5TF9A 1ND4A 4XUFA 4DBNA 2RG6A 2BDFA 1ZZ2A 4FTTA 5HHWA 4BI2A 1PXJA 4FGRA 4BWPA 2WMUA 3UE4A 3WF5A 2J5EA 2XK8A 3MBLA 4JDKA 4IVCA 2X2LA 4FOBA 4RJ4A 4E6DA 2J0JA 5CZHA 4P5ZA 5LVLA 4CFMA 4O0YA 4MQ2A 5E92A 1CTPE 3R9DA 2CCHA 3UO4A 4I23A 5C26A 4Y73A 2C30A 1XH8A 1URWA 1U59A 1YDTE 4O91A 5CVFA 4H3PA 5KE0A 1ZOHA 3SAYA 2CGWA 1PYXA 2ZYBA 4YC3A 3CE3A 2HY81 3D7ZA 3FHRA 4OTGA 3IW8A 4RIYB 1Z5MA 3R8VA 5M06A 4FTLA 3QD2B 5H8BA 4AE6A 3FHIA 2BDJA 4S32A 2HZ0A 3CKWA 5B7VA 4IXPA 1XH6A 4NFNA 3CPCA 4HVGA 4FKUA 3ROCA 4R3PA 5LMKA 3ZLYA 2ITUA 3OVVA 3QUDA 3NS9A 1VR2A 4YHTA 5AADA 4O7LA 1ZWSA 4F7JA 2X6DA 2YIWA 1F0QA 3DTWA 3PE1A 4FVPA 5FEQA 1ZXEA 2BPMA 5EM8A 3GC9A 3HRBA 2GNHA 3LZBA 4OTIA 2BUJA 1BL6A 2HWOA 4BKZA 3PYYA 4OTQA 4RIOA 3T8OA 1J91A 3QLFA 5I3OA 5TE0A 3CGOA 4AF3A 1M2PA 3PE2A 2HXLA 4O2PA 3G90X 3P7CA 3BYVA 5M56A 4DH8A 3MPTA 3FZTA 5LVOA 3FMMA 2OIDA 2PZ5A 3MWUA 4FKLA 5DOSA 3TV7A 4C59A 3HVCA 1SVHA 4AXAA 5KNJA 4NT4A 5CXHA 2JKKA 4LG4A 1XR1A 2ITWA 4A7CA 4YZDA 2R3FA 5TT7A 3K54A 2XS0A 4UEUA 5HKMA 5KX8A 5IQHA 2XCHA 1H00A 3GXLA 3UDBA 4EK5A 2H6DA 4BBFA 4DGOA 4BKYA 3TCPA 1Y8YA 4ORKA 3OS3A 4KKGA 4K33A 2R3IA 4AZTA 2J50A 3N9XA 3UQFA 1H26A 1T46A 3M11A 4D2SA 5LMBA 3Q5IA 4IVDA 1RDQE 5AUYA 4FEQA 5AV1A 5CF6A 2BAQA 2W1EA 4U43A 4YZMA 5C9CA 1PY5A 4HNIA 3GU8A 5AP6A 2XIZA 3IGOA 5BNJA 3QU0A 2BFYA 4FYOA 2ITQA 4AT5A 3CSVA 3FZPA 5EM6A 5LVMA 2R4BA 3KK9A 4GYIA 3FQHA 3FSKA 4XG4A 3F66A 2FH9A 3E8EA 4DFLA 4YLJA 5AR8A 1OIYA 5CEIA 4C02A 2VTPA 3KC3A 5LMAA 4O0RA 1QMZA 1TQIA 3MW1A 1Y6BA 3OF0A 4MHAA 4BDDA 1QCFA 4K77A 2IO6A 3KXZA 4ZTRA 3CKXA 3MVMA 4GFMA 5FUTA 2VTMA 4IB0A 2JD5A 4AA5A 1FVTA 4O2ZA 3FSFA 2WZJA 4FTUA 4DEIA 4E8AA 4QMQA 3OEZA 3NNUA 4RX5A 4TWPA 4FV9A 4AP7A 3NLBA 3CTJA 1LUFA 3MB7A 3QYZA 5IQBA 4YURA 1W82A 3ZTXA 4X7QA 3DZOA 2VWVA 1Q8TA 4GV1A 4G16A 3W2PA 3NUUA 3GU5A 4QMLA 4EK6A 2F7EE 2XKEA 5ANDA 3OWLA 4TYIA 5BVWA 4CV8A 4LL5A 1OB3A 4G3DA 2GDOA 3SX9A 3RPRA 4M68A 5DYJA 4JT3A 4EHGA 5HLWA 5J9YA 4LRKA 3TNWA 3I0QA 3NR9A 3LFSA 4WT6A 4XBRA 4AACA 5BVEA 2IVUA 3PJ2A 3PWDA 2XIXA 4G17A 4ZTNA 4HJOA 5GZ9A 2CGUA 2O64A 2VAGA 3O2MA 4MEDA 1JSUA 2UZNA 2XK9A 4EOKA 4DGGA 1ATPE 3MH2A 3OCGA 2P3GX 4DEBA 4DH5A 5HBEA 2OF2A 1H27A 2WQNA 3UOLA 5AA8A 4M0YA 4Z9LA 4ANNA 5M07A 2EU9A 4WD5A 4CFWA 2YCRA 5DPVA 1M7QA 3H0YA 2WMSA 3WF7A 1XQZA 4FIIA 4PP9A 4XG9A 2W17A 2ZM3A 1R0EA 3GBZA 4C4GA 2B4SB 1KOBA 3RBWA 2HW7A 4RJ8A 4M97A 4WIHA 3KXNA 4BDIA 5A4TA 1OIQA 4I6HA 5ITAA 2DUVA 5JN2A 4FYNA 5CSHA 2JITA 4I24A 2BRBA 4KA3A 2A4LA 4NEUA 4DLIA 1BUHA 2W05A 3KVXA 4JBOA 3VBVA 4L52A 3VUGA 4QP9A 5BUJA 2CSNA 4ZSEA 4GVAA 3GU4A 1BYGA 3A8XA 2FO0A 3COHA 4TXCA 2HZIA 3FLNC 5LMKC 3P9JA 1OGUA 5EOBA 3O23A 5L6PA 3MTLA 2YIRA 4HVIA 4QTCA 3OUNB 4WG3A 4F0IA 5CXZA 5AV2A 3FI8A 3FKLA 4FV6A 1J1BA 4IM2A 4F0GA 3AC8A 4ZEGA 3O8UA 1IA8A 4FOCA 3IDCA 5EI8A 2IPXA 4OAUC 2YLEA 3QTUA 2YM7A 3BQRA 5AUWA 2QU6A 1R39A 3FDNA 5JRSA 2XRUA 2QR7A 4CXAA 3E88A 3KF4A 4TYGA 4YC8A 3F7WA 3N51A 2Y4IC 4TWCA 2ZV2A 4QMXA 5L6WL 1X8BA 4JBPA 2XNBA 3BWJA 4RA5A 5DBXA 3R7IA 3HKOA 5AIRA 2BTRA 2YFXA 4BGGA 5C8NA 4UB7A 4R3CA 3W2CA 4EH3A 4QQTA 1P4FA 2UZOA 4E7WA 1WAKA 2ACXA 4CRSA 3WI6A 2VWBA 3P0MA 5DIAA 3R30A 4LFIA 4NYEA 2VRXA 1HCKA 2UW8A 4RIXB 2HWPA 2SRCA 2ZMCA 2I0VA 4U42A 3WE8A 1A9UA 2BKZA 2GHLA 2XEZA 3A62A 3C4CA 5FBOA 2QOCA 3E5AA 3EN6A 4Z3VA 5ETCA 3ROYA 3TEIA 4N6YA 4JVGA 3V5PA 4MH7A 4GSBA 3UVQA 3T3UA 1H07A 2YIXA 5JKGA 3NZ0A 5CU2A 3PPKA 1CSNA 3THBA 1UU9A 4YSMA 4I6BA 5IUHA 2PZIA 2R3GA 1Q61A 2PVFA 3PVUA 4F9BA 3P1AA 4CVAA 5L2TA 3F7ZA 4GMYA 4RWJA 2IZRA 4MXYA 4CQEA 3R1YA 3DXQA 3W10A 3HDNA 4I0RA 3O7LB 3DBDA 4LRJA 5GJDA 3TZ9A 4PMPA 2DWBA 1WVXA 4DGLC 3D5VA 3FLYA 5M44A 3LFDA 5GIOE 3IECA 3AC2A 5IA5A 4LGDA 5D1JA 1DM2A 2F7ZE 3LQ5A 3PSDA 4PDYA 3QF9A 2XBAA 3PXFA 4FV3A 4D5HA 3I6WA 4I22A 5C8KA 5CSVA 4Y95A 2ITTA 3OWKA 1R78A 5EHOA 2GMXA 4BTJA 4EOMA 4YZCA 5D10A 4FTQA 3UQCA 2NNWB 4QNAA 2CNVA 3EWHA 1Q3WA 3Q32A 4KBKA 4N0SA 2UZUE 4NW5A 5D7VA 5BMMA 4IAFA 3BPRA 2B53A 3QZHA 1UU7A 4L45A 3DKOA 4IWDA 4X3FA 2PHKA 3R8MA 3T3VA 3TNPC 3PXYA 3UNZA 4CRLA 2VTTA 2PWLA 2QOHA 3KN5A 4BI1A 4DFBA 4KIKA 2NPQA 4FKVA 4U80A 4X2KA 5KO1A 3FV8A 3LJ0A 4DGNA 4YJPA 4O0VA 3OCBA 3V5WA 5HVKA 3BHTA 3ULIA 2OWBA 2EXCX 4XRJA 2R3RA 3AC3A 1ZMVA 3G6HA 1OPKA 4QP3A 2WMWA 5EYDA 4EKLA 3PLSA 1J7LA 3QTQA 5A9UA 2R3PA 3EQRA 4MD9E 1WBPA 3KB7A 1GY3A 3F5PA 3FEGA 4R7HA 4KBAA 3WZUA 1ZLTA 1UNGA 5IQIA 3OTVA 3PIZA 4BWKA 2PVLA 4MD8E 3T9TA 2Y9QA 3BGPA 5LVNA 3BZ3A 3DDPA 5HZNA 4IZAA 2C6EA 3FMJA 4TPTA 3E8DA 4FE2A 2C5NA 4ANQA 3A7JA 5IU2A 3F5UA 2PUPA 4Q9ZA 4EYJA 4DGMA 4PDSA 4IAKA 3NCZA 4W8DA 4GEOA 2PU8A 2C4GA 1WBSA 5JFXA 1SZMA 5CEMA 4F9CA 5IMXA 3OBJA 3JY9A 3G51A 3ALNA 3IK3A 3L9NA 1JKKA 5ETFA 4DCAA 4FTRA 1CM8A 1ERKA 2WEIA 5L8JA 4L01A 1ZYLA 3KF7A 3RCDA 3VVHA 4AGUA 4CQGA 4EHEA 4F6UA 2BIYA 3R7EA 2A2AA 2OW3A 3DK3A 3K3IA 4IEBA 5HVJA 3O51A 1KE5A 1WBNA 3FBVA 3BYOA 1PXMA 4NCTC 4V04A 4W4XA 2XMYA 1OKZA 1YWNA 3RGFA 4DTAA 3LXNA 3VS3A 4FSWA 3EQBA 4WSQA 3PPJA 2QOOA 4U45A 3HL7A 3KEXA 4RC4A 4JIAA 4J99A 4ZSGA 3HV6A 4X3JA 4V0GB 2PMLX 4BBMA 2ZM1A 1U54A 1OKWA 2CMWA 4EH8A 3SG9A 3RCJA 1CKIA 4PTGA 4QOXA 3Q2JA 4DEDA 1REKA 2JKMA 4D2VA 4BDCA 3LM0A 3RK7A 4BF2A 5IH5A 4H1MA 4BDEA 5CEPA 3F3TA 4C4FA 3PA3A 1XKKA 1EH4A 4EKKA 2XEYA 4IANA 4AQCA 1Q5KA 1SVEA 4DLJA 1OECA 3LXLA 2UW3A 2E2BA 4QMOA 4W9XA 2W06A 1Q41A 2W1HA 3O7LD 4JRNA 4ENYA 3S1HA 3DQXA 4FTMA 4BDBA 2B52A 3NSZA 3QTWA 3TNQB 3ATTA 5HE2A 3VQHA 4AW2A 2R0IA 3ZZWA 3IKAA 3ZSHA 4ERWA 5B2LA 3D83A 5HU3A 4QPSA 2EXEA 1Q97A 2X2KA 1JVPP 3KULB 3AD6A 4PDPA 3FZRA 3UG1A 5J7HA 4I4EA 3NIZA 2JKOA 4PQNA 2VZ6A 2QR8A 1GJOA 3QTRA 3LKMA 3R9HA 3DKGA 4E5BA 1KSWA 3PVWA 3G2FA 2XNMA 1U5QA 4QYGA 4TYHA 3NNWA 4FSZA 4L44A 2GSFA 3VULA 4BYIA 2XF0A 4CEGA 5AV4A 4AUAA 5M51A 2I0HA 2WTIA 5FRIA 4O27B 5CANA 3R83A 3MH1A 2VX3A 5ACBC 4DN5A 4D4YA 2BZKB 4IB5A 4BVUA 4TYJA 2GFSA 4NKAA 4UV0A 5TKDA 4H05A 4IM0A 2RFDA 4NM5A 3GOPA 2OXDA 4F63A 2ZJWA 2WMQA 3A4PA 2WB8A 3TACA 4KBCA 2B9JA 2R3NA 4IDVA 4ZS4A 4HCVA 3HLLA 4B9DA 3R01A 4PF4A 4KS8A 4ACCA 2CPKE 2YM5A 5IG1A 1PRYA 5K0KA 4E20A 4EL9A 2OI4X 2V7OA 3EB0A 3R8ZA 4FNWA 3MPMA 3C13A 4N4SA 3UOJA 2CKOA 3I7BA 3P23A 2PUUA 4IQ6A 3HAMA 1PXPA 3R71A 3GCSA 4PRJA 1GNGA 1OPLA 3HUCA 2GCDA 2JDOA 2YM8A 4QTAA 4NSTA 3NUYA 4B6LA 2UZLA 3ITZA 5AMNA 4YTIA 2XNNA 5KHXA 4XV3A 5C27A 3JS2A 3TDWA 3H9OA 5AR5A 3ZH8A 4DBXA 3BE2A 5DG5A 5DGZA 3QZGA 2W9FB 4EOOA 4J97A 4LGHA 3ZRLA 4OT5A 2ZAZA 4AT4A 3PY0A 2X9FA 4Y85A 2QG5A 4LI5A 4UX9A 5DT0A 3DJ5A 3CTQA 3PXKA 5D9HA 5EI2A 2ONLA 4OTFA 4QP2A 4X3FC 5GJGA 5H8GA 3C1XA 5HE0A 2J6MA 2W5BA 3U4WA 4AW5A 4S31A 3P7BA 5M57A 3CY3A 3EQHA 3FI2A 3PY1A 3QKMA 1RJBA 5H3QA 1K9AA 2B1PA 2C47A 2WNTA 4CLJA 1WMKA 3D7TA 3QX2A 4LMNA 4BY9E 3VBWA 2WFYA 3E7VA 3K5UA 3ZUTA 4BCGA 2EWAA 4FKSA 4QQ5A 2W1CA 5FD2A 1Q8WA 4BDKA 1JAMA 2WMRA 4IADA 5IF1A 4J1RA 3QLGA 2WOUA 2C0IA 2BAJA 4ZAUA 3FL4A 4BYJA 4R1YA 5CAOA 1NA7A 4F65A 4ZLZA 5E4HA 4ZZOA 4TN6A 5JFWA 3I0OA 5F94A 2WTDA 3JVSA 4UZHA 5E8SA 4N70A 4FKPA 1MRVA 1YI6A 4YJNA 4BGHA 1O6LA 4FTKA 4E6QA 3PFQA 2XM8A 2C5XA 4PY1A 5AM6A 3MFUA 1MP8A 2QG7A 5FTQA 2CNUA 2B0QA 4ASDA 3QD0A 4EONA 3C5UA 3HMOA 2BAKA 3A99A 1PMVA 3KXGA 4E6CA 5L2WA 3D15A 2X8DA 5HNBA 2PSQA 4XNEA 3GC7A 4BZNA 2PVRA 2C6IA 4YMJA 5AR2A 4PMTA 4DEGA 5EQYA 4XG7A 3TN8A 4EH6A 5GZ8A 3ZONA 5BX0A 5BVOA 4O7YA 5A46A 4CMOA 1BLXA 3E3PA 3KXXA 3U6JA 2FYSA 4DH7A 3UIXA 4DINA 3EHAA 1Q8ZA 4IACA 1H24A 3KRJA 3MS9A 4U9AA 1O6YA 5BYLA 5DR2A 1XBBA 2VTAA 3A2CA 1DI8A 4XG3A 1LR4A 2F7XE 4IM3A 4E4LA 4W8EA 3GU7A 4QP7A 3ZC6A 4YC6A 5IPJA 2XK3A 3QKKA 3GOKA 2OG8A 3AT3A 3AD4A 4ASXA 4M67A 4YJOA 4A9SA 4RQVA 3Q04A 2NRUA 2XKFA 3BRBA 3B2TA 3PG1A 3BLHA 3PXQA 3WIKA 1G5SA 2V0DA 1K2PA 2UVZA 3VAPA 3H0ZA 2HXQA 4IX4A 2BROA 4UWCA 2OIQA 4UXQA 3DFAA 4EH9A 4H36A 2CLXA 5BVDA 2HW6A 2J90A 4IWQA 4LMUA 2VWWA 3SD0A 3DAKA 4GU6A 2C5YA 4G6OA 3GNIB 3VRYA 5HORA 3AC1A 3SRVA 4NIFA 5CAQA 3E63A 4U3ZA 1H01A 4WO5A 2GNJA 3V04A 4JXFA 5AIKA 4MWIA 3FMHA 4OTWA 4PL3A 4ZJVA 2C6OA 2UW5A 4YTHA 3ENHA 2J0LA 3EQPA 5ANGA 3V6RA 4AS0A 3KA0A 5DEWA 2ITVA 4DFZE 3P79A 3HV3A 3RI1A 4JG6A 2O63A 4GK3A 4D4RA 2YLFA 3BHVA 3I79A 4WA9A 3F9NA 5EQEA 5HGIA 1G3NA 3C4XA 4CCUA 3EQFA 2X8EA 5EDRA 5HCXA 3F2AA 4O0WA 4OBOA 4J8MA 3DK6A 3PJ1A 1P5EA 4HGTA 3PZHA 4YPDA 2OJ9A 3DKFA 5IH4A 4IDTA 4YJQA 2VTRA 3TIYA 3VJOA 4MTAA 4OW8A 4EOLA 5JK3A 2C6KA 4ITHA 2BHHA 2ZDUA 2CHLA 3TT0A 5J5SA 4FTJA 3FLSA 4QPAA 4Q9SA 4ARKA 3QWJA 4KABA 2E9UA 4FK6A 4QO9A 5JQ8A 4HPUE 4A4XA 4F70A 1WBVA 5FTOA 3KRLA 1GAGA 3UP7A 4BCQA 4IJ9A 4C4IA 5I9WA 3A61A 4FSYA 4QTEA 5EYMA 4RJ7A 5HG5A 3ZLWA 2ITPA 2WTWA 4G34A 4IX5A 4WNKA 5CU6A 2BKKA 1H08A 4XMOA 3W2OA 5CSPA 5CAPA 4BCPA 4EOSA 4CNHA 5CEQA 3QRJA 4EUTA 2ONLC 1A06A 1G8SA 4BGQA 3B8RA 3D5WA 3HRCA 4F6WA 3I6UA 2CGVA 4JS8A 1MRYA 4GT4A 4F9WA 3FAAA 3U9CA 3C4EA 4ZLYA 2BCJA 5JFSA 2V5QA 2YITA 3TI1A 4C8BA 5C01A 4J98A 3D14A 1UV5A 3HNGA 2W4KA 3LFCA 4F9YA 4I0SA 3QL8A 4C2VA 2XCKA 3DTCA 3GC8A 1YXXA 5EYCA 1FVVA 2P0CA 4JQ7A 4V05A 3ZUVA 3EN7A 3AC5A 4MBJA 4G9CA 4ZIMA 5IA3A 3LQ3A 1OL2A 3UZRA 2PVNA 3C0GA 4FL1A 5EW9A 5BUIA 4EEVA 3MB6A 4U41A 4GH2A 2R3MA 4XLIA 3BV2A 1NVSA 2UW4A 4QP6A 3P7AA 4X2GA 4MQ1A 4PPAA 2BZIB 1RW8A 5DMZA 4KIOA 4ACDA 4CKRA 5IZFA 3KQ7A 3R7UA 4IVBA 3NX8A 3QKLA 1SVGA 3FMLA 4Q5HA 5E91A 3V6SA 5IUGA 4C58A 2CLQA 2AUHA 4ZK5A 2V55A 3IW5A 3MY0A 4W9WA 3QYWA 4M15A 2VWUA 3I1AA 4QMNA 4FEVA 3NDMA 5FWKK 2IVTA 2VU3A 1WVYA 4H58A 4XP2A 4E26A 3SKCA 5KMLA 2IG7A 4IBMA 4HGSA 2IZUA 4PMSA 4MK0A 4O96A 5CI7A 4G3GA 3QAME 5C03A 4AZFA 3CS9A 1XBCA 5KUPA 5EYKA 3EYHA 3PZEA 4O81A 5I9VA 1YXTA 2XRWA 2YISA 3BI6A 4P7EA 4RVMA 5EK7A 3R73A 4S2ZA 3I5ZA 3BV3A 4BTFA 3QCQA 5CWZA 5A54A 4FA2A 2X4FA 2WOTA 4NWMA 2IZSA 3OOGA 5F95A 4MAOA 2I0YA 4FI1A 4F0FA 2X2MA 4XCUA 3ZDUA 4NL0A 4NJDA 2PY3A 4L9IA 1JKLA 5HIEA 5CLPA 1YHSA 2VUWA 4H1JA 5LARA 1FGKA 4FG9A 4FIJA 3R1SA 2W1FA 3GCUA 5EG3A 3TTJA 3BE9A 3UIMA 4I5HA 4J71A 3LFQA 4XYFA 1PJKA 3R1NA 5FG8A 4W4YA 4ZP5A 2ITOA 1DAWA 3AXWA 2IWIA 4K6ZA 4RLKA 4L67A 5HLNA 3C0HA 1OKVA 4O82A 4GFGA 4RIWB 2Y4IB 2AC5A 4RX7A 2JDVA 4K18A 3F3WA 4K9YA 2BHEA 3UYTA 4C35A 5BPYA 5ETAA 1V0PA 2OIBA 4RZVA 4FKWA 4HCTA 4AT3A 4BBEA 4DFYA 5L8KA 5J1VA 3CR0A 3QQUA 4BB4A 5KCVA 2PUNA 4EK8A 2Y0AA 4D5KA 3NGAA 5AV0A 5GNKA 4CMUA 1NT2A 4DFNA 2BRMA 2YA9A 1Q62A 1ZYCA 3BKBA 3D5UA 3DS6A 4JL9A 4FT7A 3DJ6A 2W5HA 1H25A 3PUPA 4DF3A 3NVKI 4BCOA 4ASEA 1PXOA 1PYEA 2XIYA 4D1SA 5E1EA 1H28A 2ZDTA 1UA2A 3QRTA 3RPYA 3ZCLA 4YSJA 5KHWA 5IQCA 3CY2A 3GU6A 3OWPA 4JIKA 4EH2A 4GJ3A 5GHVA 2GHMA 2PMIA 4MBIA 3AOXA 5ANJA 1JKTA 2G15A 3KRXA 3R7VA 3NIEA 4FV0A 3VWAA 4C4HA 4CFFA 4ONAA 4GYGA 2IVVA 3UJGA 4B4LA 2KTYA 3JVRA 5L2SA 2VX1A 3GVUA 3NWWA 3PJ8A 1LPUA 1J3HA 4JG7A 3PVBA 5HX8A 1GZ8A 2C3JA 2VTJA 3G15A 4RC2A 4NTTA 4ZSJA 3E87A 4GK2A 3CQEA 3NUPA 2RIOA 4YBJA 3WARA 2C3KA 4ENXA 2O5KA 4KB8A 3ZRMA 4L6QA 4DEHA 4OT6A 3DV3A 3CGFA 4A9UA 1H1PA 2JKQA 4AG8A 1TKIA 3A7FA 3RK9A 3SC1A 1A48A 1OBGA 2JIUA 1R3CA 1U46A 3IOPA 3I7CA 2IW9A 5HE1A 2W9ZB 4I21A 1YHVA 3REPA 4GG7A 2X6EA 5EQPA 1TVOA 1ZZLA 4O0SA 3DBEA 5I0BA 3C50A 3Q4TA 2QVSE 3G9NA 4F1OA 4DT9A 3LXPA 4H3BA 2CN8A 4PL5A 2OXYA 4HOKA 3W8LA 5HD7A 3F2NA 3EOCA 3NMUF 4K1BA 2ZM4A 2QOKA 3CCNA 2Q0NA 4OUCA 3HMMA 3O8PA 4Y5HA 2RSVA 3QX4A 3Q4UA 3KRWA 3U6HA 3SXRA 3A8WA 3QQGA 3C0IA 3RM6A 2YCFA 1OL5A 3D2KA 4NU1A 4UMUA 2QOQA 3R2YA 5D12A 2WD1A 2ITXA 3F3UA 4FSTA 4EUUA 4FSRA 4JDHA 1M14A 3NAYA 3WYXA 2CKEA 4OGRA 4LUEA 3P08A 4QTBA 2O0UA 4WUAA 4AN3A 3I60A 4R78A 2VO6A 1WBOA 2F4JA 4JRVA 3UVPA 3EMGA 5AR3A 2XNOA 4BTKA 5HG7A 3ZBXA 4WRGA 4EJNA 2FB8A 5LVPA 2WELA 3RAIA 1GZKA 5A4EA 4YP8A 3VS0A 4AGWA 4NCTA 2R3OA 4DH1A 1UKHA 4FNXA 3FC1X 2OH0E 5CS6A 3VS2A 4UWYA 2YERA 2IZTA 1H1QA 4FKOA 4MVFA 2F2CB 4R7BA 3W55A 4XOYA 3UO6A 2IJMA 4BDHA 4DG3E 3PY3A 5JSMA 1PW2A 3ZXZA 5AUTA 5F4NA 5GIPE 3TJCA 3CC6A 5HE3A 3IOKA 2YAKA 3R1QA 4RVTA 4PNKA 3RJCA 3O17A 3TV4A 1NVRA 2XJ1A 5ANOA 3EQGA 2WKMA 2UZBA 4RT7A 1H1WA 2O3PA 4YHJA 2DYLA 4O0TA 3PRFA 3DAEA 1DI9A 3Q9YA 3GCPA 2WPAA 4ZZMA 3BBWA 1IA9A 5CF5A 1L8TA 4XV2A 2OFVA 5C4LA 4DT8A 2ESMA 1M2QA 3R22A 4FVQA 4WHZA 4GRBA 4O0XA 5AP1A 1RE8A 3TKHA 2PVMA 1KE9A 5CNNA 4I1ZA 2JDTA 4JNWA 5BVNA 3E7OA 2R3QA 4D2TA 2LGCA 4IZ5A 3FJQE 3LJ2A 4NJ3A 5HCYA 1B38A 4EYMA 1F5QA 1Q4LA 4TRLA 4GFOA 4Y8DA 4WG5A 4AGCA 3Q53A 3DZQA 3CD3A 4RX8A 2OLCA 2UZDA 3BHHA 4QTDA 3DKCA 3WILA 1ZYSA 3DT1A 2B9IA 1YDRE 3HA8A 5CVGA 4TY1A 5C4KA 1KUTA 2WHBA 5H9BA 3D9VA 2X7OA 4FIFA 3NYVA 3BGQA 4FIHA 3ERKA 4TW9A 3SW4A 2PPQA 4WOVA 2VTNA 3F5XA 5K4IA 3ALOA 3R21A 4BCNA 1GOLA 1IG1A 2WEVA 5DEYA 4EHZA 3PJCA 3QWKA 1YQJA 2Q83A 3ZRKA 2JDRA 2UZWE 3LFFA 4DHFA 2IN6A 2PVYA 2VNWA 3F61A 3HV7A 3FL5A 4ZTLA 1J7IA 5D41A 4ID7A 1GIJA 4E4MA 2CGXA 5EDQA 3DAJA 4JI9A 4AZSA 5HIBA 3AD5A 3CQUA 5M09A 1ZMWA 3UP2A 4FT5A 3ANRA 3R02A 3FKOA 4I20A 2C69A 3OCSA 4FEWA 4B7TA 1P4OA 3AQVA 4D2PA 4U40A 2UW7A 5CTPA 5ANEA 3EFKA 4L7SA 4C3PA 4FKGA 1JOWB 2V62A 3DDQA 4CKJA 1APME 4ZTQA 5HNIX 3FLQA 1MQ4A 4BDAA 4F6SA 4IVAA 1YWVA 3SOAA 3PDTA 2Z7QA 2VGPA 4ZXTA 3TG1A 4NM3A 2YJRA 3COIA 4ZY6A 4I41A 3LCDA 3S0OA 3LCSA 5FM2A 2YACA 3LCOA 4HGLA 3KREA 4MF1A 2GQRA 4PTEA 4D2WA 2YDKA 1VYZA 3JPVA 4M66A 4U7ZA 1UWHA 1CKPA 2X0GA 3HP2A 3I4BA 5FEEA 3ODZX 2RG5A 5FXSA 4DCEA 3EN4A 3HA6A 4IW0A 3NEWA 3PXRA 1ZOEA 3LHJA 4KIKB 5BYZA 3RK5A 4IFGA 3TUDA 5TR6A 3WE4A 4WSYA 4UALA 4XH6A 2PULA 4P4CA 4YJSA 3I81A 3N4VA 4J52A 4KKHA 2E9OA 2OKRA 1JBPE 5HX6A 4HVSA 1PXNA 3DB6A 3V8SA 1YDSE 2NP8A 2H8HA 3U87A 3QXPA 1H8FA 3RINA 2CDZA 4JLCA 1YKRA 4BR3A 3GFWA 4FF8A 2Z7RA 4HYIA 4XJ0A 4D4SA 4L3LA 4QMUA 5HESA 4FZ7A 3MV5A 3B8QA 5CALA 1PMNA 3UNKA 5D7AA 4Z55A 4CT2A 3LMIA 3HV5A 3OW4A 3BBTB 1OM1A 2Z02A 2FSMX 3DJ7A 5AP2A 3M42A 3R9RA 1M17A 2PL0A 4DA5A 5HVYA 3ZEPA 1YRPA 3MVJA 5IEXA 3VUMA 5IQDA 2PVHA 3FZSA 2GTNA 1P2AA 5IA0A 3VW6A 4KIPA 3MTFA 3BIZA 4J7BA 2PE1A 3KMMA 4KSPA 3R7OA 1Q3DA 4ZY5A 4HNFA 3LVPA 4FVRA 1QPJA 4EOJA 3OXZA 5IKWA 3LAUA 3OT3A 5EM5A 3MSSA 4FZ6A 3CD8A 3ZSIA 5CT7A 5B0XA 3VIDA 4BCFA 4E5AX 3H3CA 3QQFA 4FUXA 2JC6A 4IZYA 4EOQA 3V5QA 4IH8A 4MKCA 1V0BA 4PV0A 3MY1A 4FKTA 4YJTA 3ET7A 4U3YA 3LE6A 4Y72A 4D4VA 2WQEA 4ASZA 3LLTA 4V0GA 1U54B 3FXXA 4EC8A 1Z57A 3QTZA 3V01A 2R3HA 4G6LA 4O6EA 5JEBA 4XLVA 5IDNA 2H96A 4A9RA 5AFVA 2E9PA 3DCVA 2P4IA 4ZTSA 3HYHA 2FVDA 3MVLA 4NUSA 5EKOA 3EFJA 4O7WA 4TZRA 1V1KA 2BRGA 2BRHA 1NVQA 4FX3A 4L53A 4ZOGA 3FXZA 3R9NA 4AWIA 2XM9A 3VO3A 5E9EA 1AD5A 4UBAA 4KD1A 4QMZA 4GIIA 5AX3A 4O38A 2XZSA 2WMXA 2UW9A 4BC6A 2UVYA 4MCVA 4BIDA 4RWIA 4IB3A 4TNDA 5DVRA 5FDXA 1W83A 3QC9A 4ITIA 2C68A 4EZ3A 3KULA 4D0XA 1M7NA 2P55A 3DQWA 4DC2A 4O84A 3LMGA 5D11A 4UWBA 3R6XA 4FZDB 1JWHA 4M3QA 4MXZA 4A9TA 2XVDA 3AMBA 3HZTA 4AU8A 2VD5A 4TYHB 5E8UA 2X9EA 3W8QA 3ORXA 3TNHA 3V8TA 3UGCA 2HCKA 5AA9A 2WMAA 2G9XA 4XRLA 5DWRA 3ZEWA 3L1SA 1NW1A 3C5IA 4NZWB 2C0TA 3VS4A 2UW6A 5IMEA 3PWYA 4C4JA 4O1PA 4MD7E 4D9UA 3L9LA 1OZ1A 3RPOA 2WAJA 5BMSA 3IW4A 3PA5A 2GNLA 2QO2A 3QZIA 3ULZA 1YXUA 2EVAA 4L43A 4YGAA 4E6AA 5AUUA 4D58A 5KKRB 1SNXA 5IA4A 2B7AA 3TKUA 3DLSA 3MIAA 3ETAA 1UU8A 2R64A 3MFTA 5A6OA 4ANOA 5E7RA 2EB3A 2KULA 3VS5A 2Y8OA 2ZMDA 1VYWA 3FYKX 2J0KA 3OOMA 3Q52A 3Q3BA 5KBQA 4I6FA 3LPBA 4YJRA 4XV9A 2GNGA 3GT8A 3DA6A 4G3EA 3VBTA 3BX5A 1JQHA 4CZTA 3WF8A 4I93A 4PPCA 1PMEA 5G1XA 2Y4PA 2XYUA 4HVHA 2WTKB 2UZTA 4OLIA 4RFYA 4V01A 3RHKA 2O65A 4P5QA 5DE2A 5AAFA 4BL1A 2XIKA 5CAUA 5E8VA 3UTOA 2VGOA 2QNJA 3PPZA 2YCSA 4JDJA 4DITA 2Z60A 3LOKA 5FBNC 3VRZA 2XP2A 2OH4A 3DPKA 4ERKA 4YNOA 2R7IA 2H9VA 5AWMA 2UVXA 3F5GA 3FY0A 3ACJA 5KMKA 4EH7A 3SGCA 4CZYB 5CAVA 2G2IA 5AR7A 2OJJA 1NXKA 4MNEA 4KSQA 4LOQA 1OL7A 2WTCA 2JDSA 4ALVA 4I5PA 3RZFA 5M4CA 4B8MA 4AX8A 3EFWA 4USEA 3QUPA 5T6KA 1ZRZA 5B2MA 2R5TA 3D7TB 3FQEA 4IX6A 4X6RA 3OY3A 4PMMA 4I4FA 2QO7A 3MH3A 4OTRA 4X2JA 1U5RA 5DLSA 4TKSA 3OWJA 3PG3A 2QLUA
chains in the Genus database with same CATH superfamily
4PX6A 3GI3A 3Q2MA 3O71A 1S9JA 1M2RA 3EZRA 3HEGA 5CQWA 3S4QA 4F08A 2AEGA 3QCYA 2PTKA 3V5LA 1OUYA 3HMPA 3LJ1A 4AZEA 3JXWA 3F88A 4DYMA 1VZOA 3ZSGA 4EI4A 2UUEA 3ZYAA 3IW6A 4GUBA 3DBQA 4J95A 3R00A 4Q2AA 4M0ZA 4O21A 5DHJA 4IJPA 2QO9A 1M52A 1E1XA 4XHKB 3U4UA 4MX9A 4XBUA 5A4QA 4RRVA 4BFMA 4KUJA 3PA4A 5EKNA 3R04A 4DEAA 1P14A 2OICA 2ZV7A 3E8CA 1B39A 2XJ2A 5AP0A 4ZTHA 3W32A 4APCA 3RM7A 3DOGA 3OT8A 4BCMA 4JDIA 5LOHA 4EQMA 1WCCA 1WBWA 4LYNA 5JGAA 5AAEA 3SOCA 2QONA 4LGGA 2QI8A 2GNFA 3ZFYA 3G9LX 5CY3A 3ATSA 3CTHA 3DK7A 3GQLA 3QCXA 5HNGA 4M84A 4QYHA 4Z16A 2VTQA 3UIBA 2P2HA 2YWPA 3WYYA 5KMNA 1XH9A 2ETMA 3E64A 4U97A 3BLRA 3DNDA 4JG8A 3QHWA 5L2QA 3I5NA 4BRXA 3Q96A 5HO8A 2FGIA 3SVVA 2YDIA 5CVHA 4N6ZA 4QQCA 1OKYA 1RQQA 3P4KA 2C1AA 4C2WA 3AG9A 3S2PA 1JSVA 3Q6WA 5E90A 4AW1A 4UMQA 4CKIA 3BQCA 4IWPA 3NW7A 5E1SA 4NFMA 4HVDA 4JQEA 1XH4A 4ZSAA 3IG7A 1Z9XA 3HP5A 1YW2A 3GFEA 4W4VA 3EIDA 3VF8A 4M69A 5L6OA 3LFBA 3EN9A 4CYIA 1IAHA 2ETKA 2QOBA 1OL1A 2BIKB 1Y57A 4CFXA 2R3JA 3UG2A 3NNVA 3FXWA 4HZRA 2E9NA 2J5FA 3FMKA 3F69A 3OHTA 3DFCB 5K4JA 2VTIA 5E8XA 4AXDA 4G1WA 4O6LA 1OITA 3F82A 3ODYX 5IDPA 4GJ2A 1F3MC 4AAYA 3WZDA 4TL0A 2X4ZA 3R7YA 4USDA 4M7IA 4XX9A 3MESA 1JKSA 5HIDA 5J5TA 1UVRA 1LEWA 2I7QA 3H9FA 3M2WA 4QMPA 2OJFE 2VWXA 5CF8A 1VEBA 1MRUA 4XV1A 3HECA 4F09A 5DA3A 3E92A 3SXFA 3ZLSA 3BELA 2OSCA 5J79A 3TWJA 3UDZA 5K3YA 1E9HA 2HK5A 3S3IA 4BIEA 3N4TA 5JH6A 4ZS0A 2FA2A 2YCQA 3PP0A 4QD6A 4FC0A 4O86A 4EC9A 3HRFA 2F57A 5DRBA 2OGVA 2VO7A 4N57A 2HELA 3NVMB 1OMWA 3ORIA 1BI7A 4EBWA 2OZAB 2WIPA 4U0IA 5M4FA 5LWNA 2VV9A 4WNOA 4ALWA 4YTCA 3DXPA 3HX4A 3AKKA 1WBTA 2NO3A 4G6NA 3TL8A 1QL6A 3WIGA 3F6XA 3VW8A 3WZKA 2BILB 2ITYA 4HCUA 3ZDIA 2GHGA 1PMUA 2V7AA 3ZHPC 4Z7HA 3C4ZA 3O96A 4FNZA 4GW8A 3Q60A 4BIBA 4PUZA 4QMWA 4RG0A 3MDYA 3LCTA 3DLZA 1J1CA 1OIRA 1FBNA 4HYHA 2G2HA 4YPSA 5HQ0A 3TZ7A 4NK9A 5J9ZA 3P5KA 4PP7A 3IGGA 5AUZA 2ERZE 2EB2A 4CGAA 4MXOA 3LQ8A 2W1ZA 1GZOA 3QTSA 4UMRA 4U6RA 3QUEA 3R28A 4U8ZA 4F9AA 4BICA 2PVJA 4FTNA 4ZMFA 4MNFA 1FINA 2BZHB 4YZNA 4P90A 4B0GA 3G6GA 5IA1A 4RC3A 2X1NA 3ZO4A 4ANSA 5IQGA 3VS6A 3UC3A 2RFEA 4ZLOA 5HTCA 4YR8A 2A1AB 5JRQA 3OG7A 3TZMA 3Q4ZA 2VNYA 2C3IB 1BL7A 1CMKE 4I6LA 3A7GA 4OAVB 4D28A 3EL8A 4EK4A 2O8YA 4PPBA 4EWHA 2X7FA 3MFRA 3NYNA 5HEZA 1TZDA 2QODA 3U8WA 4FZAB 3BHUA 3DBCA 2NRYA 4AA0A 4TWNA 1ZYJA 3U51A 1K3AA 5J9LA 2J7TA 3AT4A 3AMAA 1BI8A 4BDGA 2F49A 5G6VA 5HCZA 2YM4A 3EZVA 4YUQA 1HOWA 5AM7A 4FZFB 2QOFA 4GVJA 3UODA 4G31A 2UZVA 3UYSA 2GS2A 2HIWA 2JLDA 2WQBA 2XA4A 3FI4A 4FTCA 5TO8A 3E93A 4P2KA 4ACGA 3U6IA 2XALA 3BU5A 5EM7A 4D9TA 5L4QA 5FQDC 3BYUA 4LUDA 4RIYA 3ZM9A 5IEYA 4FK3A 4JOAA 3GUBA 4JR3A 2I0EA 5EHLA 4FSNA 3FUPA 5FXQA 2GTMA 5J1WA 2WIHA 2PMNX 4YZBA 5EI6A 4DFXE 3MGYA 5J7BA 4A4LA 4DTKA 4F99A 3FWQA 3T9IA 3MH0A 5AP7A 4S33A 1ST4A 4WBBB 1T45A 1KV2A 3MPAA 4I92A 1H1RA 3UNJA 4TTHB 1KWPA 2Y7JA 4XOZA 5F1ZA 5KMIA 3VNTA 4UYNA 5FDPA 1IAJA 4AN2A 3FY2A 4LL0A 4RGJA 3D2IA 3NCGA 5FGKA 1S9IA 1SYKA 4QMMA 4EBVA 1PF8A 2B55A 3OY1A 2HZNA 5JGDA 2XAOA 5AUXA 3L8SA 1GZNA 4APPA 4USFA 3SHEA 4IFCA 2AYPA 2DS1A 1PXLA 3UZPA 3VUHA 1J7UA 3V8WA 3ZU7A 3L8VA 5HTBA 4GT5A 3L9PA 4X0MA 1CKJA 5CEOA 3LW0A 4RIWA 3V5TA 4HZSA 3TUBA 3FKNA 4C4EA 1BX6A 4LRMA 5M55A 5CX9A 2OFUA 4HW7A 4BJJA 4O0UA 3ENMA 4H39A 4QPMA 4WBOA 4EH5A 2WGJA 3IONA 3QTIA 3IQ7A 4X2FA 4DHJA 3G0FA 4RA4A 1W0XC 1BKXA 2OK1A 3G0EA 4UYAA 4LDTA 1Q99A 2R7BA 1PXKA 1XJDA 3W2SA 3UPZA 3ZO1A 2VTOA 2XUUA 4D1XA 3CLYA 1ZARA 3FQSA 3M1SA 3PSCA 2I1MA 3FC2A 1Q8YA 1YXVA 1YHWA 2BALA 3GCQA 3BEGA 4BI0A 4E1ZA 2YZLA 2CN5A 4E4NA 3WF9A 1PHKA 1YOLA 3KGAA 5AV3A 3UIUA 3QGWA 1G8AA 1CDKA 3OUKA 1OL6A 3EKNA 3EH9A 2GPHA 3E62A 3B2WA 3PJ3A 4IZ7A 4KIQA 5C1QB 3UO5A 4D0WA 3AC4A 3C4FA 3K5VA 2BZJA 2YAAA 4OTHA 2OZOA 3FI3A 3ORKA 4FV5A 4U5JA 5ACKA 3GENA 3KVWA 5E8WA 4A9YA 1Q8UA 3Q4CA 4FSQA 4IMYA 1QPDA 3DB8A 3RTPA 2V22A 3II5A 1YI4A 3PXZA 1Y8GA 4I0TA 4YZ9A 5CU4A 3S95A 2OBJA 3VBQA 3VS7A 2A19B 2I40A 2QURA 5HLPA 4F1MA 4E4XA 4RPVA 2QQ7A 4FICA 4FTIA 4GKIA 4EH4A 3E3BX 2UZEA 1OI9A 3R63A 2UV2A 3PSBA 1SNUA 5KZIA 3AGMA 2R3LA 3BGZA 5CEKA 1ZAOA 3ZS5A 1SM2A 2PVKA 4Y5QA 5DT3A 3RNIA 3WBLA 1IEPA 4KINA 1FPUA 3D4QA 4M12A 2Y6MA 3D94A 3ZZEA 2YZAA 3C7QA 4LV5A 4RFZA 3RP9A 5KMMA 3QD4A 3LMHA 4FT3A 4IC7A 5HICA 3W2RA 5CT0A 3ELJA 2REIA 4YU2A 4F64A 2B9FA 2HY0A 4QNYA 4CYJA 4X21A 3ZOSA 4JBQA 3BYSA 3RWQA 1SMHA 5LCKA 1YWRA 4QYFA 5F9EA 4FBXA 4FT9A 2AQXA 5DI1A 1PKGA 4RQKA 4RX9A 2VTSA 1UU3A 4RSSA 2JBPA 2VTLA 4C37A 5K9IA 5L2IA 4L68A 5EDPA 3VF9A 4EK3A 4GG5A 4FTOA 4FKQA 4FSMA 3RZBA 3QTXA 4JMQA 3RAWA 4JJRA 1ZY4A 1FQ1B 5CYIA 3ZO3A 2YN8A 4R7IA 3RAHA 5L3AA 4OBPA 4MXXA 2W1IA 3QQJA 1VJYA 5BYYA 4RFMA 3COMA 1GIHA 4AFJA 4UZDA 4S30A 4YNEA 5JFVA 3OP5A 4BCKA 5LWMA 4JX3A 4FIGA 4QRCA 4IAAA 3MA3A 4WUNA 3GEQA 3BLQA 5F20A 3UBDA 4O7ZA 3TDVA 4XG8A 4BCHA 4CSVA 4CZUA 4I5CA 5AP3A 3TIZA 3QQLA 1V0OA 2OO8X 4U79A 3VC4A 3VQUA 3RPVA 4OBQA 4RVLA 4WNMA 3BLAA 4DG2E 3CJFA 3LIJA 4MF0A 4RWLA 2DQ7X 4J8NA 2YJSA 2J9MA 1TQMA 3BL7A 5GJFA 3SG8A 3H9RA 3UC4A 3Q9WA 4DAWA 4Z7GA 1DS5A 1W84A 4BHNA 2QHMA 5B2KA 5I9YA 2X8IA 4ZTMA 4FL2A 2UW0A 4ITJA 3NFGB 4K2RA 1OIUA 3MFSA 4KKEA 5IISA 3QD3A 3W1FA 2CJMA 3DU8A 5JZNA 3V3VA 1OBDA 2BR1A 1KE7A 4NW6A 1GIIA 4HPTE 4U81A 4F7NA 1WVWA 4F7SA 5IQFA 4R8QA 4FUYA 4RJ5A 4E3CA 4QEBA 1O6KA 2YWVA 2OF4A 4KAOA 3NPCA 4IX3A 1XBAA 1AGWA 2VO3A 4A07A 4FKIA 4GU9A 5K5XA 1HCLA 3A4OX 3S00A 3FMEA 3QRKA 2XJ0A 5HG9A 4FV1A 2XAMA 4YO6A 3NW6A 3ZC5A 5BQ0A 5BUEA 3RMFA 1DAYA 5KMOA 2YIYA 5FM3A 3IO7A 3ORPA 3EQCA 5JMSA 4J96A 4D55A 3OC1A 3EYGA 5TOZA 5HI2A 2YHVA 3TM0A 4NH1A 4RIXA 3HGKA 2GNIA 5CF4A 2J51A 4G5JA 2Z7LA 3WZEA 4F1TA 5IQEA 3MA6A 4EQUA 2WQMA 2OJGA 1NY3A 5AP5A 2R3KA 5AP4A 4G9RA 3W0QA 4HYUA 5FEDA 3TTIA 4LV7A 5AJQA 3HDMA 3NW5A 3R2BA 5H8EA 2BTSA 3FMDA 2ZVAA 1LP4A 3VBYA 2WU6A 1U4DA 5HBJA 2WMTA 1UNHA 4TYEA 2YM3A 3W33A 2AC3A 3JR1A 3R9OA 4QMYA 4FIEA 3EL7A 3VUTA 3FLZA 2PZRA 3MJ1A 3ZM4A 3Q9XA 5M4IA 3BL9A 4AFEA 1I44A 2X7GA 4BDJA 1BMKA 3WF6A 4IAZA 4U44A 2HYYA 3LFNA 2XK4A 2O2UA 3A7HA 3W2QA 5K5NA 3U55A 3EKKA 2HOGA 2OJIA 4BWXA 3W16A 2OU7A 3SXSA 3BU6A 2HZ4A 5EOLA 1STCE 3KU2A 4G5PA 4C33A 4C62A 3UZTA 4CCBA 3QALE 1XHAA 3ORMA 3ZXTA 2G1TA 4EHVA 3KCFA 4EORA 2IW6A 3NUXA 1IRKA 2W4OA 3QA0A 4CTCA 4FV7A 2R0UA 4X3FB 1FVRA 3LM5A 3V5JA 5H2UA 3GB2A 3PIYA 3OZ6A 1JPAA 2GFCA 2JIVA 3C4WA 3QCSA 3VN9A 5HO6A 5HD4A 2C0OA 4R77A 3H30A 4G2FA 3VUDA 4FG7A 3RVGA 1Y91A 3FPQA 4ACHA 1KV1A 3TNIA 3A60A 4QMVA 2XNGA 2RGPA 2EXMA 1H0VA 2CNQA 4TT7A 3KMWA 4C3RA 3GP0A 5IA2A 2Z8CA 3SQQA 4RZWA 3OEFX 3EQIA 2BMCA 1UNLA 4WNPA 3QC4A 5JZJA 2GU8A 3F3ZA 5A3XA 4RMZA 3PP1A 2WTVA 3F3VA 5CSWA 4UMTA 2VN9A 4DH3A 3POOA 4K8AA 3KRRA 5LCJA 3LFAA 4A06A 4TWOA 4OTPA 4JAJA 3Q5ZA 4O83A 4CV9A 2JAVA 5EFQA 2OXXA 1B6CB 3EN5A 4EZ5A 5KMJA 4GCJA 3U54A 4XG6A 3NYXA 1Q24A 5CSXA 4IAIA 2C3LA 4FKRA 5EW8A 4BCIA 2XNPA 3D0EA 3AGLA 1W7HA 4OR5A 4E5WA 2JFMA 5J8IA 1R0PA 2G2FA 2RFSA 3TUCA 4E73A 1XH7A 3ORNA 3SLSA 3VUKA 2GS7A 2PK9A 4BZOA 3R7GA 2R2PA 3LXKA 5FP6A 3ZFXA 4IIRA 4M13A 5CU0A 4L42A 3ZFMA 3R8UA 4AAAA 2W1GA 3POZA 3TJDA 4O7VA 3TV6A 4EZ7A 4CT1A 1QPEA 3HMNA 4M8TA 3KXHA 3R8PA 2Z7SA 5I9XA 4C57A 5LXMA 4FKJA 4Y46A 2QOIA 3WZJA 2YM6A 2R9SA 2P33A 4K0YA 3IDBA 5ANKA 2YDJA 4EOPA 3FPMA 4FR4A 4QYYA 3VJNA 4GL9A 3EJ1A 2XYNA 4FTAA 4X2NA 2HENA 1AQ1A 4AOTA 2WTJA 4B8LA 3FLWA 4C34A 4FV2A 3SV0A 4FMQA 3GQIA 4C38A 4HYSA 4AOIA 3CPBA 1JSTA 3OFMA 4KRCA 5I9ZA 4C3FA 4KWPA 3PLAE 5DRDA 1PXIA 3F2RA 3AKLA 4I5MA 1YOMA 1UWJA 4DFUA 4FV8A 5I3RA 4JX7A 2X81A 2C6MA 3BHYA 2YIQA 3OTUA 4YJUA 5DFPA 3WOWA 4AOJA 4O1OA 5M08A 5AUVA 2QOLA 4RJ3A 5HTIA 5HU9A 4BZDA 3NAXA 4PWNA 5HG8A 1W8CA 4YBKA 5ICPA 3AT2A 5HOAA 5J95A 4CTBA 2QKRA 5EHYA 5A14A 4YJVA 4C61A 3ZLXA 2WQOA 4UXLA 5HBHA 4ANLA 2I6LA 4XG2A 4GKHA 2PZYA 2CKQA 2XK7A 3GCVA 2ITZA 4IAYA 3NUAA 1MQBA 2C6TA 3IW7A 4FG8A 2IVSA 4NM7A 4XEYA 1L3RE 4ZJJA 2QD9A 3TKIA 3KFAA 4RLLA 4KNBA 2C1BA 5KBRA 2W99B 4WRSA 3L9MA 4CLIA 3IDPA 4UY9A 2VWZA 4NKSA 4GT3A 5E8ZA 5HO7A 5M53A 2VO0A 4YTFA 3CQWA 3RPSA 2YEXA 4O7RA 4R5SA 3COKA 2VX0A 3PTGA 3MIYA 4DTBA 1FGIA 5JQ5A 3IS5A 2ITNA 2B9HA 2QC6A 5AX9A 1URCA 3SA0A 4AN9A 3NNXA 5EH0A 1H0WA 4YHFA 3ACKA 3FE3A 3QA8A 2W1DA 4QP4A 1E1VA 3ANQA 4I3ZA 4FNYA 4MYGA 5ETIA 3JY0A 5JGBA 1PKDA 1YVJA 4L3PA 2W0JA 3UOHA 3VUIA 3QHRA 3UVRA 3DXNA 4ZY4A 3ZMMA 3PRIA 5DT4A 4GIHA 4IC8A 5LQFA 3OCTA 3GC0A 4RWKA 1ZYDA 1FMKA 3BEAA 3OBGA 1KE8A 1G8JA 4O7NA 2QHNA 3H4JA 5FTGA 2J2IB 3KK8A 4IHPA 3LFEA 3BU3A 3KCKA 5AR4A 5IH6A 3HUBA 4MNEB 5E8TA 1ST0A 4XP3A 3UMXA 2FSOX 4F4PA 4H3QA 4CD0A 4II5A 4XP0A 4ZZNA 3G5DA 3Q6UA 4AZVA 1W98A 3ORTA 3L8PA 1OVEA 5CQUA 3EQDA 4DDIA 4L8MA 2W5AA 3L8XA 3TXOA 3QZFA 4QP8A 4AE9A 4HGEA 3PIXA 4AZWA 4YO4A 1OUKA 4WG4A 3FZOA 4FGBA 2PE2A 2C5OA 5DR9A 1W2DA 3HMIA 2IW8A 4KRDA 2PE0A 2IEWA 4ANMA 4C7TA 3G33A 4XS2A 4FL3A 2EUFB 1QPCA 3UMWA 5LJJA 4D1ZA 2PYWA 2ZV8A 4ANBA 4QDVA 4QP1A 5EW3A 2ETRA 2XNEA 4IB1A 3E8NA 4DG0E 2QLQA 3NRMA 3KY2A 4RJ6A 4CG8A 2WO6A 3DY7A 2FSTX 1FOTA 1YI3A 4PDOA 5C8MA 4JR7A 2B54A 1XWSA 3MJ2A 3P78A 4R3RA 4OTDA 1REJA 2XKCA 3ZBFA 2RL5A 4WKQA 4BKJA 3ID6C 5CENA 2W96B 4CFVA 4QQJA 3R8LA 3OXTA 4S34A 1IASA 3OW3A 1WZYA 4CFUA 4IE9A 4R5YA 4RVKA 5CI6A 3BYMA 4PL4A 3CBLA 4ALUA 1JNKA 4EQCA 4JQ8A 4QYEA 2LAVA 3BWFA 2RFNA 2WU7A 4I6QA 4LOPA 3RHXA 3QGYA 2ERKA 4C0TA 3VS1A 3LLAA 2GQGA 2PZPA 3HAVA 2WXVA 4MXCA 5KZ0A 3QBNA 1OPJA 5BVFA 3Q9ZA 2XKDA 4CFNA 2VTHA 4TNBA 4O7SA 5FXRA 2JEDA 1KE6A 5T3QA 3UPXA 3GGFA 5IUIA 4A4OA 4E93A 4YLKA 1KOAA 1YOJA 4FT0A 5I9UA 4EWQA 1IR3A 5I4NA 4G3FA 1ZOGA 5M4UA 3RWPA 3O50A 5CU3A 5FLFA 3KL8A 4G3CA 1LEZA 2W4JA 4L7FA 3OROA 3DGKA 2ZB0A 4PTCA 4R6VA 3KMUA 3SRVB 4M14A 2CCIA 3H10A 3AMYA 4NIFB 3IPHA 4LOOA 5J87A 3TZ8A 5IEVA 3MN3A 2XH5A 3P86A 3QFVA 5DH3A 2HAKA 3OMVA 4O22A 4LM5A 4ACMA 4M69B 3VONA 4Y83A 3V51A 4C36A 1H1SA 3OXIA 3CEKA 3VHKA 5A4LA 2BVAA 3VHEA 3ZO2A 5K0XA 3RNYA 4MWHA 2QU5A 5A4CA 5GINE 2H34A 1ZY5A 2C6LA 4NTSA 4FODA 2RF9A 5L8LA 4FV4A 4IWOA 3O8TA 4O7TA 2J4ZA 3DBFA 2Z2WA 5GZAA 3C9WA 3NYOA 3C51A 3RAKA 3FYJX 2F9GA 3JYAA 4BDFA 1YXSA 1UKIA 3MY5A 3MYGA 3DNEA 4GUEA 4GS6A 4X6QC 5CASA 1TQPA 2ZV9A 4LQMA 2YABA 5I5ZA 1ZMUA 5CZIA 3QRUA 2JIIA 4CG9A 1MUOA 4UMPA 2BDWA 2PMOX 4MXAA 1G8KA 3JUHA 3CIKA 3K3JA 3U9NA 3ORZA 3NUNA 4KS7A 2XB7A 5DN3A 5AAGA 5KKRC 2J0IA 2VWYA 4QMTA 5BVKA 4FEXA 2BFXA 4ZSLA 2XBJA 3FMNA 1Y6AA 3R0TA 4R1VA 4K11A 3CJGA 5DR6A 4UN0C 2PUIA 4I94A 2QKWB 3MVHA 3KKVA 2P2IA 4BTMA 3FZ1A 3SDJA 4PNIA 4GK4A 2A0CX 4FSUA 4LV8A 4AGDA 2Q0BA 2OZAA 4D2RA 1XO2B 4BCJA 2XIRA 2CKPA 2JGZA 1JLUE 3PVGA 4BHZA 4L46A 4YLLA 5E8YA 3MI9A 1H4LA 2A27A 2QCSA 3D5XA 2WTKC 4DEEA 2BRNA 2GQSA 2C5VA 2XK6A 3QQHA 5IQAA 2ZOQA 3KXMA 2FUMA 3ORLA 4RBLA 1FMOE 5CNOA 2JFLA 2W7XA 1R1WA 4QDEA 4MBLA 3ZUUA 4W4WA 3QQKA 3UOKA 3A7IA 4JBVA 3VBXA 4CMTA 2F2UA 4Q5EA 3RKBA 2G01A 4DE4A 4ZMEA 2WMBA 2RKUA 3RALA 3OD6X 3QRIA 3O0GA 4EJ7A 2JAMA 4AW0A 2GS6A 5AEPA 2E9VA 3BCEA 2ZB1A 3SW7A 5ANIA 2Y6OA 3CXWA 2C6DA 4JAIA 2X39A 1XH5A 3N4UA 3QXOA 4QT1A 5T68A 4BN1A 5JT2A 2J0MB 5FP5A 3EFLA 4B99A 2WMVA 2FSLX 3KN6A 4AA4A 2VWIA 4FEUA 1WFCA 4L00A 3LCKA 2JBOA 3NUSA 4J53A 4L3JA 3UQGA 5DNRA 5A6NA 4NM0A 1I09A 4F7LA 1O9UA 4QMSA 3HV4A 3K2LA 3W18A 3CP9A 4ZJIA 4EOIA 5TF9A 1ND4A 4XUFA 4DBNA 2RG6A 2BDFA 1ZZ2A 4FTTA 5HHWA 4BI2A 1PXJA 4FGRA 4BWPA 2WMUA 3UE4A 3WF5A 2J5EA 2XK8A 3MBLA 4JDKA 4IVCA 2X2LA 4FOBA 4RJ4A 4E6DA 2J0JA 5CZHA 4P5ZA 5LVLA 4CFMA 2IF8A 4O0YA 4MQ2A 5E92A 1CTPE 3R9DA 2CCHA 3UO4A 4I23A 5C26A 4Y73A 2C30A 1XH8A 1URWA 1U59A 1YDTE 4O91A 5CVFA 4H3PA 5KE0A 1ZOHA 3SAYA 2CGWA 1PYXA 2ZYBA 4YC3A 3CE3A 2HY81 3D7ZA 3FHRA 4OTGA 3IW8A 4RIYB 1Z5MA 3R8VA 5M06A 4FTLA 3QD2B 5H8BA 4AE6A 3FHIA 2BDJA 4S32A 2HZ0A 3CKWA 5B7VA 4IXPA 1XH6A 4NFNA 3CPCA 4HVGA 4FKUA 3ROCA 4R3PA 5LMKA 3ZLYA 2ITUA 4F78A 3OVVA 3QUDA 3NS9A 1VR2A 1W2FA 4YHTA 5AADA 4O7LA 1ZWSA 4F7JA 2X6DA 2YIWA 1F0QA 3DTWA 3PE1A 4FVPA 5FEQA 1ZXEA 2BPMA 5EM8A 3GC9A 3HRBA 2GNHA 3LZBA 4OTIA 2BUJA 1BL6A 2HWOA 4BKZA 3PYYA 4OTQA 4RIOA 3T8OA 1J91A 3QLFA 5I3OA 5TE0A 3CGOA 4AF3A 1M2PA 3PE2A 2HXLA 4DHZA 4O2PA 3G90X 3P7CA 3BYVA 5M56A 4DH8A 3MPTA 3FZTA 5LVOA 5BV3A 3FMMA 2OIDA 2PZ5A 3MWUA 4FKLA 5DOSA 3TV7A 4C59A 3HVCA 1SVHA 4AXAA 5KNJA 4NT4A 5CXHA 2JKKA 4LG4A 1XR1A 2ITWA 4A7CA 4YZDA 2R3FA 5TT7A 3K54A 2XS0A 4UEUA 5HKMA 5KX8A 4DHIB 5IQHA 2XCHA 1H00A 3GXLA 3UDBA 4EK5A 2H6DA 4BBFA 4DGOA 4BKYA 3TCPA 1Y8YA 4ORKA 3OS3A 4KKGA 4K33A 2R3IA 4AZTA 2J50A 3N9XA 3UQFA 1H26A 1T46A 3M11A 4D2SA 5LMBA 3Q5IA 4IVDA 1RDQE 5AUYA 4FEQA 5AV1A 5CF6A 2BAQA 2W1EA 4U43A 4YZMA 5C9CA 1PY5A 4HNIA 3GU8A 5AP6A 2XIZA 3IGOA 5BNJA 3QU0A 2BFYA 4FYOA 2ITQA 4AT5A 3CSVA 3FZPA 5EM6A 5LVMA 1W2CA 2R4BA 3KK9A 4GYIA 3FQHA 3FSKA 4XG4A 3F66A 2FH9A 3E8EA 4DFLA 4YLJA 5AR8A 1OIYA 5CEIA 4C02A 2VTPA 3KC3A 5LMAA 4O0RA 1QMZA 1TQIA 3MW1A 1Y6BA 3OF0A 4MHAA 4BDDA 1QCFA 4K77A 3P5JC 2IO6A 3KXZA 4ZTRA 3CKXA 3MVMA 4GFMA 5FUTA 2VTMA 4IB0A 2JD5A 4DDGA 4AA5A 1FVTA 4O2ZA 3FSFA 2WZJA 4FTUA 4DEIA 4E8AA 4QMQA 3OEZA 3NNUA 4RX5A 4TWPA 4FV9A 4AP7A 3NLBA 3CTJA 3W0OA 1LUFA 3MB7A 3QYZA 5IQBA 4YURA 1W82A 3ZTXA 4X7QA 3DZOA 2VWVA 1Q8TA 4GV1A 4G16A 3W2PA 3NUUA 3GU5A 4QMLA 4EK6A 2F7EE 2XKEA 5ANDA 3OWLA 4TYIA 5BVWA 4CV8A 4LL5A 1OB3A 4G3DA 2GDOA 3SX9A 3RPRA 4M68A 5DYJA 4JT3A 4EHGA 5HLWA 4O4CA 4LRKA 3TNWA 5J9YA 3I0QA 3NR9A 3LFSA 4WT6A 4XBRA 4AACA 5BVEA 2IVUA 3PJ2A 3PWDA 2XIXA 4G17A 3KIOC 4ZTNA 4HJOA 5GZ9A 2CGUA 2O64A 2VAGA 3O2MA 4MEDA 1JSUA 2UZNA 2XK9A 4EOKA 4DGGA 1ATPE 3MH2A 3OCGA 2P3GX 4DEBA 4DH5A 5HBEA 2OF2A 1H27A 2WQNA 3UOLA 5AA8A 4M0YA 4Z9LA 4ANNA 5M07A 2EU9A 4WD5A 4CFWA 2YCRA 5DPVA 1M7QA 3H0YA 2WMSA 3WF7A 1XQZA 4FIIA 4PP9A 4XG9A 2W17A 2ZM3A 1R0EA 3GBZA 4C4GA 2B4SB 1KOBA 3RBWA 2HW7A 4RJ8A 4M97A 4WIHA 3KXNA 4BDIA 5A4TA 1OIQA 4I6HA 5ITAA 2DUVA 5JN2A 4FYNA 5CSHA 2JITA 4I24A 2BRBA 4KA3A 2A4LA 4NEUA 4DLIA 1BUHA 2W05A 3KVXA 4JBOA 3VBVA 4L52A 3VUGA 4QP9A 5BUJA 2CSNA 4ZSEA 4GVAA