4QMZA

Mst3 in complex with sunitinib
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
287
structure length
286
Chain Sequence
MQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE 24
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 100
structure length 286
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qmzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qmzA01
4MD8E 4W9XA 5IPJA 3FV8A 3G6GA 1H1QA 3OZ6A 3UIXA 3R21A 1OL5A 1PYEA 3EFJA 4JIKA 3ULIA 2UZNA 4FSNA 5EYMA 2W1IA 4CFNA 1PMUA 4K2RA 4RWLA 3QCYA 4XLVA 3R6XA 4O0SA 2X2MA 1CKPA 4TN6A 4BDBA 2VWYA 2VTHA 4JDIA 2JEDA 2Z7QA 3HMIA 4FNWA 3P86A 4O83A 1Q99A 2QHMA 1UU9A 4UXLA 4LUDA 2Y6MA 3GUBA 4O0WA 1JKTA 2REIA 2OI4X 4USDA 1Q3DA 2X8DA 3SLSA 2YM3A 3I6WA 2Y9QA 2CMWA 4Q9ZA 3R8LA 2OFVA 2F7EE 4GT5A 4TPTA 4ERWA 3IQ7A 3ZFXA 5M4UA 3AC1A 4PMMA 4E4MA 1OMWA 3FLNC 3LCKA 4GJ2A 3OWKA 3O50A 5IEVA 4NTSA 3HEGA 3UIBA 2C6KA 1YXVA 4DH1A 5HZNA 4GKHA 3QZFA 5J9LA 3QX2A 3F5PA 5I9ZA 2WTWA 1IA8A 4BDGA 5LMKA 2BZIB 2HZNA 2G9XA 3FXZA 4JRNA 2V55A 3DAJA 3GB2A 3L9LA 4IM2A 5EYKA 3UBDA 4YJQA 4OTQA 4TWOA 3BYMA 4KABA 3QX4A 4R1VA 3ZO3A 2PK9A 4A9YA 4DINA 5BUIA 3H0ZA 2OXYA 5BVNA 3KFAA 3ALNA 4NJ3A 2QLQA 3EN4A 4O27B 4IDVA 2GHMA 5A4CA 2GTNA 1PJKA 5BYLA 3Q52A 4BGGA 4G2FA 5AP4A 2QOHA 1UV5A 4KBAA 1PW2A 4GVAA 3BGZA 4YLLA 3KMWA 2BFYA 3EN9A 4L68A 4M12A 4FEVA 1F5QA 1PF8A 2XBJA 3EFWA 3HMPA 1H07A 4FT3A 4L8MA 3ORZA 4C62A 4EQUA 1FBNA 2Z60A 5IEXA 5HNIX 2XNPA 5E8VA 2X81A 4NJDA 3VUHA 4L6QA 1IR3A 4X0MA 4EKKA 3KA0A 4XG2A 5BVEA 4TXCA 2H8HA 4IHPA 3KK8A 2X7FA 1GZNA 3VVHA 2PMOX 3RPRA 3PJ3A 3R8PA 2XK4A 2XVDA 4D2WA 3QLFA 4LGDA 3EFKA 2ZB1A 5CZIA 2J0IA 2R7IA 1XH6A 1XO2B 2QOOA 3QTQA 4I5HA 3R9RA 3GI3A 4DFXE 3LJ2A 1IEPA 4QMVA 3RPSA 3ZM9A 4B9DA 2HY81 3KB7A 3TZ7A 1YXUA 3DK7A 5AJQA 2VWVA 4NK9A 3NIZA 5DWRA 4BGQA 1H1WA 2XNBA 2X7GA 3LVPA 3ZM4A 4RJ3A 3WILA 2EXEA 3A7HA 1XHAA 2DYLA 4CFWA 4M67A 4FOCA 4FTMA 4MXCA 4IQ6A 2V7OA 4ACHA 4FKPA 3ODZX 3AOXA 2FH9A 4CZTA 5I9VA 2Z02A 4NT4A 2I0YA 2WHBA 2O0UA 5CU0A 5JFWA 2BZJA 4JDJA 2O8YA 5KBRA 3QUEA 4XRJA 1XH8A 2YDKA 3ANRA 4O2ZA 2Y0AA 3RKBA 3RZFA 4CYJA 4WIHA 2BIYA 4MF0A 4H3PA 1LEWA 3SRVA 1Q4LA 2JBPA 3Q04A 5M51A 4JR3A 4ZY6A 1OECA 2IJMA 3BHYA 5AP0A 4AZFA 2FO0A 3T9IA 4EOLA 3FHIA 2BTSA 2IW6A 2W5BA 3QQUA 4QYHA 5J1WA 3TN8A 3UOLA 5HD4A 4FT5A 5D1JA 3RAIA 3TNWA 3MV5A 3ZLWA 5J9ZA 5E1EA 4FSYA 2UUEA 2XKCA 4XG8A 4ALWA 2YLEA 2PZRA 2XMYA 4RBLA 4LV8A 4ZJJA 5EOBA 5A4QA 4KUJA 4QQJA 3F3VA 3ZUUA 4FKSA 1U46A 2HY0A 3NEWA 4M69A 4CSVA 5HE3A 1ZOHA 4AW2A 3EN7A 4GH2A 3NNXA 5AEPA 2W4JA 4IE9A 2UW5A 3DBCA 5M08A 2XK6A 3C5UA 4USFA 5E90A 3NIEA 4QPSA 2YEXA 2PUPA 3KRJA 4BN1A 4AGCA 4U81A 3WF8A 5J8IA 3TTIA 4R78A 3CQWA 4FZ6A 4O1OA 4PL5A 4XNEA 3V5JA 2WEIA 3GU8A 4XP3A 5GIPE 1GZKA 2XB7A 3MFRA 4AE9A 3ATTA 4JG6A 2R3JA 4FSTA 2XRUA 3E63A 5J7BA 2X6EA 3NUSA 4FKWA 4E6AA 2XKEA 5BUEA 2BZKB 3LXKA 4DYMA 3SXSA 5HD7A 4KAOA 2ACXA 3MS9A 5M4FA 4ZSLA 4EQCA 1REKA 4U0IA 3PA4A 1W7HA 4TL0A 2UZOA 4RWKA 4MVFA 4XG6A 1QL6A 3LQ8A 3QTIA 3OUKA 5ANEA 4GK4A 3Q6UA 4P2KA 4OR5A 1NVRA 4GK2A 4D0XA 4PMTA 4LV5A 5CLPA 4E6DA 3BRBA 3DY7A 2E2BA 3ZO1A 4FF8A 2FSLX 2NP8A 5I0BA 4C4JA 2NRUA 4BZNA 4JQEA 4AN3A 5KO1A 2PPQA 4PDYA 5TO8A 5GZ9A 2PVMA 4KKEA 1OUKA 3ODYX 4WD5A 3CKXA 5B2MA 3ORIA 1KWPA 1APME 4AE6A 3UQGA 3A7IA 3FLQA 4XG7A 5AR4A 3QQLA 4DT8A 3NNWA 2UW6A 4RIYA 5HNGA 4YJRA 1M14A 4UZHA 5HO6A 1J7LA 1GNGA 2IZSA 5CXHA 5DEWA 1PHKA 5L8JA 3TEIA 5DMZA 3ORPA 1JOWB 3NCGA 4UMQA 3EQRA 2C3KA 2GHLA 2OKRA 3E8NA 3PY1A 2OU7A 2W99B 4MNEB 5CI6A 4ASXA 4BKZA 4YTFA 1YKRA 5CAPA 2JAMA 5CT7A 4IEBA 4AT5A 4O7ZA 3D9VA 1FVTA 2G1TA 3G0FA 4FX3A 4P5QA 5LVMA 5T68A 3TKHA 5AA9A 5JGAA 5FM3A 1Q8YA 2OH0E 2QU5A 3A4OX 4XP2A 4ZOGA 5HVKA 3JYAA 4PMSA 2BAQA 3PIYA 4D4SA 2QO9A 3QA8A 5CEQA 1W82A 3P7CA 2X8IA 3TKUA 3QRUA 1NA7A 3DZOA 3VW8A 3IO7A 4FT7A 4QMPA 2B53A 2YHVA 1OIRA 2UW4A 1O9UA 1M2PA 5LMKC 2YZAA 3M11A 4PPBA 2B52A 3OROA 2WPAA 4U43A 3DB8A 4CTBA 5FRIA 2WIPA 3GQIA 5KMIA 3LJ1A 4G6OA 4YC8A 4BDHA 3RHKA 5IU2A 5M44A 3IDBA 3Q9XA 4KIKA 3A7GA 2JDRA 4JXFA 4MAOA 4RIWA 4Y73A 5J87A 3HVCA 4XV2A 4F1TA 1J7UA 2QLUA 2J7TA 3MVMA 3D5XA 4BTKA 3TM0A 3EHAA 3KU2A 3PTGA 2FUMA 2ZDTA 4YO4A 4YZBA 4BDEA 5ANIA 5CAOA 1RQQA 5EG3A 4AW0A 2YCRA 2UW0A 2XKDA 3C4CA 4LOOA 2RSVA 1MRYA 3CP9A 3QF9A 2WTDA 4Y83A 2R3PA 2RG5A 5CVFA 2HZ4A 5DR9A 2CN5A 3QQJA 5I9UA 3RCJA 4JI9A 4AU8A 2GS6A 4PF4A 4DTKA 4MEDA 4DGLC 5JN2A 4F1OA 4Q9SA 4G34A 2JDVA 3MBLA 3VWAA 2V5QA 4U9AA 1JSTA 2VTSA 4D0WA 5M56A 1OBGA 4RC2A 3L1SA 3C4WA 3R1QA 3K3JA 2Y4IC 2QOLA 3BU6A 4BHZA 3REPA 4X2KA 3RNYA 3V5QA 3B8RA 1YI6A 3BQCA 3F2NA 3FL4A 4OTGA 3RJCA 4BIDA 2YIRA 3G0EA 4FVRA 2BRBA 3ROCA 3OTUA 3R04A 3RWQA 4IMYA 5CU6A 4AWIA 4U3YA 4WRGA 3EWHA 4YSMA 3ULZA 3FZOA 4M97A 2QG5A 1MQ4A 4RJ8A 4F9AA 3AMAA 4IADA 3GU7A 3JVRA 3SX9A 3UVPA 3S0OA 1H00A 3QGYA 5FGKA 2ZOQA 4FKRA 4S31A 3FZPA 3VW6A 2QO2A 5IQHA 4ANSA 3RPVA 3MIYA 3OMVA 5E4HA 5K5XA 4YUQA 1KV1A 4FTCA 3AMBA 5A4TA 4HGSA 3RI1A 3UOHA 4KRDA 2VU3A 4RX9A 5EYCA 4E5WA 5JFSA 3SA0A 2BALA 4TZRA 3F69A 3TIYA 4IW0A 5D12A 5IQCA 5CF6A 3PIXA 3UNZA 2OICA 3SVVA 1U59A 3W16A 4ZTSA 3BHTA 3NLBA 4TYHA 5AMNA 4C35A 2PZ5A 3HLLA 1ZMUA 4KBKA 4HPUE 3KVWA 1B6CB 5E8UA 1YXTA 4OTIA 2EU9A 4Q5EA 4WRSA 3ANQA 3FWQA 5EM6A 3QKMA 3AD5A 1CM8A 3K3IA 5EM5A 4FGRA 2C3LA 3UZTA 4F9WA 4O7NA 3VJNA 3VUDA 2RGPA 5ACKA 3HX4A 3V01A 2YDIA 4CGAA 3EKKA 4IWDA 2C6LA 5AP7A 3FY2A 5DYJA 1OPLA 5DEYA 5IQEA 4TWCA 4C4GA 2E9OA 2ITYA 1XQZA 3TIZA 2WO6A 4CRLA 1A06A 3D7ZA 5TF9A 2BVAA 4U41A 5JRSA 5I5ZA 1M2RA 3IECA 1HCKA 3QTWA 1ZZ2A 3V6SA 4UMUA 3RHXA 2IZUA 2XJ1A 2BPMA 3EQPA 3HRFA 3KRXA 5BMMA 3TL8A 4F6UA 4BI0A 3UP7A 3OY3A 4K18A 4XBUA 3SHEA 3NPCA 4I4EA 2B54A 4KIQA 5A46A 2YM5A 2NRYA 2W5HA 4UV0A 2CNQA 5A3XA 3KXZA 4V05A 4QPAA 5H8EA 3WIKA 5HE2A 4EK3A 3BLRA 5CAVA 4FIGA 4UEUA 2UW3A 4TTHB 4UWBA 1WBVA 1BMKA 2H96A 4RFYA 3W8LA 5EOLA 5KCVA 2O63A 2XBAA 4FOBA 3R9OA 1LP4A 2KTYA 2J90A 3MTFA 5EDRA 4H3BA 3GCUA 3ZEWA 4ZY5A 1BI8A 3PE2A 3QC4A 5KZIA 3R9HA 3PRIA 4F9BA 5JH6A 3CXWA 4L42A 4BF2A 3PIZA 3QKKA 3MH1A 1ZYJA 3DK6A 4R7BA 5EM7A 1H24A 5EH0A 4DITA 3E64A 3VBWA 4PL3A 3UOKA 5IA0A 5DFPA 3RVGA 1JNKA 3L8PA 4TWNA 1UU7A 3FZRA 4TY1A 3P0MA 3U87A 3O8PA 5EW9A 1E1XA 5EHYA 2XIYA 1H25A 2JIUA 2XK8A 2YIXA 3QTRA 4JQ8A 2GS7A 4LL0A 5BVOA 3H30A 2BDJA 1V0BA 3DLSA 2WMSA 2VX1A 4OBQA 4JX3A 4W4WA 1V1KA 5HICA 3PWYA 4U5JA 4BHNA 5AV4A 3DJ6A 4N6ZA 4FTRA 2VZ6A 2WMRA 4ZTQA 4D55A 5EYDA 4R3RA 4AW1A 2OG8A 2HELA 2B1PA 3FI4A 2X4FA 4IANA 2YITA 5CQWA 2C69A 4JG7A 5E8YA 3KKVA 4PTGA 4Q5HA 2IZRA 5HIEA 3CPCA 2CGXA 4YJPA 1P2AA 3QFVA 2FYSA 3TZ8A 5CU3A 4QMMA 2QOBA 4FEXA 2VTLA 3VS3A 3EQBA 3RINA 3V5LA 5FUTA 5EI2A 5CF4A 5FD2A 5BPYA 2ITUA 1P14A 3KULA 4MWIA 3L9MA 4K0YA 4BCOA 2H34A 3HL7A 3AC3A 5K4JA 3LCSA 1ZYSA 2C5OA 2Z8CA 3EQFA 3ZH8A 3AMYA 1NT2A 4D1ZA 2QVSE 4OT6A 5AUWA 4V04A 5DNRA 1FQ1B 1RJBA 1ZLTA 3BYUA 3V04A 4UN0C 5G1XA 1OI9A 2QODA 3QYZA 3EIDA 4C3FA 3LAUA 3RTPA 3QALE 5AP5A 1NXKA 1GJOA 2Y4IB 3JPVA 4O96A 3W33A 3U55A 1R78A 1P4FA 4FVPA 2VTMA 3P79A 3R7VA 1SZMA 4QT1A 4WT6A 5K0XA 2X7OA 4LQMA 4CKRA 4Y46A 4CEGA 3TG1A 4OAUC 4UXQA 3W2OA 2R9SA 4PRJA 1OIYA 3U54A 3PPJA 5AAEA 2R3LA 3TNIA 3TXOA 1Z9XA 3POOA 4BDDA 2XJ0A 1V0OA 3QAME 4JDHA 3Q4ZA 1KE6A 4ZLYA 4YNEA 5BMSA 3DXQA 2YABA 1VEBA 4HGEA 3E87A 3PUPA 4AQCA 3GC8A 3SDJA 3QXPA 2VWBA 4IDTA 4NM5A 3RK7A 3E88A 4TYEA 3U9CA 3ORNA 4XJ0A 4FG8A 4XG3A 3G2FA 2W4OA 5GJDA 3DAEA 4P90A 5JEBA 4A4OA 3R63A 4CXAA 2VNYA 4RZVA 2A1AB 2XCKA 4FZAB 5I9WA 1UVRA 1XBAA 3CY2A 3OCSA 3ZRLA 4EH5A 3ITZA 3Q2JA 1OL1A 3QHRA 2RG6A 3D2KA 3FZ1A 2IW9A 3EMGA 3SRVB 3MJ1A 3VUIA 3LLAA 3FMNA 3VO3A 2XRWA 4ZZNA 4YZ9A 4M0ZA 3THBA 3R1YA 4RT7A 3VS7A 5IH4A 3FUPA 4QD6A 1A48A 4ZAUA 1BLXA 4XYFA 3VBXA 5L6WL 4BCJA 2C47A 3RPYA 2WTVA 5HORA 3MY0A 1PXKA 3SOAA 5J79A 3CE3A 5M55A 4ENYA 4BCNA 1O6YA 2HWPA 1PXMA 3FE3A 3O7LB 5DOSA 2IPXA 3LM0A 2FA2A 4YHFA 3HKOA 4QMTA 4DTBA 4M0YA 3TV7A 4C4EA 2W1GA 4MBLA 2Z7LA 4KIPA 5AP2A 1SVHA 5HCZA 3R7EA 4S30A 3PXZA 3NNVA 4C8BA 4S2ZA 2X9FA 4TYIA 4EQMA 1KOAA 2PWLA 3R7UA 5EHOA 3SW7A 5I4NA 4EZ5A 4EH6A 2HWOA 3G33A 5HLPA 1KE5A 1PXJA 5D7VA 4QTAA 4H36A 3A4PA 2Z7RA 5I3OA 1PMEA 4GCJA 2P4IA 2YM6A 4ONAA 2QONA 3DKFA 4TNBA 4TNDA 3F5XA 1AD5A 4U42A 4WUNA 3VS1A 3SG8A 2EXCX 2OIQA 1WVYA 4A9TA 4HNFA 4J1RA 4MF1A 3ZUTA 4JRVA 3RM7A 4ZTHA 3HV7A 2WQEA 3VF9A 4EH9A 2HCKA 4AS0A 4Z55A 3UMXA 3CQEA 5JMSA 5AUYA 2JC6A 1JSUA 3LQ5A 3RPOA 3KY2A 4O7LA 4DEIA 2JIVA 4QYYA 1AGWA 2ZJWA 1PMNA 3S4QA 2IO6A 2OXDA 2UW8A 2WEVA 3NUXA 3I7BA 3W10A 4WOVA 3CSVA 3PVWA 4OTPA 4ZXTA 4JR7A 2ZV8A 2B4SB 5DH3A 2J5FA 1U54A 3FKOA 3IDPA 2XK3A 5LWNA 3PY0A 3BHVA 3F3ZA 3E93A 2PZYA 4YJVA 5H3QA 3MB7A 5HX6A 4RQVA 4J95A 3HA6A 3FSFA 4UY9A 4ACCA 2OZAA 3P08A 3ZDIA 3PA3A 4E5BA 3PP1A 4HYSA 4CMUA 4YGAA 1S9IA 4NIFA 4RIYB 4JT3A 1JAMA 4NM7A 4S33A 5GHVA 4CV9A 3TDWA 2W1DA 1UNHA 2HOGA 2JKMA 3POZA 4V01A 3ZBFA 1QCFA 3PXFA 5ITAA 3U6HA 1URCA 4TYGA 2XK7A 5IA5A 3ZMMA 4IVCA 2ERZE 3TNQB 2OJFE 3HECA 4HW7A 5AUTA 5LJJA 1PYXA 4KA3A 2PYWA 3COHA 2C3IB 4K11A 4FZFB 4C0TA 3EYGA 2GNGA 5L2SA 4FKOA 3BKBA 3BELA 4O84A 4XG4A 5KMJA 4I1ZA 3RP9A 5L6PA 1PKGA 3B2TA 3R7IA 2C5NA 4EONA 2BRHA 2VN9A 4J96A 3V3VA 1H27A 2GQGA 2X1NA 4O0UA 2A27A 4GFOA 4I6QA 4YHTA 5HBHA 4JBOA 4D4YA 4F64A 4L46A 5ACBC 4CFFA 2IZTA 3LXNA 3CCNA 4DN5A 2OJ9A 2GNJA 2R3NA 3LPBA 3MH0A 5AM6A 5DRDA 2QC6A 5CEOA 3FPMA 4B7TA 4J8NA 4DC2A 4KRCA 4KIKB 4EOOA 2WQBA 2J51A 3FMDA 3COKA 3WZKA 5H8GA 3K54A 2UZVA 4QYFA 3FEGA 2GDOA 2OIBA 4BFMA 4BWKA 2VWIA 5TKDA 4D1SA 5LOHA 2WOUA 3ZONA 1H26A 5EKNA 4OGRA 2YAAA 3GCPA 4C58A 4E1ZA 4Z16A 4NW5A 3FC2A 5IA2A 3LHJA 1H1SA 1XBBA 3VRYA 4O7TA 2HYYA 1CMKE 1OIQA 3LFQA 3WE8A 3VIDA 1OM1A 1FVVA 1FGKA 3FY0A 5BX0A 4UBAA 2I0VA 4Z7HA 2HW7A 2C1AA 2CDZA 1JVPP 1OGUA 4C02A 4GRBA 2YCSA 4JLCA 3EQDA 1P5EA 3UC3A 5J7HA 4UZDA 4W4VA 5HVYA 5A6OA 1ND4A 2UV2A 4Z9LA 3RMFA 5GJFA 2O3PA 2YWPA 3AC4A 2J2IB 4XBRA 2PULA 5ANJA 3PXYA 4JBVA 3TI1A 5AR3A 2HZ0A 5JRQA 3DZQA 3F82A 3L9NA 1KE9A 3JY9A 3UYSA 1YXSA 2X0GA 2CN8A 2XNOA 1Z5MA 1EH4A 2QNJA 3JS2A 3H3CA 3OCBA 4QYGA 4C3PA 3MA6A 3FI2A 3NVKI 2CGUA 2ITNA 1KOBA 5CANA 3EZVA 3T8OA 2BRNA 5HG8A 3ENHA 3SD0A 4IIRA 3IGGA 2HIWA 3CIKA 2P33A 3UIUA 5IG1A 3FMEA 3E8EA 5E8TA 4RRVA 2XYNA 2C3JA 3VHEA 5LWMA 3FXWA 4MHAA 4M66A 5AR2A 5B7VA 3WZUA 4E4XA 1H8FA 4EOJA 5E9EA 1Q41A 3OY1A 3LFEA 1I09A 4NM0A 4EH7A 1FOTA 2QOKA 2JITA 2PSQA 2PE0A 2E9UA 2CCIA 4FV2A 3OXZA 5ICPA 3E62A 3DDPA 4HVHA 2VO6A 5K3YA 5FTQA 4A07A 4UMPA 3BX5A 3UG2A 3FI3A 1DAWA 4I5CA 4ZLOA 5IA3A 4W8DA 1XR1A 4WG4A 5C8NA 1ZYCA 3D7TA 2QR8A 4O1PA 4QP9A 5HESA 4EK8A 3EFLA 3EQCA 4F9YA 4BL1A 5L4QA 4Y8DA 4JS8A 4D5KA 4FTKA 1Q97A 5AIKA 3KCFA 3KEXA 4AA0A 3HV3A 4Z7GA 5HCYA 5AP6A 4OT5A 4BYIA 5AADA 4WO5A 4IB5A 1CDKA 3VAPA 2YDJA 4EH2A 3P9JA 3EL8A 3UC4A 3RALA 2YIQA 3MPTA 4DG2E 4DEGA 5M06A 1JQHA 5JQ5A 4DCEA 2VTOA 3BI6A 4HVGA 3C9WA 4R6VA 1SNXA 3F66A 3NNUA 3MA3A 2R64A 2WKMA 2XJ2A 4G3CA 2ITOA 3GBZA 5HG9A 4GSBA 3GT8A 4TYJA 2VTAA 4RJ4A 1UNLA 3Q96A 3OT8A 4FV8A 3BWFA 2CKPA 2B9FA 2RFEA 3IPHA 4IB0A 4A7CA 2ZVAA 3HGKA 3IG7A 1CSNA 1WBTA 4FSRA 3ALOA 2OF2A 3EOCA 4V0GB 3UVRA 2YN8A 4BICA 4O81A 5FEEA 4FL3A 2QKRA 2CGVA 3BYSA 4AN9A 1IRKA 3Q9ZA 1OZ1A 1M2QA 1YOJA 3UO6A 1YOLA 3I5NA 4ENXA 4K6ZA 5DE2A 1GIJA 5AM7A 3WOWA 3HUCA 3O8UA 4RZWA 4FTUA 4EOKA 1FVRA 2DQ7X 4I41A 5BVFA 1GAGA 3GVUA 4FIHA 4G31A 1GZOA 4G3GA 5HG5A 3PXQA 4FUXA 3TZ9A 2FSOX 4J53A 3ZC6A 4GL9A 5H8BA 2ITWA 4R5SA 4KS8A 3ET7A 5E8WA 2CHLA 2UZBA 4MKCA 5AX3A 3UQCA 1Y8YA 1OUYA 3R28A 5DN3A 2BR1A 4LUEA 4DLIA 4FTQA 1H1PA 5F94A 2YISA 4FKJA 2PMIA 3D5WA 1Q8TA 2Y6OA 4FK3A 1GIHA 1WFCA 4OTWA 3SXFA 4DBNA 3C50A 4WNOA 3U51A 3ZTXA 5JT2A 2HENA 5EW8A 2VO7A 3H10A 3GC9A 4RIXB 3PXRA 5L8KA 4KKHA 2WTKC 2YERA 4KSQA 3GFEA 3IDCA 3RZBA 4I93A 1AQ1A 2VTPA 1WBNA 4ASZA 3C4ZA 3CGFA 4GEOA 4AZTA 2XF0A 5KE0A 3RBWA 4O82A 4EZ3A 3KULB 3HP2A 5D41A 4JX7A 3ZSGA 4QRCA 3DTCA 4F0FA 2QOCA 5CF5A 3R8VA 3QKLA 1SMHA 3HV5A 4FVQA 5IQDA 3TACA 3CQUA 1YRPA 4U7ZA 4CFMA 5JQ8A 1G8SA 1LR4A 5L2QA 2VTJA 4B8MA 2PMNX 2J6MA 2YA9A 3WBLA 3KMMA 4GUEA 3FDNA 4NZWB 3ZLYA 4BZOA 3BPRA 3PYYA 4GW8A 4G3DA 2ZAZA 3T3UA 4CG8A 5FXSA 4GG7A 2CGWA 3ZO4A 5E7RA 2PE1A 4FR4A 5HU3A 3SC1A 3DBEA 5H9BA 4LM5A 5D11A 4FEUA 2VX0A 1FPUA 2W9FB 3C0IA 3MI9A 3A7JA 3CPBA 3NRMA 4GU9A 4HCVA 4MXAA 4UX9A 2IG7A 1JKSA 2WGJA 4O0XA 4FV6A 4LRJA 3OWLA 3GCQA 2EVAA 3VQHA 3H0YA 4HGTA 3HAMA 4II5A 3CBLA 3VS4A 4FKIA 4IZAA 3F7ZA 4LL5A 4JL9A 3CR0A 3FC1X 1NY3A 5E8XA 4LMUA 4FK6A 2XH5A 3FMMA 4YBJA 5GZAA 2C6MA 4AF3A 1K2PA 1JSVA 4M84A 4QMOA 4WG5A 5F1ZA 3KRWA 2G2FA 4ZSJA 2OJIA 4IWPA 4TT7A 3DA6A 4L7FA 4YJOA 3ZYAA 4PL4A 4BB4A 1WMKA 3EZRA 1OKYA 4FIIA 4APCA 4HVIA 1QMZA 2GMXA 2R2PA 3NYVA 4UYNA 1WBSA 3C51A 4G17A 4J98A 4KKGA 2KULA 5C8MA 3UZPA 4M3QA 4E6QA 4IBMA 4EEVA 5AAFA 4D1XA 2VWUA 4GT3A 1Z57A 4O2PA 3LXLA 4CKJA 3R0TA 3CS9A 3ENMA 4OBPA 3WF9A 4O7RA 2OLCA 4B99A 3S00A 3WYYA 5L2IA 4CNHA 4PP7A 4FKVA 3R2YA 4A9RA 2X9EA 3U9NA 4DFLA 4IVDA 3ZCLA 3M42A 3R7GA 3NGAA 2UZLA 4CFUA 4M14A 4HNIA 4FV9A 4QMZA 4QMUA 2IVVA 3BEGA 3I0OA 4P5ZA 3HDNA 5DBXA 2XNGA 4D9TA 4I4FA 4RGJA 2CCHA 2ZM4A 1HOWA 3AT2A 4PX6A 1J91A 5IZFA 5F20A 4CT2A 1XBCA 2WMQA 2WTCA 3C4XA 1PXIA 4YTCA 5HE0A 5FP6A 5LMBA 1BL6A 4TW9A 2W5AA 4YPDA 4FG7A 3FZSA 5ETAA 3UO4A 3D5VA 1GZ8A 5EDQA 2AC5A 2ZV9A 3PWDA 5TOZA 4FEQA 2UVXA 4F4PA 2CNVA 3BBWA 5LARA 2VWWA 2WFYA 4BCQA 3FI8A 5M09A 3MB6A 4EYJA 4HOKA 1WBOA 5AR8A 4FNYA 4G3FA 2PZPA 4BBFA 4KINA 3E7VA 1XH5A 3CTJA 4YHJA 3F88A 5LXMA 3IGOA 1IAHA 5CWZA 4X2JA 5E8SA 2BFXA 4Q2AA 5DR2A 4PNKA 4ZMEA 3PJCA 4ZP5A 4FSUA 5HOAA 5CY3A 4LRMA 4TKSA 4NCTA 3AT4A 1WBWA 2HK5A 3S3IA 4DA5A 4FTTA 4C38A 3PZHA 5C27A 4E4LA 4F1MA 5KHWA 4ZJIA 3DLZA 4G1WA 1W8CA 5L2TA 3RWPA 1PKDA 4ANLA 5BUJA 3KCKA 4L01A 3MESA 2VNWA 3IW4A 4IFCA 4ZY4A 2QOQA 4AGDA 5L3AA 1NVQA 3D5UA 1UNGA 5IEYA 3ZFYA 2OWBA 4FICA 3FLSA 5ANGA 3NR9A 4G9RA 2XNEA 4G6LA 3TJCA 4AOJA 1MP8A 1ZARA 4RJ7A 2J5EA 1U54B 3OBGA 2WMXA 2HW6A 4IJ9A 4NM3A 4DFNA 5M4IA 2SRCA 4X2FA 1F0QA 5BNJA 2W7XA 4RMZA 2OXXA 3QA0A 2P0CA 3R9NA 3ZZWA 2OZOA 2VO0A 3UPZA 2OZAB 3D15A 3QQGA 4LGGA 4BKYA 3DKOA 2UZUE 3AD4A 4M13A 4BDAA 4BCKA 4YLJA 3WF7A 3QU0A 4ERKA 2IVUA 5M57A 2BMCA 4NIFB 4FKQA 4R5YA 4FV3A 4G6NA 3MPAA 2BHEA 2WTKB 2CKOA 4X6RA 2V62A 4KIOA 1L8TA 4IACA 2YIYA 4J99A 2B7AA 4HYHA 4RJ5A 5CU2A 1YXXA 2WU6A 5CSHA 3E7OA 5KMKA 5L2WA 1XH4A 3SV0A 4QP7A 4AZSA 4D4RA 2I6LA 3F2RA 2X2LA 3A8WA 4E6CA 2JIIA 2W1FA 3QGWA 4XCUA 1OL7A 5EW3A 3E5AA 3FMHA 3QQKA 3QRTA 5ETIA 4X2NA 3UMWA 3G9NA 4M7IA 3UDBA 2UZWE 3FPQA 1DS5A 3OBJA 4LMNA 5E8ZA 4DEDA 3EKNA 4XHKB 4DEEA 3BV2A 3QCXA 1UU8A 3ELJA 3LKMA 4MH7A 5DT3A 5AUUA 3DK3A 4NW6A 1IAJA 4FSZA 3CD8A 1I44A 1DI8A 2PVRA 4MD9E 3DOGA 2YWVA 4RVLA 3G15A 4HJOA 2IW8A 4CFXA 4BWPA 3ACKA 4B8LA 4YZNA 4E93A 3LFDA 5HIBA 1OKWA 4APPA 1PY5A 4OBOA 1YHVA 3FKNA 3QZIA 3KN5A 3VQUA 4AAAA 3Q9WA 5KX8A 4PY1A 3NUNA 2W06A 2PY3A 5IUGA 2UZEA 4LOPA 1YI3A 4X3FA 1ZYLA 3I1AA 3KL8A 3S95A 3JR1A 3R7YA 4O7SA 4O38A 5FDPA 4ACDA 3HMNA 3KRLA 1YOMA 2I1MA 4ZSEA 4C34A 4LG4A 5AA8A 3IOPA 4BCIA 4BYJA 2GS2A 3ZLSA 4GS6A 3UO5A 5CSVA 2BDFA 2I40A 1SNUA 3FMLA 4QNYA 3OW4A 4MX9A 5KMNA 3LQ3A 3IW7A 4S32A 3ZC5A 4BIBA 2VWXA 3N9XA 4EUUA 1CTPE 3ORMA 3TCPA 1K3AA 3LOKA 4IZ7A 3SAYA 1ERKA 4BI1A 3GU5A 5A4EA 2JAVA 3DB6A 3A99A 1TQMA 3IKAA 3NDMA 3QD0A 3VHKA 4C37A 5K4IA 4GKIA 4N57A 3ORKA 3PY3A 5C4LA 1M52A 2W1ZA 5HKMA 4G16A 4E3CA 4USEA 5CXZA 2BHHA 4FEWA 2BUJA 1W98A 3FXXA 3WF6A 3G9LX 4IM0A 3NMUF 3DNEA 3E3BX 4FTNA 4RVTA 3A60A 4AACA 1W84A 2R3GA 3G51A 3AD6A 4FV1A 4YNOA 5K0KA 2JDOA 3AG9A 4AX8A 3U4UA 1YI4A 5J95A 4C36A 4O7YA 3UODA 4XUFA 3P7AA 2F2CB 4ANBA 2R4BA 4DFYA 2AYPA 5F9EA 3FHRA 4O0TA 5HBEA 1UKIA 3DS6A 4DGOA 4RC3A 2FB8A 2V22A 3II5A 3LLTA 4XX9A 3HMMA 3ZDUA 4XG9A 3ZRMA 5EK7A 2PU8A 3LCTA 2C0TA 1U5QA 3KF7A 3QTUA 2B9IA 3C13A 4H3QA 4FE2A 2OF4A 4O22A 5D10A 2XS0A 5AX9A 2GNLA 4GVJA 2V7AA 3DCVA 2UW7A 5AV2A 2R0UA 5KHXA 4EYMA 3C0GA 2GU8A 4IWOA 4UMTA 3MPMA 3R8MA 4D2PA 3MTLA 3L8VA 5LVOA 3UOJA 1F3MC 2BIKB 2OH4A 2YM4A 4EBWA 3D7TB 4ITIA 4OTHA 2JLDA 3FAAA 4DF3A 2B0QA 2ITPA 2BRGA 3HAVA 2F7XE 4DTAA 4QYEA 5HLWA 2C6OA 4MBIA 4K33A 3BU3A 3UNJA 2A0CX 2GTMA 4HYUA 4EWQA 2VO3A 1STCE 4XEYA 4HZSA 4IAKA 5E1SA 3JXWA 5C9CA 4YLKA 2IVSA 4C7TA 3U6IA 3KXXA 2JKKA 4G5PA 4WG3A 2VTTA 5AFVA 3PDTA 5AUZA 4IAAA 3MWUA 4ID7A 2WQMA 3DTWA 3KN6A 3Q5ZA 5ETFA 4D28A 2FSMX 3OVVA 1YDTE 5FEQA 3I5ZA 5IMEA 3S2PA 4NCTC 4BI2A 5KMMA 4FUYA 4QQCA 4F99A 2YM8A 4AFJA 2LAVA 1YVJA 3BE2A 3C1XA 3TNPC 1J1CA 5CZHA 2IVTA 3WIGA 5T6KA 3QUPA 3FL5A 1OBDA 4L3JA 3LM5A 1VYZA 1OPJA 4FYNA 4NFNA 2O64A 4C3RA 3DXPA 5A9UA 4I24A 4CYIA 4F0GA 4I5MA 4CVAA 1M7NA 2YACA 4EOQA 1Q62A 4EC8A 3R30A 4UMRA 3ZU7A 3P23A 4F6WA 4QP6A 2BAJA 4GT4A 4M69B 4C4HA 4ZS4A 3PVBA 4QMYA 2OJGA 1H08A 3DV3A 3FYJX 4I6HA 5GINE 1IA9A 3ZZEA 4WSQA 3CKWA 5K9IA 5HTIA 2O65A 1B38A 3D4QA 4BTMA 2QU6A 3N4VA 3P1AA 4MBJA 5DHJA 3NAXA 3ORXA 3ZFMA 4YBKA 3A61A 1KV2A 4PP9A 5BVKA 1Y6BA 4DLJA 5HE1A 2VWZA 2HXLA 1UU3A 2XYUA 2XZSA 2YLFA 3UVQA 2WQNA 3DBFA 3ZLXA 3UG1A 4YSJA 2PVYA 3CGOA 3GNIB 2XIKA 4J8MA 3OFMA 2XIZA 4AFEA 2C6TA 2CJMA 4IWQA 4B6LA 1URWA 4AN2A 4F7SA 3D83A 5HBJA 2WB8A 3FQEA 1UA2A 1NW1A 2ETKA 4N4SA 4BIEA 2EUFB 5B2LA 2XCHA 2C5YA 3ZBXA 4FNXA 3LIJA 3W32A 3WARA 5J9YA 3LFSA 3VUTA 3OD6X 4QTEA 3ZO2A 4I20A 4KD1A 5LVPA 3N4UA 5J1VA 4OW8A 2RFDA 4L44A 3T9TA 1UWHA 4EH3A 3BGQA 4JBQA 4QTBA 2W96B 2GPHA 4O0RA 2ONLA 2EB2A 4CLJA 5FXRA 3G90X 3I81A 2ZMCA 5LVLA 1O6KA 4BCPA 1Y91A 2Z7SA 3MSSA 4XLIA 5HVJA 4U79A 3RAHA 3V5PA 4YMJA 4H1JA 1NVSA 1R0EA 1WVXA 4QTCA 3O71A 4TRLA 4WUAA 3VC4A 4EBVA 2QCSA 2VTQA 4ZTNA 1OIUA 4WKQA 1E9HA 4F63A 3MVHA 4JQ7A 5HG7A 2ITVA 4A4XA 5HLNA 4IZYA 4ZSAA 1R1WA 1H0VA 1Y6AA 5EI8A 3LCOA 3R1SA 4BR3A 4FBXA 3EH9A 4O21A 2ZMDA 4EOSA 3MVLA 4X3FC 4F7JA 3QRKA 3MGYA 3ROYA 3F7WA 3R02A 4FKGA 4CQEA 1OL2A 2AUHA 5A14A 4EORA 4O7VA 5DVRA 3EQHA 4UALA 3BEAA 3U6JA 3E92A 3WZEA 3P78A 4RSSA 3F9NA 2WMWA 2IWIA 3DGKA 4XOYA 4EK5A 3OW3A 4CFVA 4QQTA 3COIA 4RC4A 2R3IA 3C4FA 4QNAA 3SQQA 3BQRA 3QCSA 1ZY4A 3G6HA 2B55A 2O5KA 1JKLA 1YWRA 2PHKA 5DI1A 4YTIA 4P4CA 5JZJA 1OL6A 2EXMA 5A4LA 5FBOA 3R7OA 2QOIA 5T3QA 1R39A 2OBJA 3OC1A 3DJ7A 4IVAA 4HVSA 3FYKX 4OLIA 2YJRA 2BAKA 5CEPA 4D5HA 3WZDA 3FQSA 3ZS5A 3V5TA 3BIZA 3H9RA 3EL7A 1JPAA 4F65A 3Q60A 3DFCB 3ZOSA 4FTOA 3FLWA 3R2BA 5FG8A 2DUVA 4O0YA 1BKXA 4RIWB 2X39A 4GUBA 2I7QA 4MCVA 5GJGA 3IONA 5C03A 4IZ5A 3DBDA 4F70A 5JSMA 2C0IA 4L53A 4QQ5A 5FTGA 1J3HA 5M53A 4ZS0A 5BYZA 4EH4A 2JFMA 3F61A 3Q4TA 4U80A 5EM8A 1Q5KA 1DM2A 2GCDA 1MQBA 3MYGA 4DGGA 4IVBA 4EH8A 4EC9A 4G9CA 5J5SA 1XKKA 2C6IA 2R3KA 4FSMA 4N0SA 2XA4A 3UE4A 3OOMA 4FKLA 1ZWSA 2HAKA 3A8XA 3W2CA 3LMIA 2BROA 4YR8A 4D58A 3F5UA 4OAVB 2Q0NA 2DS1A 2OSCA 4YJNA 3DKCA 5KUPA 2ITZA 2ITQA 3UIMA 4GK3A 4Y72A 3KXGA 2E9PA 3I60A 3IW6A 2PL0A 5D7AA 2JKQA 3BBTB 3S1HA 2C6DA 2C0OA 3TDVA 1WCCA 4FZ7A 1MRUA 4FTAA 3NAYA 2ETMA 3Q2MA 4RX7A 3F2AA 4JJRA 4O0VA 3JY0A 3AT3A 3QZGA 4JIAA 2WZJA 4EJ7A 2WIHA 4CQGA 5HI2A 3P4KA 3NUYA 2UVYA 3RM6A 4FA2A 4R3CA 5CVGA 4YTHA 4AZVA 2G01A 3AC2A 4YZDA 5C4KA 3UJGA 3VS0A 4JAIA 4KB8A 3C7QA 2A19B 3D0EA 4ORKA 2W9ZB 2C68A 4E5AX 4F7LA 3PFQA 1U4DA 4BDIA 3KREA 4ZZMA 3VN9A 4IH8A 3FQHA 2PTKA 3QXOA 3TWJA 2JFLA 3OTVA 5I3RA 1REJA 3W2QA 4LRKA 3R83A 3PJ8A 4XV1A 1WZYA 3Q4CA 4D9UA 4E73A 4QMQA 4DFZE 5L8LA 4MXYA 4DEHA 2GFCA 3NS9A 3PLSA 4H39A 3GU6A 5ANKA 2GQRA 2VD5A 3TJDA 4AG8A 4ASDA 4DT9A 4TYHB 2OIDA 4I5PA 4R7IA 4F08A 5CAUA 1BYGA 3TUBA 3SG9A 2VRXA 3Q5IA 3TV4A 2PE2A 2R7BA 3MJ2A 4EUTA 2DWBA 4R7HA 1OKZA 2PVLA 3GC7A 4WA9A 1WVWA 2F9GA 3PE1A 3EN5A 4BY9E 1ZMVA 3FMKA 3OWJA 5D9HA 3PSCA 4E4NA 4HPTE 2G2HA 1YWNA 4O86A 5F95A 3BLQA 5IMXA 3LFFA 4K9YA 4AGUA 4O7WA 3I7CA 4HYIA 2RIOA 4IAIA 1FMOE 2OW3A 3ZSIA 3N4TA 2JD5A 1XJDA 2R3FA 2QOFA 4BZDA 5FLFA 3VF8A 3RAWA 3B2WA 3FZTA 3H4JA 4ITJA 2CNUA 4FL2A 3VNTA 2FVDA 4UYAA 5FWKK 4AUAA 3GP0A 2YZLA 3U4WA 4H05A 3OEFX 3A62A 4D2VA 2F57A 4IC8A 3OF0A 1T45A 1Y57A 2GSFA 2W1HA 3R1NA 3GCVA 4GV1A 3W2PA 3LZBA 4KBCA 4RX5A 4H1MA 4NEUA 4RWJA 5FXQA 1CKIA 4IB3A 3BWJA 1PXPA 4LOQA 4X3FB 5FP5A 5HTBA 3DQXA 4R8QA 1JWHA 4DCAA 4PMPA 3F3UA 2XNNA 4E7WA 4AA5A 4A4LA 4BKJA 2RKUA 5G6VA 4QP2A 3MIAA 1PRYA 2G15A 5M07A 1JKKA 4I3ZA 3SW4A 1XH7A 4D2TA 4FG9A 4I0TA 3H9FA 3PJ1A 4J97A 4IM3A 2ONLC 3QTZA 4PTCA 4EHGA 4EHVA 4XH6A 3K5UA 2H9VA 4OTDA 3UNKA 1J1BA 3R01A 5AR5A 2O2UA 3KXMA 3CJFA 4GMYA 5HTCA 4I22A 2PVKA 3CJGA 4KSPA 4RJ6A 3BU5A 2UZDA 2PZIA 4HZRA 3KRRA 5EQEA 1H01A 3Q9YA 4FIJA 5EDPA 3QUDA 4G5JA 3E8DA 1H1RA 2QQ7A 3TTJA 4QP8A 3TZMA 3OWPA 4NUSA 3FSKA 2ERKA 3C4EA 3O17A 3OP5A 4E8AA 5BQ0A 4I21A 3DNDA 4JOAA 1PXOA 2Q0BA 4GIIA 3TNHA 3UGCA 4AXAA 3OEZA 1QPDA 3GC0A 4WNMA 2BZHB 2F7ZE 5TE0A 4EK6A 4DH5A 2XM8A 2V0DA 2WOTA 4NH1A 2JBOA 4RIOA 4A06A 4ANOA 4NYEA 1R3CA 4I0RA 4YJTA 4CLIA 4IFGA 3F3TA 3V5WA 4F7NA 1O6LA 3AC5A 4AP7A 4NKAA 3W2SA 1LPUA 2A4LA 5CI7A 4EOMA 5DLSA 5FTOA 2P3GX 5LQFA 3R71A 4GFMA 4K77A 3AGMA 4RA4A 4BCFA 4J52A 5LCJA 3ATSA 1WAKA 4I92A 4Y95A 3VUGA 4BWXA 4X3JA 4DFBA 4QTDA 5GZ8A 3HV4A 2YCFA 3W1FA 5DRBA 2W0JA 4MWHA 2W4KA 3A7FA 2GFSA 3NWWA 3R8ZA 2R3RA 2XM9A 4YC6A 1PMVA 3OOGA 3ORLA 5ETCA 4ZK5A 4KNBA 2JDTA 1R0PA 1U5RA 5AR7A 2Z2WA 4ZIMA 3CD3A 3VBYA 4O6LA 4D2RA 5AV0A 2PMLX 3LE6A 4FTLA 3QC9A 3FMJA 5IKWA 4A9SA 2CSNA 2C4GA 4MQ2A 4A9UA 4PPCA 4LYNA 4FNZA 1Q8WA 4PPAA 4U40A 3WF5A 2WU7A 1G3NA 1Q3WA 2BDWA 3NYNA 5I9XA 4CG9A 1YDRE 2QG7A 1L3RE 5IH5A 2PUNA 3WI6A 3H9OA 2F2UA 3MN3A 1DAYA 3NZ0A 4MK0A 4FZDB 4X7QA 4C57A 1QPJA 4NSTA 2QR7A 4W4YA 4XMOA 5ANOA 5A54A 2ESMA 4QO9A 5M4CA 5EI6A 4C61A 3QD3A 4MQ1A 4C2WA 4GFGA 1ZOGA 3KXNA 3LFAA 3Q4UA 2PUUA 5CNNA 2A2AA 3HYHA 4DH8A 1YW2A 3QD2B 3CY3A 4IAZA 3VUMA 4PDPA 2RFNA 5CASA 4OUCA 4YC3A 2UW9A 4PWNA 4YJUA 4IJPA 4IAYA 3Q3BA 4GJ3A 4IX6A 4ZMFA 2ZM3A 2ITTA 3BHHA 3KC3A 4HCTA 3PA5A 4RA5A 4I6FA 4WNKA 4HVDA 1OB3A 1LUFA 3BHUA 1KE8A 4XV3A 3TKIA 1Q61A 1QPEA 3U8WA 3ID6C 3MW1A 3NYOA 5KNJA 4ZEGA 4G3EA 4EJNA 3VBTA 3P5KA 3WZJA 3VBQA 4CZUA 1H0WA 3F6XA 3V8WA 5JGBA 4FYOA 3PSDA 4HGLA 5DR6A 4BRXA 4ZTMA 3HMOA 4CV8A 2WELA 4NL0A 2CLQA 2R5TA 1V0PA 4BVUA 4L45A 4UWCA 4ALVA 4YU2A 3HV6A 4U6RA 5AAGA 5IQBA 5CSPA 3ZXTA 4AOIA 2C30A 4X6QC 2CKQA 4BCMA 1SM2A 3O96A 5HO8A 5FEDA 2PUIA 4EHEA 2OO8X 1YHSA 3R73A 4F6SA 3DDQA 3F3WA 4PTEA 4GIHA 3MFUA 4LGHA 1H28A 2P2IA 4QMXA 4AT4A 2FSTX 3NW7A 3RK5A 1SVEA 3NYXA 3T3VA 2XEYA 4WHZA 3LFNA 4XS2A 3DKGA 4PDOA 1KE7A 1OPKA 2J0JA 2RL5A 3L8XA 4EOIA 4MTAA 2XKFA 1DI9A 3QWJA 5F4NA 2VV9A 3D94A 4WSYA 4S34A 4YZCA 5CQUA 5AV1A 3WYXA 1SYKA 3MDYA 2CPKE 3EQIA 4XRLA 4YP8A 5A6NA 2R3OA 3Q53A 3OUNB 4JNWA 2GNFA 3OHTA 4QP4A 2X4ZA 2QKWB 3NCZA 4FT9A 5IISA 2NPQA 2WAJA 3PPZA 2IN6A 5HCXA 3ZUVA 4FGBA 4BC6A 5EQPA 2AC3A 3EN6A 4K1BA 4FT0A 1JBPE 2PVNA 2QHNA 2VGPA 4IC7A 5GIOE 2WXVA 1UKHA 1OVEA 3KF4A 2BTRA 5C01A 2I0EA 2BRMA 2G2IA 4JAJA 4N6YA 4RG0A 4ACMA 4DGNA 3V8TA 4EL9A 4DHFA 3FLYA 4U45A 3O2MA 1Q8UA 4C4FA 1S9JA 4JDKA 2XP2A 5C8KA 2W05A 3PP0A 1K9AA 5IA4A 4L9IA 3PJ2A 4BDJA 4YJSA 3UPXA 2W1EA 5CAQA 4B0GA 4ASEA 3RGFA 3ORTA 3UYTA 3KK9A 5CF8A 2WNTA 2QURA 3ZHPC 4DE4A 3I6UA 1TQIA 3MH3A 1VR2A 4M15A 5EKOA 5DGZA 5J5TA 4I94A 3NVMB 2ZV2A 5IQGA 4RLLA 4C59A 1SVGA 2OK1A 4JBPA 4OTRA 1IASA 4XOZA 1VJYA 1E1VA 1ZY5A 4B4LA 5AV3A 2YAKA 4C2VA 4FSWA 2C1BA 3KGAA 5EHLA 5CENA 3W55A 4BBMA 4FV0A 4FL1A 3BZ3A 3Q32A 2C5XA 3I0QA 3QZHA 4RQKA 4TWPA 4Y5QA 2ZM1A 3Q6WA 4LI5A 4CKIA 3OG7A 3PVGA 4FTJA 4O91A 2BKKA 3TUCA 4MXOA 1XWSA 2C5VA 4OTFA 2ZDUA 4MNFA 4IX4A 1LEZA 1YDSE 3TV6A 4BDCA 5LVNA 3DJ5A 1KSWA 2HXQA 4NU1A 3DPKA 5K5NA 4FODA 3RAKA 3AXWA 3SOCA 3LJ0A 4L67A 4EKLA 3DFAA 3QD4A 5E91A 4DG3E 5AWMA 4EOPA 1BI7A 4RVKA 4BTJA 1KUTA 4R77A 3R00A 3MFTA 4CMOA 4WBBB 5EFQA 1M7QA 4DEAA 3VRZA 1ZZLA 4J7BA 4BDFA 3GOPA 2UZTA 4L7SA 3GXLA 4YO6A 2GQSA 3C0HA 3QL8A 1OITA 4H58A 3VS2A 5HEZA 5HNBA 3QYWA 2VX3A 5B0XA 3OXTA 2X6DA 1RE8A 3ZXZA 4W9WA 4DFUA 4IX5A 4L3PA 4D2SA 4DH7A 4CD0A 5CU4A 3BYOA 1X8BA 1FINA 4QMLA 3HP5A 3KQ7A 3ZRKA 3DAKA 4E20A 3PPKA 2CKEA 4IX3A 4R1YA 1FGIA 2J4ZA 1B39A 4W8EA 4Z3VA 3GFWA 4F0IA 3R8UA 2WTJA 2GNHA 1RW8A 4NKSA 5IDPA 4ANMA 2YJSA 2XK9A 3MH2A 3V6RA 3ETAA 3HA8A 4V0GA 3RNIA 4MXXA 3DXNA 3PG1A 4L3LA 2E9NA 2ZYBA 3W8QA 5JGDA 1CKJA 4QP1A 3LFCA 2QD9A 4BCHA 5KKRC 2R3MA 3D2IA 4KS7A 5CVHA 4FSQA 3G5DA 3MVJA 4ZTRA 1RDQE 2ZV7A 3O51A 4EK4A 4GG5A 2RFSA 4K8AA 2B9HA 2C6EA 2QI8A 5CEKA 2Y7JA 5FDXA 3TUDA 3QQFA 3NX8A 2WMAA 2WMTA 3LCDA 4UB7A 1MRVA 2J0LA 2PVFA 4ACGA 4IAFA 2VTRA 3SGCA 4QOXA 1H4LA 3QLGA 1GY3A 2GHGA 3L8SA 3QRIA 4YZMA 3PXKA 2GNIA 5E92A 1Q24A 3FBVA 4ZSGA 2R0IA 2X2KA 5BVWA 3VBVA 4FI1A 4CRSA 2OFUA 4RIXA 2JGZA 2WQOA 5B2KA 5DPVA 5CALA 2B9JA 3OCTA 1QPCA 4U44A 3QHWA 4RLKA 4D4VA 3O0GA 5CEIA 3LXPA 4U3ZA 4FC0A 1UWJA 3CTHA 3SKCA 1JLUE 1GIIA 2WTIA 4GYGA 4I23A 2I0HA 4QMWA 1G5SA 3RCDA 4BTFA 2XIRA 5FQDC 4DAWA 4DH3A 5HO7A 1YQJA 4U8ZA 1GOLA 4DGMA 5JFXA 3WE4A 2WMUA 2HZIA 2JDSA 2R3QA 4L52A 3QBNA 3LMHA 2VAGA 2W17A 5JZNA 5FBNC 4UWYA 4EI4A 4NFMA 5IF1A 5CNOA 3HRCA 2J0MB 1ZAOA 3ZSHA 4XP0A 2JKOA 5CEMA 5C26A 2VGOA 2QO7A 3GCSA 4BCGA 4CT1A 5LMAA 5KMOA 4RPVA 4CMTA 2E9VA 5ANDA 2J0KA 1A9UA 5LCKA 3RK9A 1FMKA 4RFMA 3OCGA 3QTSA 3UTOA 4MXZA 5CS6A 3VS5A 4E26A 3IW8A 5DT0A 3BLHA 4L00A 4ANQA 3I79A 3LMGA 4JG8A 1TKIA 3VUKA 3BGPA 4BBEA 4FKUA 4C4IA 3AGLA 2ITXA 4RX8A 4ZZOA 4MNEA 3KXHA 3QWKA 2H6DA 4LFIA 2F4JA 4QP3A 4F9CA 3C5IA 3SXRA 3E3PA 3EJ1A 4X21A 4FIEA 5AIRA 2NO3A 3NUPA 3L9PA 3HDMA 4P7EA 4ITHA 4BGHA 1XH9A 5HU9A 4IB1A 4DBXA 5JK3A 5EQYA 1IG1A 2YIWA 1P4OA 5HGIA 3K5VA 3CEKA 2WMBA 5I9YA 2Y4PA 3V51A 3CLYA 3W18A 1VZOA 3BV3A 2YM7A 3COMA 4AT3A 3PSBA 2J50A 4AZEA 3BE9A 4R3PA 4M8TA 1YWVA 2WMVA 2Y8OA 4PQNA 3OS3A 3B8QA 3PZEA 4ZJVA 3CC6A 1BL7A 3AQVA 3GEQA 5HQ0A 3HZTA 4FTIA 3MY5A 4W4XA 2VTNA 1TQPA 5HIDA 2XNMA 3MFSA 3DU8A 4RFZA 3QRJA 5IUHA 5IH6A 5KMLA 3UZRA 4I6BA 4BDKA 5CX9A 5AUXA 3DT1A 3GQLA 4QMSA 3LW0A 4X2GA 3UP2A 2VUWA 5DIAA 5FM2A 4PDSA 2WD1A 4EHZA 5IQFA 3NSZA 4AGWA 3O7LD 4GU6A 4ZLZA 5DA3A 5TR6A 1W0XC 4GYIA 5DT4A 1HCLA 5HHWA 5C1QB 5IQAA 3QTXA 2PVHA 3P7BA 4CCBA 4M68A 3E8CA 4FMQA 4C33A 3IOKA 3NW6A 4WBOA 4YPSA 3O23A 3PLAE 1Q8ZA 3KVXA 3EYHA 4JVGA 2UVZA 3D14A 2YCQA 3QCQA 4RWIA 3R9DA 2FGIA 3OXIA 4QMNA 1T46A 3TT0A 4PNIA 2J9MA 2P55A 2Q83A 4DG0E 5CYIA 3JUHA 2XIXA 5DG5A 1BX6A 3JVSA 1ZYDA 5JFVA 5L6OA 4J71A 2ZB0A 4AOTA 5JKGA 3FLZA 3LFBA 3MY1A 3M1SA 5CT0A 4EWHA 4AA4A 1PXNA 4CCUA 3VS6A 4Y85A 3FKLA 3DBQA 3IK3A 2P2HA 3OT3A 3QQHA 3R22A 2EB3A 4FV5A 3NUUA 3PVUA 1MUOA 4MYGA 1OKVA 5KKRB 5KBQA 2XEZA 1YHWA 5IUIA 5GNKA 3CTQA 5IQIA 2ETRA 3NUAA 4ALUA 3UQFA 3K2LA 4QPMA 5IA1A 5IDNA 1J7IA 2W1CA 4ZTLA 3BYVA 3VJOA 2X8EA 4PUZA 5CSWA 3HNGA 5CSXA 4O6EA 3ZEPA 4AW5A 1TVOA 2R3HA 4Y5HA 3N51A 3NW5A 4N70A 5CTPA 4F09A 4NTTA 2BCJA 3KMUA 3HRBA 4FV7A 1BUHA 4MD7E 1ZXEA 3ERKA 4FV4A 4HCUA 4I0SA 2F49A 3F5GA 4IXPA 3GOKA 3M2WA 4AZWA 5TT7A 2BILB 3IW5A 4WNPA 3IS5A 3GGFA 3DQWA 2LGCA 3FJQE 2PVJA 1W83A 4PV0A 1PXLA 4RVMA 4FIFA 5AP3A 4ARKA 3EB0A 4YURA 3AC8A 2CLXA 5BYYA 5AP1A 4ANNA 4EZ7A 5BVDA 4XV9A 1ZRZA 2NNWB 4CZYB 1ZOEA 3O8TA 2XUUA 5H2UA 3EQGA 1G8AA 2OGVA 3W2RA 1VYWA 3PG3A 2RF9A 1WBPA 3GU4A 1ZMWA 3I4BA 5AUVA 5KZ0A 3BCEA 3V8SA 4U97A 3VULA 3GENA 1Y8GA 3PRFA 4FKTA 3A2CA 4NWMA 4KWPA 2VTIA 2YFXA 1ATPE 4DEBA 3HUBA 4L43A 3ACJA 4CTCA 2OJJA 2EWAA 1M17A 5HX8A 2BKZA
chains in the Genus database with same CATH superfamily
4MD8E 4W9XA 5IPJA 3FV8A 3G6GA 1H1QA 3OZ6A 3UIXA 3R21A 1OL5A 1PYEA 3EFJA 4JIKA 3ULIA 2UZNA 4FSNA 5EYMA 2W1IA 4CFNA 1PMUA 4K2RA 4RWLA 3QCYA 4XLVA 3R6XA 4O0SA 2X2MA 1CKPA 4TN6A 4BDBA 2VWYA 2VTHA 4JDIA 2JEDA 2Z7QA 3HMIA 4FNWA 3P86A 4O83A 1Q99A 2QHMA 1UU9A 4UXLA 4LUDA 2Y6MA 3GUBA 4O0WA 1JKTA 2REIA 2OI4X 4USDA 1Q3DA 2X8DA 3SLSA 2YM3A 3I6WA 2Y9QA 2CMWA 4Q9ZA 3R8LA 2OFVA 2F7EE 4GT5A 4TPTA 4ERWA 3IQ7A 3ZFXA 5M4UA 3AC1A 4PMMA 4E4MA 1OMWA 3FLNC 3LCKA 4GJ2A 3OWKA 3O50A 5IEVA 4NTSA 3HEGA 3UIBA 2C6KA 1YXVA 4DH1A 5HZNA 4GKHA 3QZFA 5J9LA 3QX2A 3F5PA 5I9ZA 2WTWA 1IA8A 4BDGA 5LMKA 2BZIB 2HZNA 2G9XA 3FXZA 4JRNA 2V55A 3DAJA 3GB2A 3L9LA 4IM2A 5EYKA 3UBDA 4YJQA 4OTQA 4TWOA 3BYMA 4KABA 3QX4A 4R1VA 3ZO3A 2PK9A 4A9YA 4DINA 5BUIA 3H0ZA 2OXYA 5BVNA 3KFAA 3ALNA 4NJ3A 2QLQA 3EN4A 4O27B 4IDVA 2GHMA 5A4CA 2GTNA 1PJKA 5BYLA 3Q52A 4BGGA 4G2FA 5AP4A 2QOHA 1UV5A 4KBAA 1PW2A 4GVAA 3BGZA 4YLLA 3KMWA 2BFYA 3EN9A 4L68A 4M12A 4FEVA 1F5QA 1PF8A 2XBJA 3EFWA 3HMPA 1H07A 4FT3A 4L8MA 3ORZA 4C62A 4EQUA 1FBNA 2Z60A 5IEXA 5HNIX 2XNPA 5E8VA 2X81A 4NJDA 3VUHA 4L6QA 1IR3A 4X0MA 4EKKA 3KA0A 4XG2A 5BVEA 4TXCA 2H8HA 4IHPA 3KK8A 2X7FA 1GZNA 3VVHA 2PMOX 3RPRA 3PJ3A 3R8PA 3BL7A 2XK4A 2XVDA 4D2WA 3QLFA 4LGDA 3EFKA 2ZB1A 5CZIA 2J0IA 2R7IA 1XH6A 1XO2B 2QOOA 3QTQA 4I5HA 3R9RA 3GI3A 4DFXE 3LJ2A 1IEPA 4QMVA 3RPSA 3ZM9A 4B9DA 4JMQA 2HY81 3KB7A 3TZ7A 1YXUA 3DK7A 5AJQA 2VWVA 4NK9A 3NIZA 5DWRA 4BGQA 2X0OA 1H1WA 2XNBA 2X7GA 3LVPA 3ZM4A 4RJ3A 3WILA 2EXEA 3A7HA 1XHAA 2DYLA 4CFWA 4M67A 4FOCA 4FTMA 4MXCA 4IQ6A 2V7OA 4ACHA 4FKPA 3ODZX 3AOXA 2FH9A 4CZTA 5I9VA 2Z02A 4NT4A 2I0YA 2WHBA 2O0UA 5CU0A 5JFWA 2BZJA 4JDJA 2O8YA 5KBRA 3QUEA 4XRJA 1XH8A 2YDKA 3ANRA 4O2ZA 2Y0AA 3RKBA 3RZFA 4CYJA 4WIHA 2BIYA 4MF0A 4H3PA 1LEWA 3SRVA 4BJJB 1Q4LA 2JBPA 3Q04A 5M51A 4JR3A 4ZY6A 1OECA 2IJMA 3BHYA 5AP0A 4AZFA 2FO0A 3T9IA 4EOLA 3FHIA 2BTSA 2IW6A 2W5BA 3QQUA 4QYHA 5J1WA 3TN8A 3UOLA 5HD4A 4FT5A 5D1JA 3RAIA 3TNWA 3MV5A 3ZLWA 5J9ZA 5E1EA 4FSYA 1XMLA 2UUEA 2XKCA 4XG8A 4ALWA 2YLEA 2PZRA 2XMYA 4RBLA 4LV8A 4ZJJA 5EOBA 5A4QA 4KUJA 2AQXA 4QQJA 3F3VA 3ZUUA 4FKSA 1U46A 2HY0A 3NEWA 4M69A 4CSVA 5HE3A 1ZOHA 4AW2A 3EN7A 4GH2A 3NNXA 5AEPA 2W4JA 4IE9A 2UW5A 3DBCA 5M08A 2XK6A 3C5UA 4USFA 5E90A 3NIEA 4QPSA 2YEXA 2PUPA 3KRJA 4BN1A 4AGCA 4U81A 3WF8A 3BL9A 5J8IA 3TTIA 4R78A 3CQWA 4FZ6A 4O1OA 4PL5A 4XNEA 3V5JA 2WEIA 3GU8A 4XP3A 5GIPE 1GZKA 2XB7A 3MFRA 4AE9A 3ATTA 4JG6A 2R3JA 4FSTA 2XRUA 3E63A 5J7BA 2X6EA 3NUSA 4FKWA 4E6AA 2XKEA 5BUEA 2BZKB 3LXKA 4DYMA 3SXSA 5HD7A 4KAOA 2ACXA 3MS9A 5M4FA 4ZSLA 4EQCA 1REKA 4U0IA 3PA4A 1W7HA 4TL0A 2UZOA 4RWKA 4MVFA 4XG6A 1QL6A 3LQ8A 3QTIA 3OUKA 5ANEA 4GK4A 3Q6UA 4P2KA 4OR5A 1NVRA 4GK2A 4D0XA 4PMTA 4LV5A 5CLPA 4E6DA 3BRBA 3DY7A 2E2BA 3ZO1A 4FF8A 2FSLX 2NP8A 5I0BA 4C4JA 2NRUA 4BZNA 4JQEA 4AN3A 4DHIB 5KO1A 2PPQA 4PDYA 5TO8A 5GZ9A 2PVMA 4KKEA 1OUKA 3ODYX 4WD5A 3CKXA 5B2MA 3ORIA 1KWPA 1APME 4AE6A 3UQGA 3A7IA 3FLQA 4XG7A 5AR4A 3QQLA 4DT8A 3NNWA 2UW6A 4RIYA 5HNGA 4YJRA 1M14A 4UZHA 5HO6A 1J7LA 1GNGA 2IZSA 5CXHA 5DEWA 1PHKA 5L8JA 3TEIA 5DMZA 3ORPA 1JOWB 3NCGA 4UMQA 3EQRA 2C3KA 2GHLA 2OKRA 3E8NA 3PY1A 2OU7A 2W99B 4MNEB 5CI6A 4ASXA 4BKZA 4YTFA 1YKRA 5CAPA 2JAMA 5CT7A 4IEBA 4AT5A 4O7ZA 3D9VA 1FVTA 2G1TA 3G0FA 4FX3A 4P5QA 5LVMA 5T68A 3TKHA 5AA9A 5JGAA 5FM3A 1Q8YA 2OH0E 2QU5A 3A4OX 4XP2A 4ZOGA 5HVKA 3JYAA 4PMSA 2BAQA 3PIYA 4D4SA 2QO9A 3QA8A 5CEQA 1W82A 3P7CA 2X8IA 3TKUA 3QRUA 1NA7A 3DZOA 3VW8A 3IO7A 4FT7A 4QMPA 2B53A 2YHVA 1OIRA 2UW4A 1O9UA 1M2PA 5LMKC 2YZAA 3M11A 4PPBA 2B52A 3OROA 2WPAA 4U43A 3DB8A 4CTBA 5FRIA 2WIPA 3GQIA 5KMIA 3LJ1A 4G6OA 4YC8A 4BDHA 3RHKA 5IU2A 5M44A 3IDBA 3Q9XA 4KIKA 3A7GA 2JDRA 4JXFA 4MAOA 4RIWA 4Y73A 5J87A 3HVCA 4XV2A 4F1TA 1J7UA 2QLUA 2J7TA 3MVMA 3D5XA 4BTKA 3TM0A 3EHAA 3KU2A 3PTGA 2FUMA 2ZDTA 4YO4A 4YZBA 4BDEA 5ANIA 5CAOA 1RQQA 5EG3A 4AW0A 2YCRA 2UW0A 2XKDA 3C4CA 4LOOA 4AAYA 2RSVA 1MRYA 3CP9A 3QF9A 2WTDA 4Y83A 2R3PA 2RG5A 5CVFA 2HZ4A 5DR9A 2CN5A 3QQJA 5I9UA 3RCJA 3UDZA 4JI9A 4AU8A 2GS6A 4PF4A 4DTKA 4MEDA 4DGLC 5JN2A 4F1OA 4Q9SA 2XARA 4G34A 2JDVA 3MBLA 3VWAA 2V5QA 4U9AA 1JSTA 2VTSA 4D0WA 5M56A 1OBGA 4RC2A 3L1SA 3C4WA 3R1QA 3K3JA 2Y4IC 2QOLA 3BU6A 4BHZA 3REPA 4X2KA 3RNYA 3V5QA 3B8RA 1YI6A 3BQCA 3F2NA 3FL4A 4OTGA 3RJCA 3KIOC 4BIDA 2YIRA 3G0EA 4FVRA 2BRBA 3ROCA 3OTUA 3R04A 3RWQA 4IMYA 5CU6A 4AWIA 4U3YA 4WRGA 3EWHA 2IEWA 4YSMA 3ULZA 3FZOA 4M97A 2QG5A 1MQ4A 4RJ8A 4F9AA 3AMAA 4IADA 3GU7A 3JVRA 3SX9A 3UVPA 3S0OA 1H00A 3QGYA 5FGKA 2ZOQA 4FKRA 4S31A 3FZPA 3VW6A 2QO2A 5IQHA 4ANSA 3RPVA 3MIYA 3OMVA 5E4HA 5K5XA 4YUQA 1KV1A 4FTCA 3AMBA 5A4TA 4HGSA 3RI1A 3UOHA 4KRDA 2VU3A 4RX9A 5EYCA 4E5WA 5JFSA 3SA0A 2BALA 4TZRA 3F69A 3TIYA 4IW0A 5D12A 5IQCA 5CF6A 3PIXA 3UNZA 2OICA 3SVVA 1U59A 3W16A 4ZTSA 3BHTA 3NLBA 4TYHA 5AMNA 4C35A 2PZ5A 3HLLA 1ZMUA 4KBKA 4HPUE 3KVWA 1B6CB 5E8UA 1YXTA 4OTIA 2EU9A 4Q5EA 4WRSA 3ANQA 3FWQA 5EM6A 3QKMA 3AD5A 1CM8A 3K3IA 5EM5A 4FGRA 2C3LA 3UZTA 4F9WA 4O7NA 3VJNA 3VUDA 2RGPA 5ACKA 3HX4A 3V01A 2YDIA 4CGAA 3EKKA 4IWDA 2C6LA 5AP7A 3FY2A 5DYJA 1OPLA 5DEYA 5IQEA 4TWCA 4C4GA 2E9OA 2ITYA 1XQZA 3TIZA 2WO6A 4CRLA 1A06A 3D7ZA 5TF9A 2BVAA 4U41A 5JRSA 5I5ZA 1M2RA 3IECA 1HCKA 3QTWA 1ZZ2A 3V6SA 4UMUA 3RHXA 2IZUA 2XJ1A 2BPMA 3EQPA 3HRFA 3KRXA 5BMMA 3TL8A 4F6UA 4BI0A 2AEGA 3UP7A 3OY3A 4K18A 4XBUA 3SHEA 3NPCA 4I4EA 2B54A 4KIQA 5A46A 2YM5A 2NRYA 2W5HA 4UV0A 2CNQA 5A3XA 3KXZA 4V05A 4QPAA 5H8EA 3WIKA 5HE2A 4EK3A 3BLRA 5CAVA 4FIGA 4UEUA 2UW3A 4TTHB 4UWBA 1WBVA 1BMKA 2H96A 4RFYA 3W8LA 5EOLA 5KCVA 2O63A 4O4FA 2XBAA 4FOBA 3R9OA 1LP4A 2KTYA 2J90A 3MTFA 5EDRA 4H3BA 3GCUA 3ZEWA 4ZY5A 1BI8A 3PE2A 3QC4A 5KZIA 3R9HA 3PRIA 4F9BA 5JH6A 3CXWA 4L42A 4BF2A 3PIZA 3QKKA 3MH1A 1ZYJA 3DK6A 4R7BA 5EM7A 1H24A 5EH0A 4DITA 3E64A 3VBWA 4PL3A 3UOKA 5IA0A 5DFPA 3RVGA 1JNKA 3L8PA 4TWNA 1UU7A 3FZRA 4TY1A 3P0MA 3U87A 3O8PA 5EW9A 1E1XA 5EHYA 2XIYA 1H25A 2JIUA 2XK8A 2YIXA 3QTRA 4JQ8A 2GS7A 4LL0A 5BVOA 3H30A 2BDJA 1V0BA 3DLSA 2WMSA 2VX1A 4OBQA 4JX3A 4W4WA 1V1KA 5HICA 3PWYA 4U5JA 4BHNA 5AV4A 3DJ6A 4N6ZA 4FTRA 2VZ6A 2WMRA 4ZTQA 4D55A 5EYDA 4R3RA 4AW1A 2OG8A 2HELA 2B1PA 3FI4A 2X4FA 4IANA 3NFGB 2YITA 5CQWA 2C69A 4JG7A 5E8YA 3KKVA 4PTGA 4Q5HA 2IZRA 5HIEA 3CPCA 2CGXA 4YJPA 1P2AA 3QFVA 2FYSA 3TZ8A 5CU3A 4QMMA 2QOBA 4FEXA 2VTLA 3VS3A 3EQBA 3RINA 3V5LA 5FUTA 5EI2A 5CF4A 5FD2A 5BPYA 2ITUA 1P14A 3KULA 4MWIA 3L9MA 4K0YA 4BCOA 2H34A 3HL7A 3AC3A 5K4JA 3LCSA 1ZYSA 2C5OA 2Z8CA 3EQFA 3ZH8A 3AMYA 1NT2A 4D1ZA 2QVSE 4OT6A 5AUWA 4V04A 5DNRA 1FQ1B 1RJBA 1ZLTA 3BYUA 3V04A 4UN0C 5G1XA 1OI9A 2QODA 3QYZA 3EIDA 4C3FA 3LAUA 3RTPA 3QALE 5AP5A 1NXKA 2Y4IB 1GJOA 3JPVA 4O96A 3W33A 3U55A 1R78A 2XAOA 1P4FA 4FVPA 2VTMA 3P79A 3R7VA 1SZMA 4QT1A 4WT6A 5K0XA 2X7OA 4LQMA 4CKRA 4Y46A 4CEGA 3TG1A 4OAUC 4UXQA 3W2OA 2R9SA 4PRJA 1OIYA 3U54A 3PPJA 5AAEA 2R3LA 3TNIA 3TXOA 1Z9XA 3POOA 4BDDA 2XJ0A 1V0OA 3QAME 4JDHA 3Q4ZA 1KE6A 4ZLYA 4YNEA 5BMSA 3DXQA 2YABA 2XANA 1VEBA 4HGEA 3E87A 3PUPA 4AQCA 3GC8A 3SDJA 3QXPA 2VWBA 4IDTA 4NM5A 3RK7A 3E88A 4TYEA 3U9CA 3ORNA 4XJ0A 4FG8A 4XG3A 3G2FA 2W4OA 5GJDA 3DAEA 4P90A 5JEBA 4A4OA 3R63A 4CXAA 2VNYA 4RZVA 2A1AB 2XCKA 4FZAB 5I9WA 1UVRA 1XBAA 3CY2A 3OCSA 3ZRLA 4EH5A 3ITZA 3Q2JA 1OL1A 3QHRA 2RG6A 3D2KA 3FZ1A 2IW9A 3EMGA 3SRVB 3MJ1A 3VUIA 3LLAA 3FMNA 3VO3A 2XRWA 4ZZNA 4YZ9A 4M0ZA 3THBA 3R1YA 4RT7A 3VS7A 5IH4A 3FUPA 4QD6A 1A48A 4ZAUA 1BLXA 4XYFA 3VBXA 5L6WL 4BCJA 2C47A 3RPYA 2WTVA 5HORA 3MY0A 1PXKA 3SOAA 5J79A 3CE3A 5M55A 4ENYA 4BCNA 1O6YA 2HWPA 1PXMA 3FE3A 3O7LB 5DOSA 2IPXA 3LM0A 2FA2A 4YHFA 3HKOA 4QMTA 4DTBA 4M0YA 3TV7A 4C4EA 2W1GA 4MBLA 2Z7LA 4KIPA 5AP2A 1SVHA 5HCZA 3R7EA 4S30A 3PXZA 3NNVA 4C8BA 4S2ZA 2X9FA 4TYIA 4EQMA 1KOAA 2PWLA 3R7UA 5EHOA 3SW7A 5I4NA 4EZ5A 4EH6A 2HWOA 3G33A 5HLPA 1KE5A 1PXJA 5D7VA 4QTAA 4H36A 3A4PA 2Z7RA 5I3OA 1PMEA 4GCJA 2P4IA 2YM6A 4ONAA 2QONA 3DKFA 4TNBA 4TNDA 3F5XA 1AD5A 4U42A 4WUNA 3VS1A 3SG8A 2EXCX 2OIQA 1WVYA 4A9TA 4HNFA 4J1RA 4MF1A 3ZUTA 4JRVA 3RM7A 4ZTHA 3HV7A 2WQEA 3VF9A 4EH9A 2HCKA 4AS0A 4Z55A 3UMXA 3CQEA 5JMSA 5AUYA 2JC6A 1JSUA 3LQ5A 3RPOA 3KY2A 4O7LA 4DEIA 2JIVA 4QYYA 1AGWA 2ZJWA 1PMNA 3S4QA 2IO6A 2OXDA 2UW8A 2WEVA 3NUXA 3I7BA 3W10A 4WOVA 3CSVA 3PVWA 4OTPA 4ZXTA 4JR7A 2ZV8A 2B4SB 5DH3A 2J5FA 1U54A 3FKOA 3IDPA 2XK3A 5LWNA 3PY0A 3BHVA 3F3ZA 3E93A 2PZYA 4YJVA 5H3QA 3MB7A 5HX6A 4RQVA 4J95A 3HA6A 3FSFA 4UY9A 4ACCA 2OZAA 3P08A 3ZDIA 3TMOA 3PA3A 4E5BA 3PP1A 4HYSA 4CMUA 4YGAA 1S9IA 4NIFA 4RIYB 4JT3A 1JAMA 4NM7A 4S33A 5GHVA 4CV9A 3TDWA 2W1DA 1UNHA 2HOGA 2JKMA 3POZA 4V01A 3ZBFA 1QCFA 3PXFA 5ITAA 3U6HA 1URCA 4TYGA 2XK7A 5IA5A 3ZMMA 4IVCA 2ERZE 3TNQB 2OJFE 3HECA 4HW7A 5AUTA 5LJJA 1PYXA 4KA3A 2PYWA 3COHA 2C3IB 4AXCA 4K11A 4FZFB 4C0TA 3EYGA 2GNGA 5L2SA 4FKOA 3BKBA 3BELA 4O84A 4XG4A 5KMJA 4I1ZA 3RP9A 5L6PA 1PKGA 3B2TA 3R7IA 2C5NA 4EONA 2BRHA 2VN9A 4J96A 3V3VA 1H27A 2GQGA 2X1NA 4O0UA 2A27A 4GFOA 4I6QA 4YHTA 5HBHA 4JBOA 4D4YA 4F64A 4L46A 5ACBC 4CFFA 2IZTA 3LXNA 3CCNA 4DN5A 2OJ9A 2GNJA 2R3NA 3LPBA 3MH0A 5AM6A 5DRDA 2QC6A 5CEOA 3FPMA 4B7TA 4J8NA 4AQKA 4DC2A 4KRCA 4KIKB 4EOOA 2WQBA 2J51A 3FMDA 3COKA 3WZKA 5H8GA 3K54A 2UZVA 4QYFA 3FEGA 2GDOA 2ZFYA 2OIBA 4BFMA 4BWKA 2VWIA 5TKDA 4D1SA 5LOHA 2WOUA 3ZONA 1H26A 5EKNA 4OGRA 2YAAA 3GCPA 4C58A 4E1ZA 4Z16A 4NW5A 3FC2A 5IA2A 3LHJA 1H1SA 1XBBA 3VRYA 4O7TA 2HYYA 1CMKE 1OIQA 3LFQA 3WE8A 3VIDA 1OM1A 1FVVA 1FGKA 3FY0A 5BX0A 4UBAA 2I0VA 4Z7HA 2HW7A 2C1AA 2CDZA 1JVPP 1OGUA 4C02A 4GRBA 2YCSA 4JLCA 3EQDA 1P5EA 3UC3A 5J7HA 4UZDA 4W4VA 5HVYA 5A6OA 1ND4A 2UV2A 4Z9LA 3RMFA 5GJFA 2O3PA 2YWPA 3AC4A 2J2IB 4XBRA 2PULA 5ANJA 3PXYA 4JBVA 3TI1A 5AR3A 2HZ0A 5JRQA 3DZQA 3F82A 3L9NA 4BJJA 1KE9A 3JY9A 3UYSA 3W0SA 1YXSA 2X0GA 2CN8A 2XNOA 1Z5MA 1EH4A 2QNJA 3JS2A 3H3CA 3OCBA 4QYGA 4C3PA 3MA6A 3FI2A 3NVKI 2CGUA 2ITNA 1KOBA 5CANA 3EZVA 3T8OA 2BRNA 5HG8A 3ENHA 3SD0A 4IIRA 3IGGA 2HIWA 3CIKA 2P33A 3UIUA 5IG1A 3FMEA 3E8EA 5E8TA 4RRVA 2XYNA 4LV7A 2C3JA 3VHEA 5LWMA 3FXWA 4MHAA 4M66A 5AR2A 5B7VA 3WZUA 4E4XA 1H8FA 4EOJA 5E9EA 1Q41A 3OY1A 3LFEA 1I09A 4NM0A 4DDGA 4EH7A 1FOTA 2QOKA 2JITA 2PSQA 2PE0A 2E9UA 2CCIA 4FV2A 3OXZA 5ICPA 3E62A 3DDPA 4HVHA 2VO6A 5K3YA 5FTQA 4A07A 4UMPA 3BX5A 3UG2A 3FI3A 1DAWA 4I5CA 4ZLOA 5IA3A 4W8DA 1XR1A 4WG4A 5C8NA 1ZYCA 3D7TA 2QR8A 4O1PA 4QP9A 5HESA 4EK8A 3EFLA 3EQCA 4F9YA 4BL1A 5L4QA 4Y8DA 4JS8A 4D5KA 4FTKA 1Q97A 5AIKA 3KCFA 3KEXA 4AA0A 3HV3A 4Z7GA 5HCYA 5AP6A 4OT5A 4BYIA 5AADA 4WO5A 4IB5A 1CDKA 3VAPA 2YDJA 4EH2A 3P9JA 3EL8A 3UC4A 3RALA 2YIQA 3MPTA 4DG2E 4DEGA 5M06A 1JQHA 5JQ5A 4DCEA 2VTOA 3W0OA 3BI6A 4HVGA 3C9WA 4R6VA 1SNXA 3F66A 3NNUA 3MA3A 2R64A 2WKMA 2XJ2A 4G3CA 2ITOA 3GBZA 5HG9A 4GSBA 3GT8A 4TYJA 2VTAA 4RJ4A 5BV3A 1UNLA 3Q96A 3OT8A 4FV8A 3BWFA 2CKPA 2B9FA 2RFEA 3IPHA 4IB0A 4A7CA 2ZVAA 3HGKA 3IG7A 1CSNA 1WBTA 4FSRA 3ALOA 2OF2A 3EOCA 4V0GB 3UVRA 2YN8A 4BICA 4O81A 5FEEA 4FL3A 2QKRA 2CGVA 3BYSA 4AN9A 1IRKA 3Q9ZA 1OZ1A 1M2QA 1YOJA 3UO6A 1YOLA 3I5NA 4ENXA 4K6ZA 5DE2A 1GIJA 5AM7A 3WOWA 3HUCA 3O8UA 4RZWA 4FTUA 4EOKA 1FVRA 2DQ7X 4I41A 5BVFA 1GAGA 3GVUA 4FIHA 4G31A 1GZOA 4G3GA 5HG5A 3PXQA 4FUXA 3TZ9A 2FSOX 4J53A 3ZC6A 4GL9A 5H8BA 2ITWA 4R5SA 4KS8A 3W0NA 3ET7A 5E8WA 2CHLA 1ST0A 2UZBA 4MKCA 5AX3A 3UQCA 1Y8YA 1OUYA 3R28A 5DN3A 2BR1A 4LUEA 4DLIA 4FTQA 1H1PA 5F94A 2YISA 4FKJA 2PMIA 3D5WA 1Q8TA 2Y6OA 4FK3A 1GIHA 1WFCA 4OTWA 3SXFA 4DBNA 3C50A 4WNOA 3U51A 3ZTXA 5JT2A 2HENA 5EW8A 2VO7A 3H10A 3GC9A 4RIXB 3PXRA 5L8KA 4KKHA 2WTKC 2YERA 4KSQA 3GFEA 3IDCA 3RZBA 4I93A 1AQ1A 2VTPA 1WBNA 4ASZA 3C4ZA 3CGFA 4GEOA 4AZTA 2XF0A 5KE0A 3RBWA 4O82A 4EZ3A 3KULB 3HP2A 5D41A 4JX7A 3ZSGA 4QRCA 3DTCA 4F0FA 2QOCA 5CF5A 3R8VA 3QKLA 1SMHA 3HV5A 4FVQA 5IQDA 3TACA 3CQUA 1YRPA 4U7ZA 4CFMA 5JQ8A 1G8SA 1LR4A 5L2QA 2VTJA 4B8MA 2PMNX 2J6MA 2YA9A 3WBLA 3KMMA 4GUEA 3FDNA 4NZWB 3ZLYA 4BZOA 3BPRA 3PYYA 4GW8A 4G3DA 2ZAZA 3T3UA 4CG8A 5FXSA 4GG7A 2CGWA 3ZO4A 5E7RA 2PE1A 4FR4A 5HU3A 3SC1A 3DBEA 5H9BA 4LM5A 5D11A 4FEUA 2VX0A 1FPUA 2W9FB 3C0IA 3MI9A 3A7JA 3CPBA 3NRMA 4GU9A 4HCVA 4MXAA 4UX9A 2IG7A 1JKSA 2WGJA 4O0XA 3W0MA 4FV6A 4LRJA 3OWLA 3GCQA 2EVAA 3VQHA 3H0YA 4HGTA 3HAMA 4II5A 3CBLA 3VS4A 4FKIA 4IZAA 3F7ZA 4LL5A 4JL9A 3CR0A 3FC1X 1NY3A 5E8XA 4LMUA 4FK6A 2XH5A 3FMMA 4YBJA 5GZAA 2C6MA 4AF3A 1K2PA 1JSVA 4M84A 4QMOA 4WG5A 5F1ZA 3KRWA 2G2FA 4ZSJA 2OJIA 4IWPA 4TT7A 3DA6A 4L7FA 4YJOA 3ZYAA 4PL4A 4BB4A 1WMKA 3EZRA 1OKYA 4FIIA 4APCA 4HVIA 1QMZA 2GMXA 2R2PA 3NYVA 4FJVA 4UYNA 1WBSA 3C51A 4G17A 4J98A 4KKGA 2KULA 5C8MA 3UZPA 4M3QA 4E6QA 4IBMA 4EEVA 5AAFA 4D1XA 3UDTA 2VWUA 4GT3A 1Z57A 4O2PA 3LXLA 4CKJA 3R0TA 3CS9A 3ENMA 4OBPA 3WF9A 4O7RA 2OLCA 3PUFC 4B99A 3S00A 3WYYA 5L2IA 4CNHA 4PP7A 4FKVA 3R2YA 4A9RA 2X9EA 3U9NA 4DFLA 4IVDA 3ZCLA 3M42A 3R7GA 3NGAA 2UZLA 4CFUA 4M14A 4HNIA 4FV9A 4QMZA 4QMUA 2IVVA 1W2FA 3BEGA 3I0OA 4P5ZA 3HDNA 5DBXA 2XNGA 4D9TA 4I4FA 4RGJA 2CCHA 2ZM4A 1HOWA 3AT2A 4PX6A 1J91A 5IZFA 5F20A 4CT2A 1XBCA 2WMQA 2WTCA 3C4XA 1PXIA 4YTCA 5HE0A 5FP6A 5LMBA 1BL6A 4TW9A 2W5AA 4YPDA 4FG7A 3FZSA 5ETAA 3UO4A 3D5VA 1GZ8A 5EDQA 2AC5A 2ZV9A 3PWDA 5TOZA 4FEQA 2UVXA 4F4PA 2CNVA 3BBWA 5LARA 2VWWA 2WFYA 4BCQA 3FI8A 5M09A 3MB6A 4EYJA 4HOKA 1WBOA 5AR8A 4FNYA 4G3FA 2PZPA 4BBFA 4KINA 3E7VA 1XH5A 3CTJA 4YHJA 3F88A 5LXMA 4QDVA 3IGOA 1IAHA 5CWZA 4X2JA 4QDEA 5E8SA 2BFXA 4Q2AA 5DR2A 4PNKA 4ZMEA 3PJCA 4ZP5A 4FSUA 5HOAA 5CY3A 4LRMA 4TKSA 4NCTA 3AT4A 1WBWA 2HK5A 3S3IA 4DA5A 4FTTA 4C38A 3PZHA 5C27A 4E4LA 4F1MA 5KHWA 4ZJIA 3DLZA 4G1WA 1W8CA 5L2TA 3RWPA 1PKDA 4ANLA 5BUJA 3KCKA 4L01A 3MESA 2VNWA 3IW4A 4IFCA 4ZY4A 2QOQA 4AGDA 5L3AA 1NVQA 3D5UA 1UNGA 5IEYA 3ZFYA 2OWBA 4FICA 3FLSA 5ANGA 3NR9A 4G9RA 2XNEA 4G6LA 3TJCA 4AOJA 1MP8A 1ZARA 4RJ7A 2J5EA 1U54B 3OBGA 2WMXA 2HW6A 4IJ9A 4NM3A 4DFNA 5M4IA 1W2CA 2SRCA 4X2FA 1F0QA 5BNJA 2W7XA 4RMZA 2OXXA 3QA0A 2P0CA 3R9NA 3ZZWA 2OZOA 2VO0A 3UPZA 2OZAB 3D15A 3QQGA 4LGGA