4QMZA

Mst3 in complex with sunitinib
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
287
structure length
286
Chain Sequence
MQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords SERINE/THREONINE-PROTEIN KINASE 24
total genus 100
structure length 286
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qmzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qmzA01
5KMNA 2VTAA 2CGXA 3PXZA 5CEQA 5EOLA 4ZSGA 3KXMA 4JJRA 3LHJA 3W1FA 3S00A 3PVBA 4XV9A 4BWXA 5CAVA 4F65A 3NW7A 1PYXA 1IA9A 2WPAA 2F7EE 2CKEA 4DBNA 2A19B 3CEKA 4DG2E 5AX9A 1GJOA 1ZZLA 2YWVA 2VX0A 4D5HA 3OF0A 5EI6A 3ZUVA 2E9VA 3ANQA 2GQRA 4UMTA 3GVUA 4ACMA 3AOXA 4ALVA 3ZH8A 4QYEA 2W5HA 4JG7A 2UW8A 3G90X 4FV5A 2Q83A 2BRMA 3NYOA 3A8XA 3PG3A 4GS6A 4BGHA 3KY2A 2R3MA 2ETRA 5F1ZA 2R3OA 3Q5IA 2QONA 3DQWA 4DEGA 2WQMA 3VBYA 5AAGA 5JZJA 3R9RA 4EHEA 4ONAA 5AP4A 5CENA 1WVXA 4OAVB 5AA9A 3P5KA 5E91A 4DFXE 4CGAA 2PVNA 3MDYA 5M56A 3QU0A 2XNBA 4XLVA 5AP6A 4PWNA 4M0YA 3NWWA 4RJ4A 3QXOA 5F20A 2O3PA 4YJQA 4L7FA 2ZAZA 4CMUA 2IPXA 2UW0A 1XBAA 1WMKA 3OUNB 4R78A 2X7OA 2BILB 2EB3A 4AW2A 2EVAA 1EH4A 2HXLA 2HOGA 4GCJA 5M4UA 2I0VA 5CU6A 4FIIA 5K3YA 5ANGA 5JK3A 4XP2A 5TR6A 4EH2A 5DR2A 1APME 1ZWSA 4I6FA 4JDHA 1FQ1B 3EQBA 2VTNA 2CHLA 3OW3A 2BZKB 3HYHA 5IQCA 4K9YA 5AP2A 2F7XE 2P2HA 2VV9A 4A9YA 2ESMA 2OZAA 3KCFA 5L4QA 1XWSA 3DZQA 2W1IA 4I94A 4RIWB 5DBXA 4WT6A 5FM2A 5LOHA 2XNGA 4K1BA 4QNAA 3EZVA 4JG8A 4O0XA 1YRPA 4RWIA 2BDJA 3O8UA 3BI6A 3MIYA 4AG8A 4EH4A 3E63A 4DHFA 2LGCA 4NUSA 3CBLA 4G2FA 4ZTSA 4BGQA 2ZMDA 3D7TA 1Q8TA 2O63A 3PFQA 4V05A 5LVOA 4MF0A 2WEVA 4J7BA 3W10A 3ZXTA 3ZO2A 3L8PA 3NUPA 4FV1A 2I1MA 3OXIA 3IPHA 4JR3A 3ZUUA 3FI2A 4QQJA 4ZY5A 5M44A 2GS6A 4FTAA 1YOMA 4CXAA 5BVOA 3Q9ZA 5A14A 3U9NA 4BDJA 2PUUA 4B9DA 3IK3A 4D2TA 1MUOA 2UW3A 2XNPA 5IISA 4UBAA 3LXPA 3EQFA 5TKDA 4JDIA 1MRYA 3SX9A 5EM5A 2PMOX 3C0HA 3QCQA 3HX4A 3UBDA 3VS1A 5BX0A 3GC9A 3N51A 4X21A 1VR2A 3PZHA 3C7QA 3TNHA 3LCDA 3MH2A 4WRGA 1O6LA 2XH5A 1Q8ZA 3P0MA 5ANIA 2VZ6A 4KNBA 2XA4A 3KULA 1OVEA 4KSPA 3ATSA 2W4OA 3PPZA 4H39A 3G51A 4UMRA 4IDVA 4GW8A 4Y46A 4XP0A 5DN3A 2QNJA 2ITVA 3ORPA 2E2BA 4KAOA 5GIOE 2JDOA 3GU5A 4L01A 4YO6A 1YI6A 3BHVA 5EW9A 3UVQA 4A9SA 1PXOA 2XIZA 3Q5ZA 5EQEA 2X2LA 1R3CA 2ZJWA 4YTHA 3OCTA 3VBWA 2YAKA 3SXSA 4PP7A 3F2RA 3HMOA 4RIXB 2QG5A 3VBVA 4Z7GA 3QZFA 1K3AA 3KRRA 5DI1A 3BE2A 4A7CA 4M12A 4AA0A 3SGCA 4TWCA 4TKSA 3AT3A 4G9CA 4NU1A 1FVRA 3TJDA 4KIQA 2YA9A 4RGJA 2R0IA 4ORKA 3UTOA 4E5WA 3RAHA 4CFXA 3SOCA 4ANNA 1UWJA 4DE4A 4C33A 4RJ5A 1LEZA 4RX9A 3DKFA 4IX3A 2NRUA 4DT9A 3PRIA 2R7BA 3WZUA 1ZOEA 3BRBA 2CNQA 4GFMA 4JIKA 3F69A 5LMKA 3EN5A 2ETKA 3GCUA 4D28A 4FKLA 3WYXA 2VGOA 1H1PA 4PNKA 4A06A 5JGDA 5FTQA 3HV4A 3QZGA 4PTGA 2XBAA 4G34A 4LV8A 1R0PA 4UYNA 4EOIA 4U80A 4FA2A 4FKRA 2C6OA 3TKHA 3FKNA 2JLDA 2JFLA 1UKHA 5BVFA 4HYHA 5CAPA 1W82A 3I1AA 2J7TA 5HD7A 3P7AA 5H9BA 3F3ZA 3WILA 4EC9A 3PXRA 1E1XA 2YJRA 3K5UA 3PYYA 1RJBA 1V0PA 3QUDA 5AX3A 2V0DA 5CAQA 4ZLZA 2OO8X 4MNFA 4Q2AA 1IR3A 3TTIA 5I0BA 1XH9A 3DDPA 4RFYA 4F0FA 4FIHA 2XK7A 4MD8E 2ZYBA 2X8EA 4BBMA 2RFNA 3NNWA 4BBEA 4APPA 1ZARA 4J95A 4AWIA 3BHTA 3Q2MA 2UZUE 3EH9A 4O7ZA 3QKMA 2G2FA 5FG8A 4D0WA 4C02A 3KGAA 4YZMA 3ITZA 5ANKA 4MVFA 4O96A 3ZONA 5JFXA 2A2AA 2OJJA 5KO1A 2R4BA 3R6XA 3ZC5A 5DEWA 4BI0A 4YZCA 1PMUA 5JRSA 1PXNA 5BVWA 2UZNA 3FMKA 3Q4UA 3R28A 4YNOA 3RJCA 4DH7A 2CNVA 3NS9A 1OIRA 3FMLA 4GSBA 3ZM9A 4O7SA 4TPTA 5JZNA 4GK2A 5JGAA 2Z7SA 1FGKA 4XBUA 4WBOA 4RX8A 4QP3A 3UP7A 2C3KA 3TI1A 3ZEPA 5A3XA 2J0JA 2PK9A 4Y8DA 4FTCA 5EHYA 4FOBA 2BVAA 4ACGA 4CFWA 5AA8A 2XNEA 4IQ6A 4M14A 3WZJA 1PXIA 5KUPA 5LVPA 3QCSA 1Z57A 2IZUA 4XLIA 5D9HA 4HVSA 4IFCA 3RNYA 5ETFA 5HI2A 4OTQA 3LMGA 2XJ1A 3RPYA 5IZFA 2HAKA 3RZFA 3DFCB 4DEEA 4MEDA 4UZDA 4U41A 4W9XA 3KC3A 3QFVA 1Q5KA 1M17A 5EHLA 4ANMA 4JAJA 4EC8A 2CGUA 1BKXA 3AC5A 3OMVA 5CU4A 3SRVA 3ZLSA 4U44A 1WBPA 2X8IA 2XJ0A 3OBGA 5IA2A 1PXPA 3C4EA 4RIOA 3OP5A 3PJ3A 3QD2B 3QQFA 4U79A 5CSWA 3V04A 2CNUA 5AUVA 4BCIA 4YGAA 2CGWA 3UC4A 4IMYA 3DKCA 4Y85A 4F08A 2C6EA 2ZVAA 5DEYA 3PJCA 4E6CA 3E5AA 5DRDA 5CF5A 4Z3VA 5FQDC 5J9LA 4CG9A 5CSPA 1Y8GA 4FG8A 5EH0A 2W1CA 3WZEA 3V5LA 4AN9A 2EWAA 5GIPE 3TL8A 2BZJA 1NT2A 5J95A 4MBIA 3TXOA 4IB3A 3G5DA 1OB3A 3QTZA 2C5YA 3EIDA 5T6KA 2IN6A 4DGGA 5CVGA 2JBPA 4Z9LA 2ZM3A 4UYAA 4DFYA 1M2RA 3BZ3A 2W05A 4HYUA 5K0KA 3BGPA 5KHXA 3N4UA 2OU7A 4QMWA 3ZDIA 3SQQA 1JKKA 3D0EA 3UQFA 3DK7A 3PUPA 4EH8A 4YTIA 4C3PA 3ORKA 1HOWA 5AJQA 3C51A 4EOLA 4A9UA 4D2RA 5JSMA 4AZEA 2YAAA 3RCDA 5KKRC 3BKBA 4BIDA 3CSVA 3CJFA 4CZUA 5JT2A 4DH8A 3GOPA 3ET7A 2WD1A 3DNEA 5E4HA 3COKA 1HCKA 3F88A 4O1OA 5CT0A 5BUJA 3H9RA 3DBCA 4BDDA 5DYJA 4QD6A 4BL1A 4U42A 3DB8A 3MBLA 1W0XC 5HG8A 1SVHA 3A4OX 3Q04A 2RIOA 4CMOA 3HDNA 1IAJA 2ZB1A 3BIZA 1CSNA 3R01A 4I21A 1M7NA 4U3ZA 4X7QA 5DT3A 5HNGA 3RWPA 5IQAA 4JDKA 3WOWA 1H28A 3QLGA 4GIHA 5HX8A 3KMWA 3EFJA 2J51A 3MVMA 4XP3A 2JEDA 4XUFA 2R7IA 4C4IA 1PMVA 2FUMA 2HWOA 3N9XA 4U97A 1OUKA 4WG5A 3DA6A 3ODZX 2WOTA 4A07A 2X4ZA 2F2CB 3C5IA 2OIQA 2RF9A 3FI3A 4IACA 2XRUA 2FVDA 2X4FA 4OR5A 3VBXA 4QMYA 4I92A 4FKTA 3MTFA 4NCTC 2LAVA 4EEVA 3A62A 1JSUA 3AMBA 4PDSA 2C0OA 3FMMA 3LFNA 1R39A 1GZKA 4FT7A 4PP9A 4XRLA 2UW4A 4FT9A 4ZAUA 2VTIA 5A4EA 3CC6A 3TIZA 1J7UA 2Y8OA 3P08A 4FEVA 5HORA 3VULA 1OBGA 4EH9A 4FX3A 4UWBA 4BZNA 2WOUA 4CLIA 1O6YA 3FJQE 4DF3A 4EZ7A 3ORTA 1W98A 3KU2A 1JQHA 4AOTA 2Z7LA 4MBLA 3O71A 2HZ4A 5IQEA 2YCFA 2AUHA 4BTMA 4R3RA 2GQGA 3U6HA 3OW4A 2QVSE 4NKAA 2OZAB 1U59A 2C6MA 4F0IA 1Q8UA 4YJRA 2BAJA 4EL9A 3UGCA 5J5TA 4FGRA 2QD9A 5HOAA 2RSVA 2UZBA 5B7VA 3H9OA 3R21A 4L8MA 2W5AA 2PMIA 3GCVA 1KE7A 3E62A 1YI3A 2C47A 2PY3A 3GXLA 4DEIA 5HHWA 4YJPA 5D10A 4IADA 3R1NA 5IH5A 3PP0A 5JQ8A 1PMEA 4KINA 2PE1A 5DNRA 4HJOA 1BL6A 5EW8A 3DXPA 5HGIA 3L8XA 4IFGA 3GP0A 1JKLA 3SG9A 2PL0A 4NTTA 3TEIA 1OKVA 1ZY5A 3GU4A 4C58A 4MNEA 2YEXA 4PV0A 5DRBA 1OECA 2X9FA 4FV4A 4OTPA 3R9OA 4UZHA 3COIA 5IA4A 4FV7A 5H2UA 4J99A 5J1WA 3E92A 4PPCA 4O2ZA 4EK8A 1STCE 2UW9A 1U5RA 4GG7A 4AU8A 4JG6A 4G3FA 2W5BA 4IVDA 4RJ3A 1MRVA 4C7TA 4E26A 4C4GA 1OIUA 2XF0A 4LYNA 4RQKA 5AR8A 5TT7A 4FC0A 3R7VA 1SM2A 4I5PA 4AGWA 1YDTE 2Q0BA 4Q9ZA 4KIOA 4AW5A 1AQ1A 4L3PA 2QO7A 3GQLA 4TYHA 4FNWA 4ASZA 5BVDA 5GJGA 4UN0C 4BICA 3NYXA 2GHGA 3W2PA 3LLAA 4W4XA 4BZDA 4HCVA 2YIRA 3FYKX 2PVJA 3PWDA 3BU3A 5DPVA 3U8WA 4D58A 4E4LA 5CF4A 1Q99A 5I5ZA 3MFUA 4ZXTA 1ATPE 3G33A 4DN5A 2JKKA 3F6XA 4EYJA 3ZDUA 4D55A 1H08A 3FKOA 3Q3BA 4YLKA 3ZMMA 4D2SA 2OF4A 3WF5A 4CQGA 5CASA 3PLAE 1KOBA 5CU2A 4R77A 1PKGA 2SRCA 3BLRA 4GK3A 5EHOA 4WD5A 4KRCA 4N6YA 4OTWA 1JPAA 3RPVA 5A4CA 5IDPA 3ANRA 1PXJA 1UKIA 4BBFA 2PUPA 2WTKB 4I1ZA 2VTPA 4DT8A 5L2QA 5G1XA 3PVGA 4BHZA 4F0GA 5EI2A 1LPUA 2P4IA 3DU8A 3I6WA 5HESA 2WEIA 4FIGA 3IW4A 5CWZA 3QC9A 3DJ5A 1ZMWA 2REIA 4AQCA 3DXNA 4O86A 4XRJA 1MQ4A 2QLQA 4HOKA 1PF8A 4RC2A 5M06A 1AGWA 4IAFA 3A4PA 3FXWA 4NM5A 4E4XA 2WU7A 4JXFA 4XS2A 3U54A 4BCKA 1BYGA 5ACBC 4D0XA 4GKIA 2YM6A 4Q9SA 4CYJA 2WXVA 1OBDA 3NGAA 1YXTA 3BHHA 3BEAA 3LFSA 3TZ9A 3QA0A 3OTVA 2BKZA 2WTVA 1I09A 3LFDA 3NLBA 4UB7A 4BCFA 4MAOA 4FIEA 5CQWA 1OL7A 3NVKI 2VAGA 2BIYA 3GCPA 1BX6A 4CG8A 5E8XA 2BMCA 3GT8A 2P33A 2RG5A 3UIBA 2I0EA 3JVRA 1RW8A 5HU3A 1BI8A 3MB7A 4E7WA 1P4OA 1QPEA 3QRKA 4PQNA 3W18A 4B8LA 4ZTMA 4U0IA 2J90A 4MK0A 3JYAA 1L3RE 3LVPA 3V8TA 4R1VA 5LMAA 4ERKA 3C4WA 3KXNA 3I6UA 4DTAA 2W4JA 3BU5A 5BUIA 2R3LA 4J71A 2G1TA 2G01A 4LGDA 3R1SA 5JRQA 4E8AA 1KE5A 2X0GA 3B2TA 4EONA 5C01A 3DKGA 2YM3A 4IXPA 3R02A 5K4IA 2X6DA 3MVJA 4F7JA 2GS2A 5I4NA 4HCUA 4FV8A 2VO7A 5EDQA 5BPYA 4FIJA 5E8TA 4J97A 3UQCA 2HXQA 4FG7A 2QHMA 2XS0A 3CP9A 1YWVA 1QCFA 3DPKA 3FC1X 3P9JA 5EKNA 3GCQA 4HVDA 3DB6A 3ODYX 3E8CA 1IASA 4V01A 3JXWA 3JY0A 4YJUA 3UZRA 4FKVA 4AGDA 5EM8A 5JFSA 1KE9A 2C68A 3I4BA 4FKQA 5LCKA 4HYIA 4ITIA 5DOSA 2IJMA 3FSKA 4NKSA 3VS7A 4FL1A 1FGIA 2WTIA 3T8OA 3FQHA 3COHA 5L8LA 2C1BA 5EM6A 4OTHA 2WQEA 4JBPA 3L9PA 4BCJA 1IAHA 4GT3A 3QTIA 4YHFA 4RZWA 2CMWA 2YM5A 1TQMA 3BV3A 2XM8A 3R9HA 3H4JA 4UXQA 1UU7A 3BWFA 4XJ0A 4XOZA 5CEKA 4KA3A 4USFA 1YHVA 3B8RA 1G8SA 3V5WA 4JLCA 4AT5A 3OBJA 3PDTA 4JL9A 1URWA 2OJIA 5EW3A 4CFMA 3P7BA 4YJTA 3LXKA 1KUTA 4AGCA 4FG9A 2ONLC 5ANOA 3W2SA 4FSQA 3H0ZA 4ZY4A 4MXZA 3DBEA 3DTWA 3ORLA 5IQGA 5CAOA 5A4QA 3GC7A 4YC8A 5E90A 3EN4A 3PIYA 2PPQA 4CFUA 4J96A 4WUNA 4BGGA 4RVTA 5F95A 5GNKA 3LCKA 5AUWA 5AV1A 4FL3A 1RE8A 4I41A 5GZ9A 2WQBA 4IC7A 4E6DA 4BDHA 2PULA 4ZJIA 4FTLA 5CSHA 4JOAA 2JKMA 4P5QA 3FWQA 4KIKA 4Y95A 4ZTNA 3ZLYA 4CV9A 5GZ8A 4IZYA 5ICPA 4Z16A 2XK9A 3UG2A 4LQMA 3KN6A 4C2WA 4CKRA 1Q8YA 1OL5A 3D14A 4GV1A 1SZMA 3QXPA 4KBKA 4LI5A 3FHRA 2B52A 2XBJA 4GVAA 4ZS0A 4U81A 4BFMA 4L46A 2NNWB 3F5XA 4D2WA 3OXZA 2C5OA 2WTCA 4IHPA 1CKPA 1GOLA 3I5NA 2OIBA 3L9MA 4M69A 3R22A 3OOMA 3UYSA 5FWKK 4BTFA 4YTCA 2QU6A 3DNDA 3PZEA 4HYSA 4RFMA 3SLSA 4H58A 3UMXA 1YWNA 4L6QA 4GMYA 3P7CA 1PXMA 3CXWA 3UP2A 4G3GA 4RIYA 3O17A 3KCKA 5DFPA 4B4LA 2Q0NA 3MJ1A 1DI8A 3CLYA 4FVQA 3CGFA 1KSWA 4OTDA 4H3QA 2E9NA 2QQ7A 3Q9YA 4YP8A 5E8ZA 3IGGA 4NFNA 2VD5A 3G6HA 4TXCA 1GZNA 1O9UA 3VQHA 4BDKA 4U5JA 5B2LA 1QPJA 5AMNA 3GGFA 4I3ZA 3DOGA 4NSTA 4EOOA 3R7IA 3Q53A 4TNBA 3VHEA 3D4QA 4IJ9A 1JKTA 5E8VA 1DAWA 4YBJA 4FTMA 1M7QA 3HRCA 4DH1A 5IEYA 1W8CA 4M15A 5DG5A 3HKOA 3NW5A 1IG1A 5EG3A 3GU7A 4H36A 2HZ0A 4WA9A 3UO4A 3PWYA 1J7IA 2A0CX 5CI7A 4GU9A 4ZP5A 2QOCA 2VX1A 2YCSA 4XG4A 2FO0A 3KF7A 4IAIA 4E6AA 2VTMA 2B4SB 3BU6A 3QKLA 3LM5A 4IJPA 3ZS5A 4QMUA 2J2IB 1Y91A 3FZTA 3TJCA 3LXNA 5DWRA 3U51A 4L7SA 4R6VA 4IX4A 4YC3A 4RWKA 3WBLA 4MQ2A 4MQ1A 2V62A 4U8ZA 2OW3A 3D15A 4RVLA 3MH3A 3KMMA 3TKIA 3R83A 4EOKA 1WVYA 4FZ6A 4CKIA 2UZEA 3CQWA 4FTKA 4MWHA 1GNGA 2WMBA 3HGKA 3RKBA 2XMYA 3RP9A 4EJNA 2YCQA 4D1XA 3R30A 3F7ZA 3EFWA 3QWJA 5LVNA 4I4EA 3IDPA 3OCBA 1Q3WA 3QHWA 3QD0A 3B8QA 4JI9A 2E9UA 4BHNA 4L67A 3KL8A 4C3FA 1RDQE 3N4TA 3ERKA 1YXVA 5HO6A 5I9ZA 3QQLA 2DS1A 4FIFA 1Q4LA 4BZOA 2BALA 4FTJA 1PMNA 4FKJA 2VX3A 1MQBA 4RMZA 1LEWA 5FXSA 1Q8WA 4RVKA 2VTQA 3PXFA 4JRVA 3PIZA 3MI9A 4GKHA 3JPVA 5I3OA 3LIJA 3EN6A 3IW5A 4FT0A 4YJVA 4BRXA 3D7TB 3CTHA 4TY1A 3PJ8A 2PMLX 3QQKA 1J1BA 5TE0A 4XBRA 3VW8A 2XNOA 3C4FA 5FEEA 2QOOA 4O21A 2JDRA 5AAEA 3SC1A 3TIYA 3GENA 3NUXA 1M2PA 4U3YA 4H3PA 3VUTA 3E3PA 4E3CA 5F4NA 4QPAA 3FZOA 5ETIA 4X6QC 5CEMA 4ZY6A 2B9FA 2FSMX 3NX8A 2VWYA 4CT2A 2WELA 3F5GA 3PSDA 3Q60A 4KIPA 3T3VA 5E8SA 5HZNA 4ANOA 4MXXA 3UO5A 4XOYA 2FH9A 4PUZA 2WMVA 4C4JA 1YDSE 1MRUA 3KN5A 5M57A 5IUGA 3L8SA 4F9CA 3QTUA 2OI4X 3DQXA 1OL6A 3ACKA 3IDBA 5A4TA 2QR7A 3BYUA 2YDJA 3H0YA 4TWPA 3TV7A 1ZLTA 4EUTA 3PY1A 3C9WA 3LOKA 3EYGA 3MY5A 5DR6A 3GUBA 1FOTA 1OI9A 2I0YA 4FTRA 5A4LA 4K18A 3UPXA 1SMHA 2WAJA 3E64A 4BCGA 1KOAA 4M69B 4JX7A 3WIGA 2A27A 4X2JA 5M09A 3RNIA 3VRYA 3K3IA 2JDTA 2VWXA 3QRIA 5E8UA 5C27A 4QQTA 4OT5A 5DA3A 5CVHA 3QTQA 4TT7A 1ZXEA 4DGOA 2YHVA 4YNEA 1UU9A 5LARA 1R1WA 3ORIA 3BCEA 2H34A 3GQIA 1UU3A 5HG7A 1ZOHA 3WE8A 2BRBA 2WNTA 3LLTA 4K0YA 5TOZA 3OWLA 4N0SA 4A9RA 2WMQA 3VHKA 4ACCA 4NL0A 1GY3A 3FLZA 4ITHA 3ZO3A 3RHXA 4BI1A 4K8AA 3TV6A 2OBJA 3AT2A 4RC4A 5AR7A 5I9YA 4FTTA 2VO3A 5EDRA 3A61A 3RGFA 4E5BA 3TM0A 2JD5A 2JKQA 2XK8A 1H00A 2HK5A 5FGKA 5LWMA 2X6EA 2FSTX 4LFIA 4MNEB 4E73A 3R71A 2W96B 3POOA 4HNFA 4ID7A 4J98A 5DIAA 4O0YA 4BCNA 4GYGA 3FC2A 4FOCA 5J9YA 3NNUA 1Y57A 3OXTA 2CN8A 2I6LA 4FKSA 5EOBA 3T9IA 4J53A 3UDBA 4NK9A 2OH0E 3MGYA 4FR4A 4PF4A 2VTTA 5K5NA 2CKQA 4G6LA 4DTBA 1P5EA 3O8PA 3Q9WA 4IX6A 3FUPA 1Q24A 4LOQA 4FSRA 3OY1A 3EKNA 3JR1A 3TDWA 4XG2A 3OOGA 4XHKB 3DAJA 4F7NA 4G3DA 3RPOA 3S1HA 3ZC6A 2OXXA 4M13A 5IUHA 3AT4A 4WKQA 3U6IA 4AA5A 1B6CB 4PNIA 4UWYA 3KRLA 2DYLA 5ETCA 3S4QA 1TKIA 1FINA 4KKEA 1FPUA 4XCUA 3QC4A 5EQPA 5E7RA 4U9AA 3IQ7A 1HCLA 3A7HA 3D94A 4QQ5A 3HV3A 4DGMA 2YIYA 3R1YA 2Y4IB 2JIVA 2ZM1A 4N6ZA 4Y5HA 4LV5A 2VO0A 5IEXA 4ALWA 2PZIA 2X2KA 2YIXA 3SHEA 2CDZA 4Y5QA 5CF8A 5HG9A 4HZSA 2O65A 2XNNA 4M3QA 3IW7A 3LFBA 1JOWB 4PX6A 5EYMA 5JMSA 3AD4A 2EUFB 4ZTQA 5HVJA 4NZWB 5J79A 3ORMA 4S32A 4TYJA 4ZLOA 2EU9A 3LFAA 4DA5A 1URCA 3E7OA 4KD1A 4E20A 3UZPA 1I44A 3GNIB 4RPVA 4CQEA 2R3JA 3EL8A 2CJMA 3I7CA 3QD3A 3DT1A 1TQPA 4L3JA 4AZSA 2J0MB 2RGPA 3HVCA 3HMIA 3PTGA 4RC3A 2IVUA 4CMTA 2J0KA 3R8LA 2C6LA 4P4CA 5FBOA 4C4FA 3Q2JA 4L45A 3WZKA 3KQ7A 4CV8A 2ZV2A 5BVNA 3JUHA 3MA3A 3QL8A 1IRKA 1F0QA 3ZFXA 1UU8A 4L52A 2GNGA 1GZOA 4F6SA 3DV3A 5LCJA 4DAWA 2PE0A 3PG1A 2F57A 3W16A 5FXQA 5C8MA 4XV1A 4AOIA 3LM0A 5AADA 4H1JA 3O23A 4O6LA 1CKIA 2XYNA 5D12A 1A9UA 3V6SA 4Q5HA 4CCBA 3MH0A 2R9SA 2W1DA 2ZMCA 2C3LA 4PL3A 4ZEGA 1GIIA 5HIEA 3VS2A 4E5AX 2WMRA 2W1GA 5CYIA 4RQVA 5HICA 5IQBA 3VAPA 2UVYA 2P0CA 3G6GA 4PL4A 5FRIA 3ZFYA 2QKWB 3K2LA 2XIRA 3P4KA 4QTAA 1R78A 1M14A 1V0BA 4NWMA 4EOMA 2QCSA 1O6KA 4QP4A 1FMKA 1K9AA 1W83A 4L00A 4S31A 4BDFA 4FNXA 4FODA 3AC1A 4KRDA 2PTKA 3MW1A 3QWKA 3VUIA 1OL1A 4UY9A 1H26A 4YSMA 5FDXA 3QGYA 2QOHA 4FKOA 2JBOA 3ZLWA 5CEPA 5HU9A 4O7LA 3MY0A 2YIQA 1J3HA 5AV2A 2PWLA 4TW9A 4NM0A 2GHMA 4QP8A 3VJNA 2HCKA 4PDYA 3R8PA 3T9TA 4APCA 2IVTA 1OPJA 2OKRA 4PDOA 2WMWA 1Q3DA 2WB8A 4K33A 4CSVA 3FI8A 4DLJA 4W9WA 3R2BA 4AFJA 5BMSA 5CX9A 3TZ8A 4DH3A 3FZPA 3MV5A 4JS8A 2RFEA 3QX2A 3E8EA 2W4KA 1LR4A 3M11A 4FUYA 4GH2A 4GRBA 1KE8A 3QUPA 4RA4A 5FP5A 3RZBA 4U40A 3SD0A 4NTSA 4YJNA 5HTIA 2UW6A 2UZVA 4K77A 3FYJX 2CCHA 5JQ5A 3AXWA 2Y6MA 4EH6A 1YW2A 2UZLA 1NVQA 2ZV7A 1XH7A 4PDPA 3FMDA 4RBLA 3OEZA 5FEQA 4FNYA 3ID6C 5KX8A 4E93A 4QPSA 3PY3A 3WE4A 5T68A 4EWHA 3TT0A 4F1MA 4TWNA 4FF8A 3QKKA 2YDIA 4U7ZA 4DCAA 3UOKA 2UZTA 2WMSA 4EH3A 2XKCA 3PSCA 4FL2A 4EKKA 2BTRA 5J7HA 4FNZA 2XVDA 3P86A 4QP9A 4WG4A 5HE3A 2JDSA 5IUIA 3RPSA 3EMGA 3TTJA 2ZV9A 2B0QA 2JC6A 3RK7A 4FGBA 2O5KA 3NMUF 2WIPA 5LXMA 3UVRA 2VTHA 1GIJA 3CCNA 2OH4A 1OPLA 2V7AA 3HP5A 5M51A 5IU2A 3LJ1A 5J5SA 5BMMA 2E9PA 4WIHA 2GQSA 5L2SA 1LP4A 3AGLA 4IVCA 2XCKA 4IWOA 5I9WA 5JH6A 1ZY4A 4BIEA 3EL7A 3LXLA 4EOQA 5EQYA 4HW7A 3BLHA 3LFQA 2Z8CA 3GFWA 2FA2A 5IA3A 1SVEA 2YWPA 3E8NA 3KEXA 4NCTA 5E1EA 2QG7A 2BRHA 2ZV8A 4QMPA 1WAKA 2GDOA 2YM8A 4QMNA 5E8YA 4FE2A 2W9FB 4QTCA 4O7NA 2X2MA 3BPRA 3WF6A 3KVWA 3HLLA 2QURA 1B39A 3LMIA 2V22A 3T3UA 4AT3A 3S3IA 2HELA 3E7VA 3R0TA 2J9MA 3FMHA 2IZSA 4RLLA 5EKOA 4FTUA 3ZEWA 2QODA 3UNKA 2OJFE 4BDEA 2QI8A 3GFEA 3Q52A 2O0UA 4CFNA 5AP3A 3R00A 3O0GA 4YZ9A 3BX5A 3KULB 2FGIA 4C35A 4WHZA 3FLNC 3I5ZA 5AUYA 3EFLA 4MD9E 3UOHA 3R7YA 5CT7A 4EI4A 1H0VA 3QD4A 5AP1A 5JKGA 2W7XA 4WRSA 5CEOA 4O84A 2GCDA 3PJ1A 2XK6A 4QYGA 2IVVA 1Z9XA 3KXGA 3FY2A 1ZAOA 4QMSA 4S33A 4YPSA 5CEIA 3DK6A 3R8MA 3MFTA 4ACDA 4QNYA 3LJ0A 4D1ZA 4F9YA 1OKYA 2GFCA 4O0TA 2PHKA 2CLXA 1YQJA 2R3KA 4F7LA 5BQ0A 4PMSA 4M66A 4I6QA 4IAKA 3F5PA 4FSNA 1NA7A 3S2PA 1H01A 4JBQA 3V01A 3ZYAA 4EHVA 2NPQA 5AR3A 5F9EA 1OKWA 2H96A 5IQIA 5IA1A 1SNUA 3AG9A 4X2GA 4YLJA 4DGNA 2G15A 4RJ8A 4WSYA 3SW7A 2VU3A 2HZIA 4F64A 1OPKA 3W2OA 2ITNA 4EOPA 1PRYA 3NEWA 5J9ZA 2IW9A 3VS6A 1YDRE 3EYHA 4BCMA 2YN8A 4E4NA 3PPJA 3PPKA 2QR8A 3D7ZA 4IE9A 3WARA 2H9VA 4AFEA 2PU8A 4IAYA 1XJDA 1OM1A 1YXSA 2J5EA 3OS3A 1JSTA 4HGEA 4WNOA 3GC0A 4C61A 1DS5A 2PVMA 3UPZA 2F9GA 2HY0A 1X8BA 2BRNA 3PJ2A 4FKUA 1SYKA 4A4XA 5CALA 2BAKA 4EOSA 4FT5A 1WZYA 4X2NA 4S2ZA 3PVUA 5DMZA 1ZYDA 5HD4A 4F1OA 5EFQA 3F66A 4I0TA 5AP0A 2OG8A 1H27A 4QMVA 2R3QA 4EBVA 3G0EA 2BIKB 3O50A 5D7VA 4ENYA 5HVKA 5K0XA 5HVYA 5HCZA 4Y83A 4EK6A 4RSSA 4BCQA 3CKXA 3KVXA 4O0RA 3I0QA 3LFCA 4FEXA 4TL0A 3IECA 3SAYA 3A8WA 4OTGA 1H1RA 4GG5A 3V51A 3O7LB 1Q62A 4KS8A 2ETMA 2V7OA 4FV6A 4FKPA 4YHTA 4BKJA 2GNIA 1Q61A 2UUEA 5AM6A 4O0VA 1KV1A 2XM9A 3G9NA 4PTCA 3UE4A 4FKIA 3NCGA 5DE2A 3HUCA 3ROYA 3PXYA 2P55A 3DFAA 5CF6A 3ZFMA 1P4FA 2BFYA 3LE6A 5L6WL 4AUAA 4FTNA 5CXHA 3VJOA 5IH4A 3DDQA 5CY3A 1H1QA 3CGOA 5HNIX 4FICA 4I5CA 5AR2A 4JAIA 4H05A 1G3NA 3B2WA 2C0IA 4QMOA 4RWLA 4U6RA 4LL0A 2G2IA 3OWKA 3V3VA 5FM3A 1T45A 2R3IA 5IA5A 1JWHA 5DT4A 3ZLXA 4R3PA 4NH1A 4RX5A 4LMUA 2WTWA 1H0WA 5A54A 2IG7A 3GU6A 2JIIA 2VO6A 4QMLA 3QA8A 4FUXA 3CY3A 3ORXA 4YSJA 5HG5A 4FKWA 3DLSA 3VW6A 2YJSA 1OGUA 4WOVA 2GSFA 3HV6A 4DC2A 2FYSA 3RM7A 3CKWA 3RK9A 2J4ZA 4LOOA 3KRJA 4ZMFA 4FVRA 4YURA 2KULA 5BVEA 4NIFB 1G8AA 4P7EA 2F7ZE 5KCVA 5AIKA 5AV3A 4IVBA 4O2PA 2WMAA 3BE9A 4N70A 5C26A 2J0LA 5B0XA 5HTBA 3HRBA 3HV7A 4UV0A 5KMJA 1V0OA 3QZHA 3ACJA 1XO2B 4QP1A 4EUUA 2AYPA 2F2UA 3VS0A 2PZ5A 4TWOA 2R3HA 3CIKA 4ZOGA 5AR4A 2CKPA 4DTKA 1ZRZA 2OXDA 3DCVA 3OZ6A 2GNJA 2GU8A 3EWHA 5DH3A 4BYIA 4O1PA 2XJ2A 1OIQA 1TVOA 3WI6A 2RKUA 2VTLA 5TO8A 3M42A 3P23A 5HE1A 3S0OA 4PPBA 2X9EA 3GB2A 2VNYA 2GNHA 3NYNA 4O0UA 4UMQA 4D4SA 1ZYSA 2YM4A 4FEUA 4IB5A 4IM2A 4KBAA 4WG3A 3BWJA 3FHIA 3FLSA 1VYWA 3O7LD 4F63A 3W8LA 2J6MA 4LUEA 4GFOA 1Q97A 3DJ6A 1S9IA 2ONLA 4I6HA 1OMWA 3FLWA 4ZSLA 3CTJA 4IDTA 5B2KA 3FEGA 4FTIA 4UX9A 2PYWA 4O38A 3TZ7A 1XH5A 2WMUA 4ZTHA 4IZAA 2VTSA 3OD6X 3CPBA 2BZHB 2PVFA 5L8JA 2EXCX 2HYYA 2PSQA 2BROA 3AC8A 3TUBA 4I24A 1U46A 3L8VA 4R1YA 2PZYA 2E9OA 4CKJA 3RALA 4KSQA 5AM7A 5DT0A 5ITAA 1SNXA 4LG4A 3D5VA 3BYVA 4IWDA 3MY1A 4OBOA 3C13A 3D5UA 3MPAA 3R8ZA 3RHKA 5AR5A 2H6DA 4LRKA 1H07A 3BBWA 4Y72A 5HQ0A 3H10A 4QPMA 3PE1A 4F6WA 2ITPA 4F9BA 2CSNA 3C4CA 1UV5A 4C38A 2R3PA 2C3IB 4D5KA 4F09A 4ANQA 4E6QA 1BLXA 2NRYA 3RPRA 2GPHA 4HGTA 3R1QA 4G3CA 2IWIA 2O2UA 3ALNA 2B9HA 4KB8A 4C59A 3C0GA 5JGBA 3DTCA 4QMQA 5HLNA 1XH8A 3A7FA 2R2PA 4HPTE 4IM0A 3TN8A 2HW6A 3ZZWA 4HVGA 2C1AA 4YLLA 4AW0A 3LCSA 4JDJA 2OJ9A 5HBHA 3DGKA 4CRSA 3C5UA 4O7TA 4DITA 1Y6BA 2W1FA 4XNEA 5EK7A 5HO8A 4AP7A 3IO7A 1UVRA 1XKKA 4E4MA 3BYMA 3PVWA 4XX9A 5AUZA 3AC2A 5KKRB 5HEZA 1WBNA 2BDFA 1NY3A 4BB4A 1QPCA 4IAZA 1XBBA 4ERWA 3DJ7A 4C36A 2WKMA 4QMMA 5A6NA 5LWNA 5CZIA 4EQUA 1H24A 4KKGA 4NYEA 3UIUA 4AN2A 4G16A 3Q4ZA 3D83A 3W8QA 4IANA 5FP6A 2GS7A 2WU6A 4AAAA 4O91A 3NNVA 1FMOE 4FZDB 5FTOA 5M4FA 1NXKA 3N4VA 2NO3A 4FTQA 5D1JA 2YERA 3R7EA 4AZFA 2OIDA 3QLFA 2W1EA 3TACA 3ZUTA 4USDA 3ZU7A 4C34A 5LMKC 1YOLA 3NUAA 4I0SA 3MESA 4FZ7A 3IGOA 3EQPA 2C5XA 4G5PA 2X81A 3QBNA 3KA0A 2J5FA 3JS2A 2VRXA 3CQUA 4FTOA 2WQOA 5HTCA 1OL2A 4AOJA 1GAGA 2GTNA 4M67A 4EOJA 3ELJA 2WMXA 3ZBXA 2EXMA 3KB7A 4X3FB 3W33A 4B8MA 3TUCA 1NW1A 4RVMA 4QO9A 2Y6OA 2Z60A 3IONA 4O7VA 4RWJA 4ZSJA 3NZ0A 4TN6A 3QTSA 2YDKA 4XV2A 5CVFA 2XK4A 5HO7A 3DBFA 5HIBA 2FSLX 1Z5MA 3TWJA 5E9EA 3ORNA 4G3EA 4XG7A 4KUJA 2ZM4A 3GBZA 2C6TA 4NM3A 4X3JA 4DBXA 4FSZA 2F49A 2BHHA 4CD0A 4DEDA 3QRJA 2B55A 4I20A 4WSQA 5L8KA 3D5XA 4V04A 4MBJA 2PZRA 2F4JA 4X6RA 2XP2A 3CE3A 5AIRA 2QKRA 2JITA 5CS6A 3TG1A 4FK6A 5KHWA 4RA5A 4HCTA 1ZZ2A 1U54B 3PLSA 4MXYA 4ALUA 4FZAB 1AD5A 4K2RA 4O0WA 3AGMA 3MVHA 4FVPA 4FBXA 3FKLA 5H8BA 4BVUA 4D9TA 2Z7RA 4RG0A 1WBWA 4J1RA 4MF1A 4W8DA 3GCSA 3DK3A 4AS0A 3NNXA 2C69A 3IW8A 2CGVA 4CEGA 1J91A 1XBCA 4GVJA 4J8MA 2XRWA 3R7GA 1OIYA 4FSTA 2XB7A 1REKA 5DHJA 1S9JA 2IW8A 1YHSA 5C4LA 3VVHA 2Z2WA 2ACXA 3ENMA 3U9CA 4ARKA 4KS7A 3VS3A 5JEBA 2WMTA 3C4XA 4HGSA 2IVSA 3DAEA 1BI7A 5HKMA 4GT4A 3P79A 3VWAA 4LMNA 2YCRA 3DBDA 2X7GA 3EN7A 2UW5A 4LGHA 4NW5A 2XKFA 3LCOA 4I22A 2V5QA 2RG6A 3W2RA 2BAQA 4O7WA 3U4WA 4R8QA 4MTAA 3AQVA 4YPDA 3VBQA 3VUKA 4DFLA 2BTSA 2KTYA 5IMEA 3RAWA 5AEPA 3E3BX 4RX7A 3D5WA 4M68A 4IZ7A 2YISA 3HEGA 1DI9A 2CCIA 5KZ0A 4CVAA 5HX6A 4DLIA 5LQFA 3F9NA 4GIIA 2EXEA 4ZSEA 4X3FA 3QHRA 4R3CA 2JIUA 2IZTA 3VS5A 5KMOA 3FMEA 1GZ8A 2RL5A 1H1WA 1PJKA 4XG3A 2DUVA 4J8NA 4AT4A 2PMNX 3FMNA 3KMUA 3OY3A 1WBVA 4Z55A 3VUHA 5C8KA 3SW4A 3A7IA 1OUYA 1WCCA 4IIRA 3K54A 4IZ5A 3C0IA 4QTDA 4XG8A 3RI1A 5KBQA 2YZLA 4JQEA 4TZRA 4NEUA 5ANDA 2X8DA 4ANSA 3ZCLA 4EH7A 4FEWA 3I81A 4QP7A 4OW8A 3HZTA 3PSBA 5D7AA 4ENXA 2CN5A 2OSCA 3HDMA 1JKSA 2XEZA 2WZJA 2PVHA 2X1NA 3Q9XA 3V8WA 4ZK5A 3KRXA 1NVSA 3DS6A 3EQDA 2W06A 3LFEA 4BR3A 3Q6WA 4QYHA 2QC6A 4D2PA 4DFZE 5HE2A 4P2KA 3FAAA 5IA0A 4G6OA 3BGQA 5IG1A 4BDAA 3R63A 4Y73A 1YVJA 3K3JA 3IS5A 3OEFX 3LJ2A 4ZTLA 5M08A 2HIWA 3IOPA 3FBVA 4R7BA 4FV3A 5M4CA 4C2VA 4NFMA 2GMXA 2C4GA 2QHNA 3KK8A 4QTBA 3MFSA 3DXQA 3LQ8A 1T46A 4EKLA 3VNTA 1TQIA 3UIXA 2VN9A 4IVAA 4TNDA 4PPAA 4C4EA 5C1QB 4ZJJA 4CNHA 5AP5A 3EHAA 1R0EA 4X3FC 5CNNA 5CSXA 4GT5A 2XIXA 5KBRA 4S30A 4HVHA 3FL4A 3OC1A 4QMTA 4GL9A 2GNLA 4BDGA 5HBEA 4X2FA 5KNJA 4UMPA 4K11A 3FPQA 4BI2A 3SA0A 3KREA 2X39A 3G2FA 4YC6A 1CDKA 5IH6A 5KMIA 5CAUA 2W1HA 4AW1A 4S34A 4EK4A 3GC8A 4BIBA 4IW0A 4RJ7A 4PRJA 4CCUA 4MXAA 4B99A 1YKRA 3UODA 3L9LA 5KMLA 1UNHA 1H1SA 2ERKA 3I79A 3RTPA 3DBQA 1U5QA 2GHLA 4W4YA 2VWIA 3RWQA 4AXAA 2QOLA 1KE6A 2XIKA 5BYZA 4YHJA 3LCTA 3MS9A 2YABA 2BR1A 3SXRA 3D9VA 5GJDA 5I9UA 5L6PA 4E1ZA 5L2IA 2O8YA 3FPMA 3HV5A 4JBOA 4YUQA 4G1WA 4CZTA 2W0JA 5BNJA 4QOXA 4YBKA 3RM6A 3H9FA 2JAMA 1H4LA 3EQIA 3W2QA 4X2KA 2UZWE 1BUHA 5M07A 4M0ZA 2C6IA 3S95A 1M2QA 3NIZA 3NIEA 3M1SA 4KWPA 5EYCA 2UV2A 3A2CA 3C50A 4XG9A 5B2MA 3F82A 3OCGA 4GUBA 5JFWA 2C5VA 5AWMA 3SG8A 4EK5A 4NIFA 4UALA 4L68A 2CPKE 5EI8A 1L8TA 3FZRA 3AMYA 1OKZA 2I0HA 2PVLA 2VWZA 4LRJA 1CM8A 3ENHA 4O22A 4QTEA 5CTPA 4BY9E 2R0UA 4TYEA 4XH6A 5IF1A 3KKVA 2A1AB 3MPTA 1OITA 3ORZA 2X7FA 3E8DA 4DG0E 4EYMA 3ATTA 1W7HA 3KXZA 4QQCA 2ERZE 3F7WA 3UVPA 4N57A 4H1MA 3BYOA 4F4PA 3OG7A 2CKOA 3CTQA 3O2MA 3V5PA 4AACA 4TYIA 3HRFA 4AZWA 4L3LA 4KABA 4BCOA 2UVXA 3QYZA 4QYYA 2YITA 4ACHA 5M53A 1VJYA 4JRNA 1WVWA 3VF9A 4XYFA 4UWCA 3ZSGA 2BHEA 3BLQA 4MWIA 5ANEA 5IDNA 3ZHPC 2ZDTA 1PXLA 3UNZA 5E1SA 3V8SA 4RLKA 2UZOA 4BN1A 1SVGA 1BL7A 2IZRA 3II5A 4DG3E 2B9JA 3BBTB 3LQ5A 2XYUA 4RFZA 3UO6A 3L9NA 3WYYA 4GJ3A 1JNKA 4WNPA 5HCYA 3VF8A 3KXXA 4JT3A 3GU8A 2OLCA 2XK3A 2WGJA 1UA2A 1IA8A 2WTKC 2XNMA 2ZDUA 4BDBA 1E1VA 1XHAA 3UG1A 5AUXA 3MSSA 3ALOA 4QT1A 3EQGA 3HNGA 3UJGA 1PY5A 4OTRA 5CZHA 3BHYA 4XMOA 3VS4A 2B7AA 5F94A 4IEBA 4OBPA 4D4RA 5M4IA 2O64A 5LMBA 1JBPE 1J7LA 2Z02A 4TTHB 4CLJA 1H8FA 2YLFA 2HWPA 4CZYB 3D2KA 3LW0A 4BTKA 2B54A 4LUDA 4NM7A 3ZO1A 4F6UA 5KE0A 2Y0AA 2WO6A 5CU3A 2VWVA 1KV2A 1JSVA 4V0GA 5AV0A 3O51A 4AN3A 5CU0A 5BYLA 1YXUA 2WIHA 3QRUA 3IKAA 4G17A 4RJ6A 4I23A 3MWUA 5FEDA 1PXKA 4I5MA 4MCVA 5CLPA 5H3QA 4ZMEA 3FQEA 3HMPA 3NR9A 3IG7A 4W8EA 4GYIA 2XEYA 5ACKA 4BKYA 2JAVA 1GIHA 1IEPA 4FZFB 4I0RA 4Q5EA 5IMXA 4O83A 3FLYA 5GZAA 4L9IA 4EZ3A 3VRZA 4DCEA 3HA8A 4C8BA 2G2HA 3Q6UA 2XCHA 5FBNC 4AF3A 3KK9A 4A4LA 3BQCA 3SXFA 3JY9A 3OWJA 4F99A 5L2WA 1F5QA 3F5UA 3M2WA 4RRVA 4WO5A 5HLWA 4EORA 2PUNA 4AX8A 2XIYA 1CTPE 3ZSIA 4FYNA 1V1KA 3FSFA 4OAUC 5E92A 1LUFA 3HECA 2B1PA 3LZBA 2HW7A 3LKMA 1PKDA 3LAUA 3QZIA 4MXCA 3R73A 4FV9A 5ANJA 3E88A 3R8VA 4AGUA 2ITWA 3K5VA 2OK1A 2ITXA 4FMQA 4OBQA 4OTFA 4EZ5A 2Y9QA 4FK3A 3O8TA 4KBCA 3G0FA 3MIAA 4NJDA 4PMMA 2HENA 3CJGA 3ZRMA 3HA6A 4FT3A 4NJ3A 4WUAA 1ZYLA 1XQZA 5LVMA 1M52A 5C9CA 4JIAA 3VC4A 1WBSA 3NYVA 3ZSHA 4G5JA 3ZO4A 3WIKA 4ZSAA 3ZM4A 3V6RA 3UC3A 4RIWA 4GUEA 5LVLA 3VUMA 4BCPA 3EZRA 4F1TA 4AZTA 3R8UA 3TNPC 1W84A 1CKJA 4TYGA 3ZRKA 4F9WA 3Q32A 1PYEA 3EKKA 4ANLA 3UYTA 3OWPA 4B7TA 4R7HA 4ASDA 3NCZA 1FBNA 2OGVA 2OICA 3QQGA 3PXKA 1FVVA 3E93A 4I93A 4YJOA 4DEAA 3C4ZA 3I7BA 2BFXA 2UZDA 3MPMA 4YO4A 5BYYA 4PMTA 3VUGA 5AUTA 4QMZA 5D41A 1U4DA 5FLFA 4F7SA 5CNOA 4ZLYA 1UNGA 4AE9A 2HZNA 4WNMA 4H3BA 4BF2A 3BHUA 3TZMA 2BKKA 3LQ3A 2GFSA 1XH6A 2B9IA 4XV3A 3OROA 4GK4A 4MD7E 5J7BA 3EFKA 4GU6A 4MX9A 4DH5A 3DAKA 3OT8A 3IDCA 5T3QA 3REPA 4C3RA 4ZZOA 4PTEA 4R7IA 2Y4PA 1YHWA 3HMMA 2R64A 2YM7A 4IWQA 5GHVA 3HUBA 4BCHA 3R7UA 3QAME 5AFVA 3F3TA 2BCJA 5EDPA 5DLSA 2VTJA 4L53A 3KXHA 5E8WA 4CRLA 2CLQA 2WTDA 4KKHA 3QTXA 5I3RA 3FDNA 2EB2A 3ROCA 2VNWA 4FSYA 4LGGA 4O27B 4M97A 4UEUA 2I7QA 3A7GA 3CQEA 4X0MA 5GJFA 3LPBA 3FXXA 2JKOA 4RT7A 3ZTXA 5IQFA 4OTIA 2NP8A 2FB8A 2AC3A 3QCXA 3QRTA 4BWKA 3RINA 4GEOA 3Q4TA 3SRVB 4R5SA 3THBA 3V5TA 3DZOA 2OWBA 3RK5A 4HGLA 4HVIA 3R7OA 4B0GA 3ULIA 2OFVA 5HLPA 3LFFA 4OLIA 2QOFA 3V5JA 2ITYA 2YACA 3OUKA 4PL5A 4IBMA 5BVKA 4DEBA 3MVLA 1YOJA 4U45A 4TYHB 3FV8A 5DGZA 3EN9A 5EM7A 5HNBA 2OJGA 3NW6A 3R2YA 1A48A 4YZBA 5IQDA 1VYZA 2C6DA 5LJJA 4ZJVA 3FY0A 3NUYA 4UXLA 4F9AA 1ZYJA 2R3NA 3BELA 5L3AA 2ITZA 4CT1A 2B53A 5KZIA 3FMJA 4ZIMA 2I40A 2QLUA 3CPCA 1VZOA 3TDVA 5C03A 5C4KA 3QUEA 3WZDA 3R9NA 4XEYA 5D11A 4M7IA 3VN9A 5CXZA 3PA4A 1CMKE 3TNIA 4CTBA 4CTCA 3F3UA 3RCJA 1MP8A 4V0GB 5IQHA 2C0TA 1QMZA 4YZDA 2XKEA 4J52A 4K6ZA 4O81A 2BUJA 4LOPA 4G6NA 4JX3A 1VEBA 4HNIA 4IH8A 2W17A 3HMNA 4YMJA 2PZPA 2ZOQA 2JFMA 3UOLA 5DR9A 4EH5A 3V5QA 4QRCA 5A9UA 2XUUA 3QQJA 4GJ2A 3AD5A 1U54A 5C8NA 2Y4IC 1WBOA 3FXZA 3FQSA 4BDCA 3FI4A 1QL6A 4JQ8A 1UWHA 4QP6A 4MXOA 4ASEA 4EQCA 3LMHA 3NAXA 3UOJA 1KWPA 5IKWA 3PY0A 3TNQB 4BTJA 2RFDA 1YXXA 3HAMA 1G5SA 4QMXA 4GFGA 5EYDA 4PMPA 5I9VA 2IO6A 5HBJA 3COMA 3BEGA 3PXQA 3ZXZA 4O7RA 5FUTA 2R3FA 4AA4A 3WF7A 2YIWA 3KRWA 4G9RA 3VIDA 3U55A 2VUWA 3VO3A 4FV0A 1UNLA 4F70A 2ZB0A 3TV4A 4FSUA 1XR1A 4IX5A 2P3GX 3RVGA 3A60A 3NUNA 5EYKA 3FL5A 3SOAA 1ZOGA 2WQNA 1Q41A 1PW2A 3RAKA 4MHAA 4FSWA 4MH7A 2ITOA 4R5YA 4BYJA 5L2TA 4M84A 3U87A 3UNJA 4EQMA 3UZTA 2GNFA 2QOKA 3FE3A 3I0OA 3MTLA 5FTGA 4FI1A 2C30A 4FSMA 4M8TA 3R9DA 3VBTA 3ZZEA 3NUSA 2XZSA 4IWPA 4ZS4A 2YZAA 3OVVA 4JNWA 4O6EA 4TRLA 5H8EA 5K5XA 2W9ZB 5DVRA 3Q4CA 3IOKA 3FLQA 3QGWA 3F3WA 3UIMA 3F3VA 4YR8A 4YU2A 3NSZA 4FKGA 1DM2A 3OT3A 3WF9A 1PHKA 2A4LA 3F61A 1ZYCA 3PE2A 4C4HA 3P1AA 3ULZA 2PUIA 3W2CA 3RBWA 3AC4A 3CR0A 4I4FA 2VWBA 4DINA 2VGPA 3CD3A 5CQUA 3D2IA 3ZBFA 4EJ7A 1JVPP 3SDJA 2GTMA 4L42A 5AV4A 2PVYA 3H3CA 3CD8A 2Z7QA 3BQRA 4BWPA 3MYGA 3TCPA 3W32A 3QF9A 5K9IA 3QALE 4EHZA 4PY1A 3KF4A 3BYSA 2QO2A 3EJ1A 4W4WA 4JVGA 4BC6A 4UMUA 3QCYA 3TKUA 3QQHA 5HIDA 1XH4A 4D1SA 4Z7HA 5JN2A 1RQQA 3C1XA 4YTFA 4MKCA 1Y8YA 4OGRA 5BUEA 2Y7JA 4IB1A 4IAAA 4MYGA 2C5NA 2JGZA 3EQHA 3KFAA 4B6LA 2W99B 3U4UA 3NVMB 3RMFA 3AC3A 5J8IA 4U43A 3QYWA 1J1CA 4D2VA 2BPMA 2C3JA 5TF9A 2VWWA 5H8GA 3BV2A 3DLZA 4DYMA 2OXYA 5CI6A 4ZTRA 3QTRA 5AAFA 2HY81 2OFUA 2QOBA 5M55A 4A4OA 2RFSA 1OZ1A 3FZ1A 5KMKA 3HL7A 3ZRLA 3NPCA 4DFNA 1YI4A 2J0IA 3F2NA 1F3MC 2PE2A 4L43A 3DKOA 4ANBA 4OT6A 3ZOSA 4JBVA 2BZIB 3A7JA 4NW6A 3I60A 4ITJA 3WF8A 4KIKB 2R5TA 4HZRA 2QOQA 2ITUA 4G31A 4O82A 5HE0A 4BKZA 4USEA 3U6JA 1WFCA 2VTOA 2FSOX 3AMAA 4D4VA 1REJA 3O96A 4D9UA 4ZZNA 4BDIA 3MA6A 2YLEA 4CFFA 4I5HA 3OHTA 5G6VA 3MB6A 1NVRA 3EOCA 4RZVA 4OUCA 1FVTA 4NT4A 4WNKA 3EQRA 5A46A 4DFUA 3IW6A 5FDPA 5IEVA 3EQCA 2R3RA 3MN3A 4AE6A 4FV2A 3AD6A 3L1SA 2PVRA 3GEQA 2J50A 4P90A 5IPJA 3TNWA 3CS9A 4RIYB 2BRGA 5AUUA 5CANA 4CFVA 2QO9A 2VWUA 4EWQA 4P5ZA 2WTJA 4II5A 4QYFA 3VQUA 3HP2A 4XG6A 2JDVA 4C62A 4YJSA 3F2AA 3Q96A 5J1VA 5HCXA 4EBWA 1ZMVA 4CYIA 4D4YA 1ZMUA 2DQ7X 5J87A 3UQGA 1P14A 4EHGA 5I9XA 4WBBB 5JFVA 3ETAA 3GOKA 4LRMA 2DWBA 3NAYA 4ASXA 3EB0A 4FYOA 5L6OA 2QOIA 2UW7A 3W55A 2OF2A 1WBTA 4YZNA 5KMMA 1ND4A 4W4VA 4JR7A 5CSVA 4EK3A 2H8HA 4C57A 3GI3A 4I6BA 3QTWA 4DGLC 3POZA 3UMWA 4DFBA 4C0TA 5FD2A 3FZSA 3R04A 4QP2A 3MJ2A 2C6KA 3PA3A 3QX4A 1B38A 2AC5A 2W1ZA 3OCSA 4A9TA 3H30A 5FXRA 2XKDA 3SKCA 2G9XA 4JQ7A 3SVVA 4ZZMA 1ERKA 4IM3A 3HAVA 2OZOA 3BGZA 1QPDA 3OFMA 1A06A 3PRFA 5ETAA 3SV0A 2BDWA 2WHBA 5AP7A 3NRMA 2UVZA 4IB0A 3OTUA 4HPUE 3TUDA 2YFXA 3RAIA 4IC8A 1DAYA 1Y6AA 2IW6A 3NUUA 3PA5A 3PP1A 2V55A 4FEQA 5A6OA 5GINE 1JLUE 3VUDA 3MFRA 2ITQA 5K4JA 3QQUA 4DEHA 1K2PA 4RIXA 3DY7A 2P2IA 3E87A 3PIXA 3G15A 1P2AA 1E9HA 2WFYA 2R3GA 4O7YA 3JVSA 4O0SA 3CY2A 4L44A 1H25A 2ITTA 2PVKA 3MH1A 3A99A 4LM5A 3NDMA 1YWRA 1BMKA 2QU5A 2VTRA 4N4SA 4AZVA 3P78A 4C37A 1JAMA 3G9LX 4LL5A
chains in the Genus database with same CATH superfamily
5KMNA 2VTAA 2CGXA 3PXZA 5CEQA 5EOLA 4ZSGA 3KXMA 4JJRA 3LHJA 3W1FA 3S00A 3PVBA 4XV9A 4BWXA 5CAVA 4F65A 3NW7A 1PYXA 1IA9A 2WPAA 2F7EE 2CKEA 4DBNA 2A19B 3CEKA 4DG2E 5AX9A 1GJOA 1ZZLA 2YWVA 2VX0A 4D5HA 3OF0A 5EI6A 3ZUVA 2E9VA 3ANQA 2GQRA 4UMTA 3GVUA 4ACMA 3AOXA 4ALVA 3ZH8A 4QYEA 2W5HA 4JG7A 2UW8A 3G90X 4FV5A 2Q83A 2BRMA 3NYOA 3A8XA 3PG3A 4GS6A 4BGHA 3KY2A 2R3MA 2ETRA 5F1ZA 2R3OA 3Q5IA 2QONA 3DQWA 4DEGA 2WQMA 3VBYA 5AAGA 5JZJA 3R9RA 4EHEA 4ONAA 5AP4A 5CENA 1WVXA 4OAVB 5AA9A 3P5KA 5E91A 4DFXE 4CGAA 2PVNA 3MDYA 5M56A 3QU0A 2XNBA 4XLVA 5AP6A 4PWNA 4M0YA 3NWWA 4RJ4A 3QXOA 5F20A 2O3PA 4YJQA 4L7FA 2ZAZA 4CMUA 2IPXA 2UW0A 1XBAA 1WMKA 3OUNB 4R78A 2X7OA 2BILB 2EB3A 4AW2A 2EVAA 1EH4A 2HXLA 2HOGA 4GCJA 5M4UA 2I0VA 5CU6A 4FIIA 5K3YA 5ANGA 5JK3A 4XP2A 5TR6A 4EH2A 5DR2A 1APME 1ZWSA 4I6FA 4JDHA 4AXFA 1FQ1B 3EQBA 2VTNA 2CHLA 3OW3A 2BZKB 3HYHA 5IQCA 4K9YA 5AP2A 2F7XE 2P2HA 2VV9A 4A9YA 2ESMA 2OZAA 3KCFA 5L4QA 1XWSA 3DZQA 2W1IA 4I94A 4RIWB 5DBXA 4WT6A 5FM2A 5LOHA 2XNGA 4K1BA 4QNAA 3EZVA 4JG8A 4O0XA 1YRPA 4RWIA 2BDJA 3O8UA 3BI6A 3MIYA 4AG8A 4EH4A 3E63A 4DHFA 2LGCA 4NUSA 3CBLA 4G2FA 4ZTSA 4BGQA 2ZMDA 3D7TA 1Q8TA 2O63A 3PFQA 4V05A 5LVOA 4MF0A 4QDEA 2WEVA 4J7BA 3W10A 3ZXTA 3ZO2A 3L8PA 3NUPA 4FV1A 2I1MA 3OXIA 3IPHA 4JR3A 3ZUUA 3FI2A 4QQJA 4ZY5A 5M44A 2GS6A 4FTAA 1YOMA 4CXAA 5BVOA 3Q9ZA 5A14A 3U9NA 4BDJA 2PUUA 4B9DA 3IK3A 4D2TA 1MUOA 2UW3A 2XNPA 5IISA 4UBAA 3LXPA 3EQFA 5TKDA 4JDIA 1MRYA 3SX9A 5EM5A 2PMOX 3C0HA 3QCQA 3HX4A 3UBDA 3VS1A 5BX0A 3GC9A 3N51A 4X21A 1VR2A 3PZHA 3C7QA 3TNHA 3LCDA 3MH2A 4WRGA 1O6LA 2XH5A 1Q8ZA 3P0MA 5ANIA 2VZ6A 4KNBA 2XA4A 3KULA 1OVEA 4KSPA 3ATSA 2W4OA 3PPZA 4H39A 3G51A 4UMRA 4IDVA 4GW8A 4Y46A 4XP0A 5DN3A 2QNJA 2ITVA 3ORPA 2E2BA 4KAOA 5GIOE 2JDOA 3GU5A 4L01A 4YO6A 1YI6A 3BHVA 5EW9A 3UVQA 4A9SA 1PXOA 2XIZA 3Q5ZA 5EQEA 2X2LA 4AXEA 1R3CA 2ZJWA 4YTHA 3OCTA 3VBWA 2YAKA 3SXSA 4PP7A 4FRFA 3F2RA 3HMOA 4RIXB 2QG5A 3VBVA 4Z7GA 3QZFA 1K3AA 3KRRA 5DI1A 3BE2A 4A7CA 4M12A 4AA0A 3SGCA 4TWCA 4TKSA 3AT3A 4G9CA 4NU1A 1FVRA 3TJDA 4KIQA 2YA9A 4RGJA 2R0IA 4ORKA 3UTOA 4E5WA 3RAHA 4CFXA 3SOCA 4ANNA 1UWJA 4DE4A 4C33A 4RJ5A 1LEZA 1TFFA 4RX9A 3DKFA 4IX3A 2NRUA 4DT9A 3PRIA 2R7BA 3WZUA 1ZOEA 3BRBA 2CNQA 4GFMA 4JIKA 3F69A 5LMKA 3EN5A 2ETKA 3GCUA 4D28A 4FKLA 3WYXA 2VGOA 1H1PA 4PNKA 4A06A 5JGDA 5FTQA 3HV4A 3QZGA 4PTGA 2XBAA 4G34A 4LV8A 1R0PA 4UYNA 4EOIA 4U80A 4FA2A 4FKRA 2C6OA 3TKHA 3FKNA 2JLDA 2JFLA 1UKHA 5BVFA 4HYHA 5CAPA 1W82A 3I1AA 2J7TA 5HD7A 3P7AA 5H9BA 3F3ZA 3WILA 4EC9A 3PXRA 1E1XA 2YJRA 3K5UA 3PYYA 1RJBA 1V0PA 3QUDA 5AX3A 2V0DA 5CAQA 4ZLZA 2OO8X 4MNFA 4Q2AA 1IR3A 3TTIA 5I0BA 1XH9A 3DDPA 4RFYA 4F0FA 4FIHA 2XK7A 4MD8E 2ZYBA 2X8EA 4BBMA 2RFNA 3NNWA 4BBEA 4APPA 1ZARA 4J95A 4AWIA 3BHTA 3Q2MA 2UZUE 3EH9A 4O7ZA 3QKMA 2G2FA 3PUFC 5FG8A 4D0WA 4C02A 3KGAA 4YZMA 3ITZA 5ANKA 4MVFA 4O96A 3ZONA 5JFXA 2A2AA 2OJJA 5KO1A 2R4BA 3R6XA 3ZC5A 5DEWA 4BI0A 4YZCA 1PMUA 5JRSA 1PXNA 5BVWA 2UZNA 3FMKA 3Q4UA 3R28A 4YNOA 3RJCA 4DH7A 2CNVA 3NS9A 1OIRA 3FMLA 4GSBA 3ZM9A 4O7SA 4TPTA 5JZNA 4GK2A 5JGAA 2Z7SA 1FGKA 4XBUA 4WBOA 4RX8A 4QP3A 3UP7A 2C3KA 3TI1A 3ZEPA 5A3XA 2J0JA 2PK9A 4Y8DA 4FTCA 5EHYA 4FOBA 2BVAA 4ACGA 4CFWA 5AA8A 2XNEA 4IQ6A 4M14A 3WZJA 1PXIA 5KUPA 5LVPA 3QCSA 1Z57A 2IZUA 4XLIA 5D9HA 4HVSA 4IFCA 3RNYA 5ETFA 5HI2A 4OTQA 3LMGA 2XJ1A 3RPYA 5IZFA 2HAKA 3RZFA 3DFCB 4DEEA 4MEDA 4UZDA 4U41A 4W9XA 3KC3A 3QFVA 1Q5KA 1M17A 5EHLA 4ANMA 4JAJA 4EC8A 2CGUA 1BKXA 3AC5A 3OMVA 5CU4A 3SRVA 3ZLSA 4U44A 1WBPA 2X8IA 2XJ0A 3OBGA 5IA2A 1PXPA 3C4EA 4RIOA 3OP5A 3PJ3A 3QD2B 3QQFA 4U79A 5CSWA 3V04A 2CNUA 5AUVA 4BCIA 4YGAA 2CGWA 3UC4A 4IMYA 3DKCA 4Y85A 4F08A 2C6EA 2ZVAA 5DEYA 3PJCA 4E6CA 3E5AA 5DRDA 5CF5A 4Z3VA 5FQDC 5J9LA 3W0NA 5CSPA 1Y8GA 4FG8A 5EH0A 2W1CA 3WZEA 3V5LA 4AN9A 2EWAA 5GIPE 3TL8A 2BZJA 1NT2A 5J95A 4MBIA 3TXOA 4IB3A 3G5DA 1OB3A 3QTZA 2C5YA 3EIDA 5T6KA 2IN6A 4DGGA 5CVGA 2JBPA 4Z9LA 2ZM3A 4UYAA 4DFYA 1M2RA 3BZ3A 2W05A 4HYUA 5K0KA 3BGPA 5KHXA 3N4UA 2OU7A 4QMWA 3ZDIA 3SQQA 1JKKA 3D0EA 3UQFA 3DK7A 3PUPA 4EH8A 4YTIA 4C3PA 3ORKA 1HOWA 5AJQA 3C51A 4EOLA 4A9UA 4D2RA 5JSMA 4AZEA 2YAAA 3RCDA 5KKRC 3BKBA 4BIDA 3CSVA 3CJFA 4CZUA 5JT2A 2X0PA 4DH8A 3GOPA 3ET7A 2WD1A 3DNEA 5E4HA 3COKA 1HCKA 3F88A 4O1OA 5CT0A 5BUJA 3H9RA 3DBCA 4BDDA 5DYJA 4QD6A 4BL1A 4U42A 3DB8A 3MBLA 1W0XC 5HG8A 1SVHA 3A4OX 3Q04A 2RIOA 4CMOA 3HDNA 1IAJA 2ZB1A 3BIZA 1CSNA 3R01A 4I21A 1M7NA 4U3ZA 4X7QA 5DT3A 5HNGA 3RWPA 5IQAA 4JDKA 3WOWA 1H28A 3QLGA 4GIHA 5HX8A 3KMWA 3EFJA 2J51A 3MVMA 4XP3A 2JEDA 4XUFA 2R7IA 4C4IA 1PMVA 2FUMA 2HWOA 3N9XA 4U97A 1OUKA 4WG5A 3DA6A 3ODZX 2WOTA 4A07A 2X4ZA 2F2CB 3C5IA 2OIQA 2RF9A 3FI3A 4IACA 2XRUA 2FVDA 2X4FA 4OR5A 3VBXA 4QMYA 4I92A 4FKTA 3MTFA 4NCTC 2LAVA 4EEVA 3A62A 1JSUA 3AMBA 4PDSA 2C0OA 3FMMA 3LFNA 1R39A 1GZKA 4FT7A 4PP9A 4XRLA 2UW4A 4FT9A 4ZAUA 2VTIA 5A4EA 3CC6A 3TIZA 1J7UA 2Y8OA 3P08A 4FEVA 5HORA 3VULA 1OBGA 2XANA 4EH9A 4FX3A 4UWBA 4BZNA 2WOUA 1VLRA 4CLIA 1O6YA 3FJQE 4DF3A 4EZ7A 3ORTA 1W98A 3KU2A 1JQHA 4AOTA 2Z7LA 4MBLA 3O71A 2HZ4A 5IQEA 2YCFA 2AUHA 4BTMA 4R3RA 2GQGA 3U6HA 3OW4A 2QVSE 4NKAA 2OZAB 1U59A 2C6MA 4F0IA 1Q8UA 4YJRA 2BAJA 4EL9A 3UGCA 5J5TA 1ST4A 2QD9A 5HOAA 2RSVA 2UZBA 5B7VA 4BJJA 3H9OA 3R21A 4L8MA 2W5AA 2PMIA 3GCVA 1KE7A 3E62A 1YI3A 2C47A 2PY3A 3GXLA 4DEIA 5HHWA 4YJPA 5D10A 4IADA 3R1NA 5IH5A 3PP0A 5JQ8A 1PMEA 4KINA 2PE1A 5DNRA 4HJOA 1BL6A 5EW8A 3DXPA 5HGIA 3L8XA 4IFGA 3GP0A 1JKLA 3SG9A 2PL0A 4NTTA 3TEIA 1OKVA 3TMOA 1ZY5A 3GU4A 4C58A 4MNEA 2YEXA 4PV0A 5DRBA 1OECA 2X9FA 4FV4A 4OTPA 3R9OA 4UZHA 3COIA 5IA4A 4FV7A 5H2UA 4J99A 5J1WA 3E92A 4PPCA 4O2ZA 4EK8A 1STCE 2UW9A 1U5RA 1W2FA 4GG7A 4AU8A 4JG6A 4G3FA 2W5BA 4IVDA 4RJ3A 1MRVA 4C7TA 4E26A 4C4GA 1OIUA 2XF0A 4LYNA 4RQKA 5AR8A 5TT7A 4FC0A 3R7VA 1SM2A 4I5PA 4AGWA 1YDTE 2Q0BA 4Q9ZA 4KIOA 4AW5A 1AQ1A 4L3PA 2QO7A 3GQLA 4TYHA 4FNWA 4ASZA 5BVDA 5GJGA 4UN0C 4BICA 3NYXA 2GHGA 3W2PA 3LLAA 4W4XA 4BZDA 4HCVA 2YIRA 3FYKX 2PVJA 3PWDA 4AAYA 3BU3A 5DPVA 3U8WA 4D58A 4E4LA 1TZDA 5CF4A 1Q99A 5I5ZA 3MFUA 4ZXTA 1ATPE 3G33A 4DN5A 2JKKA 3F6XA 4EYJA 3ZDUA 4D55A 1H08A 3FKOA 3Q3BA 4YLKA 3ZMMA 4D2SA 2OF4A 3WF5A 4CQGA 5CASA 3PLAE 1KOBA 5CU2A 2XALA 4R77A 1PKGA 2SRCA 3BLRA 4GK3A 5EHOA 4WD5A 4KRCA 4N6YA 4OTWA 1JPAA 3RPVA 5A4CA 5IDPA 3ANRA 1PXJA 1UKIA 4BBFA 2PUPA 2WTKB 4I1ZA 2VTPA 4DT8A 5L2QA 5G1XA 3PVGA 4BHZA 4F0GA 5EI2A 3UDTA 1LPUA 2P4IA 3DU8A 3I6WA 5HESA 2WEIA 4FIGA 3AKLA 3IW4A 5CWZA 3QC9A 3DJ5A 1ZMWA 2REIA 4AQCA 4I6LA 3DXNA 4O86A 4XRJA 1MQ4A 2QLQA 4HOKA 1PF8A 4RC2A 5M06A 1AGWA 4IAFA 3A4PA 3FXWA 4NM5A 4E4XA 2WU7A 4JXFA 4XS2A 3U54A 4BCKA 1BYGA 5ACBC 4D0XA 4GKIA 2YM6A 4Q9SA 4CYJA 2WXVA 1OBDA 3NGAA 1YXTA 3BHHA 3BEAA 3LFSA 3TZ9A 3QA0A 3OTVA 4O4FA 2BKZA 2WTVA 1I09A 3LFDA 3NLBA 4UB7A 4BCFA 4MAOA 4FIEA 5CQWA 1OL7A 1ST0A 3NVKI 2VAGA 2BIYA 3GCPA 1BX6A 4CG8A 5E8XA 2BMCA 3GT8A 2P33A 2RG5A 3UIBA 2I0EA 3JVRA 1RW8A 5HU3A 1BI8A 3MB7A 4E7WA 1P4OA 1QPEA 3QRKA 4PQNA 3W18A 4B8LA 4ZTMA 4U0IA 2J90A 4MK0A 3JYAA 1L3RE 3LVPA 3V8TA 4R1VA 5LMAA 4ERKA 3C4WA 3KXNA 3I6UA 4DTAA 2W4JA 3BU5A 5BUIA 2R3LA 4J71A 2G1TA 2G01A 4LGDA 3R1SA 5JRQA 4E8AA 1KE5A 2X0GA 3B2TA 4EONA 5C01A 3DKGA 2YM3A 4IXPA 3R02A 5K4IA 2X6DA 3MVJA 4F7JA 2GS2A 5I4NA 4HCUA 4FV8A 2VO7A 5EDQA 5BPYA 4FIJA 5E8TA 4J97A 3UQCA 2HXQA 4FG7A 2QHMA 2XS0A 3CP9A 1YWVA 1QCFA 3DPKA 3FC1X 3P9JA 5EKNA 3GCQA 4HVDA 3DB6A 3ODYX 3E8CA 1IASA 4V01A 3JXWA 3JY0A 4YJUA 3UZRA 4FKVA 4AGDA 5EM8A 5JFSA 1KE9A 2C68A 3I4BA 4FKQA 5LCKA 4HYIA 4ITIA 5DOSA 2IJMA 3FSKA 4NKSA 3VS7A 4FL1A 1FGIA 2WTIA 3T8OA 3FQHA 3COHA 5L8LA 2C1BA 5EM6A 4OTHA 2WQEA 4JBPA 3L9PA 4BCJA 1IAHA 4GT3A 3QTIA 4YHFA 4RZWA 2CMWA 2YM5A 1TQMA 3BV3A 2XM8A 3R9HA 3H4JA 4UXQA 1UU7A 3BWFA 4XJ0A 4XOZA 5CEKA 4KA3A 4USFA 1YHVA 3B8RA 1G8SA 3V5WA 4JLCA 4AT5A 3OBJA 3PDTA 3UDSA 4JL9A 1URWA 2OJIA 5EW3A 4CFMA 3P7BA 4YJTA 3LXKA 1KUTA 3NFFB 4AGCA 4FG9A 2ONLC 5ANOA 3W2SA 4FSQA 3H0ZA 4ZY4A 4MXZA 3DBEA 3DTWA 3ORLA 5IQGA 5CAOA 5A4QA 3GC7A 4YC8A 5E90A 3EN4A 3PIYA 2PPQA 4CFUA 4J96A 4WUNA 4BGGA 4RVTA 5F95A 5GNKA 3LCKA 5AUWA 5AV1A 4FL3A 1RE8A 4I41A 5GZ9A 2WQBA 4IC7A 4E6DA 4BDHA 2PULA 4ZJIA 4FTLA 5CSHA 4JOAA 2JKMA 4P5QA 3FWQA 4KIKA 4Y95A 4ZTNA 3ZLYA 4CV9A 5GZ8A 4IZYA 5ICPA 4Z16A 2XK9A 3UG2A 4LQMA 3KN6A 4C2WA 4CKRA 1Q8YA 1OL5A 3D14A 4GV1A 1SZMA 3QXPA 4KBKA 4LI5A 3FHRA 2B52A 2XBJA 4GVAA 4ZS0A 4U81A 4BFMA 4L46A 2NNWB 3F5XA 4D2WA 3OXZA 2C5OA 2WTCA 4IHPA 1CKPA 1GOLA 3I5NA 2OIBA 3L9MA 4M69A 3R22A 3OOMA 3UYSA 5FWKK 4BTFA 4YTCA 2QU6A 3DNDA 3PZEA 4HYSA 4RFMA 3SLSA 4H58A 3UMXA 1YWNA 4O4DA 4L6QA 3NFGB 4GMYA 3P7CA 1PXMA 3CXWA 3UP2A 4G3GA 4RIYA 3O17A 3KCKA 5DFPA 4B4LA 2Q0NA 3MJ1A 1DI8A 3CLYA 4FVQA 3CGFA 1KSWA 4OTDA 4DHZA 4H3QA 2E9NA 2QQ7A 3Q9YA 4YP8A 5E8ZA 3IGGA 4NFNA 2VD5A 3G6HA 4TXCA 1GZNA 1O9UA 3VQHA 4BDKA 4U5JA 5B2LA 1QPJA 5AMNA 3GGFA 4O4CA 4I3ZA 3DOGA 4NSTA 4EOOA 1XMLA 3R7IA 3Q53A 4TNBA 3VHEA 1G8JA 3D4QA 4IJ9A 1JKTA 5E8VA 1DAWA 4YBJA 4FTMA 1M7QA 3HRCA 4DH1A 5IEYA 1W8CA 4M15A 5DG5A 3HKOA 3NW5A 1IG1A 5EG3A 3GU7A 4H36A 2HZ0A 4WA9A 3UO4A 3PWYA 1J7IA 2A0CX 5CI7A 4GU9A 4ZP5A 2QOCA 2VX1A 2YCSA 4XG4A 2FO0A 3KF7A 4IAIA 4E6AA 4BJJB 2VTMA 2B4SB 3BU6A 3QKLA 3LM5A 4IJPA 3ZS5A 4QMUA 2J2IB 1Y91A 3FZTA 3TJCA 3LXNA 5DWRA 3U51A 4L7SA 4R6VA 4IX4A 4YC3A 4RWKA 3WBLA 4MQ2A 4MQ1A 2V62A 4U8ZA 2OW3A 3D15A 4RVLA 3MH3A 3KMMA 3TKIA 3R83A 4EOKA 1WVYA 4FZ6A 4CKIA 2UZEA 3CQWA 4FTKA 4MWHA 1GNGA 2WMBA 3HGKA 3RKBA 2XMYA 3RP9A 4EJNA 2YCQA 4D1XA 3R30A 3F7ZA 3EFWA 3QWJA 5LVNA 4I4EA 3IDPA 3OCBA 1Q3WA 3QHWA 3QD0A 3B8QA 4JI9A 2E9UA 4BHNA 4L67A 3KL8A 4C3FA 1RDQE 3N4TA 3ERKA 1YXVA 5HO6A 5I9ZA 3QQLA 4QEBA 2DS1A 4FIFA 1Q4LA 4BZOA 2BALA 4FTJA 1PMNA 4FKJA 2VX3A 1MQBA 4RMZA 1LEWA 5FXSA 1Q8WA 4RVKA 2VTQA 3PXFA 4JRVA 3PIZA 3MI9A 4GKHA 3JPVA 5I3OA 3LIJA 3EN6A 3IW5A 4FT0A 4YJVA 4BRXA 3D7TB 3CTHA 4TY1A 3PJ8A 2PMLX 3QQKA 1J1BA 5TE0A 4XBRA 3VW8A 2XNOA 3C4FA 5FEEA 2QOOA 4O21A 2JDRA 5AAEA 3SC1A 3TIYA 3GENA 3NUXA 1M2PA 4U3YA 4H3PA 3VUTA 3E3PA 4E3CA 5F4NA 4QPAA 3FZOA 5ETIA 4X6QC 5CEMA 4ZY6A 2B9FA 2FSMX 3NX8A 3PFYA 4JMQA 2VWYA 4CT2A 2WELA 3F5GA 3PSDA 3Q60A 4KIPA 3T3VA 3W0PA 5E8SA 5HZNA 4ANOA 4MXXA 3UO5A 4XOYA 2FH9A 4PUZA 2WMVA 4C4JA 1YDSE 1MRUA 3KN5A 5M57A 5IUGA 3L8SA 4F9CA 3QTUA 2OI4X 3DQXA 1OL6A 3ACKA 3IDBA 5A4TA 2QR7A 3BYUA 2YDJA 3H0YA 4TWPA 3TV7A 1ZLTA 4EUTA 3PY1A 3C9WA 3LOKA 3EYGA 3MY5A 5DR6A 3GUBA 1FOTA 1OI9A 2I0YA 4FTRA 5A4LA 4K18A 3UPXA 1SMHA 2WAJA 3E64A 4BCGA 1KOAA 4M69B 4JX7A 3WIGA 2A27A 4X2JA 5M09A 3RNIA 3VRYA 3K3IA 2JDTA 2VWXA 3QRIA 5E8UA 5C27A 4QQTA 4OT5A 5DA3A 5CVHA 3QTQA 4TT7A 1ZXEA 4DGOA 2YHVA 4YNEA 1UU9A 5LARA 1R1WA 3ORIA 3BCEA 2H34A 4DDIA 3GQIA 1UU3A 5HG7A 1ZOHA 3WE8A 2BRBA 2WNTA 3LLTA 4K0YA 4O4EA 3OWLA 4N0SA 5TOZA 2WMQA 3VHKA 4A9RA 4ACCA 1GY3A 4NL0A 3FLZA 4ITHA 3ZO3A 3RHXA 4BI1A 4K8AA 3TV6A 2OBJA 3AT2A 4RC4A 5AR7A 5I9YA 4FTTA 2VO3A 2ZFYA 5EDRA 3A61A 3RGFA 4E5BA 3TM0A 2JD5A 2JKQA 2XK8A 1H00A 2HK5A 5FGKA 5LWMA 2X6EA 2FSTX 4LFIA 4MNEB 4E73A 3R71A 2W96B 3POOA 4HNFA 4ID7A 4J98A 5DIAA 4O0YA 4BCNA 4GYGA 3FC2A 4FOCA 5J9YA 3NNUA 1Y57A 3OXTA 2CN8A 2I6LA 4FKSA 5EOBA 3T9IA 4J53A 3UDBA 4NK9A 2OH0E 3MGYA 4FR4A 4PF4A 2XAOA 2VTTA 5K5NA 2CKQA 4G6LA 4DTBA 1P5EA 3O8PA 3Q9WA 4IX6A 3FUPA 1Q24A 4LOQA 4FSRA 3OY1A 3EKNA 3JR1A 3TDWA 4XG2A 3OOGA 4XHKB 3DAJA 4F7NA 4G3DA 3RPOA 3S1HA 3ZC6A 2OXXA 4M13A 5IUHA 3AT4A 4WKQA 3U6IA 4AA5A 1B6CB 4PNIA 4UWYA 3KRLA 2DYLA 5ETCA 3S4QA 1TKIA 1FINA 4KKEA 1FPUA 4XCUA 3QC4A 5EQPA 5E7RA 4U9AA 3IQ7A 1HCLA 3A7HA 3D94A 4QQ5A 3HV3A 4DGMA 2YIYA 3R1YA 2Y4IB 2JIVA 2ZM1A 4N6ZA 4Y5HA 4LV5A 2VO0A 5IEXA 4ALWA 2PZIA 2X2KA 2YIXA 3SHEA 2CDZA 4Y5QA 5CF8A 5HG9A 4HZSA 2O65A 2XNNA 4M3QA 3IW7A 3LFBA 1JOWB 4PX6A 5EYMA 5JMSA 3AD4A 2EUFB 4ZTQA 5HVJA 4NZWB 5J79A 3ORMA 4S32A 4TYJA 4ZLOA 2EU9A 3LFAA 4DA5A 1URCA 3E7OA 4KD1A 4E20A 3UZPA 1I44A 3GNIB 4RPVA 4CQEA 2R3JA 3EL8A 2CJMA 3I7CA 3QD3A 3DT1A 1TQPA 4L3JA 4AZSA 2J0MB 2RGPA 3HVCA 3HMIA 3PTGA 4RC3A 3W0QA 2IVUA 4CMTA 2J0KA 3R8LA 2C6LA 4P4CA 5FBOA 4C4FA 3Q2JA 4L45A 3WZKA 3KQ7A 4CV8A 2ZV2A 5BVNA 3JUHA 3MA3A 3QL8A 1IRKA 1F0QA 3ZFXA 1UU8A 4L52A 2GNGA 1GZOA 4F6SA 3DV3A 5LCJA 4DAWA 2PE0A 3PG1A 2F57A 3W16A 5FXQA 5C8MA 4XV1A 4AOIA 3LM0A 5AADA 4H1JA 3O23A 4O6LA 1CKIA 2X0OA 2XYNA 1A9UA 5D12A 4Q5HA 3V6SA 4CCBA 3MH0A 2R9SA 2W1DA 2ZMCA 2C3LA 4PL3A 4ZEGA 1GIIA 5HIEA 3VS2A 4E5AX 2WMRA 2W1GA 5CYIA 4RQVA 5HICA 3AKJA 3VAPA 2UVYA 2P0CA 3G6GA 4PL4A 5IQBA 5FRIA 3ZFYA 2QKWB 3K2LA 2XIRA 3P4KA 4QTAA 1R78A 1M14A 1V0BA 4NWMA 4EOMA 2QCSA 1O6KA 4QP4A 1FMKA 1K9AA 1W83A 4L00A 4S31A 4BDFA 4F78A 4FNXA 4FODA 3AC1A 4KRDA 2PTKA 3MW1A 3QWKA 3VUIA 1OL1A 4UY9A 1H26A 4YSMA 5FDXA 3QGYA 2QOHA 4FKOA 2JBOA 3ZLWA 5CEPA 5HU9A 4O7LA 3MY0A 2YIQA 1J3HA 5AV2A 2PWLA 4TW9A 4NM0A 2GHMA 4QP8A 3VJNA 2HCKA 4PDYA 3R8PA 3T9TA 4APCA 2IVTA 1OPJA 2OKRA 4PDOA 2WMWA 1Q3DA 2WB8A 4K33A 4CSVA 3FI8A 4DLJA 4W9WA 3R2BA 4AFJA 5BMSA 5CX9A 3TZ8A 4DH3A 3FZPA 3MV5A 4JS8A 4AQKA 2RFEA 3QX2A 3E8EA 2W4KA 1LR4A 3M11A 4FUYA 4GH2A 4GRBA 1KE8A 3QUPA 4RA4A 5FP5A 3RZBA 4U40A 3SD0A 4NTSA 4YJNA 5HTIA 2UW6A 2UZVA 4K77A 3FYJX 2CCHA 5JQ5A 3AXWA 2Y6MA 4EH6A 1YW2A 2UZLA 1NVQA 2ZV7A 1XH7A 4PDPA 3FMDA 4RBLA 3OEZA 5FEQA 4FNYA 3ID6C 5KX8A 4E93A 4QPSA 3PY3A 3WE4A 5T68A 4EWHA 3TT0A 4F1MA 4TWNA 4FF8A 3QKKA 2YDIA 4U7ZA 4DCAA 3UOKA 1G8KA 2UZTA 2WMSA 4EH3A 2XKCA 3PSCA 4FL2A 4EKKA 2BTRA 5J7HA 4FNZA 2XVDA 3P86A 4QP9A 4WG4A 5HE3A 2JDSA 5IUIA 3RPSA 3EMGA 3TTJA 2ZV9A 2B0QA 2JC6A 3RK7A 4FGBA 2O5KA 3NMUF 2WIPA 5LXMA 3UVRA 2VTHA 1GIJA 3CCNA 2OH4A 1OPLA 2V7AA 3HP5A 5M51A 5IU2A 3LJ1A 5J5SA 5BMMA 2E9PA 4WIHA 2GQSA 5L2SA 1LP4A 3AGLA 4IVCA 2XCKA 4IWOA 5I9WA 5JH6A 1ZY4A 4BIEA 3EL7A 3LXLA 4EOQA 5EQYA 4HW7A 3BLHA 3LFQA 2Z8CA 3GFWA 2FA2A 5IA3A 1SVEA 2YWPA 3E8NA 3KEXA 4NCTA 5E1EA 2QG7A 2BRHA 2ZV8A 4QMPA 1WAKA 2GDOA 2YM8A 4QMNA 5E8YA 4FE2A 2W9FB 4DHIB 4QTCA 4O7NA