4QNBA

Disulfide stabilized hiv-1 ca hexamer in complex with phenyl-l-phenylalaninamide inhibitor
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
219
structure length
215
Chain Sequence
b'PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVTETLLVQNANPDCKTILKALGPGATLEEMMTACQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of HIV-1 capsid recognition by PF74 and CPSF6.
pubmed doi rcsb
molecule keywords CAPSID PROTEIN P24
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Viral protein/inhibitor
total genus 76
structure length 215
sequence length 219
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4qnbA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4qnbA02
3VRLC 4U0CA 4PH3A 4U0FA 4INBA 2XT1A 4DGAC 4XROA 4U0EA 5DCKA 3MGEA 3DS3A 5I4TG 3DPHA 2M8PA 4J93A 2XDEA 3G29A 2EIAA 4M0IA 3DS4A 4IPYA 3G1GA 1P7NA 2X82A 1EM9A 4QNBA 2XGYA 1U7KA 2ONTA 4LQWC 1AUMA 3G28A 4XRQA 1M9EC 1EIAA 2PWMA 3DS2A 3P05A 5HGLA 3H47A 2GOLB 2JYLA 1EOQA 2WLVB 4B4NA 4COPA 2GONA 1AFVA 2V4XA 2X83A 2PXRC 2BUOA 1M9CC 3G21A 2JYGA 3DS5A 3NTEA 3BP9A 1M9DC 2X2DD 2KODA 4E91A 2XV6A 4DGEC 2XXMA 2Y4ZA 3DS0A 1M9YC 3G1IA 5HGMA 4U0BA 4U0AA 4XFYA 4PH1A 3DTJA 5HGOA 1GWPA 3LRYA 1BAJA 1M9XC 2WLVA 4NX4C 2L6EA 2KGFA 2JPRA 2XGVA 3H4EA 4PH0A 2M8NA 2PWOA 5HGKA 4WYMA 2XGUA 3G0VA 4XFXA 1AK4C 4E92A 1QRJA 1E6JP 4PH2A 4XFZA 1M9FC 1A43A 3DS1A 2LF4A 4COCA 5JPAA 4HTWA 4U0DA 2JO0A 1L6NA 1A8OA 1G03A 1D1DA 3G26A 5HGNA 2M8LA
chains in the Genus database with same CATH superfamily
2K93A 2N98A 3VRLC 4NEOA 2DNWA 2VLQA 1QVGO 3NY7B 5DCKA 3DS3A 2VLNA 2PY8A 2N6YA 2FVEA 3E2DA 2KOSA 1K8AQ 1L0HA 1P7NA 2X82A 3HZQA 2PEQA 2MY5A 1YJWP 2K0DX 4QNBA 1U7KA 2JBGA 2ONTA 1VQ5P 1M6NA 3G28A 4XRQA 1RO0A 1EIAA 1RNIA 2PWMA 3DS2A 4QKOA 1IMQA 2GOLB 2Z46A 2FQ2A 4COPA 2GONA 1AFVA 2X83A 3G21A 4MRTC 3CCEP 3WBHA 2XZ0D 3CCJP 2JGPA 3EJBA 1M9DC 2KOPA 2N5IA 2X2DD 1YHQP 4E91A 1VQOP 5KP6B 4PH1A 4U0AA 3DTJA 2LMLA 2GZFA 3CCVP 3CPWO 1VQLP 2FACA 1X3OA 2PNGA 3CC2P 2PEMA 2CQ8A 1VQNP 1OR5A 3RG2A 2MD9A 4WYMA 4H2XC 3G0VA 2MVUA 1KC8Q 1VKUA 1FR2A 3B4QA 2GZJA 5JPAA 2BHVA 5HVCA 1D1DA 2X2BA 3G26A 1Q86Q 4INBA 2PEKA 4DGAC 2GYKA 4XROA 2PEJA 2MR8A 5F2KA 3DPHA 4J93A 4M0IA 3OW2O 5BS2A 2L22A 1Z6MA 2KR5A 2JU2A 2CGQA 1GXHA 3CCUP 1VQKP 3GZMA 2FVFA 5EW5E 2OARA 1M9EC 1EMVA 2OTJP 1M90Q 1MZ8A 3P05A 3HYBA 4BPGA 3CMAP 2L4BA 2JYLA 2Z45A 2WLVB 1K73Q 1M9CC 1GPJA 3I55P 5BS1A 2JYGA 2EG5A 1T8KA 2AF8A 3BP9A 2KODA 4BPFA 3U43A 2XV6A 4R0MA 2N50A 2EFJA 3CCQP 3DS0A 3G1IA 5HGMA 2KG8A 5HGOA 1BXIA 1GWPA 2JU1A 1BAJA 1M9XC 1KLPA 3H4EA 4PH0A 1JJ2O 2M8NA 2K94A 1Q82Q 4XFXA 4E92A 3GZLA 3G4SP 1E6JP 2JB0A 4XFZA 1M9FC 2VLPA 4COCA 3RG6C 2FQ1A 4HTWA 1L0IA 4U0DA 2LOLA 1HQBA 2K0YA 1ZMBA 1ACPA 1AF8A 1YIJP 5HGNA 3CC4P 1UNKA 2AVAA 2VLOA 2K0XA 5EJDA 5F2NA 4U0CA 2WPTA 1NJIQ 2P9XA 1GXGA 2EHSA 2LPKA 4PWVB 2GZEA 3MGEA 2KG6A 2Z44A 2M8PA 2FADA 2MF4A 2KGEA 4GR2A 1VQ7P 2XDEA 3G29A 4H2YC 2KORA 2KGAA 4HKGA 1Q7YQ 1KD1Q 2KOQA 3G1GA 2CNRA 4F37A 2K5XA 1VQMP 1VHNA 2XGYA 4LQWC 1AUMA 2L9FA 1YJ9P 2KWLA 3CMEP 1AYIA 3I56P 3H47A 2E1MA 1Q81Q 1VQ4P 4B4NA 3EJDA 3DS5A 5KP8B 3GJNA 3NTEA 2QA4P 2K92A 2FVAA 4DGEC 2XXMA 2GDWA 2Y4ZA 2AFDA 2N6ZA 1M9YC 2QEXP 2PEOA 4U0BA 4XFYA 2LL8A 5CZDB 3LRYA 4NX4C 2L6EA 4BPHA 2KGDA 2XGVA 2MR7A 2CWOA 2XGUA 1VQPP 1W2BO 1E0HA 3B5IA 1QRJA 4PH2A 1A43A 5KP7B 1VQ9P 2N5HA 3CXCO 2L0QA 2GZIA 1A8OA 2JQ4A 1NQ4A 2M8LA 1IUQA 3M1MA 4PH3A 4U0FA 2FAEA 2OTLP 1VQ8P 4IZ6A 1KQSO 1RO2A 2XT1A 2NO8A 3CCLP 4U0EA 5HV8A 5I4TG 1QVFO 1YITP 2LIWA 2KG9A 3LMOA 2AFEA 2K2QA 2EIAA 1DNYA 1M1KQ 2KOOA 3DS4A 4IPYA 1K30A 2DGYA 4GR6A 1EM9A 3CD6P 2PEIA 2CG5B 2GDXA 1ZNVA 2KW2A 5HGLA 1UJZA 3CCRP 3G6EP 1EOQA 1K9MQ 4UHPB 3Q20A 2V4XA 1M6EX 2PXRC 2BUOA 2PENA 4H2WC 2EHTA 2VSQA 1F80D 2LKIA 2QNWA 5F2OA 1VQ6P 1YI2P 4CA3A 2XZ1C 4PXHB 1YJNP 3EJEA 3GKLC 1HY8A 2KGCA 2M5RA 3CC7P 2MVVA 1DV5A 2GDYA 3CCSP 1CEIA 1M74A 2WLVA 2GZGA 2JAZA 2KGFA 3CCMP 2JPRA 3G71P 3CE7A 2PWOA 3H0DA 5HGKA 2LTEA 2FHSC 7CEIA 1AK4C 2ERHA 2FQ0A 1S72P 3DS1A 2ROQA 2LF4A 2JO0A 4DG9A 1L6NA 1G03A 2LIUA 1N8RQ 1IMPA
chains in the Genus database with same CATH topology
1IUQA 3M1MA 4U0CA 3VRLC 4PH3A 4U0FA 2P9XA 5F2NA 4INBA 1Q86Q 2OTLP 1VQ8P 2PEKA 1KQSO 1RO2A 2XT1A 4DGAC 4XROA 3CCLP 4U0EA 2PEJA 1QVGO 5DCKA 3MGEA 3DS3A 2PY8A 5F2KA 2Z44A 5I4TG 3DPHA 1QVFO 2M8PA 1YITP 3E2DA 4GR2A 1VQ7P 4J93A 2XDEA 1K8AQ 3G29A 2EIAA 4M0IA 3OW2O 1M1KQ 3DS4A 1Q7YQ 1KD1Q 4IPYA 1K30A 2DGYA 5BS2A 3G1GA 4GR6A 1P7NA 2X82A 1EM9A 3HZQA 1VQMP 2PEQA 1YJWP 3CD6P 4QNBA 2XGYA 2PEIA 1U7KA 3CCUP 1VQKP 2ONTA 4LQWC 1AUMA 1YJ9P 1VQ5P 1M6NA 2OARA 4XRQA 1RO0A 1M9EC 3G28A 1EIAA 1RNIA 3CMEP 2OTJP 2PWMA 1M90Q 3I56P 3DS2A 3P05A 5HGLA 3HYBA 3H47A 2GOLB 2E1MA 1Q81Q 3CCRP 3CMAP 1VQ4P 3G6EP 2JYLA 2Z45A 2Z46A 1EOQA 1K9MQ 2WLVB 4B4NA 4COPA 3Q20A 2GONA 1K73Q 1AFVA 2V4XA 2X83A 2PXRC 1M6EX 2BUOA 1M9CC 2PENA 3G21A 3I55P 5BS1A 2JYGA 2EG5A 3DS5A 3CCEP 3NTEA 3WBHA 2QA4P 3BP9A 3CCJP 5F2OA 1M9DC 2X2DD 1VQ6P 2KODA 1YI2P 1YHQP 4E91A 2XV6A 4DGEC 2XXMA 1YJNP 1VQOP 2Y4ZA 2EFJA 3CCQP 3DS0A 1M9YC 2QEXP 3G1IA 5HGMA 2PEOA 3CC7P 4U0BA 4U0AA 4XFYA 4PH1A 3DTJA 5HGOA 3CCVP 3CCSP 1GWPA 3LRYA 3CPWO 1BAJA 1VQLP 1M74A 1M9XC 2WLVA 4NX4C 2L6EA 3CC2P 2PEMA 2KGFA 3CCMP 2JPRA 2XGVA 3H4EA 4PH0A 3G71P 1JJ2O 1VQNP 2M8NA 2PWOA 3H0DA 2CWOA 5HGKA 4WYMA 2XGUA 3G0VA 1VQPP 1Q82Q 1W2BO 4XFXA 1AK4C 4E92A 3G4SP 1KC8Q 3B5IA 1QRJA 1E6JP 4PH2A 1S72P 4XFZA 1M9FC 1A43A 3DS1A 1VQ9P 2LF4A 3CXCO 4COCA 3RG6C 5JPAA 4HTWA 4U0DA 2JO0A 1L6NA 2BHVA 1A8OA 1NJIQ 1G03A 1ZMBA 1D1DA 1YIJP 3G26A 5HGNA 3CC4P 1N8RQ 2M8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRL C;  4U0C A;  4PH3 A;  4U0F A;  4INB A;  2XT1 A;  4DGA C;  4XRO A;  4U0E A;  5DCK A;  3MGE A;  3DS3 A;  5I4T G;  3DPH A;  2M8P A;  4J93 A;  2XDE A;  3G29 A;  2EIA A;  4M0I A;  3DS4 A;  4IPY A;  3G1G A;  1P7N A;  2X82 A;  1EM9 A;  4QNB A;  2XGY A;  1U7K A;  2ONT A;  4LQW C;  1AUM A;  3G28 A;  4XRQ A;  1M9E C;  1EIA A;  2PWM A;  3DS2 A;  3P05 A;  5HGL A;  3H47 A;  2GOL B;  2JYL A;  1EOQ A;  2WLV B;  4B4N A;  4COP A;  2GON A;  1AFV A;  2V4X A;  2X83 A;  2PXR C;  2BUO A;  1M9C C;  3G21 A;  2JYG A;  3DS5 A;  3NTE A;  3BP9 A;  1M9D C;  2X2D D;  2KOD A;  4E91 A;  2XV6 A;  4DGE C;  2XXM A;  2Y4Z A;  3DS0 A;  1M9Y C;  3G1I A;  5HGM A;  4U0B A;  4U0A A;  4XFY A;  4PH1 A;  3DTJ A;  5HGO A;  1GWP A;  3LRY A;  1BAJ A;  1M9X C;  2WLV A;  4NX4 C;  2L6E A;  2KGF A;  2JPR A;  2XGV A;  3H4E A;  4PH0 A;  2M8N A;  2PWO A;  5HGK A;  4WYM A;  2XGU A;  3G0V A;  4XFX A;  1AK4 C;  4E92 A;  1QRJ A;  1E6J P;  4PH2 A;  4XFZ A;  1M9F C;  1A43 A;  3DS1 A;  2LF4 A;  4COC A;  5JPA A;  4HTW A;  4U0D A;  2JO0 A;  1L6N A;  1A8O A;  1G03 A;  1D1D A;  3G26 A;  5HGN A;  2M8L A; 
#chains in the Genus database with same CATH topology
 2K93 A;  2N98 A;  3VRL C;  4NEO A;  2DNW A;  2VLQ A;  1QVG O;  3NY7 B;  5DCK A;  3DS3 A;  2VLN A;  2PY8 A;  2N6Y A;  2FVE A;  3E2D A;  2KOS A;  1K8A Q;  1L0H A;  1P7N A;  2X82 A;  3HZQ A;  2PEQ A;  2MY5 A;  1YJW P;  2K0D X;  4QNB A;  1U7K A;  2JBG A;  2ONT A;  1VQ5 P;  1M6N A;  3G28 A;  4XRQ A;  1RO0 A;  1EIA A;  1RNI A;  2PWM A;  3DS2 A;  4QKO A;  1IMQ A;  2GOL B;  2Z46 A;  2FQ2 A;  4COP A;  2GON A;  1AFV A;  2X83 A;  3G21 A;  4MRT C;  3CCE P;  3WBH A;  2XZ0 D;  3CCJ P;  2JGP A;  3EJB A;  1M9D C;  2KOP A;  2N5I A;  2X2D D;  1YHQ P;  4E91 A;  1VQO P;  5KP6 B;  4PH1 A;  4U0A A;  3DTJ A;  2LML A;  2GZF A;  3CCV P;  3CPW O;  1VQL P;  2FAC A;  1X3O A;  2PNG A;  3CC2 P;  2PEM A;  2CQ8 A;  1VQN P;  1OR5 A;  3RG2 A;  2MD9 A;  4WYM A;  4H2X C;  3G0V A;  2MVU A;  1KC8 Q;  1VKU A;  1FR2 A;  3B4Q A;  2GZJ A;  5JPA A;  2BHV A;  5HVC A;  1D1D A;  2X2B A;  3G26 A;  1Q86 Q;  4INB A;  2PEK A;  4DGA C;  2GYK A;  4XRO A;  2PEJ A;  2MR8 A;  5F2K A;  3DPH A;  4J93 A;  4M0I A;  3OW2 O;  5BS2 A;  2L22 A;  1Z6M A;  2KR5 A;  2JU2 A;  2CGQ A;  1GXH A;  3CCU P;  1VQK P;  3GZM A;  2FVF A;  5EW5 E;  2OAR A;  1M9E C;  1EMV A;  2OTJ P;  1M90 Q;  1MZ8 A;  3P05 A;  3HYB A;  4BPG A;  3CMA P;  2L4B A;  2JYL A;  2Z45 A;  2WLV B;  1K73 Q;  1M9C C;  1GPJ A;  3I55 P;  5BS1 A;  2JYG A;  2EG5 A;  1T8K A;  2AF8 A;  3BP9 A;  2KOD A;  4BPF A;  3U43 A;  2XV6 A;  4R0M A;  2N50 A;  2EFJ A;  3CCQ P;  3DS0 A;  3G1I A;  5HGM A;  2KG8 A;  5HGO A;  1BXI A;  1GWP A;  2JU1 A;  1BAJ A;  1M9X C;  1KLP A;  3H4E A;  4PH0 A;  1JJ2 O;  2M8N A;  2K94 A;  1Q82 Q;  4XFX A;  4E92 A;  3GZL A;  3G4S P;  1E6J P;  2JB0 A;  4XFZ A;  1M9F C;  2VLP A;  4COC A;  3RG6 C;  2FQ1 A;  4HTW A;  1L0I A;  4U0D A;  2LOL A;  1HQB A;  2K0Y A;  1ZMB A;  1ACP A;  1AF8 A;  1YIJ P;  5HGN A;  3CC4 P;  1UNK A;  2AVA A;  2VLO A;  2K0X A;  5EJD A;  5F2N A;  4U0C A;  2WPT A;  1NJI Q;  2P9X A;  1GXG A;  2EHS A;  2LPK A;  4PWV B;  2GZE A;  3MGE A;  2KG6 A;  2Z44 A;  2M8P A;  2FAD A;  2MF4 A;  2KGE A;  4GR2 A;  1VQ7 P;  2XDE A;  3G29 A;  4H2Y C;  2KOR A;  2KGA A;  4HKG A;  1Q7Y Q;  1KD1 Q;  2KOQ A;  3G1G A;  2CNR A;  4F37 A;  2K5X A;  1VQM P;  1VHN A;  2XGY A;  4LQW C;  1AUM A;  2L9F A;  1YJ9 P;  2KWL A;  3CME P;  1AYI A;  3I56 P;  3H47 A;  2E1M A;  1Q81 Q;  1VQ4 P;  4B4N A;  3EJD A;  3DS5 A;  5KP8 B;  3GJN A;  3NTE A;  2QA4 P;  2K92 A;  2FVA A;  4DGE C;  2XXM A;  2GDW A;  2Y4Z A;  2AFD A;  2N6Z A;  1M9Y C;  2QEX P;  2PEO A;  4U0B A;  4XFY A;  2LL8 A;  5CZD B;  3LRY A;  4NX4 C;  2L6E A;  4BPH A;  2KGD A;  2XGV A;  2MR7 A;  2CWO A;  2XGU A;  1VQP P;  1W2B O;  1E0H A;  3B5I A;  1QRJ A;  4PH2 A;  1A43 A;  5KP7 B;  1VQ9 P;  2N5H A;  3CXC O;  2L0Q A;  2GZI A;  1A8O A;  2JQ4 A;  1NQ4 A;  2M8L A;  1IUQ A;  3M1M A;  4PH3 A;  4U0F A;  2FAE A;  2OTL P;  1VQ8 P;  4IZ6 A;  1KQS O;  1RO2 A;  2XT1 A;  2NO8 A;  3CCL P;  4U0E A;  5HV8 A;  5I4T G;  1QVF O;  1YIT P;  2LIW A;  2KG9 A;  3LMO A;  2AFE A;  2K2Q A;  2EIA A;  1DNY A;  1M1K Q;  2KOO A;  3DS4 A;  4IPY A;  1K30 A;  2DGY A;  4GR6 A;  1EM9 A;  3CD6 P;  2PEI A;  2CG5 B;  2GDX A;  1ZNV A;  2KW2 A;  5HGL A;  1UJZ A;  3CCR P;  3G6E P;  1EOQ A;  1K9M Q;  4UHP B;  3Q20 A;  2V4X A;  1M6E X;  2PXR C;  2BUO A;  2PEN A;  4H2W C;  2EHT A;  2VSQ A;  1F80 D;  2LKI A;  2QNW A;  5F2O A;  1VQ6 P;  1YI2 P;  4CA3 A;  2XZ1 C;  4PXH B;  1YJN P;  3EJE A;  3GKL C;  1HY8 A;  2KGC A;  2M5R A;  3CC7 P;  2MVV A;  1DV5 A;  2GDY A;  3CCS P;  1CEI A;  1M74 A;  2WLV A;  2GZG A;  2JAZ A;  2KGF A;  3CCM P;  2JPR A;  3G71 P;  3CE7 A;  2PWO A;  3H0D A;  5HGK A;  2LTE A;  2FHS C;  7CEI A;  1AK4 C;  2ERH A;  2FQ0 A;  1S72 P;  3DS1 A;  2ROQ A;  2LF4 A;  2JO0 A;  4DG9 A;  1L6N A;  1G03 A;  2LIU A;  1N8R Q;  1IMP A; 
#chains in the Genus database with same CATH homology
 1IUQ A;  3M1M A;  4U0C A;  3VRL C;  4PH3 A;  4U0F A;  2P9X A;  5F2N A;  4INB A;  1Q86 Q;  2OTL P;  1VQ8 P;  2PEK A;  1KQS O;  1RO2 A;  2XT1 A;  4DGA C;  4XRO A;  3CCL P;  4U0E A;  2PEJ A;  1QVG O;  5DCK A;  3MGE A;  3DS3 A;  2PY8 A;  5F2K A;  2Z44 A;  5I4T G;  3DPH A;  1QVF O;  2M8P A;  1YIT P;  3E2D A;  4GR2 A;  1VQ7 P;  4J93 A;  2XDE A;  1K8A Q;  3G29 A;  2EIA A;  4M0I A;  3OW2 O;  1M1K Q;  3DS4 A;  1Q7Y Q;  1KD1 Q;  4IPY A;  1K30 A;  2DGY A;  5BS2 A;  3G1G A;  4GR6 A;  1P7N A;  2X82 A;  1EM9 A;  3HZQ A;  1VQM P;  2PEQ A;  1YJW P;  3CD6 P;  4QNB A;  2XGY A;  2PEI A;  1U7K A;  3CCU P;  1VQK P;  2ONT A;  4LQW C;  1AUM A;  1YJ9 P;  1VQ5 P;  1M6N A;  2OAR A;  4XRQ A;  1RO0 A;  1M9E C;  3G28 A;  1EIA A;  1RNI A;  3CME P;  2OTJ P;  2PWM A;  1M90 Q;  3I56 P;  3DS2 A;  3P05 A;  5HGL A;  3HYB A;  3H47 A;  2GOL B;  2E1M A;  1Q81 Q;  3CCR P;  3CMA P;  1VQ4 P;  3G6E P;  2JYL A;  2Z45 A;  2Z46 A;  1EOQ A;  1K9M Q;  2WLV B;  4B4N A;  4COP A;  3Q20 A;  2GON A;  1K73 Q;  1AFV A;  2V4X A;  2X83 A;  2PXR C;  1M6E X;  2BUO A;  1M9C C;  2PEN A;  3G21 A;  3I55 P;  5BS1 A;  2JYG A;  2EG5 A;  3DS5 A;  3CCE P;  3NTE A;  3WBH A;  2QA4 P;  3BP9 A;  3CCJ P;  5F2O A;  1M9D C;  2X2D D;  1VQ6 P;  2KOD A;  1YI2 P;  1YHQ P;  4E91 A;  2XV6 A;  4DGE C;  2XXM A;  1YJN P;  1VQO P;  2Y4Z A;  2EFJ A;  3CCQ P;  3DS0 A;  1M9Y C;  2QEX P;  3G1I A;  5HGM A;  2PEO A;  3CC7 P;  4U0B A;  4U0A A;  4XFY A;  4PH1 A;  3DTJ A;  5HGO A;  3CCV P;  3CCS P;  1GWP A;  3LRY A;  3CPW O;  1BAJ A;  1VQL P;  1M74 A;  1M9X C;  2WLV A;  4NX4 C;  2L6E A;  3CC2 P;  2PEM A;  2KGF A;  3CCM P;  2JPR A;  2XGV A;  3H4E A;  4PH0 A;  3G71 P;  1JJ2 O;  1VQN P;  2M8N A;  2PWO A;  3H0D A;  2CWO A;  5HGK A;  4WYM A;  2XGU A;  3G0V A;  1VQP P;  1Q82 Q;  1W2B O;  4XFX A;  1AK4 C;  4E92 A;  3G4S P;  1KC8 Q;  3B5I A;  1QRJ A;  1E6J P;  4PH2 A;  1S72 P;  4XFZ A;  1M9F C;  1A43 A;  3DS1 A;  1VQ9 P;  2LF4 A;  3CXC O;  4COC A;  3RG6 C;  5JPA A;  4HTW A;  4U0D A;  2JO0 A;  1L6N A;  2BHV A;  1A8O A;  1NJI Q;  1G03 A;  1ZMB A;  1D1D A;  1YIJ P;  3G26 A;  5HGN A;  3CC4 P;  1N8R Q;  2M8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...