4QNBA

Disulfide stabilized hiv-1 ca hexamer in complex with phenyl-l-phenylalaninamide inhibitor
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
219
structure length
215
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVTETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of HIV-1 capsid recognition by PF74 and CPSF6.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Viral protein/inhibitor
molecule keywords CAPSID PROTEIN P24
total genus 76
structure length 215
sequence length 219
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4qnbA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4qnbA02
1AFVA 4DGAC 2M8NA 1G03A 5HGKA 1AUMA 5HGLA 2XV6A 3DS2A 4B4NA 5HGNA 4U0BA 3NTEA 2PWMA 1A8OA 3DS1A 2X82A 1GWPA 1EM9A 5HGOA 4HTWA 3BP9A 3DPHA 2GOLB 4XFZA 1M9DC 3G1GA 4NX4C 2XT1A 2JO0A 2PXRC 1AK4C 2L6EA 2XGVA 1D1DA 2KODA 4XRQA 4U0DA 2JYLA 1E6JP 2BUOA 5JPAA 2JPRA 2XDEA 4J93A 2JYGA 1QRJA 4XFXA 2GONA 3G0VA 2PWOA 1M9YC 3G21A 4E91A 2X2DD 2KGFA 4PH3A 4WYMA 1P7NA 3H4EA 3DS3A 4INBA 5HGMA 4PH0A 1M9EC 2EIAA 4COPA 4XROA 3H47A 2M8LA 1EOQA 4U0AA 4U0FA 3G26A 3G1IA 3VRLC 2WLVA 2XGUA 1M9FC 1L6NA 1A43A 2LF4A 1BAJA 1EIAA 4U0CA 3G28A 2XXMA 3G29A 4DGEC 5DCKA 4IPYA 2XGYA 4E92A 3MGEA 2V4XA 4COCA 2X83A 1U7KA 4QNBA 4M0IA 3LRYA 1M9CC 5I4TG 4U0EA 4LQWC 3DS0A 4PH2A 1M9XC 2ONTA 3DS5A 3DS4A 2Y4ZA 3P05A 3DTJA 4PH1A 4XFYA 2WLVB 2M8PA
chains in the Genus database with same CATH superfamily
4DGAC 1VQ9P 1GXHA 1F80D 1AUMA 4B4NA 5HGNA 2KOOA 2XZ0D 1UJZA 2N5IA 3CCLP 2OTJP 2KR5A 2FQ0A 2K5XA 1EM9A 5HGOA 2DNWA 1KC8Q 2KGDA 4XFZA 1M9DC 3G1GA 1VQMP 1RNIA 7CEIA 2PXRC 2JAZA 2LIWA 1VQKP 2KG9A 2QNWA 2PEOA 3GKLC 2PEKA 1E6JP 2BHVA 2FAEA 3HYBA 1Q82Q 3CMAP 3Q20A 3CCMP 2LOLA 2LL8A 3G0VA 1VQ4P 1VQ8P 1IUQA 4E91A 4IZ6A 1QVGO 2KG6A 1E0HA 2CGQA 1P7NA 3H4EA 3DS3A 4PH0A 3WBHA 4COPA 3H47A 2KGAA 4U0AA 2P9XA 1L6NA 1A43A 2CWOA 2K92A 5KP7B 4U0CA 2MD9A 3G28A 1Q7YQ 3G4SP 3I56P 2GZFA 4E92A 1KD1Q 1AYIA 2EHTA 2V4XA 5HVCA 2JGPA 3CXCO 1GPJA 2NO8A 1HQBA 3DS0A 3H0DA 5F2OA 1KLPA 2Y4ZA 4XFYA 5CZDB 2WLVB 3G71P 2MR7A 4H2YC 2QEXP 2JQ4A 5HGKA 1VQ6P 3DS2A 2L4BA 2LKIA 1UNKA 1K9MQ 4PXHB 4R0MA 2Z46A 3DS1A 1YJWP 1FR2A 1GWPA 2GZIA 1RO0A 2FHSC 4HTWA 3GZLA 2CQ8A 2PEIA 2EG5A 2GDWA 2JO0A 2DGYA 1CEIA 1AK4C 1M1KQ 2FVEA 2E1MA 2AF8A 2MR8A 2JYLA 3CC7P 2GDYA 2XDEA 2AVAA 2VLPA 2MVUA 1QRJA 2LIUA 2GONA 1M9YC 2N6ZA 3G21A 3LMOA 2N50A 3CPWO 2KGFA 5KP8B 4F37A 4INBA 2MY5A 4MRTC 5HGMA 1YJ9P 2K0XA 3CCQP 3G26A 1YITP 3M1MA 5HV8A 3VRLC 2KOSA 3OW2O 2K93A 2LF4A 1BAJA 2ERHA 3G29A 4DGEC 1NJIQ 2XGYA 1YIJP 2VLOA 4COCA 3U43A 1VQ7P 1U7KA 1QVFO 3CD6P 2FQ1A 4M0IA 5I4TG 3CE7A 3GZMA 2MF4A 2ONTA 3P05A 4BPHA 2WPTA 4QKOA 2PY8A 1G03A 1VQOP 2CNRA 2L9FA 5EW5E 1DV5A 1K8AQ 3GJNA 4U0BA 1K30A 2K94A 2PWMA 1M90Q 2QA4P 1A8OA 4GR6A 2EFJA 2X2BA 1M6EX 2K2QA 3BP9A 3CCJP 1HY8A 5F2KA 4NEOA 2KWLA 2GOLB 3CC2P 2L0QA 2Z44A 3G6EP 2KGEA 3I55P 2XT1A 2L6EA 2KODA 1IMPA 2K0YA 4XRQA 4U0DA 1VKUA 1KQSO 2PEQA 4H2WC 1L0IA 1OR5A 2OTLP 1VHNA 1GXGA 2N98A 1ZNVA 1M6NA 2KOQA 4CA3A 2FADA 2X2DD 1N8RQ 2AFEA 1YI2P 4GR2A 1RO2A 1L0HA 4HKGA 2KW2A 2M8LA 2GDXA 2PEJA 2FACA 4U0FA 2LTEA 1BXIA 3EJDA 3CCVP 2CG5B 2ROQA 1JJ2O 2GYKA 3MGEA 1NQ4A 2K0DX 3NY7B 3CC4P 2JU2A 1Z6MA 2KORA 4BPFA 1Q81Q 2N6YA 1M9CC 1YHQP 1ZMBA 4PH2A 1M9XC 4BPGA 4PH1A 3EJEA 1VQPP 2N5HA 1AFVA 2M8NA 3RG2A 1ACPA 5HGLA 2XV6A 2VSQA 2AFDA 3NTEA 1Q86Q 2JBGA 1VQNP 1K73Q 2X82A 2Z45A 2M5RA 3E2DA 2KOPA 3DPHA 2FQ2A 2LPKA 1VQ5P 2MVVA 4NX4C 1DNYA 2PEMA 3CMEP 2XGVA 1D1DA 3B5IA 1MZ8A 1X3OA 3RG6C 1AF8A 2L22A 2BUOA 5JPAA 2GZJA 2JPRA 1W2BO 4J93A 2JYGA 4XFXA 2PWOA 2VLNA 3CCSP 3B4QA 2VLQA 1VQLP 5EJDA 2PENA 4PH3A 4WYMA 4DG9A 4H2XC 5F2NA 2OARA 1M9EC 2JU1A 2EIAA 1M74A 4XROA 2XZ1C 1EOQA 1EMVA 2KGCA 3G1IA 2WLVA 2XGUA 1M9FC 3HZQA 2JB0A 2PNGA 1EIAA 2XXMA 5DCKA 4IPYA 1IMQA 3CCEP 4UHPB 2X83A 4PWVB 3CCUP 2EHSA 1YJNP 2GZEA 4QNBA 2GZGA 3CCRP 3LRYA 5BS2A 2FVFA 4U0EA 4LQWC 3EJBA 2KG8A 3DS5A 1T8KA 3DS4A 5BS1A 3DTJA 5KP6B 2LMLA 2FVAA 1S72P 2M8PA
chains in the Genus database with same CATH topology
1AFVA 4DGAC 1VQ9P 2PY8A 2M8NA 1G03A 2QEXP 1VQOP 5HGKA 1VQ6P 1AUMA 5HGLA 1K8AQ 2XV6A 3DS2A 4B4NA 5HGNA 4U0BA 3NTEA 1K30A 1Q86Q 2PWMA 1M90Q 2QA4P 1K9MQ 1A8OA 2Z46A 3CCLP 3DS1A 1VQNP 2OTJP 4GR6A 1K73Q 2EFJA 2X82A 1YJWP 2Z45A 1GWPA 1EM9A 1RO0A 5HGOA 1M6EX 3E2DA 4HTWA 3BP9A 3CCJP 5F2KA 3DPHA 2PEIA 2GOLB 1KC8Q 3CC2P 4XFZA 1M9DC 3G1GA 2EG5A 1VQMP 1VQ5P 4NX4C 1RNIA 2Z44A 3G6EP 2PEMA 3I55P 2XT1A 2JO0A 2DGYA 3CMEP 2PXRC 1AK4C 1VQKP 2L6EA 2XGVA 1D1DA 2KODA 3B5IA 1M1KQ 4XRQA 4U0DA 2E1MA 3RG6C 2JYLA 2PEOA 1KQSO 2PEKA 3CC7P 2PEQA 1E6JP 2BHVA 2BUOA 5JPAA 1W2BO 2JPRA 3HYBA 2XDEA 2OTLP 4J93A 1Q82Q 3CMAP 3Q20A 2JYGA 3CCMP 1QRJA 4XFXA 2GONA 3G0VA 2PWOA 1VQ4P 1M9YC 3G21A 1VQ8P 1IUQA 1M6NA 3CCSP 4E91A 2X2DD 1VQLP 1N8RQ 1QVGO 3CPWO 2PENA 2KGFA 4PH3A 4WYMA 1P7NA 1YI2P 3H4EA 4GR2A 1RO2A 3DS3A 4INBA 5F2NA 2OARA 5HGMA 4PH0A 1M9EC 2EIAA 3WBHA 4COPA 1M74A 4XROA 3H47A 2M8LA 2PEJA 1YJ9P 1EOQA 4U0AA 3CCQP 4U0FA 3G26A 2P9XA 1YITP 3G1IA 3M1MA 3VRLC 2WLVA 2XGUA 1M9FC 1L6NA 3HZQA 3OW2O 1A43A 2CWOA 2LF4A 3CCVP 1BAJA 1EIAA 4U0CA 3G28A 1Q7YQ 2XXMA 3G29A 4DGEC 1JJ2O 3G4SP 3I56P 1NJIQ 5DCKA 4IPYA 2XGYA 4E92A 1KD1Q 3MGEA 1YIJP 3CCEP 2V4XA 4COCA 2X83A 3CC4P 3CCUP 1VQ7P 3CXCO 1YJNP 1U7KA 4QNBA 1QVFO 3CD6P 4M0IA 3CCRP 1Q81Q 3LRYA 1M9CC 5BS2A 5I4TG 1YHQP 4U0EA 4LQWC 1ZMBA 3DS0A 3H0DA 4PH2A 5F2OA 1M9XC 2ONTA 3DS5A 3DS4A 2Y4ZA 3P05A 5BS1A 3DTJA 4PH1A 4XFYA 2WLVB 3G71P 1S72P 1VQPP 2M8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AFV A;  4DGA C;  2M8N A;  1G03 A;  5HGK A;  1AUM A;  5HGL A;  2XV6 A;  3DS2 A;  4B4N A;  5HGN A;  4U0B A;  3NTE A;  2PWM A;  1A8O A;  3DS1 A;  2X82 A;  1GWP A;  1EM9 A;  5HGO A;  4HTW A;  3BP9 A;  3DPH A;  2GOL B;  4XFZ A;  1M9D C;  3G1G A;  4NX4 C;  2XT1 A;  2JO0 A;  2PXR C;  1AK4 C;  2L6E A;  2XGV A;  1D1D A;  2KOD A;  4XRQ A;  4U0D A;  2JYL A;  1E6J P;  2BUO A;  5JPA A;  2JPR A;  2XDE A;  4J93 A;  2JYG A;  1QRJ A;  4XFX A;  2GON A;  3G0V A;  2PWO A;  1M9Y C;  3G21 A;  4E91 A;  2X2D D;  2KGF A;  4PH3 A;  4WYM A;  1P7N A;  3H4E A;  3DS3 A;  4INB A;  5HGM A;  4PH0 A;  1M9E C;  2EIA A;  4COP A;  4XRO A;  3H47 A;  2M8L A;  1EOQ A;  4U0A A;  4U0F A;  3G26 A;  3G1I A;  3VRL C;  2WLV A;  2XGU A;  1M9F C;  1L6N A;  1A43 A;  2LF4 A;  1BAJ A;  1EIA A;  4U0C A;  3G28 A;  2XXM A;  3G29 A;  4DGE C;  5DCK A;  4IPY A;  2XGY A;  4E92 A;  3MGE A;  2V4X A;  4COC A;  2X83 A;  1U7K A;  4QNB A;  4M0I A;  3LRY A;  1M9C C;  5I4T G;  4U0E A;  4LQW C;  3DS0 A;  4PH2 A;  1M9X C;  2ONT A;  3DS5 A;  3DS4 A;  2Y4Z A;  3P05 A;  3DTJ A;  4PH1 A;  4XFY A;  2WLV B;  2M8P A; 
#chains in the Genus database with same CATH topology
 4DGA C;  1VQ9 P;  1GXH A;  1F80 D;  1AUM A;  4B4N A;  5HGN A;  2KOO A;  2XZ0 D;  1UJZ A;  2N5I A;  3CCL P;  2OTJ P;  2KR5 A;  2FQ0 A;  2K5X A;  1EM9 A;  5HGO A;  2DNW A;  1KC8 Q;  2KGD A;  4XFZ A;  1M9D C;  3G1G A;  1VQM P;  1RNI A;  7CEI A;  2PXR C;  2JAZ A;  2LIW A;  1VQK P;  2KG9 A;  2QNW A;  2PEO A;  3GKL C;  2PEK A;  1E6J P;  2BHV A;  2FAE A;  3HYB A;  1Q82 Q;  3CMA P;  3Q20 A;  3CCM P;  2LOL A;  2LL8 A;  3G0V A;  1VQ4 P;  1VQ8 P;  1IUQ A;  4E91 A;  4IZ6 A;  1QVG O;  2KG6 A;  1E0H A;  2CGQ A;  1P7N A;  3H4E A;  3DS3 A;  4PH0 A;  3WBH A;  4COP A;  3H47 A;  2KGA A;  4U0A A;  2P9X A;  1L6N A;  1A43 A;  2CWO A;  2K92 A;  5KP7 B;  4U0C A;  2MD9 A;  3G28 A;  1Q7Y Q;  3G4S P;  3I56 P;  2GZF A;  4E92 A;  1KD1 Q;  1AYI A;  2EHT A;  2V4X A;  5HVC A;  2JGP A;  3CXC O;  1GPJ A;  2NO8 A;  1HQB A;  3DS0 A;  3H0D A;  5F2O A;  1KLP A;  2Y4Z A;  4XFY A;  5CZD B;  2WLV B;  3G71 P;  2MR7 A;  4H2Y C;  2QEX P;  2JQ4 A;  5HGK A;  1VQ6 P;  3DS2 A;  2L4B A;  2LKI A;  1UNK A;  1K9M Q;  4PXH B;  4R0M A;  2Z46 A;  3DS1 A;  1YJW P;  1FR2 A;  1GWP A;  2GZI A;  1RO0 A;  2FHS C;  4HTW A;  3GZL A;  2CQ8 A;  2PEI A;  2EG5 A;  2GDW A;  2JO0 A;  2DGY A;  1CEI A;  1AK4 C;  1M1K Q;  2FVE A;  2E1M A;  2AF8 A;  2MR8 A;  2JYL A;  3CC7 P;  2GDY A;  2XDE A;  2AVA A;  2VLP A;  2MVU A;  1QRJ A;  2LIU A;  2GON A;  1M9Y C;  2N6Z A;  3G21 A;  3LMO A;  2N50 A;  3CPW O;  2KGF A;  5KP8 B;  4F37 A;  4INB A;  2MY5 A;  4MRT C;  5HGM A;  1YJ9 P;  2K0X A;  3CCQ P;  3G26 A;  1YIT P;  3M1M A;  5HV8 A;  3VRL C;  2KOS A;  3OW2 O;  2K93 A;  2LF4 A;  1BAJ A;  2ERH A;  3G29 A;  4DGE C;  1NJI Q;  2XGY A;  1YIJ P;  2VLO A;  4COC A;  3U43 A;  1VQ7 P;  1U7K A;  1QVF O;  3CD6 P;  2FQ1 A;  4M0I A;  5I4T G;  3CE7 A;  3GZM A;  2MF4 A;  2ONT A;  3P05 A;  4BPH A;  2WPT A;  4QKO A;  2PY8 A;  1G03 A;  1VQO P;  2CNR A;  2L9F A;  5EW5 E;  1DV5 A;  1K8A Q;  3GJN A;  4U0B A;  1K30 A;  2K94 A;  2PWM A;  1M90 Q;  2QA4 P;  1A8O A;  4GR6 A;  2EFJ A;  2X2B A;  1M6E X;  2K2Q A;  3BP9 A;  3CCJ P;  1HY8 A;  5F2K A;  4NEO A;  2KWL A;  2GOL B;  3CC2 P;  2L0Q A;  2Z44 A;  3G6E P;  2KGE A;  3I55 P;  2XT1 A;  2L6E A;  2KOD A;  1IMP A;  2K0Y A;  4XRQ A;  4U0D A;  1VKU A;  1KQS O;  2PEQ A;  4H2W C;  1L0I A;  1OR5 A;  2OTL P;  1VHN A;  1GXG A;  2N98 A;  1ZNV A;  1M6N A;  2KOQ A;  4CA3 A;  2FAD A;  2X2D D;  1N8R Q;  2AFE A;  1YI2 P;  4GR2 A;  1RO2 A;  1L0H A;  4HKG A;  2KW2 A;  2M8L A;  2GDX A;  2PEJ A;  2FAC A;  4U0F A;  2LTE A;  1BXI A;  3EJD A;  3CCV P;  2CG5 B;  2ROQ A;  1JJ2 O;  2GYK A;  3MGE A;  1NQ4 A;  2K0D X;  3NY7 B;  3CC4 P;  2JU2 A;  1Z6M A;  2KOR A;  4BPF A;  1Q81 Q;  2N6Y A;  1M9C C;  1YHQ P;  1ZMB A;  4PH2 A;  1M9X C;  4BPG A;  4PH1 A;  3EJE A;  1VQP P;  2N5H A;  1AFV A;  2M8N A;  3RG2 A;  1ACP A;  5HGL A;  2XV6 A;  2VSQ A;  2AFD A;  3NTE A;  1Q86 Q;  2JBG A;  1VQN P;  1K73 Q;  2X82 A;  2Z45 A;  2M5R A;  3E2D A;  2KOP A;  3DPH A;  2FQ2 A;  2LPK A;  1VQ5 P;  2MVV A;  4NX4 C;  1DNY A;  2PEM A;  3CME P;  2XGV A;  1D1D A;  3B5I A;  1MZ8 A;  1X3O A;  3RG6 C;  1AF8 A;  2L22 A;  2BUO A;  5JPA A;  2GZJ A;  2JPR A;  1W2B O;  4J93 A;  2JYG A;  4XFX A;  2PWO A;  2VLN A;  3CCS P;  3B4Q A;  2VLQ A;  1VQL P;  5EJD A;  2PEN A;  4PH3 A;  4WYM A;  4DG9 A;  4H2X C;  5F2N A;  2OAR A;  1M9E C;  2JU1 A;  2EIA A;  1M74 A;  4XRO A;  2XZ1 C;  1EOQ A;  1EMV A;  2KGC A;  3G1I A;  2WLV A;  2XGU A;  1M9F C;  3HZQ A;  2JB0 A;  2PNG A;  1EIA A;  2XXM A;  5DCK A;  4IPY A;  1IMQ A;  3CCE P;  4UHP B;  2X83 A;  4PWV B;  3CCU P;  2EHS A;  1YJN P;  2GZE A;  4QNB A;  2GZG A;  3CCR P;  3LRY A;  5BS2 A;  2FVF A;  4U0E A;  4LQW C;  3EJB A;  2KG8 A;  3DS5 A;  1T8K A;  3DS4 A;  5BS1 A;  3DTJ A;  5KP6 B;  2LML A;  2FVA A;  1S72 P;  2M8P A; 
#chains in the Genus database with same CATH homology
 1AFV A;  4DGA C;  1VQ9 P;  2PY8 A;  2M8N A;  1G03 A;  2QEX P;  1VQO P;  5HGK A;  1VQ6 P;  1AUM A;  5HGL A;  1K8A Q;  2XV6 A;  3DS2 A;  4B4N A;  5HGN A;  4U0B A;  3NTE A;  1K30 A;  1Q86 Q;  2PWM A;  1M90 Q;  2QA4 P;  1K9M Q;  1A8O A;  2Z46 A;  3CCL P;  3DS1 A;  1VQN P;  2OTJ P;  4GR6 A;  1K73 Q;  2EFJ A;  2X82 A;  1YJW P;  2Z45 A;  1GWP A;  1EM9 A;  1RO0 A;  5HGO A;  1M6E X;  3E2D A;  4HTW A;  3BP9 A;  3CCJ P;  5F2K A;  3DPH A;  2PEI A;  2GOL B;  1KC8 Q;  3CC2 P;  4XFZ A;  1M9D C;  3G1G A;  2EG5 A;  1VQM P;  1VQ5 P;  4NX4 C;  1RNI A;  2Z44 A;  3G6E P;  2PEM A;  3I55 P;  2XT1 A;  2JO0 A;  2DGY A;  3CME P;  2PXR C;  1AK4 C;  1VQK P;  2L6E A;  2XGV A;  1D1D A;  2KOD A;  3B5I A;  1M1K Q;  4XRQ A;  4U0D A;  2E1M A;  3RG6 C;  2JYL A;  2PEO A;  1KQS O;  2PEK A;  3CC7 P;  2PEQ A;  1E6J P;  2BHV A;  2BUO A;  5JPA A;  1W2B O;  2JPR A;  3HYB A;  2XDE A;  2OTL P;  4J93 A;  1Q82 Q;  3CMA P;  3Q20 A;  2JYG A;  3CCM P;  1QRJ A;  4XFX A;  2GON A;  3G0V A;  2PWO A;  1VQ4 P;  1M9Y C;  3G21 A;  1VQ8 P;  1IUQ A;  1M6N A;  3CCS P;  4E91 A;  2X2D D;  1VQL P;  1N8R Q;  1QVG O;  3CPW O;  2PEN A;  2KGF A;  4PH3 A;  4WYM A;  1P7N A;  1YI2 P;  3H4E A;  4GR2 A;  1RO2 A;  3DS3 A;  4INB A;  5F2N A;  2OAR A;  5HGM A;  4PH0 A;  1M9E C;  2EIA A;  3WBH A;  4COP A;  1M74 A;  4XRO A;  3H47 A;  2M8L A;  2PEJ A;  1YJ9 P;  1EOQ A;  4U0A A;  3CCQ P;  4U0F A;  3G26 A;  2P9X A;  1YIT P;  3G1I A;  3M1M A;  3VRL C;  2WLV A;  2XGU A;  1M9F C;  1L6N A;  3HZQ A;  3OW2 O;  1A43 A;  2CWO A;  2LF4 A;  3CCV P;  1BAJ A;  1EIA A;  4U0C A;  3G28 A;  1Q7Y Q;  2XXM A;  3G29 A;  4DGE C;  1JJ2 O;  3G4S P;  3I56 P;  1NJI Q;  5DCK A;  4IPY A;  2XGY A;  4E92 A;  1KD1 Q;  3MGE A;  1YIJ P;  3CCE P;  2V4X A;  4COC A;  2X83 A;  3CC4 P;  3CCU P;  1VQ7 P;  3CXC O;  1YJN P;  1U7K A;  4QNB A;  1QVF O;  3CD6 P;  4M0I A;  3CCR P;  1Q81 Q;  3LRY A;  1M9C C;  5BS2 A;  5I4T G;  1YHQ P;  4U0E A;  4LQW C;  1ZMB A;  3DS0 A;  3H0D A;  4PH2 A;  5F2O A;  1M9X C;  2ONT A;  3DS5 A;  3DS4 A;  2Y4Z A;  3P05 A;  5BS1 A;  3DTJ A;  4PH1 A;  4XFY A;  2WLV B;  3G71 P;  1S72 P;  1VQP P;  2M8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...