4QNDA

Crystal structure of a semisweet
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
97
structure length
97
Chain Sequence
MALIERIGKALEPLMLVMGLISPLATMPQLYKLYVSHSEHALGLSLTTWLLYSFIALLWTIYGIYHKNPTIWVGNCLGFLMYVAMVVGIIAHTGGTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemical transport protein
publication title Structures of bacterial homologues of SWEET transporters in two distinct conformations.
pubmed doi rcsb
source organism Vibrio sp. n418
molecule tags Membrane protein
total genus 36
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2014-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.290 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4qndA00
4X5MA 4QNCA 4QNDA 4RNGA 4X5NA
chains in the Genus database with same CATH superfamily
3E4YA 1FZ4E 3SUOA 3UO3A 4E3SA 2P1MB 4J2EA 1FZ8E 4DTPA 4FJMA 4FK4A 4AKHA 3HGLA 2JQTA 4KHNA 3SNNA 2E31A 2B1EA 3CQ8A 3NE6A 1MHZG 4FJ7A 1XMFE 4M3YA 3OGMB 3NGIA 3TABA 2FW3A 2VJ4A 1XMGE 1FYZE 2DEBA 1XU5E 4DTJA 1CLQA 3NAEA 4FJNA 4AKIA 4M45A 3LD8A 2B8IA 4RG8A 1FZ6E 4GAMC 4JRPA 3V7DB 4ADOA 3C6OB 4B08A 4FJXA 3HP9A 4FVMA 2JPNA 4FK2A 1WAJA 1XMHE 2P1QB 4IT5A 3C6NB 3SQ1A 4KI4A 4DU1A 4EYWA 4ADNA 4JRQA 3LDSA 4HCBA 3E4WA 4FK0A 4J2AA 5IZ7A 5IREA 3QNNA 3L0MA 1FPOA 3TAGA 3SUPA 1XVGE 4FJHA 4M3ZA 1LDKE 2B7MA 1XL3C 4DTXA 3SJJA 4FJ9A 4EPHA 3QEWA 1MMOG 2VIXA 1IH7A 3TAEA 4AI6A 2OVRB 2YB5A 3QESA 2DY4A 3HL8A 2PFTA 3KD5E 4FJJA 3RMCA 1FZ2E 4KHWA 3SCXA 3SPYA 1FZ7E 1XVDE 2JH9A 2JHAA 2K5SA 3TL8B 4M3RA 3L8BA 2ATQA 1FZ1E 2RKHA 2QXFA 3C6PB 3LZJA 3LDBA 3TAFA 1NEXB 3SPZA 3RMAA 2OZMA 1FZ3E 2JHCA 4M41A 3NCIA 3UIQA 1P22A 4X5NA 1FZIE 2JH8A 4RL5A 3N1BA 4I6JB 3S9HA 4J2BA 4FJ8A 4KI6A 1XVCE 1XVBE 4DTMA 4QNDA 3UO2A 3QEXA 3NDKA 2DTUA 3CFOA 1MTYG 4M42A 3SUNA 4I9LA 4M3WA 4KHUA 3L1NA 4M3XA 2LF3A 1XVFE 2PFVA 3J2PA 3WSOA 4DU4A 4FJIA 2OYQA 1FZHE 1FS1A 4ICGC 4JS4A 2P1PB 3QNOA 4RNGA 4KHSA 3NHGA 4DTRA 5IBKB 1Q9XA 1MHYG 3RMBA 3SI6A 1FZ5E 3C95A 3QERA 3BVOA 3MKSB 3OGLB 3SQ2A 4DU3A 3KD1E 2P1OB 4KHYA 2MZWB 3J27A 2OVQB 3SVIA 4JS5A 4DTOA 3OGKB 5H37A 3CFRA 2HD0A 4EP9A 3QEPA 2OZSA 4FJGA 4FJ5A 4DTUA 2E32A 2OVPB 4M3TA 3C94A 4J2DA 3CFPA 4FJKA 2RCUA 4DTSA 2P1NB 3TJYA 3QEVA 2VJ5A 1Q9YA 1XU3E 3K2OA 3SQ0A 2FYOA 3RMDA 3QETA 1XVEE 1IG9A 1N1CA 2H4TA 4X5MA 4KHQA 4QNCA 2P5GA 2LF6A 3QEIA 3N1EA 1JW2A 3SUQA 4DTNA 2P5OA 1FZ0E 2MMBA 3RWUA 3L2OB 3SQ4A 4E4BA 4I9QA 4AKGA 4HCCA 1FZ9E 3HGKE 1FXXA 2MW2A 3LZIA 4FJLA 2JHPA 4M3UA 1WAFA
chains in the Genus database with same CATH topology
3E4YA 1FZ4E 3SUOA 4FK4A 4E3SA 2P1MB 4J2EA 1FZ8E 4DTPA 4FJMA 4AKHA 3HGLA 4KHNA 3SNNA 2E31A 2B1EA 3CQ8A 3NE6A 1MHZG 4FJ7A 1XMFE 4M3YA 3OGMB 3NGIA 3TABA 2FW3A 2VJ4A 1XMGE 1FYZE 2DEBA 1XU5E 4DTJA 1CLQA 3NAEA 4FJNA 4AKIA 4M45A 3LD8A 2B8IA 4RG8A 1FZ6E 4GAMC 4JRPA 3V7DB 4ADOA 3C6OB 4B08A 4FJXA 3HP9A 4FVMA 2JPNA 4FK2A 1WAJA 1XMHE 2P1QB 3SQ1A 3C6NB 4KI4A 4DU1A 4EYWA 4ADNA 4JRQA 3LDSA 4HCBA 3E4WA 4FK0A 4J2AA 5IZ7A 5IREA 3QNNA 3L0MA 3TAGA 3SUPA 1XVGE 4FJHA 4M3ZA 1LDKE 2B7MA 1XL3C 4DTXA 3SJJA 4FJ9A 4EPHA 3QEWA 1MMOG 2VIXA 1IH7A 3TAEA 4AI6A 2OVRB 2YB5A 3QESA 2DY4A 3HL8A 2PFTA 3KD5E 4FJJA 3RMCA 1FZ2E 4KHWA 3SCXA 3SPYA 1FZ7E 1XVDE 2JH9A 2JHAA 3TL8B 4M3RA 3L8BA 2ATQA 1FZ1E 3C6PB 2QXFA 3LZJA 3TAFA 3LDBA 3SPZA 1NEXB 3RMAA 2OZMA 1FZ3E 2JHCA 4M41A 3NCIA 3UIQA 1P22A 4X5NA 1FZIE 2JH8A 4RL5A 3N1BA 4I6JB 3S9HA 4J2BA 4FJ8A 4KI6A 1XVCE 1XVBE 4DTMA 4QNDA 3QEXA 3NDKA 2DTUA 3CFOA 1MTYG 4M42A 3SUNA 4I9LA 4M3WA 4KHUA 3L1NA 4M3XA 2LF3A 1XVFE 2PFVA 3J2PA 3WSOA 4DU4A 4FJIA 2OYQA 1FZHE 1FS1A 4JS4A 2P1PB 3QNOA 4RNGA 4KHSA 3NHGA 4DTRA 5IBKB 1Q9XA 1MHYG 3RMBA 3SI6A 1FZ5E 3C95A 3QERA 3KD1E 3MKSB 3OGLB 3SQ2A 4DU3A 2P1OB 4KHYA 2MZWB 3J27A 2OVQB 3SVIA 4JS5A 4DTOA 3OGKB 5H37A 3CFRA 2HD0A 4EP9A 3QEPA 2OZSA 4FJGA 4FJ5A 4DTUA 2E32A 2OVPB 4M3TA 3C94A 4J2DA 3CFPA 4FJKA 2RCUA 4DTSA 2P1NB 3TJYA 3QEVA 2VJ5A 1Q9YA 1XU3E 3K2OA 3SQ0A 2FYOA 3RMDA 3QETA 1XVEE 1IG9A 2H4TA 4X5MA 4KHQA 4QNCA 2P5GA 2LF6A 3QEIA 3N1EA 3SUQA 4DTNA 2P5OA 1FZ0E 2MMBA 3RWUA 3L2OB 3SQ4A 4E4BA 4I9QA 4AKGA 4HCCA 1FZ9E 3HGKE 1FXXA 3LZIA 4FJLA 2JHPA 4M3UA 1WAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X5M A;  4QNC A;  4QND A;  4RNG A;  4X5N A; 
#chains in the Genus database with same CATH topology
 3E4Y A;  1FZ4 E;  3SUO A;  3UO3 A;  4E3S A;  2P1M B;  4J2E A;  1FZ8 E;  4DTP A;  4FJM A;  4FK4 A;  4AKH A;  3HGL A;  2JQT A;  4KHN A;  3SNN A;  2E31 A;  2B1E A;  3CQ8 A;  3NE6 A;  1MHZ G;  4FJ7 A;  1XMF E;  4M3Y A;  3OGM B;  3NGI A;  3TAB A;  2FW3 A;  2VJ4 A;  1XMG E;  1FYZ E;  2DEB A;  1XU5 E;  4DTJ A;  1CLQ A;  3NAE A;  4FJN A;  4AKI A;  4M45 A;  3LD8 A;  2B8I A;  4RG8 A;  1FZ6 E;  4GAM C;  4JRP A;  3V7D B;  4ADO A;  3C6O B;  4B08 A;  4FJX A;  3HP9 A;  4FVM A;  2JPN A;  4FK2 A;  1WAJ A;  1XMH E;  2P1Q B;  4IT5 A;  3C6N B;  3SQ1 A;  4KI4 A;  4DU1 A;  4EYW A;  4ADN A;  4JRQ A;  3LDS A;  4HCB A;  3E4W A;  4FK0 A;  4J2A A;  5IZ7 A;  5IRE A;  3QNN A;  3L0M A;  1FPO A;  3TAG A;  3SUP A;  1XVG E;  4FJH A;  4M3Z A;  1LDK E;  2B7M A;  1XL3 C;  4DTX A;  3SJJ A;  4FJ9 A;  4EPH A;  3QEW A;  1MMO G;  2VIX A;  1IH7 A;  3TAE A;  4AI6 A;  2OVR B;  2YB5 A;  3QES A;  2DY4 A;  3HL8 A;  2PFT A;  3KD5 E;  4FJJ A;  3RMC A;  1FZ2 E;  4KHW A;  3SCX A;  3SPY A;  1FZ7 E;  1XVD E;  2JH9 A;  2JHA A;  2K5S A;  3TL8 B;  4M3R A;  3L8B A;  2ATQ A;  1FZ1 E;  2RKH A;  2QXF A;  3C6P B;  3LZJ A;  3LDB A;  3TAF A;  1NEX B;  3SPZ A;  3RMA A;  2OZM A;  1FZ3 E;  2JHC A;  4M41 A;  3NCI A;  3UIQ A;  1P22 A;  4X5N A;  1FZI E;  2JH8 A;  4RL5 A;  3N1B A;  4I6J B;  3S9H A;  4J2B A;  4FJ8 A;  4KI6 A;  1XVC E;  1XVB E;  4DTM A;  4QND A;  3UO2 A;  3QEX A;  3NDK A;  2DTU A;  3CFO A;  1MTY G;  4M42 A;  3SUN A;  4I9L A;  4M3W A;  4KHU A;  3L1N A;  4M3X A;  2LF3 A;  1XVF E;  2PFV A;  3J2P A;  3WSO A;  4DU4 A;  4FJI A;  2OYQ A;  1FZH E;  1FS1 A;  4ICG C;  4JS4 A;  2P1P B;  3QNO A;  4RNG A;  4KHS A;  3NHG A;  4DTR A;  5IBK B;  1Q9X A;  1MHY G;  3RMB A;  3SI6 A;  1FZ5 E;  3C95 A;  3QER A;  3BVO A;  3MKS B;  3OGL B;  3SQ2 A;  4DU3 A;  3KD1 E;  2P1O B;  4KHY A;  2MZW B;  3J27 A;  2OVQ B;  3SVI A;  4JS5 A;  4DTO A;  3OGK B;  5H37 A;  3CFR A;  2HD0 A;  4EP9 A;  3QEP A;  2OZS A;  4FJG A;  4FJ5 A;  4DTU A;  2E32 A;  2OVP B;  4M3T A;  3C94 A;  4J2D A;  3CFP A;  4FJK A;  2RCU A;  4DTS A;  2P1N B;  3TJY A;  3QEV A;  2VJ5 A;  1Q9Y A;  1XU3 E;  3K2O A;  3SQ0 A;  2FYO A;  3RMD A;  3QET A;  1XVE E;  1IG9 A;  1N1C A;  2H4T A;  4X5M A;  4KHQ A;  4QNC A;  2P5G A;  2LF6 A;  3QEI A;  3N1E A;  1JW2 A;  3SUQ A;  4DTN A;  2P5O A;  1FZ0 E;  2MMB A;  3RWU A;  3L2O B;  3SQ4 A;  4E4B A;  4I9Q A;  4AKG A;  4HCC A;  1FZ9 E;  3HGK E;  1FXX A;  2MW2 A;  3LZI A;  4FJL A;  2JHP A;  4M3U A;  1WAF A; 
#chains in the Genus database with same CATH homology
 3E4Y A;  1FZ4 E;  3SUO A;  4FK4 A;  4E3S A;  2P1M B;  4J2E A;  1FZ8 E;  4DTP A;  4FJM A;  4AKH A;  3HGL A;  4KHN A;  3SNN A;  2E31 A;  2B1E A;  3CQ8 A;  3NE6 A;  1MHZ G;  4FJ7 A;  1XMF E;  4M3Y A;  3OGM B;  3NGI A;  3TAB A;  2FW3 A;  2VJ4 A;  1XMG E;  1FYZ E;  2DEB A;  1XU5 E;  4DTJ A;  1CLQ A;  3NAE A;  4FJN A;  4AKI A;  4M45 A;  3LD8 A;  2B8I A;  4RG8 A;  1FZ6 E;  4GAM C;  4JRP A;  3V7D B;  4ADO A;  3C6O B;  4B08 A;  4FJX A;  3HP9 A;  4FVM A;  2JPN A;  4FK2 A;  1WAJ A;  1XMH E;  2P1Q B;  3SQ1 A;  3C6N B;  4KI4 A;  4DU1 A;  4EYW A;  4ADN A;  4JRQ A;  3LDS A;  4HCB A;  3E4W A;  4FK0 A;  4J2A A;  5IZ7 A;  5IRE A;  3QNN A;  3L0M A;  3TAG A;  3SUP A;  1XVG E;  4FJH A;  4M3Z A;  1LDK E;  2B7M A;  1XL3 C;  4DTX A;  3SJJ A;  4FJ9 A;  4EPH A;  3QEW A;  1MMO G;  2VIX A;  1IH7 A;  3TAE A;  4AI6 A;  2OVR B;  2YB5 A;  3QES A;  2DY4 A;  3HL8 A;  2PFT A;  3KD5 E;  4FJJ A;  3RMC A;  1FZ2 E;  4KHW A;  3SCX A;  3SPY A;  1FZ7 E;  1XVD E;  2JH9 A;  2JHA A;  3TL8 B;  4M3R A;  3L8B A;  2ATQ A;  1FZ1 E;  3C6P B;  2QXF A;  3LZJ A;  3TAF A;  3LDB A;  3SPZ A;  1NEX B;  3RMA A;  2OZM A;  1FZ3 E;  2JHC A;  4M41 A;  3NCI A;  3UIQ A;  1P22 A;  4X5N A;  1FZI E;  2JH8 A;  4RL5 A;  3N1B A;  4I6J B;  3S9H A;  4J2B A;  4FJ8 A;  4KI6 A;  1XVC E;  1XVB E;  4DTM A;  4QND A;  3QEX A;  3NDK A;  2DTU A;  3CFO A;  1MTY G;  4M42 A;  3SUN A;  4I9L A;  4M3W A;  4KHU A;  3L1N A;  4M3X A;  2LF3 A;  1XVF E;  2PFV A;  3J2P A;  3WSO A;  4DU4 A;  4FJI A;  2OYQ A;  1FZH E;  1FS1 A;  4JS4 A;  2P1P B;  3QNO A;  4RNG A;  4KHS A;  3NHG A;  4DTR A;  5IBK B;  1Q9X A;  1MHY G;  3RMB A;  3SI6 A;  1FZ5 E;  3C95 A;  3QER A;  3KD1 E;  3MKS B;  3OGL B;  3SQ2 A;  4DU3 A;  2P1O B;  4KHY A;  2MZW B;  3J27 A;  2OVQ B;  3SVI A;  4JS5 A;  4DTO A;  3OGK B;  5H37 A;  3CFR A;  2HD0 A;  4EP9 A;  3QEP A;  2OZS A;  4FJG A;  4FJ5 A;  4DTU A;  2E32 A;  2OVP B;  4M3T A;  3C94 A;  4J2D A;  3CFP A;  4FJK A;  2RCU A;  4DTS A;  2P1N B;  3TJY A;  3QEV A;  2VJ5 A;  1Q9Y A;  1XU3 E;  3K2O A;  3SQ0 A;  2FYO A;  3RMD A;  3QET A;  1XVE E;  1IG9 A;  2H4T A;  4X5M A;  4KHQ A;  4QNC A;  2P5G A;  2LF6 A;  3QEI A;  3N1E A;  3SUQ A;  4DTN A;  2P5O A;  1FZ0 E;  2MMB A;  3RWU A;  3L2O B;  3SQ4 A;  4E4B A;  4I9Q A;  4AKG A;  4HCC A;  1FZ9 E;  3HGK E;  1FXX A;  3LZI A;  4FJL A;  2JHP A;  4M3U A;  1WAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...