4QNEA

Inosine 5'-monophosphate dehydrogenase from vibrio cholerae, deletion mutant, in complex with nad and imp
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
358
structure length
342
Chain Sequence
RIAKEALTFDDVLLVPAHSTVLPNTADLRTRLTKNIALNIPMVSASMDTVTEARLAIALAQEGGIGFIHKNMSIEQQAAQVHQVKISGGLRVGAAVGAAPGNEERVKALVEAGVDVLLIDSSHGHSEGVLQRIRETRAAYPHLEIIGGNVATAEGARALIEAGVSAVKVGIGPGSICTTRIVTGVGVPQITAIADAAGVANEYGIPVIADGGIRFSGDISKAIAAGASCVMVGSMFAGTEEAPGEVILYQGRSYKAYRGMGSLGAMSLVPEGIEGRIAYKGHLKEIIHQQMGGLRSCMGLTGSATVEDLRTKAQFVRISGAGMKESHVHDVQITKEAPNYRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inosine 5'-monophosphate dehydrogenase from Vibrio cholerae, deletion mutant, in complex with NAD and IMP
rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Oxidoreductase
molecule keywords Inosine 5'-monophosphate dehydrogenase
total genus 105
structure length 342
sequence length 358
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2014-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4qneA00
4IX2A 3TQ0A 4NXKA 1I2NA 1I2PA 3V1PA 4FX6M 4FNSA 4GUJA 3TSMA 3P7YA 4YXGA 4HNVA 4P61A 2IQTA 3KX6A 4PTNA 3C56A 4RR4A 4MFDA 3I7QA 3W07A 2E1DA 4OV4A 5D2YA 3W1UA 3GIYA 1H7WA 3LXAA 3WK0A 1KW1A 5A5WA 4YCPA 4RZ6A 1NSJA 1QMLA 5F1VA 1PVNA 3W7LA 3S6DA 4K7YA 1K7EA 5IM51 3GYEA 3PS7A 5EPDA 2C14A 4O1CA 4XQ6A 3W1NA 1ME9A 1VGAA 1ZFJA 2GQAA 7TIMA 3O16A 1SSGA 4JTSA 5D37A 3BO9A 3NZ1A 3LCWA 3WJZA 3UWVA 2CZFA 5AHNA 3KVLA 5EY5A 2ZCGA 2GVLA 1QCWA 4HPXA 3MW7A 2ZZ2A 5H2ZA 4UTJA 2QUVA 4LV4A 4GFSA 4MIMA 5D33A 5A8GA 1UJPA 1EX5A 2JGQA 5LSMA 2Y61A 3CU2A 5AN7A 1ME7A 1KTNA 3G1VA 3O8AA 1I2OA 4FIQA 1JCXA 2NXHA 4HNUA 3KRSA 4UCGA 2ZRWA 5BOOA 4UFJA 3STGA 4HKPA 4RK8A 1LBMA 2TRSA 1JCNA 3LHZA 3TFXA 1T8XA 2B4GA 1ZCOA 4O28A 3OVQA 5E0KA 4NUWA 3EKZA 1W5NA 3QZEA 3S5OA 4O11A 3DFNA 3PC0A 1QWGA 3LX9A 3NYZA 3MYPA 4Z0SA 3TMLA 3EWYA 3H55A 1H62A 5AC7A 3QPYA 1OJXA 3NL5A 1VYRA 4OWGA 3TAKA 4MLJA 2CZDA 3TC7A 2YR1A 4LWWA 3NQEA 4JY9A 3NQGA 4RV8A 1BKSA 4AWSA 3NO5A 5CPLA 1LBFA 3IGXA 2FB3A 4PL2A 3UWQA 5LZLA 1EA0A 4DXVA 1KLZA 3W2NA 4Z0JA 1XL9A 2DP3A 3W71A 1KM1A 3KHJA 4RLIA 4N9BA 2J88A 3DENA 1XBYA 2C16A 3FS2A 4UFHA 3FJLA 3W2MA 2ZFAA 4LVBA 3B0PA 1IXQA 1K02A 3LERA 3QC3A 1J5TA 3E96A 4I7UA 3TSDA 3LCXA 1NEYA 3BPWA 3W87A 3G0UA 3W1MA 2W0UA 5HUOA 3LCFA 5HR6A 2BWGA 5LNRA 2Y7DA 4M6QA 1KM3A 2OT1A 4A2SA 1DV7A 4JTGA 2E6FA 4M7SA 2E5CA 3SGUA 4O53A 3LXCA 5G4WA 5I3IA 1JCLA 1G69A 4LT9A 1WYIA 1XUUA 3CIWA 1UUOA 5AB3A 1M7PA 3DFQA 1QOPA 3A9IA 2Z6IA 1FWSA 1LRQA 3B06A 4LC6A 2QDGA 4A3UA 4MOZA 2YCEA 1TPH1 1OFQA 4AWUA 1P0NA 3A5FA 1MEWA 3GLCA 4WZHA 4JDYA 2KZHA 4X22A 3ABRA 1OG0A 3LOTA 3JS3A 3W73A 3N2MA 2DZPA 2GQ8A 2QCMA 4N02A 1Z48A 4UTKA 1OF8A 1JCMP 1JR1A 2F84A 4NX5A 3RF9A 2YPIA 1H7XA 4O18A 3IVSA 3F1QA 1ICPA 1A5AA 4WXYA 3STCA 4GJ1A 1FCBA 5G2HA 2E09A 1H7PA 3MBFA 2AAMA 1G4TA 1M6JA 2CLIA 1KTCA 4JYDA 1OVDA 4MY8A 2CLFA 3W7DA 1KM4A 2DORA 4UUIA 2ZA1A 1EPXA 3HIJA 5AC8A 1H60A 3G0SA 1FWWA 2ZZ3A 1YPIA 3CEUA 3SGZA 4AHOA 3MMTA 5EMUA 1EUNA 1Q3NA 4XKYA 1JVNA 4MY9A 3UWYA 4O4VA 5F2GA 2HMCA 3P81A 4K8EA 2WV8A 3UZ5A 3S0CA 2C19A 4O0ZA 1BWLA 3IEBA 2D73A 5G4EA 1JRCA 1TQXA 1DJQA 4OE7A 3EKLA 4GXMA 4MUZA 3FYPA 3BG9A 1FBAA 3HGSA 1M7OA 1XBXA 3PBYA 3O07A 3GAKA 5K9CA 1TPC1 4K37A 4WOQA 5D2WA 3A5VA 3HG2A 4NJIA 3W86A 3OVPA 3CWOX 3RFAA 3U2OA 4JTTA 5TIMA 1KFBA 3CHVA 1XI3A 2FJKA 4AAJA 1AG1O 4O16A 1SFLA 3CQ0A 2AQWA 3E12A 3OIXA 4C1KA 4LVFA 3HGOA 3W3OA 1LOQA 2OJPA 1SO4A 5DBTA 2DZSA 4JGDA 3N9RA 1FCQA 4PEKA 3W75A 3NM1A 2CLEA 3C0JA 2PRLA 3G22A 3G8RA 1QR7A 2VEKA 2NV1A 3HGJA 1L9WA 4QISA 2WNZA 4LS0A 1TPB1 4RZ5A 2PRMA 2ZRVA 1SR9A 5FESA 3PY2A 5CKSA 2CZ5A 1ADOA 3OBKA 1W3NA 4AH7A 1O4UA 3W7KA 2Y85A 3DZ1A 3IIZA 4KFNA 5TQLA 3LI0A 1AK5A 5FF2A 3BGGA 1FCUA 1JQVA 4TR9A 5BRBA 2CW6A 3M5YA 3LLFA 4KFOA 4M6PA 4IXXA 3RMJA 1B9BA 2G95A 1D9EA 3M5XA 4HHPA 3R12A 4AHQA 1LRNA 2XFWA 1QDSA 1T99A 2C3ZA 4OGZA 1P5BA 2Y62A 3TCEA 3UWWA 4K38A 2QEZA 3W7PA 1L2UA 4AEOA 3T44A 3R2GA 1S3HA 3G8EA 5DLCA 5CZSA 4W9TA 1RVGA 1DORA 1TV5A 3JR2A 4DPPA 3SIZA 4L4LA 4LS2A 4FNPA 3LTPA 1LBLA 2DZUA 1YYAA 2RH9A 2NLIA 3NQMA 4WY0B 1SZEA 1TCDA 1SQ7A 3G0XA 2EF9A 4O12A 3N2XA 2WSYA 3QEZA 1WOAA 4JY8A 4JTIA 2H8XA 5KTLA 3L9CA 2QAFA 3TW6A 4LUJA 4A2RA 1GYNA 3WJSA 2NV2A 4UXDA 2WNNA 4O14A 3C3NA 4IPJA 2PE4A 1GT8A 1I8JA 5G2IA 3TIMA 3DAQA 3L67A 5D2TA 2NXIA 3G1FA 4S2BA 2V5BA 3MI6A 1S5TA 4E0CA 5SWUA 4IXHA 1VCGA 2WNQA 4QNEA 2HS6A 1DJNA 4RCXA 3DI1A 4NXSA 2ZRYA 2QDHA 3NQFA 4Z08A 3V75A 3GDLA 1OABA 5CSSA 4N9DA 4YL2A 1GG1A 3QF0A 3P67A 4O13A 2CLKA 4B5NA 4MLRA 2QCNA 3LHVA 3LLDA 2E6YA 3PB2A 2VEIA 3EX3A 1EP1A 3FKRA 3KVMA 4TMCA 3FYOA 1H1YA 1NFBA 3PBVA 2ZTKA 3G1DA 4UTTC 2A6LA 3W1XA 4LC8A 2X1UA 1K03A 2CFFA 2VFFA 3NQ7A 5HWNA 3I7RA 5CSRA 3M41A 5F1UA 4FXRA 5LGXA 5AYYA 2CLMA 3W1PA 3T7VA 1PV8A 3OA3A 2ZBTA 2G96A 3T4CA 4N4QA 4ZL1A 2O7QA 3UY8A 2VEPA 1ZY9A 4MYXA 1N7KA 4JYEA 2OX1A 4NNBA 2R14A 2AGKA 3W2JA 4MZ1A 1Z42A 3M0ZA 4IMFA 3WJWA 1LROA 4IUOA 2C18A 1ZAJA 2GVGA 2ZA3A 1W3TA 1LYXA 4FNTA 3NVTA 3M5VA 1OYBA 5ABTA 2W79A 4LV9A 3W74A 3NQCA 3W6YA 3W1QA 2P0OA 1KTBA 1N8FA 4Q33A 3BW2A 3W2UA 1GJPA 1N55A 3G3MA 1UCWA 2PURA 2VFHA 5K9XA 2Y6ZA 4MY1A 3TU9A 3MHUA 2J9ZA 2XN2A 1TTIA 3QQ1A 3L5MA 4DPQA 4WXZA 4Z1AA 1CW2A 4ZZ9A 2V5LA 3GNNA 1QPRA 3INPA 2RDWA 1F5ZA 5AYZA 4NJHA 3AO0A 2FQIA 2HSAA 3UPWA 1MO0A 5HNRA 1H7RA 3ABQA 3W23A 4GUIA 1FDZA 3W84A 4Y90A 4DF0A 4GC4A 2V0TA 1TTQA 3L21A 2C1HA 2ZYFA 2JGYA 1T0OA 1YXYA 2V2DA 1R47A 3P80A 1W54A 4WOZA 4CCDA 1I2RA 3FKKA 2VFDA 3G1YA 2YZRA 2ZZ5A 5F2IA 4HSNA 1OX4A 1FQ0A 3TFCA 1PE1A 3KRZA 3LRMA 2YFOA 3QSTA 4PA8A 4XBKA 2ABAA 4WQ6A 1EP2A 4MPQA 3TKFA 1KM5A 4FB7A 2BZNA 3P74A 3QJAA 4WX2A 3F03K 4O0KA 3S1XA 4JS3A 5C5YA 1SO3A 2R91A 3MWAA 3C2OA 1FWNA 1LLZA 3HG4A 5C2XA 3HPXA 2TPSA 3M7WA 5AHMA 2E6AA 3BV4A 4ZVJA 3N9SA 3QMTA 3LTYA 5LHEA 3GR8A 4BI6A 1B57A 1SZNA 3WK3A 1LZOA 3O05A 5HWMA 1KFLA 5J5RA 5G5IA 4UTLA 4UTWC 5FEXA 4K6AA 1UUMA 4L4MA 4LRTA 4MZYA 4JIQA 4FNRA 1QPQA 4BR1A 4MVAA 3LM7A 3EWUA 4ONVA 1ZHAA 3EX2A 3UY7A 4K7VA 2X1RA 3P84A 1TPVA 1R30A 1LOLA 2NX3A 3W7GA 5LNVA 3LCHA 4XUGA 2NWSA 3W1LA 3QFEA 1QNVA 2ZA2A 4AB4A 1QOQA 1WA3A 5F4XA 1ICSA 4DBEA 3C6CA 1SW3A 4QJ1A 1F2JA 1F05A 5BW6A 3TK7A 3S42A 1F6PA 3TC6A 1VS1A 4ORIA 3W1TA 4CNPA 1LCOA 1DL3A 4JICA 3PULA 2QAPA 2CZEA 2YW3A 3HG3A 1SPQA 4UTMA 1EB3A 5I3GA 2CWNA 3GB6A 4IMGA 1GZGA 1IF2A 5G2WA 3C2EA 1MEIA 3PUOA 5DY2A 1Q6QA 3TA6A 1K8ZA 3HPZA 2A7RA 2WJZA 3M47A 1SUXA 2RDUA 2WOQA 1GOXA 4OU1A 1WBJA 2H8ZA 5IBXC 3I6RA 3WK1A 1IGSA 1F6KA 3DH7A 2Q3OA 2VXNA 4QIUA 1EEPA 3B05A 3BVJA 3BLFA 4JIPA 1WAUA 1OFPA 2ZDRA 1O5KA 1ONRA 4OV9A 2YYTA 2JK2A 3UPBA 1LRTA 4O15A 3R5EA 3FFSA 3BARA 3CEPA 5CPNA 4DO4A 3TJXA 2I9EA 4HT3A 5KINA 5AHIA 3MYOA 4POCA 2Z0IA 4UMAA 3KFTA 2FPVA 5E93A 4D2JA 2B7NA 4DQWA 2H6RA 2Y63A 4O17A 4LVDA 2RDTA 3PBUA 4Y9AA 2WQPA 4U28A 2DZXA 3RNDA 4EOUA 5K3VA 5DCDA 3VE7A 5L9FA 2VC6A 4O4WA 5U4NA 5DELA 4OHQA 4AWTA 2ZRXA 3W7RA 4M7TA 1R2SA 3BGJA 1DQXA 1TRIA 4AMAA 4H6KA 5DBUA 4JTLA 5LHFA 2Q3RA 3CT7A 5DXYA 4XBSA 3TW7A 3N3MA 3SFKA 2YDAA 4JR5A 1SSDA 4K39A 1ALDA 1GVRA 1KFCA 3ELFA 3NQVA 4WY0F 1GVSA 3GDMA 2F7FA 3C8FA 4PL1A 5U7SA 3PBWA 1L6SA 1DOSA 2HS8A 3SI9A 4N9CA 1Q45A 3DI0A 1WQ5A 1IIHA 3HO8A 3RU6A 5D30A 2GOUA 3I68A 4AXKA 1TPEA 4BF9A 1X1ZA 2NZLA 4OT7A 2ISSA 4XTIA 1YTKA 5D05A 5F4SA 5F2MA 1XUZA 1W31A 3EXRA 1HTIA 3H53A 1LP6A 3EXTA 1FWRA 1RR2A 3NM3A 1V5XA 4LOCA 1PCKA 3TSBA 2V81A 1DQWA 2OT0A 3TAOA 2QF7A 1IXOA 1XC4A 1OFDA 3NPVA 2BXVA 3LHYA 1R2TA 3FOKA 3PVFA 1GVQA 3PB0A 3NR0A 4J9JA 3S1UA 3M1ZA 4CCEA 1VZWA 1SO6A 4RZ4A 3DXIA 1XBVA 3R13A 2YYUA 5C54A 4N6EA 3C61A 4NNCA 2EKCA 4UFIA 3UXDA 2O7SA 1L6WA 1F7BA 1ZAIA 1B3OA 3W7NA 1KA9F 3HPSA 1FDYA 3W7HA 3L0GA 3DFTA 5BMWA 5C6MA 3LRKA 3PSVA 1CI1A 2P1FA 3BLIA 4LS1A 4NJKA 4RXFA 1J4EA 1RQBA 4ADTA 3VE9A 3IIOA 1OFBA 1I4NA 3IIVA 3LBCA 1GTHA 5J5DA 4TX9A 4IQLA 3S5NA 3SECA 3LTSA 3VKJA 1Z41A 3TE9A 5K2ZA 3ZR4A 2TMDA 3M6YA 3O6CA 4S2CA 4A29A 5FEPA 1NF7A 1XBZA 2ISVA 5FF7A 2G5WA 1VR6A 1OFEA 2Y7EA 4TU1A 3EEGA 2C0AA 3N14A 1ML1A 3EWBX 1NF0A 3O06A 5CZTA 5KMYA 4Y96A 3W7OA 2PC4A 2B7PA 1VJIA 1TO3A 3USBA 1GWJA 4UIOA 4KKXA 2A7PA 4FF7A 5G1TA 1TJRA 4FEZA 4BWLA 3GX9A 2VOMA 3D0CA 2C15A 3KVJA 3DFSA 3EX1A 4QAIA 4JX6A 2BSLA 1A53A 3BG3A 3O1NA 4R7JA 4GNJA 3MP3A 3OEXA 4O8RA 2QUUA 1GG0A 4EF8A 3WJYA 1LTDA 1D3HA 1WOBA 2NWRA 4K36A 4IPIA 1FWTA 4N2YA 3GDTA 3MO7A 1C9DA 3E0IA 1NAL1 5BNKA 3I7SA 4DF1A 1QPNA 4XZ9A 3STFA 2RKXA 1Z44A 3G3DA 1FXQA 4UTUA 3W2KA 2OZ0A 3NL2A 1VQTA 3NZRA 1IIGA 3B04A 1W5QA 4ZQCA 3NQ2A 1VYPX 3HOJA 1MEHA 2PRHA 1AL7A 2QCLA 3MI2A 4G1KA 4E2BA 1I2QA 1TV8A 2PCQA 3M16A 3ZS4A 3KRUA 3A22A 1K7FA 1QPOA 1ZALA 3G24A 1ZENA 3IIXA 2QCDB 4XTDA 2FLIA 1A50A 3M44A 4BWLC 2Y7FA 1EWDA 3S5ZA 2ABBA 3VFLA 3YPIA 4MZ8A 3MJYA 3NPWA 2A5HA 4UFMA 4GUFA 4JX4A 3U6WA 1PL9A 4YWIA 2ZRZA 2E5DA 1X7FA 5D04C 4O10A 4WJEA 4EVZA 3C52A 2Z6JA 3UWZA 1YPFA 3PWAA 3K30A 4M19A 1HUVA 1KM0A 2BTMA 1OFAA 4PFMA 4Z1BA 3IV3A 3W83A 4QSHA 3EX4A 4RX0A 2A6NA 3HB9A 3NXFA 5HJLA 3W7IA 5HR7A 4O19A 4UTTA 3EWZA 3MP5A 1J2WA 2B7OA 1SZGA 2QUTA 3P8JA 2YSWA 4LTSA 1K8YA 4MYAA 3C2FA 3VNDA 4O1DA 1VRDA 2EGZA 5DN1A 3HQ1A 5K7JA 3HG5A 3MHFA 4XKYB 2C6QA 4MFEA 2OMAA 4PC8A 1TV7A 3M5ZA 4NQ1A 4IJBA 1FY6A 4JD4A 5K4XA 1H1ZA 3L66A 5D32A 1G4EA 3NNTA 1WBHA 5HUPA 2VFGA 4RKAA 3KVKA 4IWWA 1D3GA 3TH6A 2DJXA 4H3DA 3W70A 3QW3A 4X3ZA 4O50A 4Z1DA 3CTLA 1XCFA 4FIRA 4OQVA 4DO6A 4ZQOA 2A1YA 2UV8G 3S1WA 1QFEA 3W7CA 3TQVA 1W8SA 1L6YA 3SJ3A 4AVFA 2J6XA 4EIVA 4BI5A 3ZWTA 4U4MA 1ICQA 2JKEA 2QCFA 1H7OA 2ATSA 3PSWA 4ZQPA 3L5AA 2DZVA 1LDCA 4ALDA 1KFKA 2ZZ1A 2GJNA 1TPUA 1W3IA 1VLWA 3G1XA 3BW4A 4FNQA 1P0KA 3P8IA 2FIQA 1HFBA 3GDKA 3NPXA 1EWEA 2NUYA 5BMXA 5FF0A 1TPFA 3L68A 3SR7A 1BTMA 3C4UA 2X16A 1G67A 4HPJA 1B4EA 4NT0A 1TB3A 1YDNA 2OCZA 1RPXA 4YLWA 1HO4A 1X8FA 2E6DA 1O94A 5HULA 3O15A 4IMDA 4GUGA 5DCEA 3DBPA 3TXZA 1JCJA 3DKLA 5E1QA 1B4KA 2I1OA 1MXSA 1OFOA 3TNOA 5AFDA 1W37A 4FXSA 3THQA 4DEFA 4MJZA 3DKJA 5AYXA 3O6YX 1F76A 5F2LA 1JRBA 4M5PA 2J24A 4DO5A 3Q37A 1V7YA 5MHBA 3P5YA 3IGUA 2ALDA 3THAA 1TJPA 2ZZ4A 3W7JA 2H3DA 2FPYA 4JTJA 4DF2A 4CNNA 3LRLA 3TDFA 4NZJA 5KSWA 1QAPA 1VHCA 1DVJA 4O57A 3LGEA 5DXXA 3TX9A 1AL8A 2I14A 3NQAA 1A5BA 3WK2A 4O1AA 1JUEA 2H90A 5D38A 1THFD 5LNSA 5D03A 3NOEA 4UR7A 4E38A 3GZ3A 3W1RA 4JNMA 2A4AA 4UTWA 3S8HA 3KOFA 4HNTA 2ZZ6A 1A5CA 2GQ9A 1DHPA 4HIBA 2RFGA 1IXNA 1X1OA 1UB3A 1MZHA 2JBMA 1VCFA 4O54A 4I7VA 2DJLA 3FJ6A 1OK4A 6TIMA 1T96A 1U5JA 5EYWA 3NAVA 4JXCA 2V82A 2DZTA 2VENA 4ORMA 2QCGA 1IXPA 3RK8A 4C1LA 3MHGA 2XN1A 3P82A 3CC1A 3ZFHA 1UBSA 4JTHA 3IIPA 2V2CA 1YDOA 4X9SA 3UD6A 3FLUA 4JYFA 1MSSA 4TO8A 1G6CA 2E68A 3W9ZA 2Y7GA 2CU0A 1K7XA 1S5WA 3P60A 5EA9A 3SZ8A 1KLYA 1TRDA 1W5OA 1EIXA 3W2LA 4O52A 3RLUA 3NDOA 3W76A 3QRHA 1AW5A 3HBLA 1OYAA 1P1XA 3GKAA 3TMQA 1C29A 5I3KA 3GNDA 4QITA 5I3JA 3R8RA 3UNDA 3Q2DA 5CPOA 2GVJA 3T55A 4GBUA 5CGQA 5HINA 3SY5A 1O60A 3M9YA 2X1TA 5FI8A 3IVUA 3G1AA 5F4WA 4ML9A 3NL3A 1FDJA 3QSRA 2VELA 1Q6OA 3A24A 2QJHA 3L0KA 1RZMA 1LM1A 3GXTA 4NVTA 3PUDA 1AMKA 2P10A 3I65A 2C13A 4ZQRA 2NUWA 1G4PA 4LVGA 4LW7A 2EAWA 4E2DA 3CM4A 1P4CA 1KM6A 3TQKA 4ZQNA 2ATMA 1O5XA 2JKAA 4UC5A 3CWNA 1TPWA 3S1VA 2HTMA 3QM3A 3ATZA 1OF6A 1TTPA 4LNYA 4YMZA 2WKJA 1H61A 2ISWA 3NPUA 1YDVA 5CG7A 3LCLA 3BK0A 2A0NA 3DFOA 2QCEA 3OHIA 3PAJA 1VH7A 3R89A 2DU2A 3VCRA 4A21A 3GXNA 3Q58A 3G1HA 1VYSX 4UR8A 3AJXA 3NEVA 4I9AA 3Q94A 4IMCA 1LORA 2Y70A 1JULA 4HNNA 3L0NA 2V8ZA 2NUXA 3NQDA 5LNUA 2Y89A 1BEUA 5EL1A 4BFAA 1YADA 1JUBA 3VI2A 1LOSA 2EPHA 2Y88A 1VPXA 2VFEA 4LVAA 1H51A 4JEQA 4WD0A 1TTJA 3TXVA 1YXDA 2XN0A 1PIIA 2V2HA 3IRDA 4IMEA 1R46A 1GYLA 3SW6A 4DELA 3W7MA 1X6UA 3S5YA 5HQEA 4UTIA 3B0UX 3W85A 2QCDA 3BG5A 1LLWA 1OX4B 3LHTA 4ZMGA 4PCFA 3QQ0A 1VC4A 3ATYA 3GKFA 5CPMA 1PS9A 1SW7A 4Q4KA 3NA8A 1YXCA 3O63A 1ZAHA 4QNWA 3CB8A 3QPZA 4FNUA 1A5SA 3TJLA 2W6RA 4JTUA 1M5WA 2QCCA 3F4NA 1EUAA 3UYCA 5I3FA 4N6FA 4EF9A 3NG3A 1YTEA 2RHGA 3N19B 4UNLA 3U8GA 3QYQA 4ADSA 1AW2A 3JRKA 4Y8FA 4GRSA 1GTEA 1OHLA 3SSJA 2E5BA 2J27A 5D02A 3GR7A 3MUXA 4WUIA 3G18A 2CLLA 3UWUA 3BLEA 3W22A 1W5MA 5CZ0A 3EWXA 1W0MA 5D2XA 4ICNA 2J9YA 3N34A 1TYGA 4FHAA 2WSQA 4I7WA 4OBTA 4HN4A 4UFKA 1KV8A 2V9DA 2FFCA 5C55A 1VCVA 2X1SA 1WDWA 4UTHA 1SO5A 4NZFA 5HMSA 5DCBA 4MKNA 4KWVA 1W5PA 3LCGA 5LKYA 3E49A 4NJGA 4RXGA 2VFIA 1FUYA 4BK9A 3FEMA 1RQHA 3QW4B 4H4IA 4R33A 3TROA 3PM6A 1S5VA 3W7EA 2NX9A 2R94A 1KBIA 3WJXA 4WY0A 4CQAA 2Q8LA 2FDSA 1TQJA 1C8VA 4CQ9A 5D09A 1TMHA 5DY3A 2J9XA 1HG3A 4CCCA 3TV8A 5K4ZA 5H91A 1HL2A 3GVGA 4GE8A 1K8XA 1DBTA 3CLMA 2YX0A 4EWND 4PH6A 1I45A 3L5LA 2G97A 1WX0A 3QMSA 1TREA 5AHLA 3G1SA 5AHEA 4R34A 1XM3A 2FPTA 4R53A 1JUKA 2FB2A 4TMBA 1SU5A 2GUUA 3ABSA 3LDVA 4AF0B 4AHPA 5TBOA 1PHQA 1WXJA 4JTEA 3HF3A 1XXXA 4TIMA 2BLEA 2Z1BA 1E51A 3M43A 2Q8ZA 1XKYA 2B0MA 2X2GA 3S9YA 1OYCA 2YW4A 3RLVA 1W56A 1G7VA 5FEZA 1ZNNA 1OX6A 1GEQA 4JDBA 1WV2A 2B7QA 2ZRUA 3F4WA 1O95A 1Q6LA 3LB0A 1YLVA 3W88A 5EKYA 4N9EA 3W1AA 4FO4A 4JX5A 3B0VC 2A7NA 5GVJA 3A23A 2ZQ0A 1TIMA 1AW1A 3P5ZA 4BI7A 3L65A 1GPWA 3HGRA 5KITA 4Z1CA 4JN6A 2QKFA 3W7QA 1KM2A 2YFNA 3TR2A 1H50A 3UXAA 1F74A 3QMRA 3P61A 4JTKA 4LUIA 3W72A 4Y6GA 3B8DA 3C2VA 1QO2A 1TPDA 3DGRA 2TYSA 3ANYA 5T26A 3EB2A 4UNKA 3C2RA 2X30A 4KWWA 3GAYA 1OK6A 2WO5A 5L6UA 4IOTA 2Z2UA 6ALDA 2A21A 1FX6A 3CIXA 1H63A 3E02A 3NQ6A 4MJMA 4LRSA 4FX8A 2R8WA 1HO1A 1JJKA 1H5YA 2NX1A 5FF3A 1SW0A 2E77A 2GJLA 1Q6RA 3DU0A 4Q32A 4NU7A 1VLIA 2ZZ7A 1XDLA 8TIMA 3H54A 2JKPA 4O1BA 1ME8A 1RQEA 1XDMA 1RD5A 1KV5A 5K9DA 4X2RA 2WPBA 3KXQA 1TSIA 3LBMA 3FIGA 4RJEA 4AF0A 2QJIA 1RV8A 3LI1A 4K8HA 4CLMA 1JQXA 3IGSA 4PODA 2EHHA 1U83A 4M6VA 4UMCA 5FF4A 1F73A 5CZJA 3LXBA 1GVOA 5D2VA 3LCIA 1JCYA 2A2IA 4JTFA 4NJJA 4S1FA 5I3HA 3B4UA 3PF3A 3L2IA 3LV5A 4XWUA 3IVTA 1EP3A 5FEWA 4GWEA 3OVRA 3T78A 3OG3A 1KBJA 4A22A 5HWJA 3EX6A 5AOUA 5KZDA 3PG8A 3NL6A 3E9AA 3GXPA 2BX7A 4NNAA 3MI3A 3KAOA 4ADUA 1KFEA 1BWKA 1SZFA 5LNWA 3UQNA 3NGJA 3PR2A 1G7UA 4FX7A 1SFJA 3LV6A 1DKWA 2VKZG 4KFPA 1PCWA 5AC6A 4IGHA 1UASA 4GUHA 3UZJA 1W1ZA 4CNOA 2H3BA 2NXGA 1VHNA 3O6DA 4ZQMA 4YCOA 4N4PA 5G1YA 1CX9A 3GK0A 1OFRA 3STEA 3GDRA 1Y0EA 1GVFA 3EXSA 3BW3A 4LY8A 3FA5A 2YGYA 2FTPA 1XFBA 2DZWA 2YXGA 2CLHA 2GPTA 4QQ3A 1G4SA 3DHFA 3DFPA 3N73A 2QR6A 2CLOA 4IX0A 3TUUA 2QCHA 3LHWA 4P2VA 2V30A 1ZJIA 1YTDA 3HMJG 5EBUA 1NVMA 2LLEA 2QJGA 3PUEA 2VEMA 1H7NA 2WSRA 5KZMA 1FXPA 4LU0A 1GQNA 3EWWA 4DBDA 4UFLA 3HJZA 3WFAA 3P62A 3B03A 3MBDA 3DHDA 1QO5A 5KZEA 2TSYA 3QH2A 3CPRA 4CQ8A 4HSOA 2ZTJA 1OX5A 2A85A 3T40A 3NQ8A 3ABOA 5AHFA 3LHUA 3A21A 1K3UA 4QM1A 1R2RA 1FCVA 4NX0A 1PHWA 4UMBA 1KFJA 3MP4A 3PG9A 5IBXA 5LGZA 3ZWSA
chains in the Genus database with same CATH superfamily
4OOZA 2UZ9A 3KWSA 2PP0A 1YW1A 1OGBA 8A3HA 3EA3A 4GZJA 1V08A 5TNVA 4P61A 1I60A 3MU7A 2OYMA 3C56A 4AZ5A 4YHEA 3W07A 3U7VA 3WK0A 1KW1A 4RZ6A 3S6DA 1FH7A 5E09A 4C6LA 3PJTA 5EPDA 2R1NA 4U2YA 1F6YA 4XQ6A 3W1NA 1ME9A 3GZAA 3P93A 2PODA 4P8UA 3BO9A 1IT0A 3WJZA 5CH9A 5EY5A 2A3CA 4HZ8A 2GSEA 4QS6A 2WWDA 3UFYA 1XIMA 2ZZ2A 3TYZA 4D6CA 4LBSA 4ACZA 1EX5A 2JGQA 3WUBA 3G1VA 3BCDA 4FIQA 1V03A 2NXHA 3KRSA 3PZUA 3QTPA 1G5AA 4UCGA 3BZGA 5I7GA 1PTDA 2HK0A 1FHDA 5BOOA 4UFJA 1JCNA 3R58A 2QPUA 1T8XA 1ZCOA 3WDPP 3MTWA 2HVMA 4NUWA 5EMKA 3EKZA 4XZIA 1QXLA 3PZ9A 1ZBWA 1E55A 4GPNA 2DUXA 1KR0A 3GG7A 3T05A 2NLYA 4Z0SA 4XB3A 3RG6A 3EWYA 5CC3A 2OEJA 3H55A 3M4HA 1DWFM 1M1BA 3V0UA 1H62A 3QPYA 4ZO6A 1OJXA 1EFZA 4OWGA 2PTWA 4MLJA 4PFHA 2YR1A 1VP5A 3NQEA 4IGMA 3VNLA 4FR1A 2Y1HA 4AWSA 3R6IA 4XKMA 1NWSA 1F9CA 1GHSA 3ZT6A 1KM1A 3KHJA 4N9BA 4R7WA 1Q7ZA 1XBYA 1B2YA 2C16A 3VO0A 4FLSA 2I17A 4UFHA 3FJLA 1XIEA 4LVBA 3K1DA 2WC7A 4CD4A 2HNHA 2Z29A 4NAFA 3E96A 4I7UA 3TSDA 3LCXA 3T0TA 3FJ4A 2YJQA 4S3EA 1JZ7A 1WZAA 3E2VA 1K1DA 1HJQA 3SGUA 4MM1A 3N4FA 1JCLA 1G69A 4LT9A 3AUJA 4IICA 5DANA 1A0CA 4PEEA 2WHLA 1M7PA 2D24A 3DFQA 1DJHA 2BNJA 3BICA 1FWSA 1LRQA 3WMBA 4A3UA 4MOZA 2OTDA 1D8CA 1LG1A 3A5FA 1MEWA 4AG0A 4DUXA 4WZHA 3LYEA 2KZHA 1KD0A 4X22A 3LOTA 4DJDD 3MCNA 3N2MA 1FWDC 1FHVA 4WJ8A 1P43A 3WLPA 1Q13A 1VFMA 2BY2A 3WENA 4NX5A 2XSBA 3F1QA 4H6EA 3WQVA 1A5AA 2XVGA 3KOZA 1FCBA 2AL1A 3E5BA 1G4TA 1WPCA 1VBHA 4LAZA 1PWLA 3CPUA 2QMKA 3II1A 4UUIA 2ZA1A 5AC8A 3WDQA 3E2QA 4KETA 5I00A 5G4HC 5EMUA 3SQSA 3AU6A 7CGTA 5BXTA 1MDRA 1HGWA 2HMCA 1VJSA 4K8EA 4ACYA 4XZBA 2C19A 1BWLA 1ITQA 1GNXA 2D73A 7ODCA 4OE7A 4MUZA 3DEQA 4QDMA 3VK5A 5K9CA 1MW3A 3NO1A 1V0LA 5D2WA 4ROQA 3UG5A 1XIHA 3HN3A 1FKWA 2OGYA 4YWSA 3U2OA 1JAEA 1CB2A 1XYLA 3V5CA 1SFLA 3M0MA 3CQ0A 4ZB2A 1UC4A 2NVAA 3PFMA 4C1KA 4LVFA 3HGOA 3VIJA 3N17A 2OJPA 1UD2A 3EEZA 2DPEA 3GD6A 3LZ3A 1U1UA 3W75A 3TOYA 1CTNA 3A4AA 1VPYA 2VEGA 2OU4A 1N8WA 4DUWA 1L9WA 1J18A 3KE0A 1RCXB 3PY2A 3LPOA 5LXXA 3QKZA 1FP9A 4IIDA 4PB3A 4K2SA 4L65A 4KFNA 3BGGA 1JQVA 1PAMA 1V3MA 4ZOEA 5BRBA 2VRKA 3PWIA 3ABXA 2F6UA 4EPBC 2D0HA 4B5XA 4BQ2A 1M03A 1LRNA 2XFWA 4GO8A 2X0YA 1T99A 3ZJ6A 2Y62A 3TCEA 4HTBA 4AEOA 3O7UA 1XW8A 1S3HA 2VD9A 3G8EA 3CV1A 5DLCA 5CZSA 1XD1A 2EPMX 3EZ4A 1DORA 4QAWA 3K8LA 1UQYA 2IQDA 2DZUA 2PA6A 1IWAA 2BY0A 1YYAA 3FYYA 1SZEA 4PTXA 4AD4A 3TTOA 1PTGA 7ENLA 4JQ1A 3N2XA 3QEZA 1WOAA 2ZE0A 2VURA 3VAVA 1SMAA 3L9CA 5ECUA 1OD8A 3WJSA 5JBFA 2NV2A 1UQZA 3C3NA 4IM4A 3CH0A 5G2IA 3IUDA 3L67A 3SRHA 2HE5A 2V5BA 4L6HA 2E9BA 1S5TA 4E0CA 5M5DA 4IXHA 1VCGA 4QNEA 4JQAA 4NXSA 1UP2A 3V75A 1P6BA 3N1AA 3NCOA 4YL2A 1C3FA 1E1FA 4UQBA 3VGGA 4MLRA 4J3TA 3ZXWA 4C1NB 1US0A 2E6YA 2XVNA 5CGMA 2IPWA 1EP1A 1EJVC 3KVMA 3UEQA 2YCJA 4H8VA 2NSXA 2EKGA 1NFBA 4UTTC 3VCNA 2VFFA 3QZ6A 5HWNA 3I7RA 3OJGA 2PCEA 5H8PA 2HVNA 1I6NA 1WE5A 5LGXA 1U1JA 3GNRA 2PZNA 1XGZA 2ZBTA 4V1XA 3OYXA 4E2OA 3T4CA 4H6RA 4B15A 4ZL1A 2O7QA 2DT1A 4TOQA 4MYXA 2EXOA 4JYEA 1XLAA 3WF0A 5HAOA 3T07A 1F4HA 2AGKA 1S2TA 4R5EA 4YN5A 4M3PA 1E71M 1QPKA 1Z42A 1HP5A 3V18A 2FTYA 4AZGA 2E8ZA 1JNDA 3U57A 1JYWA 3M5VA 1KNWA 3BSHA 3ITVA 3VOGA 3NQCA 3QC0A 1PKMA 2I56A 3V3WA 4Q33A 1VB9A 1GJPA 3G3MA 1UCWA 2PURA 2VFHA 5K9XA 1XLHA 2VGGA 1CW2A 4ZZ9A 3CV2A 5DFAA 3IK4A 4PMUA 1EGZA 3AO0A 5BOEA 4GVFA 3BMVA 2HSAA 1MO0A 3ABQA 4ZE5A 4GUIA 4YPJA 4GZ7A 5F7UA 3GTIA 3GO2A 1VEOA 1TTQA 3L21A 3V0SA 3CAWA 2PDCA 1YXYA 3P80A 3CT2A 4HNCA 5M3WA 2ZZ5A 3WSUA 1V3LA 2PMQA 3WQGA 1Q85A 4WQ6A 4MPQA 3CTTA 3WFLA 2BZNA 4WX2A 3F03K 2GVYA 4LXFA 3GSMA 3P0XA 2R9RA 4LCRA 2DY3A 1E9IA 3C2OA 1W3LA 3PJUA 3POHA 4BF5A 4HSHA 4PULA 4DAIA 3HG4A 3W38A 4G6CA 4FXFA 3BUVA 4GIRA 5AHMA 1HJXA 1HJUA 5LHEA 2VZSA 3LTYA 1B57A 3AIVA 1LZOA 1KFLA 3E3HA 4K6AA 1UUMA 2VX7A 2F2HA 1PZ3A 3BH4A 1QPQA 4LAKA 3LM7A 4K7VA 1NWUA 1TPVA 8XIMA 1EOKA 1LOLA 1R30A 2NX3A 1JDCA 3KL3A 4LBUA 4XUGA 2ZA2A 4AB4A 1WA3A 1VFSA 2OQHA 2WMHA 3B9EA 2HBVA 2QF8A 2I5QA 4QJ1A 4GH1A 3CYJA 4F2TA 3TK7A 3BAJA 3DERA 3W1TA 3XISA 2WZEA 1TA3A 1MRQA 1SPQA 1PKNA 1IF2A 2UBPC 3C2EA 3DOPA 4DX3A 3OA5A 1AJZA 3PUOA 4D8AA 1Q6QA 2D22A 4EX4A 4L56A 2ADAA 4RDZA 4G9PA 4FF5A 2HV5A 5FOOA 3KCJA 4E4UA 2GGGA 3CPGA 2Z25A 1WBJA 4PMVA 4KW2A 4PUUA 3TWBA 3E0FA 3ITTA 3I6RA 4MWAB 3WK1A 1CB7B 2Q3OA 3ALFA 4PUKA 4M1BA 4QIUA 4GFIA 1LQ2A 3BVJA 4GQ0A 4V33A 2VQTA 3U5YA 1OFPA 1UWQA 1TG7A 3TN5A 3OOQA 4AUBA 1X38A 1SGJA 3A64A 3P0WA 1B3VA 2XFYA 3QY6A 2IW0A 2JK2A 1EH9A 3S9ZA 1LRTA 4HPNA 4O15A 4HGXA 4P8VA 1CDGA 4HHHA 4ZR8A 4DO4A 3CGTA 1FHUA 4HT3A 3W6MA 4GISA 5AHIA 3S5SA 1RCOB 2PDHA 2B7NA 2H6RA 2Y63A 2QT3A 1NFPA 1J93A 4TV5A 4EPKA 1P0EA 2DZXA 8XIAA 4WDXA 5K3VA 3FAXA 4HK6A 5AC5A 2YCLA 5AC4A 3CASA 2FVLA 1J5SA 3W7RA 3QOMA 4D8ZA 2BS9A 1JD7A 1R2SA 4NRSA 3BGJA 2Y2WA 3RPTA 5DBUA 1VIWA 1PYFA 3M0JA 5LHFA 4MB1A 5DXYA 5H1WA 4GZIA 4LANA 1EHAA 1TV3A 3SFKA 2YDAA 1JCTA 1SM9A 1NOWA 2PD5A 4JR5A 1UR3M 4K39A 5BXRA 1H2JA 1OCJA 4XO6A 1REQB 3AALA 4DRSA 2WSPA 4IJRA 2BDQA 1J8VA 4JKLA 2X0HA 3B8WA 4H2CA 3LQLA 4N9CA 3JVAA 4ZENA 2GK1A 1WQ5A 3HO8A 2WVSA 3WNMA 3MZNA 2HROA 4I5UA 1X1ZA 3D46A 4XTIA 1JYXA 1YTKA 5A8NA 2WMIB 3EXRA 1HTIA 4LOCA 1XLBA 2FZDA 1QI2A 1XC4A 3SADA 4PMJA 1OFDA 2BXVA 1R2TA 3PVFA 1KXTA 5AECA 2QPSA 2WANA 3NR0A 4J9JA 2CESA 3FCPA 1CNVA 5BU6A 5FJIA 4CCEA 1VZWA 2XG9A 3KOXA 1OGGA 4NNCA 2EKCA 1Q66A 2Z1VA 3UXDA 3QTGA 4XAYA 1B3OA 4DJFD 3W7NA 2J8FA 3HPSA 3W7HA 1QI0A 3DFTA 4HN8A 5BMWA 1GVIA 1CXHA 4D72A 2P1FA 1FWBC 1K70A 1LQ0A 2DH2A 4B5WA 4Z42C 3IIVA 4GQBA 2JFEX 1WCGA 1GTHA 3AZTA 4JKKA 3ORWA 3WD3A 3TC3A 5K2ZA 3ZR4A 1RBOB 1E4NA 3EMCA 2E67A 4HPGA 3R8GA 1BWVA 1IT8A 1H4PA 3NGFA 3C0SA 3JUGA 3QGKC 3QHNA 3WUFA 1R86A 1OFEA 4KWOA 1RY0A 3S2JA 3DG7A 3W7OA 1TO3A 2YLLA 3USBA 4UIOA 4KKXA 4AD2A 3VGEA 3A12A 5A94A 2VOMA 3D0CA 4W93A 3QGAC 3DFSA 1XG4A 2ZUMA 3FY1A 2FZBA 1A53A 4GNJA 3MP3A 1ONXA 4MMWA 1ITCA 1YX1A 3SCWA 1WZMA 3ZOAA 3G2GA 2NWRA 1FWTA 4N2YA 1ONWA 4A8IA 1QPNA 4XZ9A 3F5KA 4PCNA 4XZWA 3NL2A 3QHOA 5M1TA 4AIEA 5I09A 4QE5A 4DBSA 3B04A 1VYPX 2QS8A 3HOJA 3CK5A 1MEHA 2PRHA 3KBVA 1E3XA 1JPDX 4EKJA 1IZCA 4XD3A 4GA8A 4TTUA 3EGJA 4MJ4A 1QPOA 3LNMA 4I5RA 3RDKA 4XTDA 4MDPA 3CXOA 5DQPA 2RUSA 1UH3A 3AZSA 4BWLC 4TX8A 4EACA 1LWJA 3YPIA 4QEHA 3R0UA 4UFMA 3VM7A 5A69A 5HMFA 3TZFA 3IAQA 3E5PA 2C91A 1OT1A 1A3HA 3EDEA 4PRWA 4EVZA 3UJFA 3V36A 2CHOA 3V4BA 2GZXA 2UWFA 3PWAA 4E4PA 5A6BD 2MUCA 4PFMA 1UP3A 1JDEA 4DJFC 2NQ5A 3NXFA 5CJMA 3W7IA 1Z69A 4UTTA 2IQ0A 3EWZA 1J2WA 2B7OA 3RMEA 2ZC8A 3B0XA 3OZPA 4EAMA 3WBWA 1QATA 4IFKA 4I9TA 3COTA 5AVHA 3VKDA 3W28A 3SN1A 2YSWA 1ITUA 3GYCA 1UR1A 3C2FA 1XLJA 2GGHA 4CNTA 3BURA 1WO2A 4O1DA 1VRDA 4R88A 5DN1A 3HQ1A 3IJDA 4PMQA 3MB9A 4WGHA 4MFEA 2FHCA 5DRCA 1UR9A 3KBSA 1TV7A 1FKXA 5LIYX 5K4XA 1H1ZA 5D32A 4C6QA 1V3KA 5AYBA 5HUPA 2VFGA 4RKAA 3M0HA 4W8AA 2C79A 3TH6A 3W70A 2E1WA 3QW3A 3SUVA 1SVDA 4PCSA 1U1HA 2D20A 2WHJA 2QQ6A 3RXZA 2A1YA 2UV8G 3W7CA 5A6BA 4L80A 4S38A 3HTWA 1L6YA 3AROA 5B80A 5I06A 2PWUA 4BI5A 3ZWTA 4WK9A 1H7OA 3VNYA 2WWCA 3PSWA 4JTQA 3L5AA 2EJ1A 2JE8A 3W81A 2WPGA 4CGTA 2ZZ1A 1FWHC 4FNQA 1DJGA 5LIWX 3CL7A 1HFBA 4H19A 1YRRA 2NUYA 1TUXA 3L68A 1OZQA 2ZX7A 4E5TA 2X16A 1G67A 4HPJA 3GQYA 1CECA 3TP4A 3H21A 5HULA 1SYTA 4WDTA 1C8QA 4HBKA 1MXSA 5CXPA 4GXPA 4FXSA 3DKJA 4FSAA 4X9YA 5F2LA 1F76A 1XLMA 4M5PA 2J24A 2BY1A 2Y8UA 3IGUA 1TJPA 4C91A 2H3DA 4R9OA 1W1PA 3LRLA 3EB4A 5JH2A 4NZJA 4O57A 1DVJA 4F2UA 1WB0A 1XYFA 5DXXA 3LM3A 3NQAA 1TWIA 4FZIA 4H04A 4S39A 2EEXA 4ATDA 5LNSA 3D47A 4U10A 3NOEA 5HQLA 3GZ3A 2V5JA 4JNMA 2VWSA 1XH0A 3KOFA 4HNTA 2ZZ6A 3D5HA 2GQ9A 2PDXA 1OD0A 1LQAA 2GWGA 4FAMA 4HIBA 4WSKA 1IXNA 1ZLPA 4I7VA 2VCCA 1JF6A 2YB1A 3FJ6A 1O5RA 6TIMA 3LU2A 3SQMA 3NAVA 1YMYA 2DZTA 2QCGA 1FRBA 2XN1A 4AVOA 2NW0A 4MB5A 1K9TA 2I5GA 3CC1A 2X0SA 3SCVA 1EZ2A 1UBSA 4JTHA 1GKRA 2BGQA 4KEZA 2D3NA 2Z26A 1V6TA 3FLUA 1OCQA 4KPLA 3QHMA 1P7TA 4DUOA 5A3HA 1QASA 2CKSA 1K7XA 3P60A 1V7AA 1GQIA 3EA2A 1W5OA 2DW7A 3VABA 3LBOA 1JPKA 4F2BA 2DZAA 4DJFA 3FHAA 1I0DA 3VVGA 4AD0A 4JIRA 2G50A 2C71A 3HBLA 4URIA 1UKTA 4BZYA 2OZ3A 1VD6A 4R27A 5I3JA 4JPGA 4Y8EA 1KRAC 1Q6FA 1O60A 3BJTA 3DFYA 4LB4A 3NL3A 1FDJA 5HOSA 4NL1A 4H1ZA 3L0KA 2XH2A 4QJ5B 4X2PA 2C13A 3QQWA 1IR1A 3HQPA 1HF6A 2DVTA 3SCQA 3WH5A 1G4PA 1TZ7A 4LVGA 4LW7A 3CM4A 4LYKA 1P4CA 4ZQNA 3QLDA 2A3HA 1O5XA 1B9ZA 1TR9A 1P48A 3BJSA 2J66A 3QV6A 4YMZA 5DO8A 2V3EA 2ISWA 1YDVA 5CG7A 3WQ5A 2EG8A 2ON3A 4NG3A 2QCEA 3ARYA 1V6UA 3R89A 2P3EA 3G1HA 1SZRA 4UR8A 2VHLA 4D6IA 1US2A 2B31A 2V5DA 4R3UA 4DJDA 4BA0A 2C8NA 3PBMA 3KM8A 5LNUA 5EL1A 3LA4A 1SR0A 3VI2A 3ZJKA 4LJ3A 2ZXBA 2BBFA 2VFEA 3QOKA 1YNYA 2CLPA 3RITA 3DBNA 2XN0A 1PIIA 4IMEA 3WQ6A 5HK4A 3W7MA 3S5YA 5EFDA 1MXGA 5IHRA 3B0UX 1S5NA 3BG5A 1R9XA 1LLWA 1OX4B 2VC7A 2CITA 1GOWA 4ZMGA 1A4LA 1VC4A 5H8MA 5CPMA 1XGEA 1SW7A 3NA8A 1W1B1 3A4XA 4B2DA 1M5WA 5XIAA 4EF9A 2WZHA 4GJIA 4D1JA 2RHGA 3N4AA 2JEPA 4BEQA 4GACA 1AW2A 3JRKA 1GKQA 4GRSA 1WZLA 1GTEA 3RX4A 2E5BA 3JZUA 2VC5A 5D02A 2VX6A 3G18A 4L5ZA 3WZ0E 3OZMA 5HBFA 1C90A 3BLEA 4H8UA 1H49A 1NP0A 3TR9A 5BROA 3VNZA 4UR9A 2J9YA 1M04A 4FHAA 3OP2A 2WSQA 4I7WA 3WBXA 1KV8A 1ZBCA 4DZHA 1WDWA 4UTHA 2G4FA 1H09A 2OELA 3N13A 1HP4A 3LCGA 1OSEA 1BYDA 4NJGA 4AYGA 2NQ9A 4BK9A 3MY9A 4I3GA 2HPIA 1RQHA 3QW4B 1FWJC 1EL3A 1KBIA 3U3HA 3WJXA 3VU2A 3QR3A 5FL1A 1TQJA 2QDEA 2ZUNA 4QLJA 5DY3A 2J9XA 4QJ4B 1Z32X 1X96A 3WQFA 2OODA 4PH6A 4LUSA 1TE6A 1ELSA 2G97A 3H70A 1Z6KA 3G1SA 2FHBA 1GVYA 1UD5A 1JUKA 4V1YA 4LF1A 3ZVHB 3ABSA 4AF0B 4K1WA 4JTEA 3VD5A 2BLEA 4HU3A 2Q8ZA 2BP1A 3ARSA 3A4JA 3C2YA 1DQUA 4J2PA 1BVZA 5CC7A 3ARTA 2RDXA 3NQBA 4G8TA 4FMVA 3I3EA 1F8IA 1RJQA 4Z2KA 1FTXA 3NSMA 1GEQA 3AIQA 2B7QA 3F4WA 2XISA 1RALA 3Q45A 3SUSA 5EKYA 4N9EA 1HJVA 3UJEA 4ZOBA 4DJEC 2DSWA 3WKZA 1N8IA 5GVJA 2INFA 1AW1A 3MSDA 5REQA 3P5ZA 3HGRA 4Z1CA 4JZ5A 2YFNA 1H50A 1F74A 1TZZA 3P61A 4JTKA 3RLHA 4PMYA 1QO2A 1TPDA 4MNMA 1BF6A 1X97A 4IGSA 5FD0A 2XVPA 3GXFA 2PDIA 3NQ6A 4MJMA 4LRSA 3K46A 4LAMA 2R8WA 4CD8A 5XINA 5D9MA 3RX2A 5BYWA 4GGHA 2V3FA 1DWGM 3VDGA 1CXFA 1UKOA 1W1A1 4J1OA 1RQEA 1Q63A 1RD5A 1QVBA 3BAKA 3LY0A 4X2RA 2WPBA 1TSIA 5A8PA 5CCZA 2QJIA 3SN0A 1JQXA 4J3UA 2QMJA 4GI9A 1U83A 3HV8A 3I4KA 3K13A 3GHTA 2XINA 5CZJA 4H9TA 2YCKX 4CEXC 3FW6A 1NOFA 1BHGA 4S1FA 1GQKA 1JFHA 2YDQA 3MVTA 1R3RA 3OVRA 1OG6A 4IG2B 4NILA 3E9AA 3GXPA 2BX7A 4W85A 3WH7A 2CCRA 3MI3A 3EDDA 5TF0A 4C1NA 4Q8WA 2BVWA 1SZFA 3UQNA 3ZJ7A 1DKWA 3IJIA 1E6XM 2P0IA 3AWOA 5AC6A 1A4MA 5EBAA 4XD4A 3KBMA 3B4YA 4AZCB 2H3BA 2NXGA 1VHNA 3UXLA 3ZM8A 1LUCA 3ZSTA 3T2OA 4C6MA 1MYRA 5G1YA 1CX9A 3ENLA 1R38A 1E43A 3T2QA 3UZXA 1DIDA 1WAWA 3QV9A 3SFWA 3EXSA 4U5IA 1R85A 1DWAM 4Q8VA 2GGIA 1XYBA 2CLHA 1L8NA 3SCPA 2CERA 3N73A 5A95A 3LS9A 1XLEA 3AFBA 2EG7A 2NVCA 3TUUA 1IE7C 2CBUA 1VJZA 5MKGB 3HMJG 2PLCA 4YTUA 2WSRA 1FXPA 4LU0A 1Z7AA 1ZL1A 2HVOA 4I9JA 2BOEX 3B03A 2RGLA 3QH2A 1GQLA 2A85A 3T40A 4NI3A 3FN9A 4U33A 2EBNA 2NQHA 1K3UA 3AYSA 5CPTA 1R2RA 1FCVA 1PHWA 4Q4QA 4C6FA 2VI0A 4IPNB 5IBXA 3HFYA 1VFTA 3TQ0A 4KIRA 4NXKA 1I2PA 3V1PA 4FNSA 4GUJA 1V6XA 3XIMA 3TSMA 3P7YA 1BQGA 4YXGA 1UH4A 4PTNA 2R1MA 3LPPA 3F4CA 3WQCA 4HHMA 2Y5JA 1ONEA 4Q8OA 4MWAE 1H7WA 3LXAA 1P0BA 4YCPA 1NSJA 4MB3A 3HQNA 1PVNA 1K7EA 3H2CA 3GYEA 3PS7A 3Q65A 3TYUA 2XZ9A 7TIMA 1SSGA 2P76A 5D37A 4CCZA 3LCWA 3VKKA 2CZFA 2AGTA 3KVLA 1QCWA 1BXBA 3MW7A 3VFCA 5H2ZA 4UTJA 2QUVA 4LV4A 4MIMA 2Y61A 3CU2A 1PIFA 1E0TA 1KTNA 3PPHA 2EPOA 2Q02A 6REQA 2XH4A 2ZRWA 1CT5A 4K8GA 1JPIA 2TRSA 1VFHA 1SFTA 2J62A 1WUEA 3LHZA 1SMDA 3IJ6A 1K6AA 2B4GA 1O12A 3OVQA 2XWEA 1I0BA 3M6DA 5HNNA 7TAAA 1XRFA 4HK7A 4NKCA 1WXZA 4GMEA 2OVLA 3DYMA 4K1GA 4IIGA 3WLJA 3SCUA 5IXEA 2GSJA 3R79A 1QNQA 4KBXA 1JFXA 5A8MA 3NL5A 2BVTA 2CZDA 3WQWA 4JY9A 1Q5MA 1QNOA 4RV8A 5CPLA 1LBFA 3IGXA 2FB3A 3UA3A 1EA0A 3R25A 1KLZA 2DP3A 4KT2A 2BVYA 2Y24A 2IKGA 3ITXA 3FS2A 1IEVA 3SCSA 4PTVA 5ECVA 2ZFAA 2QDDA 2IXVA 2MANA 3RU8X 3BPWA 3G0UA 4WKAA 3W1MA 3LCFA 5HR6A 2E40A 1KM3A 1A47A 2PLKA 4C65A 4M7SA 3LXCA 3A3HA 3S6TA 3SUTA 4JIIX 3TA9A 3W01A 1WYIA 1XUUA 2OLSA 1U5VA 2ISDA 4HD5A 4DWSC 1QOPA 2VM8A 1XGDA 3LD5A 1HW6A 3B06A 4S3JA 2PBOA 3CV7A 4Y9MA 4OUIA 3URQA 2Z7KA 4JDYA 4EANA 3ABRA 1OG0A 1V3JA 3W73A 4KH2A 1GYMA 2XIMA 1HKVA 1JR1A 1UROA 2A3BA 3RF9A 2ZDSA 3NVDA 2YPIA 1ICPA 1Q2SA 1JZ8A 3ID7A 1XD0A 2AAMA 3BL3A 1IEXA 3EOEA 1VBUA 4BQ3A 2CLFA 4NSBA 1RSCA 2AMGA 5AVNA 1KM4A 3TVAA 1EPXA 4MTVA 3BOLA 3HURA 1YPIA 1MRAA 1R87A 3CEUA 3TLQA 3MMTA 3B8VA 1DWIM 1RLDA 1CBGA 1JVNA 4PRRA 1IHIA 3UZ5A 4O0ZA 4EP8C 1NIUA 5G4EA 1JRCA 3PBGA 4LPCA 4UBPC 1M7OA 2HRWA 1D7FA 3O07A 3GAKA 4ZODA 1TPC1 3A5VA 4NJIA 4KGJA 3W86A 3H8AA 1RA5A 3CWOX 1XLGA 4B16A 4JTTA 5TIMA 4JFWA 3CHVA 9CGTA 1XPGA 1BSIA 1UWRA 5CZKA 3C8NA 2AQWA 1E15A 3OIXA 4S3CA 4JN8A 1KXVA 5D9PA 1LOQA 5DBTA 5E0CA 4JGDA 4C5ZA 3F4DA 4QDWA 4PEKA 1HKJA 3CHFA 1MFUA 3NM1A 2CLEA 1M41A 3G22A 3GY1A 1S2VA 6TAAA 2HE8A 5T9BG 4DJDC 2DSZA 2XIQA 4Q8PA 4QISA 1TPB1 4ZEPA 1DXEA 2GL5A 2CZ5A 1ADOA 3VUPA 3H2AA 4M29A 1W3NA 4AH7A 4LEQA 3GTFA 4JTRA 3MC5A 1HVQA 2Y85A 4UB9A 2RJHA 3IIZA 2WHKA 3LI0A 1AK5A 1FCUA 1L0PA 4X63A 3GBEA 2JF7A 3LLFA 4KFOA 3VDAA 3RMJA 4O1FA 4DWSD 3R12A 1OZMA 2CZVA 3A4WA 3L23A 1P5BA 2QEZA 4G2DA 2W92A 5AKQA 1L2UA 4QX4A 4L9YA 1H5VA 1CGXA 3UG3A 4W9TA 4AXNA 3ES7A 4LS2A 4C7FA 4FNPA 4S3AA 1UR2A 2BGNE 3NQMA 2NLIA 4WY0B 1UW9A 4ZGYA 2OWWA 4B91A 3KDOA 3QY8A 4H01A 3G0XA 3TYDA 4GKTA 3BANA 3QV8A 4BJHA 3TW6A 4A2RA 1GYNA 3FA3A 1HQTA 5EFFA 4O14A 1ZQ5A 4HZ6A 4IPJA 4IPLA 1NH6A 2PE4A 1GT8A 1LT7A 2BODX 3KOYA 3TIMA 4S2BA 2DT2A 2C0HA 1DP0A 5SWUA 1OBAA 2WNQA 1DJNA 2ZRYA 4Z08A 2PSNA 1GG1A 3SRKA 3QF0A 1JGMA 1LLOA 2VUYA 3F5JA 3TCSA 4B5NA 2JF6A 4WLCA 1ZS2A 3LLDA 3T2PA 2CIPA 2FHFA 1EX1A 3FYOA 3PBVA 1BG4A 1D7KA 1S46A 3REQA 3NQ7A 2RGMA 5TAOA 5CSRA 4ZA0A 2IXUA 2WQDA 3WNKA 5F1UA 4C6BA 1TWWA 1RK5A 3UG8A 5AYYA 2CLMA 5IHSA 1PV8A 2R1LA 3R11A 3OA3A 2ACSA 5GQBA 3U7BA 3WMLA 2ANUA 4H83A 2P53A 3UY8A 4J35A 4U5KA 3WUEA 4FLRA 2OX1A 2QHAA 1MUWA 1KXHA 2J7EA 3WD4A 3W2JA 1MNSA 3L12A 4DHGA 5T91A 4LBRA 5DMMA 1I1WA 2Z28A 4IMFA 3BE7A 1LROA 4PMNA 4IUOA 1UWIA 4S3DA 2OXNA 3STPA 4QXIA 2CXGA 2W79A 4LV9A 3AYTA 2WNWA 3W1QA 1BQCA 5BWAA 1KRMA 3ES8A 4H8NA 1JNEA 6REQB 1K4GA 2QPXA 3OPSA 4ZBCA 1YHTA 4MY1A 3EOUA 2WMJA 2EPNA 2Z1WA 3MHUA 7A3HA 2XN2A 1TTIA 3L5MA 4YTRA 4UOQA 3T6CA 3AMCA 1E9LA 2V5LA 2Z4GA 1QPRA 3INPA 2RDWA 5I23A 3ANVA 1T40A 4NYYA 3E0LA 4EPDC 2FQIA 1EGVA 5HNRA 3BCJA 4V15A 2J7BA 3H4GA 3EMZA 4GC4A 2C1HA 2ZYFA 2D1ZA 3VNJA 5C2CA 2V2DA 1WKFA 3WQDA 1W54A 4DZIA 1OM0A 4WOZA 5C70A 3RX3A 1W8GA 3FKKA 3G1YA 5F2IA 4HSNA 4DB7A 1OX4A 3TFCA 1PE1A 5C9XA 3KRZA 4KQNA 3MUCA 4CQDA 3E0VA 1W17A 2J75A 3E2SA 3TKFA 1VFOA 3B0YA 3M0IA 4US6A 1ADSA 3R10A 1XYMA 1GUVA 1SO3A 5E9XA 1FWNA 2WC3A 2ZUWA 3LSBA 3JZEA 1LLZA 1MZRA 1FVPA 3IAPA 1BYBA 1UD3A 3TW9A 3HPXA 2DQXA 3M7WA 1HKKA 4ZO8A 3SM0A 2E6AA 3BV4A 1HN1A 2PGWA 4H9MA 1QBBA 3WLQA 5G5IA 1UMLA 5FEXA 3S83A 3UF9A 4LRTA 4FNRA 4HMDA 4MVAA 4AX7A 4ONVA 8RUCA 1ZHAA 3EX2A 3P84A 1IGWA 3W7GA 2PTXA 5LNVA 1TWSA 5HNTA 3UJRA 3W1LA 1FA2A 1QOQA 3UCQA 1ICSA 4DBEA 3C6CA 1ISWA 5A6AA 1F05A 5BW6A 3LSCA 2FMOA 3TTSA 2H9AA 1JDDA 2CZEA 1DYSA 3HG3A 1CXEA 1EB3A 1L8PA 3UR5A 1IEQA 2WJDA 3CYVA 2XU2A 4UQCA 4CN6A 2FGBA 2ZXDA 1V3IA 4RV3A 2VDGA 3KWXA 5DY2A 2ZC1A 1K8ZA 3M0VA 2A7RA 4XD6A 1VRXA 1SUXA 3F2BA 1GOXA 4OU1A 1UBPC 1S1RA 3CQIA 1IGSA 1W1TA 1YE4A 4CU8A 1AUSL 3W4RA 2J7HA 1XYCA 4C6KA 1GOKA 5PTDA 3BLFA 3EYPA 1WAUA 3AHZA 4GY0A 2TAAA 3T9PA 3UA4A 4MWAD 3WEZA 8CGTA 3AS0A 3RJYA 3N29A 3IUHA 3VMOA 2PDWA 1C91A 3MKCA 3IACA 5JVLA 5DX7A 3BARA 1QW7A 1U2YA 3FVMA 4L1GA 4O8AA 3MYOA 2ODOA 2Z0IA 3LN3A 5E93A 4D2JA 3SJNA 4DQWA 3RPMA 4ECLA 4JTCA 4O17A 4LVDA 2RDTA 4WIWA 2G41A 4Y9AA 3IJ7A 1OIFA 3MSYA 3WH6A 3CZJA 1D2KA 4NZ4A 4EOUA 1H1NA 2D2OA 2G3MA 4HVXA 4ILSA 3VE7A 5L9FA 2VC6A 3IUIA 2Y4SA 1IYXA 4UTFA 4MSSA 2PPGA 2ZRXA 4OHQA 2OOFA 4M7TA 1KCZA 2D23A 5CGTA 4XVDA 4TVCA 2VVNA 4J3SA 3AHTA 4JTLA 2VO5A 4XBSA 3TW7A 2V63A 4XZLX 3V1HA 1SSDA 1XQKA 4H8HA 1XLCA 1KFCA 4WY0F 4IQJA 4LYPA 2F7FA 1BTCA 4PL1A 5U7SA 3VOCA 1DOSA 3U48A 3SI9A 4IIFA 1Q45A 3DI0A 4FI4A 5I3DA 3RU6A 4Q7IA 2XTKA 1AQHA 1KGWA 2YXOA 1TPEA 3WY1A 2WKLA 2WMKA 4BF9A 4A8NA 4OZOA 4XISA 1XUZA 1W31A 2FH8A 3H53A 3EXTA 5A6KA 4F0KA 4F4RA 1A49A 1PCKA 2HXTA 1DQWA 4MJ2A 1QHZA 3HV9A 2OT0A 3TAOA 1A3WA 3SN4A 4WHBA 1KFWA 1RHCA 2POTA 4I5XA 3BAXA 1GVQA 2WVVA 4XZNX 1SO6A 4RZ4A 1XBVA 3AU2A 3VZXA 4AZ6A 4UFIA 1CCWB 2QV5A 3SSZA 4OBSA 1FWGC 3LRKA 3BLIA 3HPFA 3BAWA 3VE9A 2ISFA 1I4NA 2ESCA 3LBCA 1UWTA 4HNOA 4Q8TA 3M0XA 1QW9A 3AI0A 3SECA 5A8QA 1Z41A 4Y7EA 1KRBC 2TMDA 2YA2A 3K4AA 5FEPA 1Q7QA 1QHPA 1XIGA 3I3DA 2G5WA 3LK6A 3EEGA 1ISZA 3N14A 3MV01 3WD2A 2HDJA 2P88A 3EWBX 2GK1B 2VZTA 3C0LA 4Y96A 2PC4A 1VJIA 1J0HA 1CLKA 3BLLA 5G1TA 4BWLA 4DLMA 4B92A 4FOKA 2C15A 3KVJA 4CD7A 4E8DA 4RE2A 1E6PA 3N6QA 4B9ZA 3EDFA 4O8RA 2QUUA 4M6UA 4V28A 3AXXA 4IPIA 3VZYA 2F2KA 3FV9A 3AHVA 1NAL1 3STFA 3MUY1 1FXQA 4U31A 1VQTA 2CEQA 3QYSA 1Q6CA 1AL7A 1W2VA 2QCLA 3TOPA 4G1KA 1TV8A 1K8CA 3ZS4A 1XHGA 3A22A 1ZALA 4XK2A 4NAFB 1ZENA 4HYWA 5HJXA 1A5OC 3VC5A 1UZDA 3WLMA 2HXUA 2ABBA 3VFLA 4BQ4A 1JI2A 3D3FA 3WH8A 3MJYA 2QVHA 4GUFA 1MNZA 4L6DA 2HBXA 4UWMA 1X7FA 4RUBA 4GVHA 1SJAA 4WJEA 3UWZA 3DX5A 1KCLA 3QR1A 1KM0A 4PB4A 3W83A 1GHRA 3EX4A 1OCNA 2A6NA 1NDWA 5HJLA 3MP5A 4IHCA 1V4YA 1PO9A 1SZGA 3IARA 5IRPA 2ZKMX 4LTSA 4NASA 1ESWA 1ZJBA 1K8YA 2VRQA 4GINA 3VNDA 3KCOA 4IGNA 5CBBA 2A3LA 2R6OA 5LA0A 2C6QA 1TVNA 4H6QA 1H11A 2GUYA 3M5ZA 4Q4PA 4IJBA 4LCSA 1A5NC 3UG4A 5FIPA 3SBFA 4RZBA 1WBHA 3GG0A 3IPWA 1C8YA 3KVKA 4MPKA 4UOJA 1BKHA 2DJXA 3WLSA 3MA8A 4Q8NA 2Z1XA 5M17A 3TYAA 1ECQA 4GCXA 4ZQOA 3HU7A 1QFEA 3TQVA 1EOMA 4PR4A 1W8SA 3BCFA 3R0KA 3DUGA 2J6XA 4HCDA 4FA3A 4DWSB 1O1ZA 5CLWA 2JKEA 2QCFA 4PMDA 1PYMA 2Z1KA 2O55A 2DIEA 2VGFA 5A6LA 4ALDA 3U2ZA 1ZSXA 3GW3A 4Y9NA 3QBUA 3ANUA 3G1XA 1P0KA 4O1EA 4AZIA 3WLTA 1HNYA 3GDKA 2ZX5A 3NPXA 3BLOA 4BS0A 3H2NA 1EWEA 4PB5A 5BMXA 3CQJA 3VC6A 1TPFA 3WIJA 5A2AA 1BTMA 2VR5A 3C4UA 3NSXA 4YTSA 4NT0A 1JPMA 5I77A 1YDNA 4YLWA 5GJPA 4W8BA 3CAVA 1XG3A 2GLKA 3O15A 1IEIA 4GUGA 3DBPA 1ISVA 3E1F1 3KL5A 3M7SA 4HJWA 1JCJA 1J0KA 1NY1A 2I1OA 4EWJA 2PTYA 1OFOA 3UVAA 5AFDA 1W37A 4P7RA 4DEFA 4MJZA 3O6YX 3LMZA 5CPSA 4ZXLA 3Q37A 5MHBA 5A6MA 3LGGA 4JQ2A 2ALDA 5I0DA 5CLTA 1UR4A 1S2WA 2DT3A 2POZA 1XRVA 3GW0A 1X1NA 3W7JA 1M3UA 4DF2A 5ABHA 1JDAA 3TDFA 1VPQA 1QAPA 1VHCA 3LGEA 3GHSA 1QNRA 3GVVA 3RN6A 3TX9A 3VIIA 1MQPA 5B7ZA 5D38A 2JIEA 3EAUA 5BRPA 4UR7A 3WBYA 4E38A 3CO8A 3N2BA 4LYQA 4UTWA 4GC3A 1T6MA 2INEA 3RRAA 2VX4A 2GGEA 1DHPA 3FHQA 2CHNA 2RFGA 3OODA 3DGBA 2DJLA 1GZJA 1OK4A 5EYWA 4ORMA 4OECA 1TV2A 2DSVA 4C1LA 3DESA 3GHRA 1UKSA 1FH9A 1VEPA 2GWNA 3ZFHA 2V2CA 4JYFA 4TO8A 1G6CA 3W9ZA 3WH9A 1XCWA 4HOZA 5EA9A 1EIXA 4ZFCA 4L9ZA 3BLDA 3RLUA 3W76A 4DYJA 1OC6A 2UY3A 3QRHA 3MWCA 1V0MA 1AW5A 1OYAA 4ZTYA 1EJTC 4KF1A 1KXQA 1TR1A 2WLYA 4ERAA 4B2DD 2OKTA 1DXIA 1C29A 2DUAA 3N6JA 4QITA 2D2JA 3MUIA 3M0YA 3UNDA 3Q2DA 1Q4NX 3S1GA 5CGQA 1DJXA 3OVGA 3M9YA 5FI8A 3IVUA 3G1AA 3KDNA 4E2VA 3L4YA 3MKVA 2VELA 3AYRA 3A24A 3BLKA 3MVIA 1RZMA 2PDYA 3GXTA 4DBWA 1M01A 2P10A 3I65A 2VOTA 3GFYA 4AZ7A 2NUWA 1W32A 2VMFA 2KX9A 2FFIA 4E2DA 1R3QA 4HOXA 5C71A 1Q65A 4PCTA 3TQKA 3BMXA 4MAZA 1BFNA 4UC5A 4GVGA 4XVEA 1L6GA 2WBGA 4FOJA 3S1VA 2HTMA 1OF6A 5EMYA 1H41A 3E74A 3LCLA 2EPKX 1XIDA 3BK0A 4PUNA 1KR1A 3BOXA 1CGYA 3DFOA 3QGVA 3PAJA 4A21A 2YCIX 1VYSX 3NEVA 3A3WA 4IMCA 4PBEA 1LORA 1XPYA 2V8ZA 2YL9A 4W86A 5FJJA 4M24A 4BFAA 4C6PA 1YADA 3OO2A 1AH0A 1C92A 1E4LA 2ZXAA 1IQ8A 7REQA 4LVAA 1H51A 4NHVA 1TTJA 3WLNA 2AL2B 1R46A 1X6UA 4JQ3A 1W9DM 2BHZA 3OQEA 1A5KC 4XUYA 1EA9C 4PCFA 4HMCA 1ECEA 3GKFA 4RNHA 3O63A 4QNWA 4HPHA 3CB8A 3HZ3A 4KEMA 4JTUA 3QFWA 4JL1A 3VYLA 5I3FA 1I75A 1ZGDA 1V0KA 4RDYA 2RJGA 3CZEA 3AIWA 5ABEA 2OZTA 5IFPA 2REQA 4ADSA 4XAPA 4LF2A 1QWKA 2UY5A 4GVIA 1OHLA 3C0QA 1K9DA 2IMRA 5MF5A 3CAQA 1XX1A 3GR7A 3GXIA 3QN3A 4WUIA 2VL4A 4GY7A 3CZLA 3SDOA 3OTRA 1W5MA 5D4YA 1HKWA 1DWJM 4ICNA 3N34A 1TYGA 5TD4A 3B9OA 3MSRA 3KTCA 1UOZA 2Q8XA 3T0AA 4C6CA 1DTNA 4GQRA 4D1IA 1FFQA 5LKYA 3E49A 4WDWA 4RXGA 3S2CA 3P14A 1XFCA 4KGLA 4JIHA 4TTGA 4I8YA 1F3TA 4HK5A 4XAGA 3ARVA 3TROA 3PM6A 4HB7A 2R94A 3NXLA 4F9DA 1A3XA 1J9YA 4WY0A 2Q8LA 2YIHA 1C8VA 5FJPA 4W7UA 4C6EA 3PAOA 1TMHA 3CS2A 5K4ZA 5H91A 2O56A 3WLHA 1K8XA 4NRRA 4EWND 3PZMA 3AZRA 3TJIA 3WF1A 1WX0A 3QMSA 5AHLA 4R34A 1E0VA 4R53A 3LDVA 5J04A 1BRLA 4TIMA 2Z1BA 3M43A 1E51A 2E4TA 4GNVA 5FJTA 3EPOA 2B0MA 2X2GA 3S9YA 3AISA 2FGLA 2YW4A 4E8CA 1BRLB 1RA0A 1XV8A 4M82A 4AFYA 3WNLA 5FEZA 2VT0A 3C5QA 4QSFA 3L4UA 2AL2A 3H7UA 3FGCA 4JDBA 1WV2A 3ARQA 4PUJA 3VIPA 1UIOA 1OB0A 1JG9A 1GPFA 2ZWZA 2PP1A 4JX5A 3J7HA 1KWGA 4P7OA 2A7NA 1BVWA 2ZQ0A 1PPIA 3H12A 4AISA 4XAFA 4QLKA 3A3XA 4QE1A 4JN6A 4CD6A 3TR2A 4F3HA 3N04A 3N9KA 3BQ6A 1Q6DA 3W72A 4Y6GA 1BAGA 4IISA 4UNKA 4KWWA 2X30A 4H9VA 1J0IA 3GAYA 2WO5A 2ZUSA 2A21A 1FX6A 3CIXA 3SAZA 4FX8A 5B7YA 1KCXA 5I07A 1H5YA 2NX1A 4MF4A 2JEQA 1EZWA 2GJLA 1Q6RA 3GR4A 1B3XA 5MKGA 2WCGA 1VLIA 3ZLHA 1XDLA 2JKPA 2VC9A 3EA1A 4O1BA 1Q6GA 1EF2A 4Q8MA 2WXDM 4QS5A 1XDMA 1KV5A 2QUNA 4BCEA 3PP7A 1R9ZA 1RV8A 4FALA 3LI1A 4CLMA 4Q22A 2EHHA 2WZIA 4M6VA 5FF4A 5JU6A 1ZU8A 9XIMA 3CUFA 3H24A 1A80A 5D2VA 3LCIA 5CSYA 3UJ2A 1HVXA 4F8XA 2A2IA 4NJJA 4HU8A 3NZGA 3ARRA 4XWUA 4FK9A 4GWEA 5CQ1A 1M68A 3OG3A 1GOQA 3SCRA 5HWJA 5KZDA 2PWGA 3TTEA 3VD7A 1VBGA 3KAOA 4Q6JA 1KFEA 2VNCA 4QJ3B 1IWBA 3WELA 3PR2A 1UYQA 4FX7A 1ISXA 2VJXA 3NDYA 1UASA 3W82A 3UR2A 1W1ZA 5GNXA 3SB0A 4AMCA 3T08A 4OOUA 1OFRA 4IF2A 4QE4A 1E40A 1MWOA 4LY8A 3BW3A 2YGYA 1RBAA 3UETA 2W61A 2YXGA 3GS6A 4YYCA 5BZAA 3PPFA 2O9RA 2QR6A 3K8MA 1OQFA 2PDNA 2CLOA 4IX0A 1UR8A 5HMDA 4P2VA 1NVMA 2LLEA 2QJGA 4HA1A 1H7NA 1XRTA 3UZZA 3VOHA 1E56A 1TZ9A 2J47A 3VNIA 4NZCA 2OO6A 1RLCL 1GQNA 4UFLA 3P62A 1UOKA 3NZPA 3GUWA 3DHDA 3CPRA 4CQ8A 3M07A 3OBAA 3UCDA 2ZTJA 5C7VA 3FK4A 3KCLA 3TNBA 1B30A 1K6WA 3TN4A 3ABOA 5AHFA 4NX0A 3WQEA 4E4FA 1RP9A 6CGTA 1R9YA 3RCYA 3MANA 5LGZA 4XIMA 2OYKA 4IX2A 2WAGA 4WF7A 3OYZA 4FX6M 4ATLA 1T7LA 4S3BA 3GH7A 4HNVA 2IQTA 3DG3A 3KX6A 3NURA 1U22A 3K2GA 2NV9A 1CEOA 4MFDA 4B5VA 2A79A 3I7QA 2E1DA 1UD6A 1LL4A 3GIYA 4HA4A 5A5WA 2DIKA 1QMLA 5F1VA 4C7GA 1XSIA 2OQYA 2VDIA 3W7LA 4D6FA 5IM51 2WB5A 4AD3A 1BGAA 4O1CA 3KP0A 1VGAA 2GQAA 1M53A 3AIRA 4CKQA 3W0KA 3FNDA 2ZICA 1QI4A 3PJWA 3UWVA 3CUGA 5AHNA 3VKCA 2X42A 2VZVA 3HM7A 2CNCA 1UJPA 1NARA 2Y8KA 4YVPA 5LSMA 3ZZ1A 4F48A 3LMYA 1ME7A 3O8AA 2AQVA 4HNUA 1YEYA 2PFHA 2OLHA 2OWXA 1BYCA 4I6KA 4DY1A 1PZ1A 3EMQA 4HKPA 4RK8A 1LBMA 4PMXA 2EQDA 2WYSA 3TFXA 3S47A 2IKJA 4O28A 2X40A 1Z9AA 2WM1A 3PNUA 1IR2A 1BYAA 1XLDA 3S5OA 3QZEA 3B8UA 3PC0A 4LB3A 3UR8A 1H3GA 3WQ4A 3BTNA 1BGGA 3UGRA 4IQDA 1OC7A 4MDOA 4H9YA 3R1ZA 3TMLA 4XZMX 5HPOA 1EDGA 3GUGA 5AC7A 4KCVA 1TVLA 4IPPA 5AZ1A 3TAKA 4LWWA 3NQGA 3VTRA 2DGAA 4GJJA 3CWHA 4GKLA 4LAOA 2WCAA 2J88A 3LLXA 2GDVA 3N25A 3MO4A 1ISYA 3B0PA 1IXQA 1K02A 3LERA 3QC3A 3ARWA 4B4FA 3L2LA 4L61A 1GGOA 1NEYA 3W87A 2A3EA 3PK7A 4H41A 2W0UA 5HUOA 2Y7DA 4M6QA 2OT1A 4A2SA 1DV7A 4GX8A 1MVYA 2E5CA 3KLLA 4O53A 5G4WA 5I3IA 3FDGA 4H00A 3B40A 3CIWA 1UUOA 4JAWA 1GCYA 1JGIA 1R5YA 3T81A 3A9IA 2UY4A 2Z6IA 3G6LA 2HPMA 4LC6A 2QDGA 3AXIA 2YCEA 3M0LA 1OFQA 4J5NA 3RILA 3MJMA 4AWUA 1P0NA 3FXGA 2NSOA 3U5UA 2V6AA 5CG0A 2GQ8A 1EXPA 2QCMA 1Z48A 2PDFA 4N02A 1T8QA 3P3BA 1HKMA 1JCMP 4GG9A 4M81A 2PI6A 1H7XA 2BHYA 3IVSA 3GRIA 2QNEA 4CEUC 4E8GA 3STCA 1UZ1A 5G2HA 3V0TA 2PWEA 3MBFA 1KO0A 3KTSA 3L4WA 4KIEA 1MMFA 3H2FA 2CLIA 1QHOA 1OVDA 3OIHA 4JYDA 4MY8A 3W7DA 4JHZA 3THCA 2DORA 3HIJA 1TA3B 2OQLA 1XF0A 1H60A 2ZZ3A 3PZOA 2D2GA 2R24A 4AHOA 2PF8A 1Q3NA 2XHYA 4O4VA 1O66A 5F2GA 3GTHA 1BF2A 3P81A 2KAUC 1K4HA 1BXNA 1JD9A 1IT7A 3QLLA 1XC6A 2PD9A 2XIJA 3NJ3A 4P8WA 2WM0A 1Y5VA 3IEBA 4TUFA 1J01A 1YPXA 3EKLA 3FYPA 3BG9A 1HZYA 1FBAA 3VD4A 4L64A 3PBYA 1NJJA 3DIPA 1FWIC 3HG2A 4GI4A 1ZPTA 3RFAA 3G6MA 1XKJA 2Q6ZA 4GD0A 1JXKA 1KFBA 2FJKA 3GM8A 1AG1O 4O16A 4GYPC 2QJNA 1Z8AA 5CJNA 3DHUA 4DNMA 4ZCWA 3W3OA 1TX0A 1EC9A 2DZSA 3PWGA 5A6JA 3BSGA 2ZVRA 2FZMA 4PBGA 2V68A 2PRLA 1QR7A 5IDZA 1FWAC 2VEKA 1R3VA 2NV1A 3HGJA 4UOZA 3WYZA 4RZ5A 4N7QA 5T8GA 2PRMA 2ZRVA 3ARPA 1B54A 1SR9A 5FESA 1V93A 5CKSA 2XSAA 4CD5A 3GVRA 4B9YA 3OBKA 5A6TC 4PSPA 1O4UA 4HP5A 1YNPA 2GQ3A 4GYFA 5DT7A 5FF2A 1OGSA 3AXMA 4TR9A 1XH1A 1Z89A 2WLZA 1M65A 1XLIA 3LEPA 1PWMA 4GYJA 4AD5A 1B9BA 2G95A 1D9EA 3M5XA 3PN8A 4AHQA 4WRHA 1QDSA 3CQHA 2C3ZA 1X6LA 3UWWA 4K38A 3W7PA 4UQ9A 3ZMRA 1ITXA 3A13A 3T44A 1LUCB 5LXEA 3DN5A 1DE5A 1WDDA 4JNZA 2J78A 1TV5A 4RE0A 3SIZA 1LT8A 3LTPA 2XDFA 2RH9A 3NOYA 3N3TA 4AZBA 4Z1YA 1DWHM 2EF9A 4O12A 4RNFA 2WSYA 2X1IA 2BXZA 5CC5A 4MWAC 4JY8A 5E70A 5KTLA 1BSLA 4LUJA 1B0IA 3DC8A 4UXDA 3WL0A 3L4VA 1S2UA 2W66A 4S23A 1I8JA 3RIKA 1O1HA 2NXIA 3VGHA 3G1FA 2J7FA 5ABGA 5ABFA 4H9UA 1VBRA 4DI8A 2HS6A 3DI1A 2QDHA 3NQFA 3GDLA 1OABA 5CSSA 2BGSA 3UW6A 3PFRA 4J40A 1LL6A 1CENA 5CPQA 4DXKA 2YB4A 4QG6A 3V5FA 3PB2A 3EX3A 3H23A 1JZ2A 1K77A 4GY1A 4JHOA 3H4WA 1XJBA 1H1YA 4L6OA 3G1DA 3W1XA 2A6LA 4JKMA 2Z7GA 1MUCA 2X1UA 3H2EA 2CFFA 1UUQA 1KC7A 2BOFX 3VIGA 1NWRA 3M41A 3IJ9A 3ZVIA 1ZBKA 4ES4A 3R4IA 3WDRA 3W1PA 2BB0A 4GGBA 2G96A 4DM2A 4PYSA 4GQGA 4N4QA 6XIMA 4L4OA 1UPMB 2VEPA 1N7KA 4D8LA 4C6JA 2DZBA 4NNBA 2R14A 1PZ2A 4U3CA 2X05A 3UERA 4IP7A 1W9UA 3M0ZA 2PUZA 2ZIDA 3PZQA 3R0DA 3LZ5A 3PNZA 4FNTA 3NVTA 1G0CA 1RK6A 5ABTA 3ZO9A 3W74A 3W6YA 4PN2A 2P0OA 3AMDA 4AU0A 2XIIA 4P7NA 4F0MA 1O5QA 3W2UA 5E5CA 2Y6ZA 4PRTA 3PTQA 4WXZA 4Z1AA 4FXJA 3GNNA 4DVOA 1F5ZA 3CUZA 3KW3A 5AYZA 4NJHA 2NVDA 3QV7A 3K4WA 1H7RA 4HNLA 1IWPA 1E4MM 5JIPA 3W23A 3W84A 2FJUB 3ITLA 1ZZMA 4GBDA 4BY3A 2JGYA 1T0OA 2VR2A 2F61A 4CCDA 4NZ1A 4MNJA 3OGRA 2PWVA 3QSTA 2YFOA 4XBKA 3VDBA 4REQA 2E9MA 3RYSA 4FB7A 3P74A 3QJAA 3AQUA 4O0KA 3S1XA 2GDUA 2R91A 4W89A 3MWAA 4EXAA 2REQB 3TTQA 4W5ZA 2DIJA 4AX6A 3RGTA 2EPLX 1CZ1A 4BF7A 2ASHA 2D0FA 4FR6A 4JBRA 1FWFC 1V8EA 1W3KA 1IV8A 3GR8A 4BI6A 2F6KA 3WK3A 3O05A 2ZE3A 4ATWA 2WVUA 1KKRA 3HFTA 4UTLA 4UTWC 2DEPA 5D8ZA 3P2VA 4L4MA 3QKEA 4WKHA 4JIQA 5JIWA 1V79A 4F9JA 3UY7A 4F0HA 2X1RA 3CL8A 3AHYA 1XH2A 2NWSA 3GBDA 2OO0A 1QNVA 1CGVA 1XP3A 2XZ7A 2V5CA 4HTYA 5F4XA 3HJEA 1SW3A 1F2JA 1C7TA 5M03A 5HATA 1KGXA 5I79A 1LCOA 1DL3A 4JICA 3PULA 4LH8A 2QAPA 4MG4A 2QYGA 2YW3A 4G7EA 1XLFA 1IZJA 4DUVA 2VZOA 3KBWA 1MDLA 5I3GA 3GB6A 4HMNA 3VDCA 1YQ2A 1P7TB 2OLAA 3CZ8A 1MEIA 2X8RA 2PF0A 1V6WA 4JNYA 1HXJA 3HPZA 3M47A 2RDUA 4MGGA 2WOQA 1WKDA 1CWYA 2H8ZA 1NDVA 3DH7A 4L1XA 1UP0A 2DSUA 2XSXA 3B05A 3QY7A 2J8TA 3T0BA 2ZDRA 4Q3MA 3O2LA 1ONRA 3ITOA 1PDYA 2YYTA 2XFFA 3ZYZA 4E3VA 2BG5A 4IJCA 2PDBA 4LCQA 3CEPA 1A0DA 3TJXA 2I9EA 2AQOA 5KINA 1F3WA 2WC4A 2YCLB 1EIBA 4POCA 3GFXA 3W26A 4KCWA 1XICA 4WGXA 4RNIA 2IKHA 2WQPA 2ZVIA 4QROA 3RNDA 2HWGA 2AOSA 3RM4A 4G56A 4F40A 2CBIA 3MQTA 5DCDA 2ACUA 3R8HA 4IIBA 4X0NA 5U4NA 5DELA 3WNOA 1ZJHA 2DFAA 4A8LA 3VX1A 3SUWA 1Q6EA 4IZGA 3MMUA 3N2CA 1NP2A 1QNSA 1TRIA 1YIXA 4AMAA 3WDIA 1E0XA 4BKNA 3F4VA 4ENLA 1RXOB 2DDXA 3KP1A 2GOKA 3N3MA 2GJXA 1ALDA 3OLGA 1GVRA 1PZ0A 3NQVA 4QRNA 3GVQA 2WK2A