4QNLA

Crystal structure of tail fiber protein gp63.1 from e. coli phage g7c
Total Genus 244
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
244
sequence length
847
structure length
847
Chain Sequence
TGILTNKQAIARHFGVKQSEVVYFSVGAVLSGYKVIYDKGTQRAYSLPANIGSGVTAISLSPAGVLVHSAGSVDLGALAVTRKEYVTLPDTFTSGSVIQTKNELLTHNGTQYRWAGGLPKSVPLNSTPVSAGGISPTAWVIANDELIRQELNNGLIPPVGSTSVYDVPGIVVNTTTDNRAAAYAFPGKIFIPNGVTIRCNLLPDDDVRKFVGEGKLIVKNQWYAKDHTFDIAASMNGNNKTVNDEIYCAFRDQTFCRIGIIGDSITDGAWGKQDWSSPPTNSDGDLDAPSTYNHSLSGGSHSWTEHWMNGLLLTQSRRSGETIYQSANCSVSGKKLSDGWGYRNFDRGFFGNTRYGAEAPRVCILAMGWNDSSASIATYRDQIDKFVRKAWGYGCAVGIVTVNDNDSVRMAFELSTKKYMADKLGVEYFNLGPNLTSASSRNEQTGYYYYVKKDGTWDTTHPQELGQMAMGNAMYMQTLGNKYCRRVRPGDMLTQAAVENYWDCVGYPSGTHYAPQYVPVSGAPALNVFRFLSKCVTNENVTMTTMVWCEEEGMTVSLLEPWTNAAVVGQSHNIRVESPVGKALFESGEYQERNTQINAYRTVLNGKTAMSYFGGGKTLTTYMGRLRKGLNFIRYIIDGSPTDAYFPMLKFGSYKTDGVKLPMVRLSKEPNMTRPAPVMKQSNANDYGVFGEVLSGTQFSKTADSHLYNGASVGYLAVPRGLKKNTYIALNYNPLTNVGVLVGVNAAGNMCIGTFNNANPTDWVVFGDTTREDKGFKVWEYTSSSTGAHTFTVESDDGTATTSAFSTTVATSGYVGLYNPSASSQLFTLEYSMTIGNVGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Function of bacteriophage G7C esterase tailspike in host cell adsorption.
pubmed doi rcsb
source organism Escherichia phage vb_ecop_g7c
molecule tags Hydrolase
molecule keywords Tail fiber protein
total genus 244
structure length 847
sequence length 847
ec nomenclature
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18668 Tail_spike_N Tail spike TSP1/Gp66 receptor binding N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.800 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4qnlA01
2.10.10.80 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4qnlA02
4OJOA 4QNLA 4OJPA 4OJ6A 4OJ5A 4OJLA
chains in the Genus database with same CATH superfamily
3HJEA 4Y2XA 3QX7A 1ZQBA 2RTSA 3RJKA 5KFQA 3UQ2A 5KFVA 3V7KA 1N2XA 5G5HA 2KJ5A 4RUCA 4QWBA 4TURA 4DOBA 2JRZA 5F3XB 5ALKA 1WWUA 8ICFA 3IV6A 4TUQA 1JIHA 3RFAA 2XY5A 5DQHA 3F2BA 4X5VA 4NZ5A 1KBUA 5AKXA 2R8KA 2VKQA 2FJ6A 3IDWA 5L1MA 2NRWA 3PMLA 2G5IB 4I2GA 1PK1A 1K5OA 3E0FA 4O0IA 2Y2MA 2BCUA 3G6XA 1D8LA 2MSNA 4UQGA 1W1TA 5J2GA 2HOQA 2G09A 4P0QB 1KS0A 9ICSA 2GOLA 4J03A 5ALRA 4NLGA 4F5NA 4DCCA 4LG2A 2AH5A 4UB5A 3BQ1A 1ZQ1C 2AJQA 2Y2GA 5J0SA 3SEIA 2K89A 4UB8U 3HRDD 2AGOA 3K1ZA 3OSNA 1H8PA 2G0AA 2F77X 1IXRA 2ZJAA 3KKAA 1TKDA 2ZIVA 4KLSA 3TFRA 5AHXA 4EBEA 2J6UA 2OM6A 4IC9A 4Q44A 3HKZF 5KL1B 1SL1A 1E6ZA 1Z00A 2ES6A 8ICEA 4KN4A 4PPXA 3GZFA 1E8BA 4BJQA 5ALLA 3RB6A 3KS4A 2R8HA 1RYRA 3PR4A 2YQEA 1JALA 2GWSA 4R8UB 5FP0A 5CEHA 3QEBZ 5KFZA 3TFSA 2OXOA 4JUZA 2ZXIA 4BXOB 1BPDA 3ORYA 4J9PA 3PW7A 1SKWA 3PSTA 4KLQA 1YT3A 2F8KA 8ICIA 2DWQA 4O3SA 2BPGA 4J9NA 3SENA 4IRKA 2KHVA 1U45A 1IIPA 4QW8A 1NZBA 4FS1A 5AIBA 1FIQA 4KLMA 1X40A 1VLBA 4C4RA 2W9CA 2BCRA 5J2CA 4DL2A 3WD4A 1N5WA 3EPGA 1F5SA 5DQGA 2A1JA 4IR1A 2JHDA 2H3VA 2KFZA 2AQ4A 2DKXA 3LVWA 1JXEA 2ZIUB 1PVRA 1NKBA 2BR0A 5KFPA 3SV3A 3KOOA 3MR2A 2D6FC 3LWMA 5KFLA 4CNQA 2LBOA 2W8KA 4MF8A 4B9NA 3L3FX 1HUOA 4CDGA 1XSLA 4DF4A 2DQNB 4O3NA 4ECRA 1Q46A 3ICXA 2L5YA 4DLEA 3AU6A 3H40A 1YUEA 4M9LA 4UAZA 3KTQA 3KBBA 3MC1A 3WX7A 3BQ7A 1L3SA 5KG2A 7ICHA 2XY7A 2Y1IA 4DQIA 3V6JA 4DF8A 2ZTDA 1UR8A 2KKPA 2W9BB 2PXIA 4EX7A 3QU2A 3HW8A 5CB1A 1WWVA 4K4IA 3L28A 2W54A 1FO4A 2H3QA 4TQRA 2EZYA 1MA7A 4ELTA 1QLNA 1E6PA 1BPZA 5ALJA 2HI0A 2HVIA 5KFNA 1OW5A 2I5HA 1D9DA 3SAHA 5DB6A 4JMUA 4BX9C 1S10A 2P6UA 1S0VA 3AQEA 4MB3A 1L7PA 4KLGA 3C2LA 4IBDA 3TANA 4CCHA 4PZNA 1PK3A 2DL0A 5AM5A 4B6JA 3G6VA 1ZQXA 4TX8A 8ICMA 4EENA 4IQVA 8ICYA 1LV5A 1D8YA 2OH2A 3T79A 4QZ9A 1L7NA 4RNMA 2ZUDA 1JX4A 5KAIU 3ZDAA 3ZDBA 4PGXA 1L3UA 2XICA 3KHGA 1BPBA 3GIIA 8ICNA 4NZ3A 5KFJA 5AKKA 2ZTEA 3FDSA 3NGDA 1X9SA 3NRZA 5ALUA 4RQ8A 3RH4A 1K1SA 3M8RA 1TK0A 3HX0A 7ICMA 3GFKB 1A6SA 3PO5A 4FZLA 4C8LA 4NJ8A 3JPRA 3A0BU 4ED0A 4JWMA 4IBKA 1SWWA 3UPQA 3AQFA 4RUAA 4KTQA 1JN3A 3KZXA 3WK6A 2WF5A 4CF4A 3V6KA 2FN2A 5KG0A 5ALFA 2ZTCA 3M9OB 3F5AA 2IOHA 2EAOA 5KFYA 2XD5A 4O5EA 5ALXA 4F5QA 7ICJA 5AKEA 2NV3A 3H4BA 1RXVA 5JRTA 3L4PA 3WKDA 1L3VA 2B0CA 1TAUA 4O3MA 3LVVA 5KFDA 2XGQA 2JXJA 3C1ZA 4RQ7A 1TK5A 4I2EA 3Q8QB 3NVVA 4ACOA 2HHXA 3WK5A 5J2EA 1XO0A 2MRLA 3TARA 2W3RA 2KICA 2FMQA 2FMSA 1WCNA 3MGHA 1LB2B 2IOFA 4J9OA 2XC9A 2NRZA 1NKCA 2OCEA 3JPQA 4DL6A 1AROP 4FE3A 4FZNA 1COOA 4F50A 1D8BA 2YB1A 2ZIXB 1S0MA 4EYHB 2BCQA 1N60A 2K8CB 3CYMA 1S0OA 2HBLA 5AI4A 3SI8A 4F5RA 4HYKA 3PY8A 2B21A 5DB7A 4O5KA 7ICEA 3H0RB 2XI9A 5ALEA 4PH5A 3H8MA 3RJEA 7ICGA 4NXZA 2RRDA 4QNLA 2LYHA 2HVHA 1A76A 1UPHA 1SL0A 2IOUA 4YR2A 3RAQA 4HMEA 3SMVA 4QJFB 4ECVA 4GIBA 5KFBA 7ICFA 2M9NA 1SKSA 1ZQHA 9ICGA 3GIKA 5DLGA 8ICOA 2AQ0A 4DL4A 1CEZA 2EAMA 5BPVA 5HMLA 4DLGA 5JU5A 4XRHA 3IP4B 4Y2SA 3ETLA 1XSPA 3SV4A 4YVZA 5TISU 2IA6A 3DEEA 5J8YC 5GTIU 5AK3A 4OJ6A 1MQ2A 1Q3UA 2QARB 3T5KA 1N63A 4BDPA 3C21A 9ICXA 4ECXA 1B4FA 3WD0A 4M04A 9ICWA 3A0HU 2VJ4A 4O5CA 1ZQUA 4RPXA 3WK8A 1JXLA 8ICJA 5L1KA 1NK7A 3PW0A 1XU4A 2WAQC 4ED3A 2PFNA 3I1YA 4C7ZA 7ICRA 2IHMA 4AYBC 4I2JA 2XD1A 4TUPA 4RNNA 5CP2A 4RQ1A 4UBBA 9ICCA 3OGUA 2UVUA 4WJ3B 3QUTA 4ECSA 9ICJA 4OCZA 1XWLA 2FDRA 2E8OA 5CRXA 4QWEA 3GDXA 5DGAA 3TADC 4UAYA 1N61A 3PZPA 2G07A 1EAKA 2HBMA 3CRXA 2KFNA 2F44A 1UA0A 4KLUA 2HMXA 1ZQSA 1ZQIA 1Z19A 4Z6CA 1XNSA 2RQ5A 3K1RB 4UBCA 4F2SA 1N56A 4KLFA 7ICOA 2V9WA 2F76X 3H0MB 2M0NA 2FPKA 3WKBA 4Z2KA 1DOQA 2IMWP 5HHHA 2HHWA 2OHFA 1V38A 4NZ4A 2Y9TA 5ALVA 1PDCA 3ZI4A 4P0QA 5K4LA 1SV4A 1QO6A 5ALQA 2KJ8A 5BPCA 2YMMA 3BDPA 2BCVA 3MFIA 4QZIA 2JR5A 3RAXA 9ICMA 3QU9A 4U6PA 4YQWA 4M6WB 4I2FA 4M9GA 1S0NA 4Q8EA 5KFTA 4GXIA 5J8YA 3L5KA 3ZDEA 2DBYA 1DXSA 4LJXA 2Y2QA 3KHLA 4RQMA 4HMCA 3ISDA 3BS7A 5KFAA 3QNMA 1T7PA 2H3IA 2J6SA 9ICKA 3V7JA 3RBEA 4PHPA 2JEFA 1T4GA 5IIMA 1JRPA 5ALYA 8ICSA 1ZQPA 2EZXA 1KN5A 1ZQLA 4JK1A 3UQ0A 1TV9A 1O03A 2IOFK 5DGBA 4IBBA 5H2FU 2D49A 1X42A 4C4SA 3TI0A 3RJHA 2E8MA 4J9RA 5AKJA 1KLNA 4Q43A 1A77A 3L29A 4QZDA 2FPLA 4M47A 2JEIA 4OJLA 3JPNA 1WYGA 8ICTA 3DV9A 1KFDA 5HHIA 2AHOB 4DFMA 4EX6A 1K1QA 1JMSA 1Z4OA 3ZD8A 4F2RA 4PHEA 3M9MB 4YMNA 3QU4A 4AYBF 2KSOB 2FMPA 2P66A 4DL3A 3MR3A 4MEYA 3RF9A 2W43A 1X9MA 4I28A 5DB8A 4IL6U 2W03A 1SB3C 5KFEA 1V85A 5HR6A 3NVZA 2KIVA 1ZOLA 2EQYA 2FLLA 4YG2A 1DGJA 3KZIU 4KLEA 3ZD9A 5ALOA 1HUZA 2KSOA 1U49A 3MGIA 3AMZA 3H7IA 4YR0A 4TQSA 3BJYA 1E6RA 5KG4A 4PGQA 2HHTA 2W8LA 4E0DA 2HDOA 3SAGA 1NZPA 2BQ3A 4Q45A 2Q4TA 5D49A 5KFFA 1RYUA 1LKYB 1SV0C 5AM2A 5ALIA 3UMBA 3T5JA 3OJUA 3RJFA 4M9NA 1ZETA 5AKGA 2QKQA 1FFVA 1A0PA 4I2IA 4BGDA 5KFIA 5ALWA 3H8SA 5T14A 3PX6A 2PKEA 2LPEA 3KFUF 5L9XA 2BGWA 1SZHA 5ALDA 4NM1A 3ISBA 7ICLA 2LI6A 1Z00B 2QLTA 1OUQA 5DG9A 1ED7A 1KKXA 5TZVA 3H4DA 1PK1B 2E1EA 1PVPA 5AKLA 3HPOA 3BZKA 5EWGA 9ICTA 7ICKA 1B22A 3UMCA 4F72A 5AM4A 1X6JA 5KL8B 3V6HA 2DPIA 4DS4A 4O3OA 2JE5A 1ZQJA 3JPOA 5KFUA 5HMMA 4M9HA 5KFOA 1P7DA 8ICZA 5KFMA 5CHGA 5J0QA 1YZ6A 5DDMA 1T94A 3QYPA 3THVA 4Z2JA 3IRUA 1W1VA 1H0GA 3ZDCA 5J0YA 1L6NA 1LVHA 3TKAA 4I2BA 1SIJA 1RZTA 3PMNA 3QE9Y 4Z2IA 1O08A 3QU7A 4NLCA 3C2MA 4F4YA 2HHSA 2I1QA 1GOIA 1H38A 3QEAZ 1AIWA 3EPIA 1YU2A 1M6YA 3SD7A 4RQ4A 2F3NA 2OWOA 4QZFA 1KFSA 4NLZA 1E88A 1KRPA 2UVWA 3GILA 3C5GA 1NK9A 2XCAA 4EZ9A 4P0PB 5KAFU 2HHVA 2JV3A 1ZQCA 4IJFA 1L8OA 4EBCA 5KG5A 2WF7A 8ICGA 5JUMA 3SYZA 3RR8A 3OPXA 1KSPA 1E15A 3F53A 2HHUA 3KHRA 3I76A 1U47A 1QTMA 1QQ7A 1W1YA 2F1JA 7ICPA 1RG6A 3IG5A 4DL5A 5J0WA 4USAA 5HNKA 2JH7A 5IINA 4Y2PA 2KZMA 5AI0A 1ZYQA 2RDJA 1TK8A 5CA7A 1ZQOA 3M8SA 4CRXA 5KT4A 3ETRA 2W55A 1IM4A 3AN1A 2KJ9A 5EE9A 2KMDA 2ODGA 2ALZA 4Z6EA 4B9TA 1Z4NA 4JV1A 4F5PA 2MUTB 2JCHA 5D4BA 1DGSA 1RM6C 5KFWA 3JPTA 5EOZA 3BQTA 4PZOA 3EWAA 2KVSA 5IIKA 1ZQVA 2K60A 2LHTA 3PO4A 4RQNA 3D2SA 3PNCA 2ZUBA 4FBTA 4NY8A 1ZD2P 1KDHA 4P4PA 5J0RA 1AQ6A 5DBCA 1QQ5A 4RQ2A 2MUTA 4M2YA 1S8OA 2FFFB 4QZ8A 3RH6A 5ALMA 2YTUA 1SKRA 5J2DA 4BWJA 2A19A 4YXMA 4RQ5A 2W9AA 1SWVA 1JI7A 4G9BA 4I2AA 4Y2QA 1NKEA 4B9VA 2ZXHA 3F2DA 3GV5B 3WK7A 4IBGA 3IM1A 3N7SC 2XGPA 1KQQA 2E3TA 2RP5A 3B0YA 1U48A 2KV2A 3Q8SB 1ZD4A 1TAQA 1BNPA 4O3PA 3C1YA 4QZHA 1Z1BA 1KW4A 2JGAA 2AGPA 2WB1F 2JH1A 3UMGA 1RPLA 2QARA 2I6XA 5KT2A 4MFFA 2BHNA 2HOFA 3BS5A 4YD2A 4YCXA 4B9LA 3L27A 3O0FA 4RQ0A 3L25A 3MFHA 2ZUCA 3HONA 1QQ6A 9ICNA 5G5GA 4LZGA 2F1HA 1S5LU 2VA2A 4XQ8A 3OHBA 1ZQMA 1KL9A 1ZQNA 1NK0A 5DDYA 3RRGA 5KT5A 4DQQA 3AU2A 3WD1A 1QH9A 3PVXA 2K4EA 3C23A 4R64A 2JEJA 4I27A 4C8KA 1UT8A 2BG1A 4IBEA 5AK4A 2EAPA 3UXOA 5AM1A 4B9MA 4GHLA 4DOAA 9ICPA 5AM3A 2OEHA 3KS8A 1MC8A 4NV0A 5J0PA 4DQPA 1ZQKA 5C5JA 1YU4A 2KP7A 3AL0B 1W1PA 3QUQA 3CP8A 5BOMA 5EWEA 3WKEA 1LKYA 3AUOA 3FC4A 3RJGA 5E79U 4J9QA 1BNOA 1X9XA 1SGGA 4ED2A 5DQIA 4GH9A 4QZEA 4ED6A 3FM9A 3SR6A 2ZIWA 5KFGA 4LVSA 2KKVA 2DGZA 1Z1VA 3WKAA 5J0OA 4OUIA 4NLBA 9ICEA 1SZPA 2ASLA 2CPRA 2BPCA 1FFUA 4CF5A 1Z3EB 4IBIA 3NTUA 5EWFA 2XY6A 4F4KA 4F8RA 2ASDA 2YMQA 3PSIA 1ECWA 1XSNA 3NS1A 1HJPA 4DOCA 5KFHA 1MQ3A 1ZQWA 3D6JA 5J0TA 1MSWD 4DFPA 5CWRA 2DFLA 2F8LA 4M6WA 3N3FA 3RRHA 2QB0A 4RU9A 4NM2A 2W7PA 2WB1C 3LYSA 2LYBA 2EZZA 3WD2A 4KLJA 4NYUA 5KG1A 4KLTA 2QB1A 4QZGA 4PGYA 3TACB 1T8EA 2WF9A 2YMPA 1F0MA 2PFOA 4PHAA 2I9GA 3QZ7A 2Y2JA 1YU0A 4US9A 5KNIA 2KZ3A 4UAVA 2V4QA 4K4HA 4GHAA 4LZDA 3RBDA 1QSLA 2D8CA 5KTQA 5AK6A 1UT5A 2RDIA 3U26A 5DB9A 2PFQA 2PMZF 2VA3A 4GXJA 5DLFA 2XCPA 4DWIA 4DFKA 3QUCA 1YZ7A 4QIWF 2CN1A 2XVTA 4FS2A 2HOIA 4K4GA 3R9KA 3ED5A 3RH5A 5ALNA 5AI5A 1ZD5A 1QSYA 4PJ0U 4RZRA 4UB4A 3GV8B 4R8UA 1RXWA 3GU3A 2ISPA 3M9NB 5ALSA 3HKZC 4EELA 2O6KA 1O6IA 1F44A 3VCBA 4I2HA 3MGVA 2YN4A 4B9UA 4UB3A 9ICFA 4UASA 1V9PA 4IJEA 1WUDA 2F1IA 5L1LA 3ONNA 3K75D 1PZNA 2LYAA 4QZBA 4UAWA 8ICKA 4J9KA 4PL1A 3ZDDA 4KX5A 1T3NA 5J2AA 4IR9A 3PSPA 4QW9A 1HIWA 3MDCA 2KOBA 4F71A 7ICUA 3LDAA 1OGGA 3M6KA 1L3TA 4QWAA 4M9JA 2Y2LA 5B66U 4BWMA 2Y9UA 3F2CA 3RJIA 3N7RC 1ZJNA 4KMOB 4O9MA 4UATA 1T3QA 4MFAA 1NOMA 2V4RA 1X6IA 8ICUA 4DSLA 2D3DA 5J29A 4ZH4A 2EDUA 4FBUA 3QZ8A 3PV8A 4ICAA 3UXNA 1ZQDA 4P4OA 2WAQF 1N48A 5JTIA 5AI8A 5KFKA 5AK5A 4RPYA 4GFJA 1B43A 5KFXA 2BZFA 5KFRA 3AM9A 9ICIA 2DKZA 7ICQA 2ZIWB 5CJ7A 2IBKA 7ICSA 2YMLA 1S9FA 2HSZA 8ICCA 3QUBA 4DQSA 2R18A 2AXTU 4DSJA 1X2IA 4Y2UA 1CRXA 4KLHA 2PI5A 2BPFA 2H5XA 1PVQA 2P6RA 3PX0A 1KTQA 2E5SA 4QZCA 3GIMA 2BCSA 3T5HA 2K4HA 3LK9A 1U9LA 2Y0SC 2W7OA 4G3IA 4F5OA 2E8PA 4UW9A 3AEVA 1UR9A 4BXOA 1DK3A 3QXGA 2KE7A 1N62A 2MAXA 2W3SA 4Y2TA 4IQUA 1JUDA 1ZXIA 4KLOA 5KFCA 3QU5A 1ZQTA 2FLNA 1NJZA 3BS5B 2A1AA 3J81j 1ZQEA 4UARA 2BDUA 2ZG6A 4DSEA 1FEZA 5EE1A 1BPEA 2W9MA 5AM0A 4JWNA 3D2NA 1HEKA 2DUYA 2KG5A 4ECZA 8ICPA 4CE6A 2GLEA 4R65A 4ED7A 2YX8A 4F4XA 4YN4A 3CNHA 1GO3F 3TQ1A 2KEYA 4EYIB 4F4ZA 4F93B 2H3ZA 5J2JA 1J7MA 1L8LA 4GC7A 5AKHA 3TAPA 3HP6A 2BQUA 4J9MA 2ESEA 1UHUA 4B9SA 4AP9A 2Z7JA 4RQ6A 3H0LB 8ICLA 4DSIA 2ZJ8A 4HMDA 4DEZA 1DRGA 4KLLA 4Y2RA 4MB5A 4JB3A 3BZCA 3RB3A 4C4TA 3HWTA 1C20A 3RB0A 5C0YA 4I2CA 1KFTA 2IHNA 4FO6A 4ELVA 5CR0A 4RT2A 2K8BB 3Q8LA 4JV0A 4PHDA 5D46A 4KMUA 3FAHA 2YB4A 2YY6A 3BQ2A 4I2DA 5J2FA 1U4BA 1ZD3A 3HSHA 2Y2KA 4C0ZA 4YD1A 9ICQA 2NRVA 1RQNA 2CXYA 2V5OA 2R8GA 1L7OA 3KHHA 2WF6A 2R8JA 1CXWA 1ZQZA 2C2EA 4Y2JA 2JEGA 4QWCA 3HILA 3RTVA 5F9LA 7ICIA 2JMGA 2UWXA 4RQ3A 3H8JA 4MF2A 4IRCA 5AICA 2VANA 2W11A 4Z6DA 4KX3A 3ISCA 4OJOA 1J97A 3L26A 3NUQA 2C2DA 3KD3A 5AI6A 2PFPA 2OYYA 1BPYA 1ZRNA 4OJ5A 5KT7A 1NJYA 5DBBA 3N97B 1L5UA 2WF8A 2Y2IA 4NY2A 4O3RA 4ECYA 4DQRA 3MR5A 4R66A 3JPPA 4P2HA 4ECQA 2UVVA 1TFRA 2XIDA 1CUKA 4P0PA 1ZQAA 1UCVA 1H0IA 2VJ5A 1NI3A 1X9WA 2KNJA 2WTFA 5HP4A 2BKEA 3PX4A 4UAUA 1GXDA 3Q8MA 4KITB 3D2QA 3N4MB 4F92B 4GXKA 4ED1A 5IILA 5AKYA 8ICBA 3NASA 1Y88A 5B5EU 2NRTA 2AU0A 3E2EA 1ZJMA 3K4GA 3Q8PB 1S76D 9ICAA 8ICRA 4MB4A 3M7DA 4Z2HA 3DDHA 2W9CB 4KN7A 4EZ6A 4MEXA 2E1FA 1JROA 7ICNA 4C80A 5KFSA 3Q8KA 5AIAA 2A1JB 4FZMA 1PUZA 4YP3A 2ZIUA 1B0XA 5DKWA 2LM4A 5KG3A 5J2IA 4A8EA 3FKEA 1TVAA 1KEJA 4F4WA 3OSPA 3SQIA 4KLDA 3KKAC 5AKIA 1Q3VA 2WHEA 1Q8KA 1NK4A 1CK7A 2MU2A 2KHQA 3T5LA 1J2MA 4Y2YA 1N5XA 2WFAA 3EW9A 7ICVA 4YMOA 3F5EA 3M6ZA 4QZAA 3G6YA 2Y2HA 4MFCA 3WKCA 2ZIXA 3UM9A 4FFDA 2DPJA 2G08A 2LMRA 1SXDA 3NVYA 3EYZA 3BQ0A 2G06A 2ZJ5A 2HBKA 5J2KA 5ALTA 1BGXT 1EXNA 2W9BA 4IBCA 2J6TA 4NL9A 1NJXA 4IQTA 4F91B 3PR5B 3WK9A 9ICHA 4Y2VA 1WCLA 3V7LA 5KT3A 4ECTA 1ZRMA 4RT3A 3N28A 4DFDA 2K8AA 2K4IA 2QB0B 1NNLA 1COKA 2C22A 3PW2A 4IQWA 2CRXA 4J9LA 4UB6U 2Y2PA 1BPXA 2NO5A 4CGZA 2ISOA 2UVRA 4O3QA 5IIJA 1S77D 2HW3A 3MR6A 3MABA 2RLTA 4QIWC 5DG8A 5IIIA 2KVCA 2ZIVB 4YR3A 2ASJA 3PW5A 4ELUA 4TUSA 4NLKA 1J2NA 3C29A 2DF4B 1L6JA 1MN8A 2FE9A 9ICLA 5BOLA 2PI4A 3I28A 4R63A 4XUSA 1YU3A 4Q8FA 4KLIA 9ICVA 8ICHA 9ICBA 5ALGA 8ICVA 4NYYA 3SAFA 3S6JA 5IIOA 4ZOHC 1NK5A 1V97A 2MA1A 3M7PA 1ED1A 3NVWA 4XA5A 5J2HA 3RR7A 8ICXA 4RNOA 1YU1A 2KD1A 1TE2A 4ECUA 9ICRA 2GO7A 1XO1A 4Z6FA 5ALZA 2FPMA 2Y1JA 4GC6A 4C8OA 2HCFA 3MDAA 1CI4A 5J0UA 3C2KA 2NO4A 4M0AA 2EH9A 3RJJA 5ALHA 2HBJA 4NLNA 2Y2OA 3WK4A 2GH1A 2KN7A 4OO1J 5EE3A 3JPSA 2ATLA 3WU2U 4EEKA 1UA1A 3B0XA 4UB1A 1IV8A 4JV2A 3HT3A 2C28A 4YFKA 4P4MA 1ZQYA 2Y0SF 2LKYA 3GV7B 2KTQA 4US8A 4ECWA 5AI9A 1SXEA 3FYHA 2E8NA 4NWIA 2JZBB 3B9JA 3VC8A 5HR7A 4IRDA 2FLPA 2W04A 3M1YA 4IBJA 3L2AA 5KG6A 4DFJA 3MQLA 1QCKA 2KIWA 5ALPA 4Z2GA 4MHVA 3CW2C 3NRWA 4HAIA 3PSFA 3IG8A 5DG7A 4DO9A 5EE0A 2BQRA 3IN5A 3EZ5A 1L7MA 3UXPA 1SL2A 2LM1A 1ZQFA 2JZBA 5J2BA 2RHFA 1ZQGA 1UQVA 1XC9A 1NK6A 9ICOA 5A0LA 2N1RA 3GIJA 3Q8RB 1E6NA 1WG8A 4IS7A 4J9SA 2NYVA 5KG7A 1XS9D 1OXJA 2R8IA 3IHQB 1S97A 4C7YA 3TADA 4DSKA 1VDVA 5AKZA 2Q0ZX 5L1IA 4ED8A 1VJ5A 5DBAA 4BUGA 1DK2A 4NL9C 4DS5A 1X66A 4F3OA 2A3VA 3TAQA 5GTHU 2XO7A 4C8NA 4OJPA 5L1JA 3OHAA 1ZQRA 3PW4A 3OTQA 7ICTA 4EBDA 2AGQA 2KK0A 3RB4A 1D9FA 2F2AB 4IBFA 1OGBA 4YXJA 4EEYA 1ZQQA 2P35A 4UB2A 4PL2A 4Z2LA 2HHQA 3E58A 3LWLA 3WD3A 4YMMA 1IG6A 1TAMA 1GPFA 1RYSA 1BVSA 4RPZA 3ALRA 2VA8A 2Y2NA 2VIXA 2EANA 4NZ1A 2B6GA 3T3FA 2H3FA 2BDPA 4DL7A 1URJA 3N7PD 3OJSA 9ICUA 3C28A 4C8MA 2C2RA 1QSSA 2K4PA 4GLXA 1RQLA 2G5HB 1SV0A 4QWDA 1NJWA 1RDFA 2NRXA 3C5FA 3SZ2A 4CF3A 1NK8A 4U7CA 3H8WA 5J0XA 8ICAA 3V72A 2FI1A 5KT6A 8ICWA 8ICQA 4OD0A 3GQCA 4I29A 1C7YA 2KZZA 3MBYA 4DSFA 5F9NA 3EUB2 2PMZC
chains in the Genus database with same CATH topology
5A0LA 2N1RA 3SAHA 2ZIUA 1YU3A 4ACOA 2Y0SC 2Q4TA 3PSTA 2ZIWA 2MRLA 2ZXHA 4JMUA 1YT3A 4BX9C 3MGVA 1XO0A 2Y2QA 4IJEA 1WUDA 2KKVA 3F2DA 2DGZA 2KICA 3ONNA 4A8EA 3AQEA 4P0PB 3FKEA 4IBGA 2H3IA 2KJ5A 3N7SC 3SQIA 2WAQC 4IJFA 4NYYA 4IBDA 3SAFA 1Q3VA 4OUIA 2LYAA 2RP5A 2JMGA 4NLBA 2UWXA 2KHQA 1A0PA 2CPRA 2KV2A 4PL1A 4AYBC 2KHVA 2MA1A 3OPXA 4KX5A 4BUGA 1ED1A 4KX3A 4IBIA 2XD1A 3PSPA 1IIPA 1HIWA 4FE3A 5T14A 3F53A 4FZNA 4OJOA 3RFAA 1NZBA 1Z1BA 1YU1A 3L26A 2KD1A 3KFUF 2YB1A 2KOBA 1D8BA 2ZIXB 2JGAA 3F5EA 2BDUA 3NUQA 2ZG6A 1SZHA 3M6ZA 3F2BA 4GH9A 4IBBA 4NZ5A 2A3VA 1KBUA 4WJ3B 2WB1F 2OH2A 2K8CB 2JH1A 3IG5A 3PSIA 3T79A 1ECWA 2Y2HA 3CYMA 2VKQA 2OYYA 3D2NA 2HBLA 4OJPA 1HEKA 3M6KA 4OJ5A 1OUQA 3VCBA 2ZIXA 2JH7A 2HOFA 2XICA 2E1EA 1PVPA 3L29A 2Y2LA 2F8LA 2F2AB 2JHDA 2YX8A 3N3FA 4NZ3A 2G08A 2W7PA 4OJLA 2H3VA 4IBFA 1GO3F 2XI9A 3H0RB 2WB1C 5CRXA 4NY2A 2Y2IA 3LYSA 4CRXA 2HBJA 2Y2OA 2KEYA 2LYBA 2G5IB 3LVWA 2ZIUB 3E0FA 3O0FA 3F2CA 1PVRA 3L27A 2G06A 2H3ZA 3N7RC 5KL8B 2HBKA 2Y2MA 2W7OA 4PL2A 4NYUA 2GH1A 2KJ9A 2RRDA 4QNLA 4OO1J 3HONA 3PZPA 2G07A 1A6SA 2HBMA 4KMOB 2D6FC 4FZLA 4IBCA 1UPHA 3CRXA 1TAMA 2JE5A 2LBOA 2IOUA 2JCHA 2HOQA 2G09A 3ALRA 4P0QB 2Y2NA 3SMVA 2Y2JA 2XIDA 4P0PA 2VIXA 2GOLA 4IBKA 1YU0A 4NZ1A 1P7DA 3L3FX 4CDGA 4AYBF 2DQNB 3AQFA 2Z7JA 3H0LB 4LG2A 3ICXA 4GHAA 2H3FA 2LHTA 2VJ5A 2Y0SF 4ICAA 4QJFB 2HMXA 1ZQ1C 1T94A 2LKYA 1Z19A 2Y2GA 1XNSA 2KNJA 2WAQF 3KZXA 2K4EA 2K89A 1URJA 3N7PD 1DRGA 3D2SA 1YUEA 3K1ZA 3SAGA 4NWIA 3C28A 2G0AA 1L6NA 2BG1A 4IBEA 2F77X 2K4IA 2K8AA 3D2QA 3VC8A 5BPVA 3WX7A 3RF9A 5HR7A 2F76X 2ZIVA 4GFJA 2CRXA 3IP4B 2PMZF 3F5AA 5C0YA 2W04A 2XD5A 2W03A 2M0NA 3H0MB 2OM6A 4IC9A 4IBJA 2G5HB 4NLCA 3HKZF 3L2AA 4GHLA 2Y2PA 5KL1B 5HR6A 2NV3A 4NV0A 4QIWF 3KS8A 2FFFB 2KKPA 2KIWA 2ZIWB 4CGZA 2CN1A 3DEEA 3NRWA 4U7CA 2K8BB 1YU4A 4NZ4A 2XVTA 3GZFA 3AL0B 4BJQA 3CP8A 4QIWC 4OJ6A 2HOIA 3L28A 4P0QA 2R18A 3PSFA 3KS4A 1Q3UA 2H3QA 2YB4A 3IG8A 2KJ8A 2KVCA 2ZIVB 3M7DA 1MA7A 1YU2A 1CRXA 4O3MA 3IN5A 3L25A 3C29A 2E1FA 3HSHA 2DF4B 4U6PA 3LVVA 1PVQA 3GU3A 2E5SA 3HKZC 2Y2KA 2OXOA 2RHFA 2ZXIA 4C0ZA 2K4HA 1F44A 4FZMA 2PMZC 2VJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OJO A;  4QNL A;  4OJP A;  4OJ6 A;  4OJ5 A;  4OJL A; 
#chains in the Genus database with same CATH topology
 3HJE A;  4Y2X A;  3QX7 A;  1ZQB A;  2RTS A;  3RJK A;  5KFQ A;  3UQ2 A;  5KFV A;  3V7K A;  1N2X A;  5G5H A;  2KJ5 A;  4RUC A;  4QWB A;  4TUR A;  4DOB A;  2JRZ A;  5F3X B;  5ALK A;  1WWU A;  8ICF A;  3IV6 A;  4TUQ A;  1JIH A;  3RFA A;  2XY5 A;  5DQH A;  3F2B A;  4X5V A;  4NZ5 A;  1KBU A;  5AKX A;  2R8K A;  2VKQ A;  2FJ6 A;  3IDW A;  5L1M A;  2NRW A;  3PML A;  2G5I B;  4I2G A;  1PK1 A;  1K5O A;  3E0F A;  4O0I A;  2Y2M A;  2BCU A;  3G6X A;  1D8L A;  2MSN A;  4UQG A;  1W1T A;  5J2G A;  2HOQ A;  2G09 A;  4P0Q B;  1KS0 A;  9ICS A;  2GOL A;  4J03 A;  5ALR A;  4NLG A;  4F5N A;  4DCC A;  4LG2 A;  2AH5 A;  4UB5 A;  3BQ1 A;  1ZQ1 C;  2AJQ A;  2Y2G A;  5J0S A;  3SEI A;  2K89 A;  4UB8 U;  3HRD D;  2AGO A;  3K1Z A;  3OSN A;  1H8P A;  2G0A A;  2F77 X;  1IXR A;  2ZJA A;  3KKA A;  1TKD A;  2ZIV A;  4KLS A;  3TFR A;  5AHX A;  4EBE A;  2J6U A;  2OM6 A;  4IC9 A;  4Q44 A;  3HKZ F;  5KL1 B;  1SL1 A;  1E6Z A;  1Z00 A;  2ES6 A;  8ICE A;  4KN4 A;  4PPX A;  3GZF A;  1E8B A;  4BJQ A;  5ALL A;  3RB6 A;  3KS4 A;  2R8H A;  1RYR A;  3PR4 A;  2YQE A;  1JAL A;  2GWS A;  4R8U B;  5FP0 A;  5CEH A;  3QEB Z;  5KFZ A;  3TFS A;  2OXO A;  4JUZ A;  2ZXI A;  4BXO B;  1BPD A;  3ORY A;  4J9P A;  3PW7 A;  1SKW A;  3PST A;  4KLQ A;  1YT3 A;  2F8K A;  8ICI A;  2DWQ A;  4O3S A;  2BPG A;  4J9N A;  3SEN A;  4IRK A;  2KHV A;  1U45 A;  1IIP A;  4QW8 A;  1NZB A;  4FS1 A;  5AIB A;  1FIQ A;  4KLM A;  1X40 A;  1VLB A;  4C4R A;  2W9C A;  2BCR A;  5J2C A;  4DL2 A;  3WD4 A;  1N5W A;  3EPG A;  1F5S A;  5DQG A;  2A1J A;  4IR1 A;  2JHD A;  2H3V A;  2KFZ A;  2AQ4 A;  2DKX A;  3LVW A;  1JXE A;  2ZIU B;  1PVR A;  1NKB A;  2BR0 A;  5KFP A;  3SV3 A;  3KOO A;  3MR2 A;  2D6F C;  3LWM A;  5KFL A;  4CNQ A;  2LBO A;  2W8K A;  4MF8 A;  4B9N A;  3L3F X;  1HUO A;  4CDG A;  1XSL A;  4DF4 A;  2DQN B;  4O3N A;  4ECR A;  1Q46 A;  3ICX A;  2L5Y A;  4DLE A;  3AU6 A;  3H40 A;  1YUE A;  4M9L A;  4UAZ A;  3KTQ A;  3KBB A;  3MC1 A;  3WX7 A;  3BQ7 A;  1L3S A;  5KG2 A;  7ICH A;  2XY7 A;  2Y1I A;  4DQI A;  3V6J A;  4DF8 A;  2ZTD A;  1UR8 A;  2KKP A;  2W9B B;  2PXI A;  4EX7 A;  3QU2 A;  3HW8 A;  5CB1 A;  1WWV A;  4K4I A;  3L28 A;  2W54 A;  1FO4 A;  2H3Q A;  4TQR A;  2EZY A;  1MA7 A;  4ELT A;  1QLN A;  1E6P A;  1BPZ A;  5ALJ A;  2HI0 A;  2HVI A;  5KFN A;  1OW5 A;  2I5H A;  1D9D A;  3SAH A;  5DB6 A;  4JMU A;  4BX9 C;  1S10 A;  2P6U A;  1S0V A;  3AQE A;  4MB3 A;  1L7P A;  4KLG A;  3C2L A;  4IBD A;  3TAN A;  4CCH A;  4PZN A;  1PK3 A;  2DL0 A;  5AM5 A;  4B6J A;  3G6V A;  1ZQX A;  4TX8 A;  8ICM A;  4EEN A;  4IQV A;  8ICY A;  1LV5 A;  1D8Y A;  2OH2 A;  3T79 A;  4QZ9 A;  1L7N A;  4RNM A;  2ZUD A;  1JX4 A;  5KAI U;  3ZDA A;  3ZDB A;  4PGX A;  1L3U A;  2XIC A;  3KHG A;  1BPB A;  3GII A;  8ICN A;  4NZ3 A;  5KFJ A;  5AKK A;  2ZTE A;  3FDS A;  3NGD A;  1X9S A;  3NRZ A;  5ALU A;  4RQ8 A;  3RH4 A;  1K1S A;  3M8R A;  1TK0 A;  3HX0 A;  7ICM A;  3GFK B;  1A6S A;  3PO5 A;  4FZL A;  4C8L A;  4NJ8 A;  3JPR A;  3A0B U;  4ED0 A;  4JWM A;  4IBK A;  1SWW A;  3UPQ A;  3AQF A;  4RUA A;  4KTQ A;  1JN3 A;  3KZX A;  3WK6 A;  2WF5 A;  4CF4 A;  3V6K A;  2FN2 A;  5KG0 A;  5ALF A;  2ZTC A;  3M9O B;  3F5A A;  2IOH A;  2EAO A;  5KFY A;  2XD5 A;  4O5E A;  5ALX A;  4F5Q A;  7ICJ A;  5AKE A;  2NV3 A;  3H4B A;  1RXV A;  5JRT A;  3L4P A;  3WKD A;  1L3V A;  2B0C A;  1TAU A;  4O3M A;  3LVV A;  5KFD A;  2XGQ A;  2JXJ A;  3C1Z A;  4RQ7 A;  1TK5 A;  4I2E A;  3Q8Q B;  3NVV A;  4ACO A;  2HHX A;  3WK5 A;  5J2E A;  1XO0 A;  2MRL A;  3TAR A;  2W3R A;  2KIC A;  2FMQ A;  2FMS A;  1WCN A;  3MGH A;  1LB2 B;  2IOF A;  4J9O A;  2XC9 A;  2NRZ A;  1NKC A;  2OCE A;  3JPQ A;  4DL6 A;  1ARO P;  4FE3 A;  4FZN A;  1COO A;  4F50 A;  1D8B A;  2YB1 A;  2ZIX B;  1S0M A;  4EYH B;  2BCQ A;  1N60 A;  2K8C B;  3CYM A;  1S0O A;  2HBL A;  5AI4 A;  3SI8 A;  4F5R A;  4HYK A;  3PY8 A;  2B21 A;  5DB7 A;  4O5K A;  7ICE A;  3H0R B;  2XI9 A;  5ALE A;  4PH5 A;  3H8M A;  3RJE A;  7ICG A;  4NXZ A;  2RRD A;  4QNL A;  2LYH A;  2HVH A;  1A76 A;  1UPH A;  1SL0 A;  2IOU A;  4YR2 A;  3RAQ A;  4HME A;  3SMV A;  4QJF B;  4ECV A;  4GIB A;  5KFB A;  7ICF A;  2M9N A;  1SKS A;  1ZQH A;  9ICG A;  3GIK A;  5DLG A;  8ICO A;  2AQ0 A;  4DL4 A;  1CEZ A;  2EAM A;  5BPV A;  5HML A;  4DLG A;  5JU5 A;  4XRH A;  3IP4 B;  4Y2S A;  3ETL A;  1XSP A;  3SV4 A;  4YVZ A;  5TIS U;  2IA6 A;  3DEE A;  5J8Y C;  5GTI U;  5AK3 A;  4OJ6 A;  1MQ2 A;  1Q3U A;  2QAR B;  3T5K A;  1N63 A;  4BDP A;  3C21 A;  9ICX A;  4ECX A;  1B4F A;  3WD0 A;  4M04 A;  9ICW A;  3A0H U;  2VJ4 A;  4O5C A;  1ZQU A;  4RPX A;  3WK8 A;  1JXL A;  8ICJ A;  5L1K A;  1NK7 A;  3PW0 A;  1XU4 A;  2WAQ C;  4ED3 A;  2PFN A;  3I1Y A;  4C7Z A;  7ICR A;  2IHM A;  4AYB C;  4I2J A;  2XD1 A;  4TUP A;  4RNN A;  5CP2 A;  4RQ1 A;  4UBB A;  9ICC A;  3OGU A;  2UVU A;  4WJ3 B;  3QUT A;  4ECS A;  9ICJ A;  4OCZ A;  1XWL A;  2FDR A;  2E8O A;  5CRX A;  4QWE A;  3GDX A;  5DGA A;  3TAD C;  4UAY A;  1N61 A;  3PZP A;  2G07 A;  1EAK A;  2HBM A;  3CRX A;  2KFN A;  2F44 A;  1UA0 A;  4KLU A;  2HMX A;  1ZQS A;  1ZQI A;  1Z19 A;  4Z6C A;  1XNS A;  2RQ5 A;  3K1R B;  4UBC A;  4F2S A;  1N56 A;  4KLF A;  7ICO A;  2V9W A;  2F76 X;  3H0M B;  2M0N A;  2FPK A;  3WKB A;  4Z2K A;  1DOQ A;  2IMW P;  5HHH A;  2HHW A;  2OHF A;  1V38 A;  4NZ4 A;  2Y9T A;  5ALV A;  1PDC A;  3ZI4 A;  4P0Q A;  5K4L A;  1SV4 A;  1QO6 A;  5ALQ A;  2KJ8 A;  5BPC A;  2YMM A;  3BDP A;  2BCV A;  3MFI A;  4QZI A;  2JR5 A;  3RAX A;  9ICM A;  3QU9 A;  4U6P A;  4YQW A;  4M6W B;  4I2F A;  4M9G A;  1S0N A;  4Q8E A;  5KFT A;  4GXI A;  5J8Y A;  3L5K A;  3ZDE A;  2DBY A;  1DXS A;  4LJX A;  2Y2Q A;  3KHL A;  4RQM A;  4HMC A;  3ISD A;  3BS7 A;  5KFA A;  3QNM A;  1T7P A;  2H3I A;  2J6S A;  9ICK A;  3V7J A;  3RBE A;  4PHP A;  2JEF A;  1T4G A;  5IIM A;  1JRP A;  5ALY A;  8ICS A;  1ZQP A;  2EZX A;  1KN5 A;  1ZQL A;  4JK1 A;  3UQ0 A;  1TV9 A;  1O03 A;  2IOF K;  5DGB A;  4IBB A;  5H2F U;  2D49 A;  1X42 A;  4C4S A;  3TI0 A;  3RJH A;  2E8M A;  4J9R A;  5AKJ A;  1KLN A;  4Q43 A;  1A77 A;  3L29 A;  4QZD A;  2FPL A;  4M47 A;  2JEI A;  4OJL A;  3JPN A;  1WYG A;  8ICT A;  3DV9 A;  1KFD A;  5HHI A;  2AHO B;  4DFM A;  4EX6 A;  1K1Q A;  1JMS A;  1Z4O A;  3ZD8 A;  4F2R A;  4PHE A;  3M9M B;  4YMN A;  3QU4 A;  4AYB F;  2KSO B;  2FMP A;  2P66 A;  4DL3 A;  3MR3 A;  4MEY A;  3RF9 A;  2W43 A;  1X9M A;  4I28 A;  5DB8 A;  4IL6 U;  2W03 A;  1SB3 C;  5KFE A;  1V85 A;  5HR6 A;  3NVZ A;  2KIV A;  1ZOL A;  2EQY A;  2FLL A;  4YG2 A;  1DGJ A;  3KZI U;  4KLE A;  3ZD9 A;  5ALO A;  1HUZ A;  2KSO A;  1U49 A;  3MGI A;  3AMZ A;  3H7I A;  4YR0 A;  4TQS A;  3BJY A;  1E6R A;  5KG4 A;  4PGQ A;  2HHT A;  2W8L A;  4E0D A;  2HDO A;  3SAG A;  1NZP A;  2BQ3 A;  4Q45 A;  2Q4T A;  5D49 A;  5KFF A;  1RYU A;  1LKY B;  1SV0 C;  5AM2 A;  5ALI A;  3UMB A;  3T5J A;  3OJU A;  3RJF A;  4M9N A;  1ZET A;  5AKG A;  2QKQ A;  1FFV A;  1A0P A;  4I2I A;  4BGD A;  5KFI A;  5ALW A;  3H8S A;  5T14 A;  3PX6 A;  2PKE A;  2LPE A;  3KFU F;  5L9X A;  2BGW A;  1SZH A;  5ALD A;  4NM1 A;  3ISB A;  7ICL A;  2LI6 A;  1Z00 B;  2QLT A;  1OUQ A;  5DG9 A;  1ED7 A;  1KKX A;  5TZV A;  3H4D A;  1PK1 B;  2E1E A;  1PVP A;  5AKL A;  3HPO A;  3BZK A;  5EWG A;  9ICT A;  7ICK A;  1B22 A;  3UMC A;  4F72 A;  5AM4 A;  1X6J A;  5KL8 B;  3V6H A;  2DPI A;  4DS4 A;  4O3O A;  2JE5 A;  1ZQJ A;  3JPO A;  5KFU A;  5HMM A;  4M9H A;  5KFO A;  1P7D A;  8ICZ A;  5KFM A;  5CHG A;  5J0Q A;  1YZ6 A;  5DDM A;  1T94 A;  3QYP A;  3THV A;  4Z2J A;  3IRU A;  1W1V A;  1H0G A;  3ZDC A;  5J0Y A;  1L6N A;  1LVH A;  3TKA A;  4I2B A;  1SIJ A;  1RZT A;  3PMN A;  3QE9 Y;  4Z2I A;  1O08 A;  3QU7 A;  4NLC A;  3C2M A;  4F4Y A;  2HHS A;  2I1Q A;  1GOI A;  1H38 A;  3QEA Z;  1AIW A;  3EPI A;  1YU2 A;  1M6Y A;  3SD7 A;  4RQ4 A;  2F3N A;  2OWO A;  4QZF A;  1KFS A;  4NLZ A;  1E88 A;  1KRP A;  2UVW A;  3GIL A;  3C5G A;  1NK9 A;  2XCA A;  4EZ9 A;  4P0P B;  5KAF U;  2HHV A;  2JV3 A;  1ZQC A;  4IJF A;  1L8O A;  4EBC A;  5KG5 A;  2WF7 A;  8ICG A;  5JUM A;  3SYZ A;  3RR8 A;  3OPX A;  1KSP A;  1E15 A;  3F53 A;  2HHU A;  3KHR A;  3I76 A;  1U47 A;  1QTM A;  1QQ7 A;  1W1Y A;  2F1J A;  7ICP A;  1RG6 A;  3IG5 A;  4DL5 A;  5J0W A;  4USA A;  5HNK A;  2JH7 A;  5IIN A;  4Y2P A;  2KZM A;  5AI0 A;  1ZYQ A;  2RDJ A;  1TK8 A;  5CA7 A;  1ZQO A;  3M8S A;  4CRX A;  5KT4 A;  3ETR A;  2W55 A;  1IM4 A;  3AN1 A;  2KJ9 A;  5EE9 A;  2KMD A;  2ODG A;  2ALZ A;  4Z6E A;  4B9T A;  1Z4N A;  4JV1 A;  4F5P A;  2MUT B;  2JCH A;  5D4B A;  1DGS A;  1RM6 C;  5KFW A;  3JPT A;  5EOZ A;  3BQT A;  4PZO A;  3EWA A;  2KVS A;  5IIK A;  1ZQV A;  2K60 A;  2LHT A;  3PO4 A;  4RQN A;  3D2S A;  3PNC A;  2ZUB A;  4FBT A;  4NY8 A;  1ZD2 P;  1KDH A;  4P4P A;  5J0R A;  1AQ6 A;  5DBC A;  1QQ5 A;  4RQ2 A;  2MUT A;  4M2Y A;  1S8O A;  2FFF B;  4QZ8 A;  3RH6 A;  5ALM A;  2YTU A;  1SKR A;  5J2D A;  4BWJ A;  2A19 A;  4YXM A;  4RQ5 A;  2W9A A;  1SWV A;  1JI7 A;  4G9B A;  4I2A A;  4Y2Q A;  1NKE A;  4B9V A;  2ZXH A;  3F2D A;  3GV5 B;  3WK7 A;  4IBG A;  3IM1 A;  3N7S C;  2XGP A;  1KQQ A;  2E3T A;  2RP5 A;  3B0Y A;  1U48 A;  2KV2 A;  3Q8S B;  1ZD4 A;  1TAQ A;  1BNP A;  4O3P A;  3C1Y A;  4QZH A;  1Z1B A;  1KW4 A;  2JGA A;  2AGP A;  2WB1 F;  2JH1 A;  3UMG A;  1RPL A;  2QAR A;  2I6X A;  5KT2 A;  4MFF A;  2BHN A;  2HOF A;  3BS5 A;  4YD2 A;  4YCX A;  4B9L A;  3L27 A;  3O0F A;  4RQ0 A;  3L25 A;  3MFH A;  2ZUC A;  3HON A;  1QQ6 A;  9ICN A;  5G5G A;  4LZG A;  2F1H A;  1S5L U;  2VA2 A;  4XQ8 A;  3OHB A;  1ZQM A;  1KL9 A;  1ZQN A;  1NK0 A;  5DDY A;  3RRG A;  5KT5 A;  4DQQ A;  3AU2 A;  3WD1 A;  1QH9 A;  3PVX A;  2K4E A;  3C23 A;  4R64 A;  2JEJ A;  4I27 A;  4C8K A;  1UT8 A;  2BG1 A;  4IBE A;  5AK4 A;  2EAP A;  3UXO A;  5AM1 A;  4B9M A;  4GHL A;  4DOA A;  9ICP A;  5AM3 A;  2OEH A;  3KS8 A;  1MC8 A;  4NV0 A;  5J0P A;  4DQP A;  1ZQK A;  5C5J A;  1YU4 A;  2KP7 A;  3AL0 B;  1W1P A;  3QUQ A;  3CP8 A;  5BOM A;  5EWE A;  3WKE A;  1LKY A;  3AUO A;  3FC4 A;  3RJG A;  5E79 U;  4J9Q A;  1BNO A;  1X9X A;  1SGG A;  4ED2 A;  5DQI A;  4GH9 A;  4QZE A;  4ED6 A;  3FM9 A;  3SR6 A;  2ZIW A;  5KFG A;  4LVS A;  2KKV A;  2DGZ A;  1Z1V A;  3WKA A;  5J0O A;  4OUI A;  4NLB A;  9ICE A;  1SZP A;  2ASL A;  2CPR A;  2BPC A;  1FFU A;  4CF5 A;  1Z3E B;  4IBI A;  3NTU A;  5EWF A;  2XY6 A;  4F4K A;  4F8R A;  2ASD A;  2YMQ A;  3PSI A;  1ECW A;  1XSN A;  3NS1 A;  1HJP A;  4DOC A;  5KFH A;  1MQ3 A;  1ZQW A;  3D6J A;  5J0T A;  1MSW D;  4DFP A;  5CWR A;  2DFL A;  2F8L A;  4M6W A;  3N3F A;  3RRH A;  2QB0 A;  4RU9 A;  4NM2 A;  2W7P A;  2WB1 C;  3LYS A;  2LYB A;  2EZZ A;  3WD2 A;  4KLJ A;  4NYU A;  5KG1 A;  4KLT A;  2QB1 A;  4QZG A;  4PGY A;  3TAC B;  1T8E A;  2WF9 A;  2YMP A;  1F0M A;  2PFO A;  4PHA A;  2I9G A;  3QZ7 A;  2Y2J A;  1YU0 A;  4US9 A;  5KNI A;  2KZ3 A;  4UAV A;  2V4Q A;  4K4H A;  4GHA A;  4LZD A;  3RBD A;  1QSL A;  2D8C A;  5KTQ A;  5AK6 A;  1UT5 A;  2RDI A;  3U26 A;  5DB9 A;  2PFQ A;  2PMZ F;  2VA3 A;  4GXJ A;  5DLF A;  2XCP A;  4DWI A;  4DFK A;  3QUC A;  1YZ7 A;  4QIW F;  2CN1 A;  2XVT A;  4FS2 A;  2HOI A;  4K4G A;  3R9K A;  3ED5 A;  3RH5 A;  5ALN A;  5AI5 A;  1ZD5 A;  1QSY A;  4PJ0 U;  4RZR A;  4UB4 A;  3GV8 B;  4R8U A;  1RXW A;  3GU3 A;  2ISP A;  3M9N B;  5ALS A;  3HKZ C;  4EEL A;  2O6K A;  1O6I A;  1F44 A;  3VCB A;  4I2H A;  3MGV A;  2YN4 A;  4B9U A;  4UB3 A;  9ICF A;  4UAS A;  1V9P A;  4IJE A;  1WUD A;  2F1I A;  5L1L A;  3ONN A;  3K75 D;  1PZN A;  2LYA A;  4QZB A;  4UAW A;  8ICK A;  4J9K A;  4PL1 A;  3ZDD A;  4KX5 A;  1T3N A;  5J2A A;  4IR9 A;  3PSP A;  4QW9 A;  1HIW A;  3MDC A;  2KOB A;  4F71 A;  7ICU A;  3LDA A;  1OGG A;  3M6K A;  1L3T A;  4QWA A;  4M9J A;  2Y2L A;  5B66 U;  4BWM A;  2Y9U A;  3F2C A;  3RJI A;  3N7R C;  1ZJN A;  4KMO B;  4O9M A;  4UAT A;  1T3Q A;  4MFA A;  1NOM A;  2V4R A;  1X6I A;  8ICU A;  4DSL A;  2D3D A;  5J29 A;  4ZH4 A;  2EDU A;  4FBU A;  3QZ8 A;  3PV8 A;  4ICA A;  3UXN A;  1ZQD A;  4P4O A;  2WAQ F;  1N48 A;  5JTI A;  5AI8 A;  5KFK A;  5AK5 A;  4RPY A;  4GFJ A;  1B43 A;  5KFX A;  2BZF A;  5KFR A;  3AM9 A;  9ICI A;  2DKZ A;  7ICQ A;  2ZIW B;  5CJ7 A;  2IBK A;  7ICS A;  2YML A;  1S9F A;  2HSZ A;  8ICC A;  3QUB A;  4DQS A;  2R18 A;  2AXT U;  4DSJ A;  1X2I A;  4Y2U A;  1CRX A;  4KLH A;  2PI5 A;  2BPF A;  2H5X A;  1PVQ A;  2P6R A;  3PX0 A;  1KTQ A;  2E5S A;  4QZC A;  3GIM A;  2BCS A;  3T5H A;  2K4H A;  3LK9 A;  1U9L A;  2Y0S C;  2W7O A;  4G3I A;  4F5O A;  2E8P A;  4UW9 A;  3AEV A;  1UR9 A;  4BXO A;  1DK3 A;  3QXG A;  2KE7 A;  1N62 A;  2MAX A;  2W3S A;  4Y2T A;  4IQU A;  1JUD A;  1ZXI A;  4KLO A;  5KFC A;  3QU5 A;  1ZQT A;  2FLN A;  1NJZ A;  3BS5 B;  2A1A A;  3J81 j;  1ZQE A;  4UAR A;  2BDU A;  2ZG6 A;  4DSE A;  1FEZ A;  5EE1 A;  1BPE A;  2W9M A;  5AM0 A;  4JWN A;  3D2N A;  1HEK A;  2DUY A;  2KG5 A;  4ECZ A;  8ICP A;  4CE6 A;  2GLE A;  4R65 A;  4ED7 A;  2YX8 A;  4F4X A;  4YN4 A;  3CNH A;  1GO3 F;  3TQ1 A;  2KEY A;  4EYI B;  4F4Z A;  4F93 B;  2H3Z A;  5J2J A;  1J7M A;  1L8L A;  4GC7 A;  5AKH A;  3TAP A;  3HP6 A;  2BQU A;  4J9M A;  2ESE A;  1UHU A;  4B9S A;  4AP9 A;  2Z7J A;  4RQ6 A;  3H0L B;  8ICL A;  4DSI A;  2ZJ8 A;  4HMD A;  4DEZ A;  1DRG A;  4KLL A;  4Y2R A;  4MB5 A;  4JB3 A;  3BZC A;  3RB3 A;  4C4T A;  3HWT A;  1C20 A;  3RB0 A;  5C0Y A;  4I2C A;  1KFT A;  2IHN A;  4FO6 A;  4ELV A;  5CR0 A;  4RT2 A;  2K8B B;  3Q8L A;  4JV0 A;  4PHD A;  5D46 A;  4KMU A;  3FAH A;  2YB4 A;  2YY6 A;  3BQ2 A;  4I2D A;  5J2F A;  1U4B A;  1ZD3 A;  3HSH A;  2Y2K A;  4C0Z A;  4YD1 A;  9ICQ A;  2NRV A;  1RQN A;  2CXY A;  2V5O A;  2R8G A;  1L7O A;  3KHH A;  2WF6 A;  2R8J A;  1CXW A;  1ZQZ A;  2C2E A;  4Y2J A;  2JEG A;  4QWC A;  3HIL A;  3RTV A;  5F9L A;  7ICI A;  2JMG A;  2UWX A;  4RQ3 A;  3H8J A;  4MF2 A;  4IRC A;  5AIC A;  2VAN A;  2W11 A;  4Z6D A;  4KX3 A;  3ISC A;  4OJO A;  1J97 A;  3L26 A;  3NUQ A;  2C2D A;  3KD3 A;  5AI6 A;  2PFP A;  2OYY A;  1BPY A;  1ZRN A;  4OJ5 A;  5KT7 A;  1NJY A;  5DBB A;  3N97 B;  1L5U A;  2WF8 A;  2Y2I A;  4NY2 A;  4O3R A;  4ECY A;  4DQR A;  3MR5 A;  4R66 A;  3JPP A;  4P2H A;  4ECQ A;  2UVV A;  1TFR A;  2XID A;  1CUK A;  4P0P A;  1ZQA A;  1UCV A;  1H0I A;  2VJ5 A;  1NI3 A;  1X9W A;  2KNJ A;  2WTF A;  5HP4 A;  2BKE A;  3PX4 A;  4UAU A;  1GXD A;  3Q8M A;  4KIT B;  3D2Q A;  3N4M B;  4F92 B;  4GXK A;  4ED1 A;  5IIL A;  5AKY A;  8ICB A;  3NAS A;  1Y88 A;  5B5E U;  2NRT A;  2AU0 A;  3E2E A;  1ZJM A;  3K4G A;  3Q8P B;  1S76 D;  9ICA A;  8ICR A;  4MB4 A;  3M7D A;  4Z2H A;  3DDH A;  2W9C B;  4KN7 A;  4EZ6 A;  4MEX A;  2E1F A;  1JRO A;  7ICN A;  4C80 A;  5KFS A;  3Q8K A;  5AIA A;  2A1J B;  4FZM A;  1PUZ A;  4YP3 A;  2ZIU A;  1B0X A;  5DKW A;  2LM4 A;  5KG3 A;  5J2I A;  4A8E A;  3FKE A;  1TVA A;  1KEJ A;  4F4W A;  3OSP A;  3SQI A;  4KLD A;  3KKA C;  5AKI A;  1Q3V A;  2WHE A;  1Q8K A;  1NK4 A;  1CK7 A;  2MU2 A;  2KHQ A;  3T5L A;  1J2M A;  4Y2Y A;  1N5X A;  2WFA A;  3EW9 A;  7ICV A;  4YMO A;  3F5E A;  3M6Z A;  4QZA A;  3G6Y A;  2Y2H A;  4MFC A;  3WKC A;  2ZIX A;  3UM9 A;  4FFD A;  2DPJ A;  2G08 A;  2LMR A;  1SXD A;  3NVY A;  3EYZ A;  3BQ0 A;  2G06 A;  2ZJ5 A;  2HBK A;  5J2K A;  5ALT A;  1BGX T;  1EXN A;  2W9B A;  4IBC A;  2J6T A;  4NL9 A;  1NJX A;  4IQT A;  4F91 B;  3PR5 B;  3WK9 A;  9ICH A;  4Y2V A;  1WCL A;  3V7L A;  5KT3 A;  4ECT A;  1ZRM A;  4RT3 A;  3N28 A;  4DFD A;  2K8A A;  2K4I A;  2QB0 B;  1NNL A;  1COK A;  2C22 A;  3PW2 A;  4IQW A;  2CRX A;  4J9L A;  4UB6 U;  2Y2P A;  1BPX A;  2NO5 A;  4CGZ A;  2ISO A;  2UVR A;  4O3Q A;  5IIJ A;  1S77 D;  2HW3 A;  3MR6 A;  3MAB A;  2RLT A;  4QIW C;  5DG8 A;  5III A;  2KVC A;  2ZIV B;  4YR3 A;  2ASJ A;  3PW5 A;  4ELU A;  4TUS A;  4NLK A;  1J2N A;  3C29 A;  2DF4 B;  1L6J A;  1MN8 A;  2FE9 A;  9ICL A;  5BOL A;  2PI4 A;  3I28 A;  4R63 A;  4XUS A;  1YU3 A;  4Q8F A;  4KLI A;  9ICV A;  8ICH A;  9ICB A;  5ALG A;  8ICV A;  4NYY A;  3SAF A;  3S6J A;  5IIO A;  4ZOH C;  1NK5 A;  1V97 A;  2MA1 A;  3M7P A;  1ED1 A;  3NVW A;  4XA5 A;  5J2H A;  3RR7 A;  8ICX A;  4RNO A;  1YU1 A;  2KD1 A;  1TE2 A;  4ECU A;  9ICR A;  2GO7 A;  1XO1 A;  4Z6F A;  5ALZ A;  2FPM A;  2Y1J A;  4GC6 A;  4C8O A;  2HCF A;  3MDA A;  1CI4 A;  5J0U A;  3C2K A;  2NO4 A;  4M0A A;  2EH9 A;  3RJJ A;  5ALH A;  2HBJ A;  4NLN A;  2Y2O A;  3WK4 A;  2GH1 A;  2KN7 A;  4OO1 J;  5EE3 A;  3JPS A;  2ATL A;  3WU2 U;  4EEK A;  1UA1 A;  3B0X A;  4UB1 A;  1IV8 A;  4JV2 A;  3HT3 A;  2C28 A;  4YFK A;  4P4M A;  1ZQY A;  2Y0S F;  2LKY A;  3GV7 B;  2KTQ A;  4US8 A;  4ECW A;  5AI9 A;  1SXE A;  3FYH A;  2E8N A;  4NWI A;  2JZB B;  3B9J A;  3VC8 A;  5HR7 A;  4IRD A;  2FLP A;  2W04 A;  3M1Y A;  4IBJ A;  3L2A A;  5KG6 A;  4DFJ A;  3MQL A;  1QCK A;  2KIW A;  5ALP A;  4Z2G A;  4MHV A;  3CW2 C;  3NRW A;  4HAI A;  3PSF A;  3IG8 A;  5DG7 A;  4DO9 A;  5EE0 A;  2BQR A;  3IN5 A;  3EZ5 A;  1L7M A;  3UXP A;  1SL2 A;  2LM1 A;  1ZQF A;  2JZB A;  5J2B A;  2RHF A;  1ZQG A;  1UQV A;  1XC9 A;  1NK6 A;  9ICO A;  5A0L A;  2N1R A;  3GIJ A;  3Q8R B;  1E6N A;  1WG8 A;  4IS7 A;  4J9S A;  2NYV A;  5KG7 A;  1XS9 D;  1OXJ A;  2R8I A;  3IHQ B;  1S97 A;  4C7Y A;  3TAD A;  4DSK A;  1VDV A;  5AKZ A;  2Q0Z X;  5L1I A;  4ED8 A;  1VJ5 A;  5DBA A;  4BUG A;  1DK2 A;  4NL9 C;  4DS5 A;  1X66 A;  4F3O A;  2A3V A;  3TAQ A;  5GTH U;  2XO7 A;  4C8N A;  4OJP A;  5L1J A;  3OHA A;  1ZQR A;  3PW4 A;  3OTQ A;  7ICT A;  4EBD A;  2AGQ A;  2KK0 A;  3RB4 A;  1D9F A;  2F2A B;  4IBF A;  1OGB A;  4YXJ A;  4EEY A;  1ZQQ A;  2P35 A;  4UB2 A;  4PL2 A;  4Z2L A;  2HHQ A;  3E58 A;  3LWL A;  3WD3 A;  4YMM A;  1IG6 A;  1TAM A;  1GPF A;  1RYS A;  1BVS A;  4RPZ A;  3ALR A;  2VA8 A;  2Y2N A;  2VIX A;  2EAN A;  4NZ1 A;  2B6G A;  3T3F A;  2H3F A;  2BDP A;  4DL7 A;  1URJ A;  3N7P D;  3OJS A;  9ICU A;  3C28 A;  4C8M A;  2C2R A;  1QSS A;  2K4P A;  4GLX A;  1RQL A;  2G5H B;  1SV0 A;  4QWD A;  1NJW A;  1RDF A;  2NRX A;  3C5F A;  3SZ2 A;  4CF3 A;  1NK8 A;  4U7C A;  3H8W A;  5J0X A;  8ICA A;  3V72 A;  2FI1 A;  5KT6 A;  8ICW A;  8ICQ A;  4OD0 A;  3GQC A;  4I29 A;  1C7Y A;  2KZZ A;  3MBY A;  4DSF A;  5F9N A;  3EUB 2;  2PMZ C; 
#chains in the Genus database with same CATH homology
 5A0L A;  2N1R A;  3SAH A;  2ZIU A;  1YU3 A;  4ACO A;  2Y0S C;  2Q4T A;  3PST A;  2ZIW A;  2MRL A;  2ZXH A;  4JMU A;  1YT3 A;  4BX9 C;  3MGV A;  1XO0 A;  2Y2Q A;  4IJE A;  1WUD A;  2KKV A;  3F2D A;  2DGZ A;  2KIC A;  3ONN A;  4A8E A;  3AQE A;  4P0P B;  3FKE A;  4IBG A;  2H3I A;  2KJ5 A;  3N7S C;  3SQI A;  2WAQ C;  4IJF A;  4NYY A;  4IBD A;  3SAF A;  1Q3V A;  4OUI A;  2LYA A;  2RP5 A;  2JMG A;  4NLB A;  2UWX A;  2KHQ A;  1A0P A;  2CPR A;  2KV2 A;  4PL1 A;  4AYB C;  2KHV A;  2MA1 A;  3OPX A;  4KX5 A;  4BUG A;  1ED1 A;  4KX3 A;  4IBI A;  2XD1 A;  3PSP A;  1IIP A;  1HIW A;  4FE3 A;  5T14 A;  3F53 A;  4FZN A;  4OJO A;  3RFA A;  1NZB A;  1Z1B A;  1YU1 A;  3L26 A;  2KD1 A;  3KFU F;  2YB1 A;  2KOB A;  1D8B A;  2ZIX B;  2JGA A;  3F5E A;  2BDU A;  3NUQ A;  2ZG6 A;  1SZH A;  3M6Z A;  3F2B A;  4GH9 A;  4IBB A;  4NZ5 A;  2A3V A;  1KBU A;  4WJ3 B;  2WB1 F;  2OH2 A;  2K8C B;  2JH1 A;  3IG5 A;  3PSI A;  3T79 A;  1ECW A;  2Y2H A;  3CYM A;  2VKQ A;  2OYY A;  3D2N A;  2HBL A;  4OJP A;  1HEK A;  3M6K A;  4OJ5 A;  1OUQ A;  3VCB A;  2ZIX A;  2JH7 A;  2HOF A;  2XIC A;  2E1E A;  1PVP A;  3L29 A;  2Y2L A;  2F8L A;  2F2A B;  2JHD A;  2YX8 A;  3N3F A;  4NZ3 A;  2G08 A;  2W7P A;  4OJL A;  2H3V A;  4IBF A;  1GO3 F;  2XI9 A;  3H0R B;  2WB1 C;  5CRX A;  4NY2 A;  2Y2I A;  3LYS A;  4CRX A;  2HBJ A;  2Y2O A;  2KEY A;  2LYB A;  2G5I B;  3LVW A;  2ZIU B;  3E0F A;  3O0F A;  3F2C A;  1PVR A;  3L27 A;  2G06 A;  2H3Z A;  3N7R C;  5KL8 B;  2HBK A;  2Y2M A;  2W7O A;  4PL2 A;  4NYU A;  2GH1 A;  2KJ9 A;  2RRD A;  4QNL A;  4OO1 J;  3HON A;  3PZP A;  2G07 A;  1A6S A;  2HBM A;  4KMO B;  2D6F C;  4FZL A;  4IBC A;  1UPH A;  3CRX A;  1TAM A;  2JE5 A;  2LBO A;  2IOU A;  2JCH A;  2HOQ A;  2G09 A;  3ALR A;  4P0Q B;  2Y2N A;  3SMV A;  2Y2J A;  2XID A;  4P0P A;  2VIX A;  2GOL A;  4IBK A;  1YU0 A;  4NZ1 A;  1P7D A;  3L3F X;  4CDG A;  4AYB F;  2DQN B;  3AQF A;  2Z7J A;  3H0L B;  4LG2 A;  3ICX A;  4GHA A;  2H3F A;  2LHT A;  2VJ5 A;  2Y0S F;  4ICA A;  4QJF B;  2HMX A;  1ZQ1 C;  1T94 A;  2LKY A;  1Z19 A;  2Y2G A;  1XNS A;  2KNJ A;  2WAQ F;  3KZX A;  2K4E A;  2K89 A;  1URJ A;  3N7P D;  1DRG A;  3D2S A;  1YUE A;  3K1Z A;  3SAG A;  4NWI A;  3C28 A;  2G0A A;  1L6N A;  2BG1 A;  4IBE A;  2F77 X;  2K4I A;  2K8A A;  3D2Q A;  3VC8 A;  5BPV A;  3WX7 A;  3RF9 A;  5HR7 A;  2F76 X;  2ZIV A;  4GFJ A;  2CRX A;  3IP4 B;  2PMZ F;  3F5A A;  5C0Y A;  2W04 A;  2XD5 A;  2W03 A;  2M0N A;  3H0M B;  2OM6 A;  4IC9 A;  4IBJ A;  2G5H B;  4NLC A;  3HKZ F;  3L2A A;  4GHL A;  2Y2P A;  5KL1 B;  5HR6 A;  2NV3 A;  4NV0 A;  4QIW F;  3KS8 A;  2FFF B;  2KKP A;  2KIW A;  2ZIW B;  4CGZ A;  2CN1 A;  3DEE A;  3NRW A;  4U7C A;  2K8B B;  1YU4 A;  4NZ4 A;  2XVT A;  3GZF A;  3AL0 B;  4BJQ A;  3CP8 A;  4QIW C;  4OJ6 A;  2HOI A;  3L28 A;  4P0Q A;  2R18 A;  3PSF A;  3KS4 A;  1Q3U A;  2H3Q A;  2YB4 A;  3IG8 A;  2KJ8 A;  2KVC A;  2ZIV B;  3M7D A;  1MA7 A;  1YU2 A;  1CRX A;  4O3M A;  3IN5 A;  3L25 A;  3C29 A;  2E1F A;  3HSH A;  2DF4 B;  4U6P A;  3LVV A;  1PVQ A;  3GU3 A;  2E5S A;  3HKZ C;  2Y2K A;  2OXO A;  2RHF A;  2ZXI A;  4C0Z A;  2K4H A;  1F44 A;  4FZM A;  2PMZ C;  2VJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...