4QNLA

Crystal structure of tail fiber protein gp63.1 from e. coli phage g7c
Total Genus 244
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
244
sequence length
847
structure length
847
Chain Sequence
TGILTNKQAIARHFGVKQSEVVYFSVGAVLSGYKVIYDKGTQRAYSLPANIGSGVTAISLSPAGVLVHSAGSVDLGALAVTRKEYVTLPDTFTSGSVIQTKNELLTHNGTQYRWAGGLPKSVPLNSTPVSAGGISPTAWVIANDELIRQELNNGLIPPVGSTSVYDVPGIVVNTTTDNRAAAYAFPGKIFIPNGVTIRCNLLPDDDVRKFVGEGKLIVKNQWYAKDHTFDIAASMNGNNKTVNDEIYCAFRDQTFCRIGIIGDSITDGAWGKQDWSSPPTNSDGDLDAPSTYNHSLSGGSHSWTEHWMNGLLLTQSRRSGETIYQSANCSVSGKKLSDGWGYRNFDRGFFGNTRYGAEAPRVCILAMGWNDSSASIATYRDQIDKFVRKAWGYGCAVGIVTVNDNDSVRMAFELSTKKYMADKLGVEYFNLGPNLTSASSRNEQTGYYYYVKKDGTWDTTHPQELGQMAMGNAMYMQTLGNKYCRRVRPGDMLTQAAVENYWDCVGYPSGTHYAPQYVPVSGAPALNVFRFLSKCVTNENVTMTTMVWCEEEGMTVSLLEPWTNAAVVGQSHNIRVESPVGKALFESGEYQERNTQINAYRTVLNGKTAMSYFGGGKTLTTYMGRLRKGLNFIRYIIDGSPTDAYFPMLKFGSYKTDGVKLPMVRLSKEPNMTRPAPVMKQSNANDYGVFGEVLSGTQFSKTADSHLYNGASVGYLAVPRGLKKNTYIALNYNPLTNVGVLVGVNAAGNMCIGTFNNANPTDWVVFGDTTREDKGFKVWEYTSSSTGAHTFTVESDDGTATTSAFSTTVATSGYVGLYNPSASSQLFTLEYSMTIGNVGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Function of bacteriophage G7C esterase tailspike in host cell adsorption.
pubmed doi rcsb
source organism Escherichia phage vb_ecop_g7c
molecule tags Hydrolase
molecule keywords Tail fiber protein
total genus 244
structure length 847
sequence length 847
ec nomenclature
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18668 Tail_spike_N Tail spike TSP1/Gp66 receptor binding N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.800 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4qnlA01
2.10.10.80 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4qnlA02
4QNLA 4OJLA 4OJ5A 4OJ6A 4OJPA 4OJOA
chains in the Genus database with same CATH superfamily
4IRDA 1X9MA 4C4SA 2PMZC 1S10A 5FP0A 2ZG6A 5AI9A 2EZXA 1NKBA 3MGVA 4K4GA 5AK4A 8ICGA 1MSWD 4DFMA 5AM0A 2LYAA 4QZ9A 4EBDA 3RR8A 4I2AA 3H8WA 4NLNA 2WF7A 1U4BA 3GIKA 2BKEA 5ALZA 4DQIA 2F8KA 4I2EA 3QEAZ 2WF6A 2G0AA 9ICVA 5F3XB 4NY2A 3ED5A 1XS9D 4P4OA 2XGPA 1FIQA 4P0PB 3FC4A 4YFKA 9ICBA 3CRXA 3BZCA 2VA3A 2KG5A 4FZMA 3KTQA 1WCLA 4ICAA 2E8OA 2JXJA 2FMPA 3UM9A 2Y9UA 1B0XA 3HKZF 4I27A 4FO6A 7ICQA 3WD2A 4J9MA 4OCZA 3WD0A 3I76A 1E6PA 2DUYA 1AROP 3U26A 2RDJA 1E6RA 1X9SA 4NM1A 4PZOA 2XD1A 3C2KA 3QU5A 4DSJA 3ZDBA 5BPVA 2YB1A 2KN7A 3KKAC 4CGZA 1ZQSA 2C2RA 3UMBA 3M9OB 1ECWA 5AHXA 2VJ5A 3RTVA 2XO7A 4MF2A 4IRCA 5KNIA 3WK8A 3IDWA 8ICSA 2D3DA 1SXDA 3ETRA 4DL6A 1NJWA 3N7RC 3UXOA 1TE2A 2MSNA 3EYZA 1OGGA 4F4KA 4BWMA 2DQNB 2AH5A 8ICUA 3MR3A 4GHAA 1IIPA 3ZI4A 5B5EU 1L3UA 1ZD2P 3LVWA 4KN7A 2AGOA 2V9WA 1XSNA 4YMMA 3ZDEA 1H38A 2FJ6A 2KVCA 4KLGA 4GFJA 5J8YA 2JR5A 4YP3A 3C29A 4M9LA 1C7YA 4DWIA 2CPRA 3M1YA 1KN5A 1A76A 1UA0A 2QKQA 4USAA 3SD7A 4J9SA 2F76X 4UAVA 4RUCA 4RPZA 4ELTA 3JPPA 5KFRA 4F71A 4ED2A 3PSFA 3SEIA 4DQRA 2NO4A 1X9XA 7ICOA 2H3IA 3HW8A 4UB8U 4C4RA 4YG2A 5DBCA 3H40A 5J0PA 1BPEA 3TI0A 5KFJA 1UQVA 1W1YA 1GO3F 3LK9A 3ISBA 4KLLA 3RJHA 2KSOB 5J29A 3TAQA 1ZQBA 5J2BA 1PK1A 3KBBA 4NLCA 4IBDA 4I2FA 4NZ3A 4DLGA 3Q8QB 1Y88A 3EW9A 4J9RA 4Y2TA 5CJ7A 1Z1VA 4R64A 3VCBA 1KL9A 3QUBA 4M0AA 5DQGA 4UB1A 4EZ6A 2H3VA 3GU3A 2JV3A 3V72A 3T5KA 3QU7A 3GDXA 1NI3A 3GZFA 1X6IA 2H3QA 4YR3A 2JEFA 1S77D 4YXJA 4RT3A 7ICRA 4C0ZA 4KITB 3BS5A 4ECTA 2W54A 1Z4NA 3N28A 2NRWA 2C28A 3Q8PB 1QQ6A 4QZAA 3V7JA 1HEKA 3JPQA 4B9NA 1S0MA 2UVWA 2JE5A 3RAXA 4O3NA 4Q8FA 1YUEA 8ICVA 4P0PA 3M8SA 1Z3EB 1FFUA 4DEZA 5L1KA 3DV9A 3OHAA 4IBCA 2H3FA 2DF4B 4K4HA 3H4DA 3MGIA 2PFOA 5J2DA 4Y2JA 1RQLA 1YZ6A 3LDAA 4KLJA 3KFUF 3QE9Y 5D4BA 3MR2A 2HHSA 4RNNA 2KHQA 2R8JA 2K89A 3K4GA 3RB3A 1KSPA 4IS7A 4UBCA 8ICYA 4Q45A 3BQ7A 3KZXA 7ICSA 3KS4A 4RQ3A 4K4IA 5CB1A 3L29A 5AKLA 4C8LA 5C5JA 1Q3VA 4PZNA 3JPSA 3CP8A 3WK9A 5CA7A 5D49A 8ICKA 2Y2QA 1WYGA 4O3RA 2LPEA 2HSZA 5DQHA 3ORYA 3T5LA 5KL1B 1PVRA 3WK5A 2W8KA 2YMPA 2OWOA 3GIIA 4RQ8A 2ZUCA 1E6ZA 5KT3A 4CF4A 2R8HA 3TKAA 4RQ7A 1JX4A 5KAFU 3ISCA 1YU4A 3THVA 4P4MA 4CDGA 3RAQA 4Z6DA 4J9QA 3RBEA 8ICWA 1U47A 1ZQRA 2JMGA 4F93B 5DG7A 3RH5A 2IBKA 1TV9A 5KL8B 3BS7A 2HBJA 1ZQYA 4B9TA 2J6SA 2AU0A 4IJEA 4JWMA 3V7LA 4R63A 1KFTA 3C2LA 1EAKA 1D8YA 5KG0A 4JV1A 4XQ8A 4ECSA 2RHFA 1YU1A 1O03A 2G08A 2RLTA 4C7YA 4GHLA 2MRLA 5IIOA 4ED8A 3ZD9A 1X6JA 4DOBA 4Z2HA 4Q8EA 7ICKA 4JB3A 2W7PA 1SL2A 3NVYA 3DDHA 1UT8A 7ICFA 5TISU 9ICWA 5J0UA 5L1IA 2I6XA 3WK4A 1F44A 1N61A 3DEEA 1KW4A 2BPGA 3PMNA 2AJQA 1KKXA 4QWEA 2BPCA 3BDPA 5AM1A 2FLPA 4RQ1A 5ALEA 2DGZA 4F4ZA 1KQQA 4Z6EA 3MFHA 4YN4A 5GTIU 3WKBA 5AICA 1D8LA 2ZIXA 3AM9A 3WD4A 4PGQA 4OO1J 1O6IA 5AKHA 4BJQA 5L1MA 4QWCA 2W9BA 1HUOA 4P0QB 5KFCA 2HHWA 3QU2A 4UAUA 3JPRA 5ALFA 7ICHA 4Z2KA 4TQSA 1N5WA 2F1JA 1L6JA 2PI5A 3Q8LA 4TUPA 4QW8A 3FYHA 4LZDA 2BPFA 3F5AA 3B9JA 5J2IA 3T5HA 5KG1A 3B0YA 1MN8A 2ZIXB 3E0FA 1NZPA 3HSHA 5EE0A 3HILA 3WK7A 3PW0A 1BPYA 5J0XA 4DL7A 2P35A 1ZQPA 3K1RB 4DFPA 2MUTB 1X2IA 4B6JA 1MQ3A 1UR9A 1L7NA 4F5NA 5HR7A 2DKXA 2ES6A 5EE1A 4DFKA 2FLNA 3E58A 4Y2QA 5ALRA 2BCQA 1SKSA 3PX6A 2BZFA 1NJYA 4M6WA 2VA8A 5G5GA 2HDOA 2MU2A 1K1SA 3H8JA 3GIJA 4NL9A 3KOOA 1T4GA 3OPXA 3H0MB 5ALNA 1MQ2A 1ZQKA 5AM2A 3D6JA 5J2JA 3M9MB 2QLTA 2KJ8A 2YQEA 1RYUA 4GC6A 9ICUA 2WFAA 1JALA 4QWDA 1SV0C 2Y2HA 2ZIVB 5KFLA 9ICCA 1WCNA 2KD1A 1HIWA 1BPBA 5ALDA 4RQ2A 4R65A 3OJUA 1IM4A 5KFGA 4QZFA 5DB8A 5H2FU 3C28A 2PKEA 2JGAA 9ICEA 7ICJA 3HKZC 9ICFA 5D46A 1ZYQA 3V7KA 4F2RA 1COKA 4MB3A 5EOZA 1NK0A 2W9CB 5F9LA 3WKDA 4EYIB 1JXLA 2JHDA 1JN3A 5KFFA 4YR0A 1N2XA 4O5CA 4C8NA 4FBUA 3MFIA 2FPMA 2BDUA 4ED7A 4PHEA 4RQ0A 5CP2A 4UAZA 5AI8A 5ALWA 5EWFA 3AU2A 9ICQA 1X9WA 2KP7A 2ZUBA 5BOMA 5A0LA 4EZ9A 2M0NA 4KMUA 4Q43A 5KFSA 3SZ2A 4G9BA 3SI8A 4MEXA 1A77A 2KMDA 1IV8A 3AU6A 2PXIA 3HRDD 1AQ6A 3WK6A 3PR4A 5KG4A 2IHMA 1BPZA 3OJSA 2WTFA 4HYKA 2ZJAA 1SGGA 4KLFA 8ICPA 3PZPA 4Y2UA 1UCVA 2BHNA 2HOIA 3Q8SB 1ZJMA 3KS8A 3PO5A 4LG2A 2JEJA 2WAQC 4KX5A 5AIAA 4O3QA 2ZTEA 2FDRA 1S5LU 4RPXA 2Y2IA 2KIWA 4US9A 3T5JA 3TADC 2QB0B 3KHLA 2W3RA 2KOBA 3MC1A 1ZQQA 2BG1A 2LYHA 1ZD4A 9ICSA 3AMZA 2HHXA 2BCSA 1YZ7A 1SZPA 2XCPA 8ICHA 1BNOA 4XA5A 1C20A 2G5IB 3N7SC 4F2SA 2E8PA 5KTQA 2IHNA 4JV0A 5KFHA 2J6UA 1Z00B 2A1JA 5KFKA 1NOMA 3T3FA 3ICXA 3BZKA 3Q8KA 3N97B 3UXPA 4Y2RA 1SZHA 3NVVA 4PJ0U 2W9MA 2G07A 5CRXA 2JZBA 5ALIA 4F91B 2KVSA 3F2DA 2HHQA 1QSSA 5ALPA 4PPXA 4AP9A 3FDSA 4B9VA 2F1HA 1H0GA 2KTQA 2JH1A 4IBGA 2FMSA 3H7IA 4C8OA 1PK3A 8ICBA 1SV0A 2UVUA 1KTQA 5AKKA 7ICGA 5ALQA 2ZIWB 4OD0A 3RB0A 1UHUA 1RXVA 5J0QA 4UBBA 2ZUDA 5ALLA 4ECQA 1OUQA 3IG5A 3HWTA 3A0HU 2JEIA 5KG5A 5J0RA 3MQLA 1RXWA 4QJFB 4RZRA 3QYPA 5KG3A 3PMLA 3R9KA 3ZDDA 5ALYA 4C80A 1N56A 8ICFA 4R8UA 4ECXA 5ALTA 4NM2A 1N62A 5B66U 5J2FA 2Y2KA 1D9DA 4TUQA 4ZOHC 5L1LA 1Z00A 4F4YA 4MFFA 4CNQA 3UXNA 3ETLA 2C2DA 1ZQHA 4ECUA 4MHVA 1U9LA 1QTMA 4FS2A 3TQ1A 1GXDA 1LVHA 1L6NA 4NLZA 2F8LA 3C21A 2XY5A 9ICJA 5HHIA 2XICA 2LM4A 3QZ8A 4IQVA 3PNCA 1ZQXA 2EANA 3SR6A 3NTUA 5KFVA 3F53A 3GIMA 1JUDA 2LYBA 2AXTU 4KX3A 1KRPA 3A0BU 1BPXA 4GH9A 3NRWA 3NVWA 2ZJ8A 5AI5A 3PSIA 5IIIA 5KFDA 3PY8A 2LM1A 4JUZA 2YY6A 4JK1A 2UVRA 2BDPA 3QU9A 2P66A 4IBEA 1BGXT 3JPTA 2D6FC 4IR1A 2RQ5A 3KHGA 2Y2LA 1UPHA 5KT5A 5KG6A 3GV5B 3EZ5A 3H0RB 1L7PA 5ALUA 1IG6A 1KFSA 3OSPA 1ZQ1C 4Z2LA 2DFLA 2F44A 4DQQA 1B4FA 4O3MA 2QARA 1TAUA 4OJ5A 4ECYA 4XUSA 2BCUA 4P4PA 2QB1A 5JRTA 1UT5A 4NZ1A 4F92B 5J2GA 2YMQA 2KJ9A 2H3ZA 2AQ0A 2EQYA 1W1PA 4US8A 1S8OA 2Y2OA 2ZIVA 3RFAA 5KG7A 2E1EA 4RPYA 4NZ4A 5CEHA 5J0OA 4OJOA 4ECRA 9ICPA 4PGYA 1SIJA 4BUGA 1NK5A 3D2QA 1OXJA 2VJ4A 4DO9A 5AM3A 3IHQB 1YU3A 3SAFA 4TQRA 1ZD3A 4RU9A 3J81j 4F3OA 5J2KA 2IOFK 3EPGA 3AQFA 2W9CA 5KFNA 1GPFA 3D2NA 4NY8A 3RRHA 2JH7A 5K4LA 4TURA 5KFPA 3RJEA 4M6WB 1KFDA 1ZQIA 4B9SA 4IBJA 1QCKA 3G6XA 3BQTA 2JZBB 4ECZA 8ICAA 2LBOA 2EAPA 4IBFA 4CRXA 2G06A 2BR0A 2HMXA 5T14A 2WF8A 1F5SA 4FS1A 8ICRA 2KK0A 3SENA 4M9NA 5DB7A 2KZ3A 5JUMA 2ODGA 4RQNA 4QZ8A 2IOUA 4WJ3B 1ZQCA 4ECWA 2BQ3A 2HW3A 2HCFA 2J6TA 5DQIA 1YU2A 2OEHA 3T79A 2EH9A 7ICEA 5AI4A 1ZQNA 1PUZA 2HHTA 2R8IA 4DS5A 9ICXA 1B43A 3L26A 1ZRNA 2F3NA 3FKEA 4KLEA 3LWLA 3MABA 4GXJA 1LV5A 3WKAA 2E5SA 2IMWP 2YTUA 1NK7A 5DGBA 4IR9A 2I1QA 3OGUA 2VA2A 5DBAA 4UB2A 2YN4A 1ZETA 4P0QA 4TUSA 2ALZA 4KLSA 3VC8A 2KZMA 1XSPA 3AL0B 3RR7A 5KFTA 1E6NA 4CE6A 2V4QA 1JROA 3LWMA 5IIKA 1A0PA 3SMVA 3ZD8A 4I2IA 2L5YA 1T3NA 4IC9A 1L5UA 1X40A 2GLEA 8ICMA 1NJZA 4DLEA 2AGPA 3M7PA 2XY6A 5E79U 2Y2NA 1ZQJA 5AKIA 4YD2A 1DGJA 5KAIU 2YMMA 2ATLA 3UMCA 3L4PA 8ICOA 1NKEA 5J2CA 4OJLA 5J0SA 4FBTA 5HP4A 2ZXHA 3RBDA 4PL2A 2K4EA 3QX7A 1RG6A 2EAOA 3IV6A 2K4IA 3V6KA 1PVPA 1B22A 4DF4A 1OGBA 2W11A 4M2YA 2BQRA 1RYSA 3N4MB 1QLNA 1V85A 4ECVA 2CRXA 4IBBA 4DSIA 4QZDA 2W7OA 2HOQA 2IOFA 2NO5A 3IRUA 4C7ZA 5AIBA 3I28A 3G6YA 2EZZA 2ZIUB 3WX7A 4FZNA 1U48A 2HVIA 5KFIA 1W1VA 4RQ6A 3PVXA 3TACB 4DS4A 1V9PA 4AYBC 4I2GA 2HBMA 2XY7A 8ICTA 4OJPA 2Y2PA 1ZQUA 1RPLA 4QW9A 2ZTCA 1SB3C 5DDMA 3MR6A 3Q8MA 1SKRA 5BOLA 4O3SA 4QIWF 4JMUA 4EX6A 3WD3A 2V5OA 2KKVA 1XNSA 1YU0A 3M7DA 9ICLA 4FZLA 5DG9A 4X5VA 2R8GA 1NK8A 2WAQF 4B9LA 3RH4A 1TK5A 1J2MA 1P7DA 5L1JA 3C5FA 1TAQA 2IA6A 3CNHA 3KHRA 2ASJA 1VLBA 4G3IA 4NL9C 1ZD5A 2QARB 3QZ7A 7ICNA 9ICRA 3RJKA 5KT6A 2OYYA 1MA7A 3EWAA 1ZQOA 5EE3A 2CXYA 2BQUA 5AI0A 2OXOA 2VKQA 2MUTA 3F2CA 3C1YA 1D8BA 2KV2A 4J9NA 1BVSA 5IINA 4RQ5A 3ZDAA 1XO0A 2GOLA 3AN1A 3KD3A 3JPOA 4ELUA 2D8CA 5AKEA 1H0IA 1S76D 4JWNA 4IJFA 8ICIA 2AQ4A 2OH2A 2WF9A 1Q3UA 4CF3A 4DSKA 4QZEA 5KT7A 2KFZA 2P6RA 2FFFB 3EPIA 8ICNA 2XD5A 4KTQA 1E88A 4AYBF 4GXIA 3GV7B 4M9JA 1ZQVA 1NK6A 5IIMA 8ICQA 1L3VA 4UB5A 1NJXA 3Q8RB 3QU4A 4KLMA 2W03A 1DRGA 3G6VA 1CXWA 1SV4A 2KNJA 4EYHB 1PVQA 3PX0A 5DB6A 3CW2C 3PSTA 1KEJA 1SL0A 2OCEA 3BJYA 5DB9A 1ZQGA 3GFKB 3RB4A 5ALKA 3AEVA 1FFVA 3PW4A 4HMDA 4UB3A 2DKZA 3ONNA 3OTQA 4NJ8A 1JRPA 2Y9TA 2KICA 5F9NA 1O08A 1SKWA 4B9UA 4DFJA 9ICTA 4NZ5A 1ZQWA 4BXOB 2PFNA 5DLGA 9ICGA 5DBBA 2WHEA 2Y0SF 4Z6CA 1ZQTA 2NRZA 4R8UB 4FE3A 2GH1A 2KIVA 4UB4A 1L3TA 3HJEA 3IG8A 8ICZA 4O0IA 2W04A 4BDPA 3TADA 1QQ7A 2RP5A 5KFOA 4IL6U 4Y2XA 3IN5A 3H4BA 1X66A 2ZIUA 4RQ4A 2FI1A 4IQUA 3TANA 7ICUA 5AKXA 1XU4A 4J9PA 3H8SA 3PSPA 1FEZA 5CWRA 1H8PA 2W9AA 4Y2VA 1CEZA 1L3SA 4GXKA 2E8NA 3EUB2 3NGDA 4DQPA 2K8CB 4ED1A 5EE9A 3WD1A 1RQNA 1PZNA 4I29A 2FE9A 3M8RA 1CK7A 2YMLA 3HP6A 4ZH4A 4MF8A 1TVAA 3QEBZ 4DOCA 2ASLA 4RQMA 3M9NB 2UVVA 3UPQA 4QZGA 4PHAA 2Y2JA 4RUAA 4BXOA 8ICCA 2W55A 3SAGA 1S0OA 9ICHA 4B9MA 4QZIA 1TFRA 5J2EA 1FO4A 3TARA 4OJ6A 4JV2A 3L3FX 3MDCA 2MAXA 1TKDA 1WUDA 2KFNA 2H5XA 3NRZA 5CR0A 5TZVA 1J7MA 4BWJA 4YR2A 3RB6A 1U45A 4M47A 1TK0A 3HONA 4F4XA 3RF9A 3H8MA 4NXZA 2GWSA 4IBIA 1Q46A 3H0LB 3BQ0A 4HMEA 4O5EA 3N3FA 2A19A 3AQEA 2EAMA 5HHHA 1JI7A 1ZOLA 2ASDA 4C8KA 5KG2A 5J2AA 2A3VA 2ESEA 4IRKA 4NWIA 9ICOA 4HMCA 3QNMA 4KLDA 1DK3A 3UQ0A 4Z2IA 4MB4A 4P2HA 1DGSA 1CUKA 2EDUA 5AKYA 4UAYA 1EXNA 3PX4A 2HI0A 5HMLA 4NLKA 7ICVA 2B6GA 1TK8A 3QUQA 2I5HA 1PK1B 1U49A 2Y2GA 3TAPA 2F77X 3UMGA 3KZIU 2GO7A 3GQCA 3RH6A 2FN2A 5JU5A 3LVVA 5AK6A 1NZBA 2BCRA 4YXMA 1ZQDA 4F5RA 9ICNA 1AIWA 1ZQFA 2F2AB 3ALRA 4I2BA 5J0WA 4LVSA 2C22A 2CN1A 4RT2A 3QUCA 4DL3A 1URJA 1S0VA 1QQ5A 1COOA 3BQ1A 4GC7A 4Y2SA 1J97A 8ICEA 5C0YA 3IP4B 3B0XA 2NRTA 4YMNA 4NYUA 4RNOA 4I28A 1E15A 9ICMA 5KFBA 1LKYB 2PI4A 1KBUA 4DCCA 3SYZA 1XWLA 4KLUA 7ICPA 3TFRA 5ALJA 1V97A 4BGDA 1UA1A 3MBYA 2ISOA 4UAWA 1T94A 7ICLA 5ALGA 5CHGA 1KS0A 2K4PA 9ICIA 4UB6U 3NASA 2N1RA 1DK2A 4A8EA 4DOAA 1T7PA 2VANA 2KEYA 2I9GA 5J0TA 1L7MA 4EBEA 1SXEA 1QO6A 3K75D 4NYYA 3L2AA 2M9NA 7ICTA 2R8KA 5BPCA 5EWEA 2FPLA 1ED7A 1LKYA 5AM4A 3L28A 5DG8A 2KKPA 5IILA 5GTHU 4ED0A 4YVZA 4GIBA 2FMQA 2OHFA 1ZQAA 2K8AA 1RYRA 2A1AA 3SV4A 1MC8A 4MFCA 4O3PA 4F4WA 1DOQA 1ZJNA 4F50A 1N48A 5DDYA 2Y1IA 3M6ZA 3C2MA 5DGAA 1QH9A 2W9BB 3JPNA 5ALVA 1IXRA 1KLNA 3QUTA 1DXSA 1JXEA 1WWVA 3V6HA 4ELVA 2EZYA 2KHVA 2Y1JA 3BQ2A 4J9KA 5JTIA 5KFZA 4QWBA 2DWQA 1TAMA 4C8MA 1RM6C 4KN4A 2HBLA 4Q44A 1PDCA 3SQIA 3RJJA 4TX8A 4UARA 5KFQA 2HVHA 1CRXA 3E2EA 1N60A 2JRZA 2W43A 1Z1BA 1SWWA 2R18A 4F72A 3PW7A 3GILA 2PFQA 1GOIA 7ICMA 4IBKA 1L8OA 2K4HA 1ZRMA 1ZQMA 5EWGA 5AI6A 2D49A 2DPJA 2XIDA 2F1IA 4QZHA 4UATA 2W8LA 4OUIA 2XGQA 4CCHA 1QSYA 3LYSA 4I2JA 8ICLA 7ICIA 1JIHA 5IIJA 2RDIA 3WU2U 4ACOA 1Z4OA 4KLTA 1T8EA 4HAIA 1SL1A 4XRHA 1W1TA 4F5OA 2FLLA 2E8MA 4EEYA 3C5GA 3PR5B 3O0FA 4C4TA 4FFDA 4EELA 4QZCA 3L25A 3MGHA 4LJXA 2HOFA 5J0YA 4NLGA 2B0CA 1NKCA 2P6UA 1M6YA 2WB1F 1K5OA 4DSEA 4NV0A 1D9FA 4I2HA 2Y0SC 5DLFA 5KT2A 4PH5A 1Q8KA 3V6JA 2NRVA 2HHUA 4EBCA 4Y2YA 1CI4A 1N63A 5KFEA 4DL4A 3F5EA 3IM1A 3PO4A 2LKYA 2IOHA 3L5KA 2MA1A 3KHHA 2Q0ZX 3C23A 4UQGA 1HJPA 3L27A 1T3QA 2AHOB 4E0DA 1BNPA 5AKGA 2NRXA 1QSLA 4QZBA 4M9HA 2K60A 4QWAA 2G5HB 5KFYA 3WKCA 4MB5A 2LMRA 1S0NA 1ZQLA 2E3TA 1OW5A 4BX9C 2JCHA 4Z2GA 2BGWA 1Z19A 3NS1A 4J9OA 8ICXA 4GLXA 4YCXA 4KLHA 5AK5A 1NK9A 3C1ZA 5J2HA 4U7CA 4KLOA 1WG8A 3FM9A 2YX8A 4DFDA 4DSFA 3RJFA 3RJGA 1VJ5A 2NV3A 4J9LA 3UQ2A 3WKEA 4I2CA 1K1QA 5HR6A 4UASA 4KMOB 5ALHA 2KZZA 4F8RA 5AM5A 9ICKA 3PW2A 5ALMA 5KFUA 2XCAA 3ZDCA 4M04A 4DL2A 4EENA 4UW9A 4QIWC 4NLBA 2ZIWA 3HX0A 2A1JB 1UR8A 4ED3A 3MDAA 2E1FA 3PW5A 5ALXA 4DF8A 1NNLA 4EX7A 5HNKA 1E8BA 1N5XA 2O6KA 4DL5A 5AK3A 3MR5A 2B21A 2ZXIA 4KLIA 5AKZA 5KT4A 2C2EA 1RZTA 2RTSA 2QB0A 4MEYA 2ZTDA 1HUZA 2G09A 3AUOA 3M6KA 1XO1A 1ZQEA 4F5PA 1XC9A 5KFAA 1A6SA 2V4RA 3N7PD 2VIXA 1XSLA 3SAHA 3SV3A 4PHPA 2XI9A 4F5QA 2Q4TA 3BS5B 1SWVA 1RDFA 3TFSA 2PMZF 4PGXA 5AKJA 1VDVA 4YQWA 4R66A 1L8LA 4DSLA 5DKWA 5ALSA 1NK4A 2Y2MA 1ED1A 2OM6A 1S97A 4YD1A 4O5KA 5KFWA 4O3OA 4IQTA 5HMMA 3OHBA 1ZXIA 2JEGA 4I2DA 3FAHA 2ISPA 3QXGA 4LZGA 1F0MA 3I1YA 2WB1C 1WWUA 2KE7A 2WF5A 3RJIA 1X42A 3PV8A 3HPOA 4DQSA 1BPDA 1J2NA 3NVZA 2YB4A 3OSNA 2HBKA 3K1ZA 2XVTA 5ALOA 3D2SA 2KJ5A 4YMOA 2KSOA 1L7OA 4Y2PA 3GV8B 3KKAA 4CF5A 4KLQA 2FPKA 5KFMA 3NUQA 2RRDA 3CYMA 3S6JA 5KFXA 4PHDA 8ICJA 3HT3A 9ICAA 2LHTA 5G5HA 2UWXA 4M9GA 2ZJ5A 1LB2B 1KDHA 1V38A 4J03A 2DPIA 1JMSA 5L9XA 4PL1A 2NYVA 4RNMA 2Z7JA 1S9FA 4U6PA 3RRGA 4IQWA 2AGQA 2DL0A 2K8BB 2W3SA 1ZQZA 4O9MA 4Z2JA 2BCVA 4MFAA 2LI6A 3F2BA 4EEKA 2DBYA 2HHVA 2XC9A 3ISDA 2PFPA 4QNLA 4ED6A 1YT3A 5J8YC 4Z6FA
chains in the Genus database with same CATH topology
3E0FA 2HMXA 3GZFA 1PVPA 3HSHA 3KS8A 2PMZF 2H3QA 2KV2A 5T14A 2PMZC 3PSPA 2Y2GA 2ZIWB 2ZG6A 1XO0A 2GOLA 2F77X 4C0ZA 1YU4A 2Y2MA 4CDGA 4IBEA 1ED1A 2G5HB 2D6FC 5A0LA 3MGVA 2OM6A 2M0NA 3LVVA 1NZBA 2KHVA 2JMGA 2ZIXB 3N7RC 2K8CB 2CRXA 4IBBA 1OUQA 3IG5A 5KL8B 4IJFA 2W7OA 2HBJA 2HOQA 2IOUA 4WJ3B 2F2AB 2OH2A 2Y2LA 2DQNB 3ALRA 1UPHA 1TAMA 4IJEA 1Q3UA 1HEKA 2LYAA 4BX9C 4QJFB 2HBLA 2WB1C 2JCHA 3H0RB 2CN1A 5HR7A 4GHAA 3SQIA 1URJA 1IIPA 1Z19A 1ZQ1C 1YU2A 2JE5A 3T79A 2ZIUB 1CRXA 1Z1BA 3WX7A 2R18A 4FZNA 1YUEA 2FFFB 2XD5A 2RHFA 1YU1A 2G0AA 2G08A 2YB4A 3LVWA 4P0PA 4AYBF 4GHLA 5C0YA 4IBKA 2K4HA 4U7CA 4NY2A 3PZPA 2HBKA 2MRLA 3IP4B 3K1ZA 2XVTA 4O3MA 2KVCA 2Y2JA 4AYBC 4NYUA 2HBMA 2HOIA 2YX8A 3D2SA 3FKEA 3L26A 2NV3A 4OJ5A 4GFJA 3SAGA 2H3FA 2XIDA 4OJPA 4P0PB 2KJ5A 2Y2PA 2DF4B 3C29A 2Y2KA 4LG2A 2WAQC 5HR6A 4KX5A 2W7PA 3CRXA 1KBUA 2CPRA 3VC8A 4OUIA 2W03A 4FZMA 4KMOB 2E5SA 1DRGA 4IBCA 4NZ1A 2KNJA 3LYSA 1PVQA 2KJ9A 3OPXA 2H3ZA 3H0MB 3NUQA 4ICAA 2Y2IA 2KIWA 2RRDA 3CYMA 3PSTA 1F44A 4OJ6A 2F76X 1T94A 4ACOA 3DEEA 3L3FX 4P0QA 4QIWC 2BG1A 2KOBA 2Y2OA 4NLBA 1WUDA 2ZIVA 3HKZF 2ZIWA 3PSFA 4JMUA 4QIWF 3RFAA 2E1EA 2N1RA 3KFUF 2LHTA 3AL0B 2UWXA 4NZ4A 4OJOA 2H3IA 4A8EA 2E1FA 2KJ8A 4BUGA 2KEYA 2KHQA 2K89A 3D2QA 2KKVA 3ONNA 1A0PA 3SMVA 2VJ4A 1XNSA 2DGZA 1YU0A 3M7DA 1YU3A 4FZLA 3O0FA 3SAFA 2Y2HA 2ZIVB 4NYYA 4IC9A 1GO3F 3KZXA 1L6NA 3HONA 3KS4A 2WAQF 3L2AA 4PL1A 2ZIXA 2KD1A 2G5IB 2F8LA 1HIWA 2KICA 2Z7JA 3N7SC 3RF9A 2XD1A 4U6PA 4IBIA 3L25A 1P7DA 3AQFA 2HOFA 4OO1J 3L29A 3H0LB 2ZXIA 3L28A 4NZ5A 4BJQA 2WB1F 3D2NA 2KKPA 1Q3VA 3N3FA 2JH7A 3AQEA 4NV0A 5BPVA 2XICA 2Y0SC 2K8BB 3ICXA 3C28A 2Y2NA 2Y0SF 2YB1A 4NLCA 2K8AA 4IBDA 4NZ3A 3CP8A 2JGAA 4P0QB 1SZHA 4FE3A 3HKZC 2Y2QA 2G07A 2G09A 2GH1A 4CGZA 3M6KA 5CRXA 2A3VA 1ECWA 3F2BA 4IBJA 3IG8A 4NWIA 3F2DA 3F53A 4OJLA 2W04A 3VCBA 5KL1B 2LYBA 3F5EA 1A6SA 4KX3A 2ZXHA 1PVRA 2LKYA 2JHDA 2OYYA 2VJ5A 1MA7A 2RP5A 3N7PD 2MA1A 4PL2A 2K4EA 2VIXA 2LBOA 3SAHA 3IN5A 3F5AA 2ZIUA 2JH1A 3NRWA 4QNLA 4GH9A 2H3VA 3L27A 2OXOA 2VKQA 3GU3A 3F2CA 2XI9A 3PSIA 4IBGA 3M6ZA 4IBFA 1YT3A 2K4IA 2Q4TA 4CRXA 1D8BA 2BDUA 2G06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QNL A;  4OJL A;  4OJ5 A;  4OJ6 A;  4OJP A;  4OJO A; 
#chains in the Genus database with same CATH topology
 4IRD A;  1X9M A;  4C4S A;  2PMZ C;  1S10 A;  5FP0 A;  2ZG6 A;  5AI9 A;  2EZX A;  1NKB A;  3MGV A;  4K4G A;  5AK4 A;  8ICG A;  1MSW D;  4DFM A;  5AM0 A;  2LYA A;  4QZ9 A;  4EBD A;  3RR8 A;  4I2A A;  3H8W A;  4NLN A;  2WF7 A;  1U4B A;  3GIK A;  2BKE A;  5ALZ A;  4DQI A;  2F8K A;  4I2E A;  3QEA Z;  2WF6 A;  2G0A A;  9ICV A;  5F3X B;  4NY2 A;  3ED5 A;  1XS9 D;  4P4O A;  2XGP A;  1FIQ A;  4P0P B;  3FC4 A;  4YFK A;  9ICB A;  3CRX A;  3BZC A;  2VA3 A;  2KG5 A;  4FZM A;  3KTQ A;  1WCL A;  4ICA A;  2E8O A;  2JXJ A;  2FMP A;  3UM9 A;  2Y9U A;  1B0X A;  3HKZ F;  4I27 A;  4FO6 A;  7ICQ A;  3WD2 A;  4J9M A;  4OCZ A;  3WD0 A;  3I76 A;  1E6P A;  2DUY A;  1ARO P;  3U26 A;  2RDJ A;  1E6R A;  1X9S A;  4NM1 A;  4PZO A;  2XD1 A;  3C2K A;  3QU5 A;  4DSJ A;  3ZDB A;  5BPV A;  2YB1 A;  2KN7 A;  3KKA C;  4CGZ A;  1ZQS A;  2C2R A;  3UMB A;  3M9O B;  1ECW A;  5AHX A;  2VJ5 A;  3RTV A;  2XO7 A;  4MF2 A;  4IRC A;  5KNI A;  3WK8 A;  3IDW A;  8ICS A;  2D3D A;  1SXD A;  3ETR A;  4DL6 A;  1NJW A;  3N7R C;  3UXO A;  1TE2 A;  2MSN A;  3EYZ A;  1OGG A;  4F4K A;  4BWM A;  2DQN B;  2AH5 A;  8ICU A;  3MR3 A;  4GHA A;  1IIP A;  3ZI4 A;  5B5E U;  1L3U A;  1ZD2 P;  3LVW A;  4KN7 A;  2AGO A;  2V9W A;  1XSN A;  4YMM A;  3ZDE A;  1H38 A;  2FJ6 A;  2KVC A;  4KLG A;  4GFJ A;  5J8Y A;  2JR5 A;  4YP3 A;  3C29 A;  4M9L A;  1C7Y A;  4DWI A;  2CPR A;  3M1Y A;  1KN5 A;  1A76 A;  1UA0 A;  2QKQ A;  4USA A;  3SD7 A;  4J9S A;  2F76 X;  4UAV A;  4RUC A;  4RPZ A;  4ELT A;  3JPP A;  5KFR A;  4F71 A;  4ED2 A;  3PSF A;  3SEI A;  4DQR A;  2NO4 A;  1X9X A;  7ICO A;  2H3I A;  3HW8 A;  4UB8 U;  4C4R A;  4YG2 A;  5DBC A;  3H40 A;  5J0P A;  1BPE A;  3TI0 A;  5KFJ A;  1UQV A;  1W1Y A;  1GO3 F;  3LK9 A;  3ISB A;  4KLL A;  3RJH A;  2KSO B;  5J29 A;  3TAQ A;  1ZQB A;  5J2B A;  1PK1 A;  3KBB A;  4NLC A;  4IBD A;  4I2F A;  4NZ3 A;  4DLG A;  3Q8Q B;  1Y88 A;  3EW9 A;  4J9R A;  4Y2T A;  5CJ7 A;  1Z1V A;  4R64 A;  3VCB A;  1KL9 A;  3QUB A;  4M0A A;  5DQG A;  4UB1 A;  4EZ6 A;  2H3V A;  3GU3 A;  2JV3 A;  3V72 A;  3T5K A;  3QU7 A;  3GDX A;  1NI3 A;  3GZF A;  1X6I A;  2H3Q A;  4YR3 A;  2JEF A;  1S77 D;  4YXJ A;  4RT3 A;  7ICR A;  4C0Z A;  4KIT B;  3BS5 A;  4ECT A;  2W54 A;  1Z4N A;  3N28 A;  2NRW A;  2C28 A;  3Q8P B;  1QQ6 A;  4QZA A;  3V7J A;  1HEK A;  3JPQ A;  4B9N A;  1S0M A;  2UVW A;  2JE5 A;  3RAX A;  4O3N A;  4Q8F A;  1YUE A;  8ICV A;  4P0P A;  3M8S A;  1Z3E B;  1FFU A;  4DEZ A;  5L1K A;  3DV9 A;  3OHA A;  4IBC A;  2H3F A;  2DF4 B;  4K4H A;  3H4D A;  3MGI A;  2PFO A;  5J2D A;  4Y2J A;  1RQL A;  1YZ6 A;  3LDA A;  4KLJ A;  3KFU F;  3QE9 Y;  5D4B A;  3MR2 A;  2HHS A;  4RNN A;  2KHQ A;  2R8J A;  2K89 A;  3K4G A;  3RB3 A;  1KSP A;  4IS7 A;  4UBC A;  8ICY A;  4Q45 A;  3BQ7 A;  3KZX A;  7ICS A;  3KS4 A;  4RQ3 A;  4K4I A;  5CB1 A;  3L29 A;  5AKL A;  4C8L A;  5C5J A;  1Q3V A;  4PZN A;  3JPS A;  3CP8 A;  3WK9 A;  5CA7 A;  5D49 A;  8ICK A;  2Y2Q A;  1WYG A;  4O3R A;  2LPE A;  2HSZ A;  5DQH A;  3ORY A;  3T5L A;  5KL1 B;  1PVR A;  3WK5 A;  2W8K A;  2YMP A;  2OWO A;  3GII A;  4RQ8 A;  2ZUC A;  1E6Z A;  5KT3 A;  4CF4 A;  2R8H A;  3TKA A;  4RQ7 A;  1JX4 A;  5KAF U;  3ISC A;  1YU4 A;  3THV A;  4P4M A;  4CDG A;  3RAQ A;  4Z6D A;  4J9Q A;  3RBE A;  8ICW A;  1U47 A;  1ZQR A;  2JMG A;  4F93 B;  5DG7 A;  3RH5 A;  2IBK A;  1TV9 A;  5KL8 B;  3BS7 A;  2HBJ A;  1ZQY A;  4B9T A;  2J6S A;  2AU0 A;  4IJE A;  4JWM A;  3V7L A;  4R63 A;  1KFT A;  3C2L A;  1EAK A;  1D8Y A;  5KG0 A;  4JV1 A;  4XQ8 A;  4ECS A;  2RHF A;  1YU1 A;  1O03 A;  2G08 A;  2RLT A;  4C7Y A;  4GHL A;  2MRL A;  5IIO A;  4ED8 A;  3ZD9 A;  1X6J A;  4DOB A;  4Z2H A;  4Q8E A;  7ICK A;  4JB3 A;  2W7P A;  1SL2 A;  3NVY A;  3DDH A;  1UT8 A;  7ICF A;  5TIS U;  9ICW A;  5J0U A;  5L1I A;  2I6X A;  3WK4 A;  1F44 A;  1N61 A;  3DEE A;  1KW4 A;  2BPG A;  3PMN A;  2AJQ A;  1KKX A;  4QWE A;  2BPC A;  3BDP A;  5AM1 A;  2FLP A;  4RQ1 A;  5ALE A;  2DGZ A;  4F4Z A;  1KQQ A;  4Z6E A;  3MFH A;  4YN4 A;  5GTI U;  3WKB A;  5AIC A;  1D8L A;  2ZIX A;  3AM9 A;  3WD4 A;  4PGQ A;  4OO1 J;  1O6I A;  5AKH A;  4BJQ A;  5L1M A;  4QWC A;  2W9B A;  1HUO A;  4P0Q B;  5KFC A;  2HHW A;  3QU2 A;  4UAU A;  3JPR A;  5ALF A;  7ICH A;  4Z2K A;  4TQS A;  1N5W A;  2F1J A;  1L6J A;  2PI5 A;  3Q8L A;  4TUP A;  4QW8 A;  3FYH A;  4LZD A;  2BPF A;  3F5A A;  3B9J A;  5J2I A;  3T5H A;  5KG1 A;  3B0Y A;  1MN8 A;  2ZIX B;  3E0F A;  1NZP A;  3HSH A;  5EE0 A;  3HIL A;  3WK7 A;  3PW0 A;  1BPY A;  5J0X A;  4DL7 A;  2P35 A;  1ZQP A;  3K1R B;  4DFP A;  2MUT B;  1X2I A;  4B6J A;  1MQ3 A;  1UR9 A;  1L7N A;  4F5N A;  5HR7 A;  2DKX A;  2ES6 A;  5EE1 A;  4DFK A;  2FLN A;  3E58 A;  4Y2Q A;  5ALR A;  2BCQ A;  1SKS A;  3PX6 A;  2BZF A;  1NJY A;  4M6W A;  2VA8 A;  5G5G A;  2HDO A;  2MU2 A;  1K1S A;  3H8J A;  3GIJ A;  4NL9 A;  3KOO A;  1T4G A;  3OPX A;  3H0M B;  5ALN A;  1MQ2 A;  1ZQK A;  5AM2 A;  3D6J A;  5J2J A;  3M9M B;  2QLT A;  2KJ8 A;  2YQE A;  1RYU A;  4GC6 A;  9ICU A;  2WFA A;  1JAL A;  4QWD A;  1SV0 C;  2Y2H A;  2ZIV B;  5KFL A;  9ICC A;  1WCN A;  2KD1 A;  1HIW A;  1BPB A;  5ALD A;  4RQ2 A;  4R65 A;  3OJU A;  1IM4 A;  5KFG A;  4QZF A;  5DB8 A;  5H2F U;  3C28 A;  2PKE A;  2JGA A;  9ICE A;  7ICJ A;  3HKZ C;  9ICF A;  5D46 A;  1ZYQ A;  3V7K A;  4F2R A;  1COK A;  4MB3 A;  5EOZ A;  1NK0 A;  2W9C B;  5F9L A;  3WKD A;  4EYI B;  1JXL A;  2JHD A;  1JN3 A;  5KFF A;  4YR0 A;  1N2X A;  4O5C A;  4C8N A;  4FBU A;  3MFI A;  2FPM A;  2BDU A;  4ED7 A;  4PHE A;  4RQ0 A;  5CP2 A;  4UAZ A;  5AI8 A;  5ALW A;  5EWF A;  3AU2 A;  9ICQ A;  1X9W A;  2KP7 A;  2ZUB A;  5BOM A;  5A0L A;  4EZ9 A;  2M0N A;  4KMU A;  4Q43 A;  5KFS A;  3SZ2 A;  4G9B A;  3SI8 A;  4MEX A;  1A77 A;  2KMD A;  1IV8 A;  3AU6 A;  2PXI A;  3HRD D;  1AQ6 A;  3WK6 A;  3PR4 A;  5KG4 A;  2IHM A;  1BPZ A;  3OJS A;  2WTF A;  4HYK A;  2ZJA A;  1SGG A;  4KLF A;  8ICP A;  3PZP A;  4Y2U A;  1UCV A;  2BHN A;  2HOI A;  3Q8S B;  1ZJM A;  3KS8 A;  3PO5 A;  4LG2 A;  2JEJ A;  2WAQ C;  4KX5 A;  5AIA A;  4O3Q A;  2ZTE A;  2FDR A;  1S5L U;  4RPX A;  2Y2I A;  2KIW A;  4US9 A;  3T5J A;  3TAD C;  2QB0 B;  3KHL A;  2W3R A;  2KOB A;  3MC1 A;  1ZQQ A;  2BG1 A;  2LYH A;  1ZD4 A;  9ICS A;  3AMZ A;  2HHX A;  2BCS A;  1YZ7 A;  1SZP A;  2XCP A;  8ICH A;  1BNO A;  4XA5 A;  1C20 A;  2G5I B;  3N7S C;  4F2S A;  2E8P A;  5KTQ A;  2IHN A;  4JV0 A;  5KFH A;  2J6U A;  1Z00 B;  2A1J A;  5KFK A;  1NOM A;  3T3F A;  3ICX A;  3BZK A;  3Q8K A;  3N97 B;  3UXP A;  4Y2R A;  1SZH A;  3NVV A;  4PJ0 U;  2W9M A;  2G07 A;  5CRX A;  2JZB A;  5ALI A;  4F91 B;  2KVS A;  3F2D A;  2HHQ A;  1QSS A;  5ALP A;  4PPX A;  4AP9 A;  3FDS A;  4B9V A;  2F1H A;  1H0G A;  2KTQ A;  2JH1 A;  4IBG A;  2FMS A;  3H7I A;  4C8O A;  1PK3 A;  8ICB A;  1SV0 A;  2UVU A;  1KTQ A;  5AKK A;  7ICG A;  5ALQ A;  2ZIW B;  4OD0 A;  3RB0 A;  1UHU A;  1RXV A;  5J0Q A;  4UBB A;  2ZUD A;  5ALL A;  4ECQ A;  1OUQ A;  3IG5 A;  3HWT A;  3A0H U;  2JEI A;  5KG5 A;  5J0R A;  3MQL A;  1RXW A;  4QJF B;  4RZR A;  3QYP A;  5KG3 A;  3PML A;  3R9K A;  3ZDD A;  5ALY A;  4C80 A;  1N56 A;  8ICF A;  4R8U A;  4ECX A;  5ALT A;  4NM2 A;  1N62 A;  5B66 U;  5J2F A;  2Y2K A;  1D9D A;  4TUQ A;  4ZOH C;  5L1L A;  1Z00 A;  4F4Y A;  4MFF A;  4CNQ A;  3UXN A;  3ETL A;  2C2D A;  1ZQH A;  4ECU A;  4MHV A;  1U9L A;  1QTM A;  4FS2 A;  3TQ1 A;  1GXD A;  1LVH A;  1L6N A;  4NLZ A;  2F8L A;  3C21 A;  2XY5 A;  9ICJ A;  5HHI A;  2XIC A;  2LM4 A;  3QZ8 A;  4IQV A;  3PNC A;  1ZQX A;  2EAN A;  3SR6 A;  3NTU A;  5KFV A;  3F53 A;  3GIM A;  1JUD A;  2LYB A;  2AXT U;  4KX3 A;  1KRP A;  3A0B U;  1BPX A;  4GH9 A;  3NRW A;  3NVW A;  2ZJ8 A;  5AI5 A;  3PSI A;  5III A;  5KFD A;  3PY8 A;  2LM1 A;  4JUZ A;  2YY6 A;  4JK1 A;  2UVR A;  2BDP A;  3QU9 A;  2P66 A;  4IBE A;  1BGX T;  3JPT A;  2D6F C;  4IR1 A;  2RQ5 A;  3KHG A;  2Y2L A;  1UPH A;  5KT5 A;  5KG6 A;  3GV5 B;  3EZ5 A;  3H0R B;  1L7P A;  5ALU A;  1IG6 A;  1KFS A;  3OSP A;  1ZQ1 C;  4Z2L A;  2DFL A;  2F44 A;  4DQQ A;  1B4F A;  4O3M A;  2QAR A;  1TAU A;  4OJ5 A;  4ECY A;  4XUS A;  2BCU A;  4P4P A;  2QB1 A;  5JRT A;  1UT5 A;  4NZ1 A;  4F92 B;  5J2G A;  2YMQ A;  2KJ9 A;  2H3Z A;  2AQ0 A;  2EQY A;  1W1P A;  4US8 A;  1S8O A;  2Y2O A;  2ZIV A;  3RFA A;  5KG7 A;  2E1E A;  4RPY A;  4NZ4 A;  5CEH A;  5J0O A;  4OJO A;  4ECR A;  9ICP A;  4PGY A;  1SIJ A;  4BUG A;  1NK5 A;  3D2Q A;  1OXJ A;  2VJ4 A;  4DO9 A;  5AM3 A;  3IHQ B;  1YU3 A;  3SAF A;  4TQR A;  1ZD3 A;  4RU9 A;  3J81 j;  4F3O A;  5J2K A;  2IOF K;  3EPG A;  3AQF A;  2W9C A;  5KFN A;  1GPF A;  3D2N A;  4NY8 A;  3RRH A;  2JH7 A;  5K4L A;  4TUR A;  5KFP A;  3RJE A;  4M6W B;  1KFD A;  1ZQI A;  4B9S A;  4IBJ A;  1QCK A;  3G6X A;  3BQT A;  2JZB B;  4ECZ A;  8ICA A;  2LBO A;  2EAP A;  4IBF A;  4CRX A;  2G06 A;  2BR0 A;  2HMX A;  5T14 A;  2WF8 A;  1F5S A;  4FS1 A;  8ICR A;  2KK0 A;  3SEN A;  4M9N A;  5DB7 A;  2KZ3 A;  5JUM A;  2ODG A;  4RQN A;  4QZ8 A;  2IOU A;  4WJ3 B;  1ZQC A;  4ECW A;  2BQ3 A;  2HW3 A;  2HCF A;  2J6T A;  5DQI A;  1YU2 A;  2OEH A;  3T79 A;  2EH9 A;  7ICE A;  5AI4 A;  1ZQN A;  1PUZ A;  2HHT A;  2R8I A;  4DS5 A;  9ICX A;  1B43 A;  3L26 A;  1ZRN A;  2F3N A;  3FKE A;  4KLE A;  3LWL A;  3MAB A;  4GXJ A;  1LV5 A;  3WKA A;  2E5S A;  2IMW P;  2YTU A;  1NK7 A;  5DGB A;  4IR9 A;  2I1Q A;  3OGU A;  2VA2 A;  5DBA A;  4UB2 A;  2YN4 A;  1ZET A;  4P0Q A;  4TUS A;  2ALZ A;  4KLS A;  3VC8 A;  2KZM A;  1XSP A;  3AL0 B;  3RR7 A;  5KFT A;  1E6N A;  4CE6 A;  2V4Q A;  1JRO A;  3LWM A;  5IIK A;  1A0P A;  3SMV A;  3ZD8 A;  4I2I A;  2L5Y A;  1T3N A;  4IC9 A;  1L5U A;  1X40 A;  2GLE A;  8ICM A;  1NJZ A;  4DLE A;  2AGP A;  3M7P A;  2XY6 A;  5E79 U;  2Y2N A;  1ZQJ A;  5AKI A;  4YD2 A;  1DGJ A;  5KAI U;  2YMM A;  2ATL A;  3UMC A;  3L4P A;  8ICO A;  1NKE A;  5J2C A;  4OJL A;  5J0S A;  4FBT A;  5HP4 A;  2ZXH A;  3RBD A;  4PL2 A;  2K4E A;  3QX7 A;  1RG6 A;  2EAO A;  3IV6 A;  2K4I A;  3V6K A;  1PVP A;  1B22 A;  4DF4 A;  1OGB A;  2W11 A;  4M2Y A;  2BQR A;  1RYS A;  3N4M B;  1QLN A;  1V85 A;  4ECV A;  2CRX A;  4IBB A;  4DSI A;  4QZD A;  2W7O A;  2HOQ A;  2IOF A;  2NO5 A;  3IRU A;  4C7Z A;  5AIB A;  3I28 A;  3G6Y A;  2EZZ A;  2ZIU B;  3WX7 A;  4FZN A;  1U48 A;  2HVI A;  5KFI A;  1W1V A;  4RQ6 A;  3PVX A;  3TAC B;  4DS4 A;  1V9P A;  4AYB C;  4I2G A;  2HBM A;  2XY7 A;  8ICT A;  4OJP A;  2Y2P A;  1ZQU A;  1RPL A;  4QW9 A;  2ZTC A;  1SB3 C;  5DDM A;  3MR6 A;  3Q8M A;  1SKR A;  5BOL A;  4O3S A;  4QIW F;  4JMU A;  4EX6 A;  3WD3 A;  2V5O A;  2KKV A;  1XNS A;  1YU0 A;  3M7D A;  9ICL A;  4FZL A;  5DG9 A;  4X5V A;  2R8G A;  1NK8 A;  2WAQ F;  4B9L A;  3RH4 A;  1TK5 A;  1J2M A;  1P7D A;  5L1J A;  3C5F A;  1TAQ A;  2IA6 A;  3CNH A;  3KHR A;  2ASJ A;  1VLB A;  4G3I A;  4NL9 C;  1ZD5 A;  2QAR B;  3QZ7 A;  7ICN A;  9ICR A;  3RJK A;  5KT6 A;  2OYY A;  1MA7 A;  3EWA A;  1ZQO A;  5EE3 A;  2CXY A;  2BQU A;  5AI0 A;  2OXO A;  2VKQ A;  2MUT A;  3F2C A;  3C1Y A;  1D8B A;  2KV2 A;  4J9N A;  1BVS A;  5IIN A;  4RQ5 A;  3ZDA A;  1XO0 A;  2GOL A;  3AN1 A;  3KD3 A;  3JPO A;  4ELU A;  2D8C A;  5AKE A;  1H0I A;  1S76 D;  4JWN A;  4IJF A;  8ICI A;  2AQ4 A;  2OH2 A;  2WF9 A;  1Q3U A;  4CF3 A;  4DSK A;  4QZE A;  5KT7 A;  2KFZ A;  2P6R A;  2FFF B;  3EPI A;  8ICN A;  2XD5 A;  4KTQ A;  1E88 A;  4AYB F;  4GXI A;  3GV7 B;  4M9J A;  1ZQV A;  1NK6 A;  5IIM A;  8ICQ A;  1L3V A;  4UB5 A;  1NJX A;  3Q8R B;  3QU4 A;  4KLM A;  2W03 A;  1DRG A;  3G6V A;  1CXW A;  1SV4 A;  2KNJ A;  4EYH B;  1PVQ A;  3PX0 A;  5DB6 A;  3CW2 C;  3PST A;  1KEJ A;  1SL0 A;  2OCE A;  3BJY A;  5DB9 A;  1ZQG A;  3GFK B;  3RB4 A;  5ALK A;  3AEV A;  1FFV A;  3PW4 A;  4HMD A;  4UB3 A;  2DKZ A;  3ONN A;  3OTQ A;  4NJ8 A;  1JRP A;  2Y9T A;  2KIC A;  5F9N A;  1O08 A;  1SKW A;  4B9U A;  4DFJ A;  9ICT A;  4NZ5 A;  1ZQW A;  4BXO B;  2PFN A;  5DLG A;  9ICG A;  5DBB A;  2WHE A;  2Y0S F;  4Z6C A;  1ZQT A;  2NRZ A;  4R8U B;  4FE3 A;  2GH1 A;  2KIV A;  4UB4 A;  1L3T A;  3HJE A;  3IG8 A;  8ICZ A;  4O0I A;  2W04 A;  4BDP A;  3TAD A;  1QQ7 A;  2RP5 A;  5KFO A;  4IL6 U;  4Y2X A;  3IN5 A;  3H4B A;  1X66 A;  2ZIU A;  4RQ4 A;  2FI1 A;  4IQU A;  3TAN A;  7ICU A;  5AKX A;  1XU4 A;  4J9P A;  3H8S A;  3PSP A;  1FEZ A;  5CWR A;  1H8P A;  2W9A A;  4Y2V A;  1CEZ A;  1L3S A;  4GXK A;  2E8N A;  3EUB 2;  3NGD A;  4DQP A;  2K8C B;  4ED1 A;  5EE9 A;  3WD1 A;  1RQN A;  1PZN A;  4I29 A;  2FE9 A;  3M8R A;  1CK7 A;  2YML A;  3HP6 A;  4ZH4 A;  4MF8 A;  1TVA A;  3QEB Z;  4DOC A;  2ASL A;  4RQM A;  3M9N B;  2UVV A;  3UPQ A;  4QZG A;  4PHA A;  2Y2J A;  4RUA A;  4BXO A;  8ICC A;  2W55 A;  3SAG A;  1S0O A;  9ICH A;  4B9M A;  4QZI A;  1TFR A;  5J2E A;  1FO4 A;  3TAR A;  4OJ6 A;  4JV2 A;  3L3F X;  3MDC A;  2MAX A;  1TKD A;  1WUD A;  2KFN A;  2H5X A;  3NRZ A;  5CR0 A;  5TZV A;  1J7M A;  4BWJ A;  4YR2 A;  3RB6 A;  1U45 A;  4M47 A;  1TK0 A;  3HON A;  4F4X A;  3RF9 A;  3H8M A;  4NXZ A;  2GWS A;  4IBI A;  1Q46 A;  3H0L B;  3BQ0 A;  4HME A;  4O5E A;  3N3F A;  2A19 A;  3AQE A;  2EAM A;  5HHH A;  1JI7 A;  1ZOL A;  2ASD A;  4C8K A;  5KG2 A;  5J2A A;  2A3V A;  2ESE A;  4IRK A;  4NWI A;  9ICO A;  4HMC A;  3QNM A;  4KLD A;  1DK3 A;  3UQ0 A;  4Z2I A;  4MB4 A;  4P2H A;  1DGS A;  1CUK A;  2EDU A;  5AKY A;  4UAY A;  1EXN A;  3PX4 A;  2HI0 A;  5HML A;  4NLK A;  7ICV A;  2B6G A;  1TK8 A;  3QUQ A;  2I5H A;  1PK1 B;  1U49 A;  2Y2G A;  3TAP A;  2F77 X;  3UMG A;  3KZI U;  2GO7 A;  3GQC A;  3RH6 A;  2FN2 A;  5JU5 A;  3LVV A;  5AK6 A;  1NZB A;  2BCR A;  4YXM A;  1ZQD A;  4F5R A;  9ICN A;  1AIW A;  1ZQF A;  2F2A B;  3ALR A;  4I2B A;  5J0W A;  4LVS A;  2C22 A;  2CN1 A;  4RT2 A;  3QUC A;  4DL3 A;  1URJ A;  1S0V A;  1QQ5 A;  1COO A;  3BQ1 A;  4GC7 A;  4Y2S A;  1J97 A;  8ICE A;  5C0Y A;  3IP4 B;  3B0X A;  2NRT A;  4YMN A;  4NYU A;  4RNO A;  4I28 A;  1E15 A;  9ICM A;  5KFB A;  1LKY B;  2PI4 A;  1KBU A;  4DCC A;  3SYZ A;  1XWL A;  4KLU A;  7ICP A;  3TFR A;  5ALJ A;  1V97 A;  4BGD A;  1UA1 A;  3MBY A;  2ISO A;  4UAW A;  1T94 A;  7ICL A;  5ALG A;  5CHG A;  1KS0 A;  2K4P A;  9ICI A;  4UB6 U;  3NAS A;  2N1R A;  1DK2 A;  4A8E A;  4DOA A;  1T7P A;  2VAN A;  2KEY A;  2I9G A;  5J0T A;  1L7M A;  4EBE A;  1SXE A;  1QO6 A;  3K75 D;  4NYY A;  3L2A A;  2M9N A;  7ICT A;  2R8K A;  5BPC A;  5EWE A;  2FPL A;  1ED7 A;  1LKY A;  5AM4 A;  3L28 A;  5DG8 A;  2KKP A;  5IIL A;  5GTH U;  4ED0 A;  4YVZ A;  4GIB A;  2FMQ A;  2OHF A;  1ZQA A;  2K8A A;  1RYR A;  2A1A A;  3SV4 A;  1MC8 A;  4MFC A;  4O3P A;  4F4W A;  1DOQ A;  1ZJN A;  4F50 A;  1N48 A;  5DDY A;  2Y1I A;  3M6Z A;  3C2M A;  5DGA A;  1QH9 A;  2W9B B;  3JPN A;  5ALV A;  1IXR A;  1KLN A;  3QUT A;  1DXS A;  1JXE A;  1WWV A;  3V6H A;  4ELV A;  2EZY A;  2KHV A;  2Y1J A;  3BQ2 A;  4J9K A;  5JTI A;  5KFZ A;  4QWB A;  2DWQ A;  1TAM A;  4C8M A;  1RM6 C;  4KN4 A;  2HBL A;  4Q44 A;  1PDC A;  3SQI A;  3RJJ A;  4TX8 A;  4UAR A;  5KFQ A;  2HVH A;  1CRX A;  3E2E A;  1N60 A;  2JRZ A;  2W43 A;  1Z1B A;  1SWW A;  2R18 A;  4F72 A;  3PW7 A;  3GIL A;  2PFQ A;  1GOI A;  7ICM A;  4IBK A;  1L8O A;  2K4H A;  1ZRM A;  1ZQM A;  5EWG A;  5AI6 A;  2D49 A;  2DPJ A;  2XID A;  2F1I A;  4QZH A;  4UAT A;  2W8L A;  4OUI A;  2XGQ A;  4CCH A;  1QSY A;  3LYS A;  4I2J A;  8ICL A;  7ICI A;  1JIH A;  5IIJ A;  2RDI A;  3WU2 U;  4ACO A;  1Z4O A;  4KLT A;  1T8E A;  4HAI A;  1SL1 A;  4XRH A;  1W1T A;  4F5O A;  2FLL A;  2E8M A;  4EEY A;  3C5G A;  3PR5 B;  3O0F A;  4C4T A;  4FFD A;  4EEL A;  4QZC A;  3L25 A;  3MGH A;  4LJX A;  2HOF A;  5J0Y A;  4NLG A;  2B0C A;  1NKC A;  2P6U A;  1M6Y A;  2WB1 F;  1K5O A;  4DSE A;  4NV0 A;  1D9F A;  4I2H A;  2Y0S C;  5DLF A;  5KT2 A;  4PH5 A;  1Q8K A;  3V6J A;  2NRV A;  2HHU A;  4EBC A;  4Y2Y A;  1CI4 A;  1N63 A;  5KFE A;  4DL4 A;  3F5E A;  3IM1 A;  3PO4 A;  2LKY A;  2IOH A;  3L5K A;  2MA1 A;  3KHH A;  2Q0Z X;  3C23 A;  4UQG A;  1HJP A;  3L27 A;  1T3Q A;  2AHO B;  4E0D A;  1BNP A;  5AKG A;  2NRX A;  1QSL A;  4QZB A;  4M9H A;  2K60 A;  4QWA A;  2G5H B;  5KFY A;  3WKC A;  4MB5 A;  2LMR A;  1S0N A;  1ZQL A;  2E3T A;  1OW5 A;  4BX9 C;  2JCH A;  4Z2G A;  2BGW A;  1Z19 A;  3NS1 A;  4J9O A;  8ICX A;  4GLX A;  4YCX A;  4KLH A;  5AK5 A;  1NK9 A;  3C1Z A;  5J2H A;  4U7C A;  4KLO A;  1WG8 A;  3FM9 A;  2YX8 A;  4DFD A;  4DSF A;  3RJF A;  3RJG A;  1VJ5 A;  2NV3 A;  4J9L A;  3UQ2 A;  3WKE A;  4I2C A;  1K1Q A;  5HR6 A;  4UAS A;  4KMO B;  5ALH A;  2KZZ A;  4F8R A;  5AM5 A;  9ICK A;  3PW2 A;  5ALM A;  5KFU A;  2XCA A;  3ZDC A;  4M04 A;  4DL2 A;  4EEN A;  4UW9 A;  4QIW C;  4NLB A;  2ZIW A;  3HX0 A;  2A1J B;  1UR8 A;  4ED3 A;  3MDA A;  2E1F A;  3PW5 A;  5ALX A;  4DF8 A;  1NNL A;  4EX7 A;  5HNK A;  1E8B A;  1N5X A;  2O6K A;  4DL5 A;  5AK3 A;  3MR5 A;  2B21 A;  2ZXI A;  4KLI A;  5AKZ A;  5KT4 A;  2C2E A;  1RZT A;  2RTS A;  2QB0 A;  4MEY A;  2ZTD A;  1HUZ A;  2G09 A;  3AUO A;  3M6K A;  1XO1 A;  1ZQE A;  4F5P A;  1XC9 A;  5KFA A;  1A6S A;  2V4R A;  3N7P D;  2VIX A;  1XSL A;  3SAH A;  3SV3 A;  4PHP A;  2XI9 A;  4F5Q A;  2Q4T A;  3BS5 B;  1SWV A;  1RDF A;  3TFS A;  2PMZ F;  4PGX A;  5AKJ A;  1VDV A;  4YQW A;  4R66 A;  1L8L A;  4DSL A;  5DKW A;  5ALS A;  1NK4 A;  2Y2M A;  1ED1 A;  2OM6 A;  1S97 A;  4YD1 A;  4O5K A;  5KFW A;  4O3O A;  4IQT A;  5HMM A;  3OHB A;  1ZXI A;  2JEG A;  4I2D A;  3FAH A;  2ISP A;  3QXG A;  4LZG A;  1F0M A;  3I1Y A;  2WB1 C;  1WWU A;  2KE7 A;  2WF5 A;  3RJI A;  1X42 A;  3PV8 A;  3HPO A;  4DQS A;  1BPD A;  1J2N A;  3NVZ A;  2YB4 A;  3OSN A;  2HBK A;  3K1Z A;  2XVT A;  5ALO A;  3D2S A;  2KJ5 A;  4YMO A;  2KSO A;  1L7O A;  4Y2P A;  3GV8 B;  3KKA A;  4CF5 A;  4KLQ A;  2FPK A;  5KFM A;  3NUQ A;  2RRD A;  3CYM A;  3S6J A;  5KFX A;  4PHD A;  8ICJ A;  3HT3 A;  9ICA A;  2LHT A;  5G5H A;  2UWX A;  4M9G A;  2ZJ5 A;  1LB2 B;  1KDH A;  1V38 A;  4J03 A;  2DPI A;  1JMS A;  5L9X A;  4PL1 A;  2NYV A;  4RNM A;  2Z7J A;  1S9F A;  4U6P A;  3RRG A;  4IQW A;  2AGQ A;  2DL0 A;  2K8B B;  2W3S A;  1ZQZ A;  4O9M A;  4Z2J A;  2BCV A;  4MFA A;  2LI6 A;  3F2B A;  4EEK A;  2DBY A;  2HHV A;  2XC9 A;  3ISD A;  2PFP A;  4QNL A;  4ED6 A;  1YT3 A;  5J8Y C;  4Z6F A; 
#chains in the Genus database with same CATH homology
 3E0F A;  2HMX A;  3GZF A;  1PVP A;  3HSH A;  3KS8 A;  2PMZ F;  2H3Q A;  2KV2 A;  5T14 A;  2PMZ C;  3PSP A;  2Y2G A;  2ZIW B;  2ZG6 A;  1XO0 A;  2GOL A;  2F77 X;  4C0Z A;  1YU4 A;  2Y2M A;  4CDG A;  4IBE A;  1ED1 A;  2G5H B;  2D6F C;  5A0L A;  3MGV A;  2OM6 A;  2M0N A;  3LVV A;  1NZB A;  2KHV A;  2JMG A;  2ZIX B;  3N7R C;  2K8C B;  2CRX A;  4IBB A;  1OUQ A;  3IG5 A;  5KL8 B;  4IJF A;  2W7O A;  2HBJ A;  2HOQ A;  2IOU A;  4WJ3 B;  2F2A B;  2OH2 A;  2Y2L A;  2DQN B;  3ALR A;  1UPH A;  1TAM A;  4IJE A;  1Q3U A;  1HEK A;  2LYA A;  4BX9 C;  4QJF B;  2HBL A;  2WB1 C;  2JCH A;  3H0R B;  2CN1 A;  5HR7 A;  4GHA A;  3SQI A;  1URJ A;  1IIP A;  1Z19 A;  1ZQ1 C;  1YU2 A;  2JE5 A;  3T79 A;  2ZIU B;  1CRX A;  1Z1B A;  3WX7 A;  2R18 A;  4FZN A;  1YUE A;  2FFF B;  2XD5 A;  2RHF A;  1YU1 A;  2G0A A;  2G08 A;  2YB4 A;  3LVW A;  4P0P A;  4AYB F;  4GHL A;  5C0Y A;  4IBK A;  2K4H A;  4U7C A;  4NY2 A;  3PZP A;  2HBK A;  2MRL A;  3IP4 B;  3K1Z A;  2XVT A;  4O3M A;  2KVC A;  2Y2J A;  4AYB C;  4NYU A;  2HBM A;  2HOI A;  2YX8 A;  3D2S A;  3FKE A;  3L26 A;  2NV3 A;  4OJ5 A;  4GFJ A;  3SAG A;  2H3F A;  2XID A;  4OJP A;  4P0P B;  2KJ5 A;  2Y2P A;  2DF4 B;  3C29 A;  2Y2K A;  4LG2 A;  2WAQ C;  5HR6 A;  4KX5 A;  2W7P A;  3CRX A;  1KBU A;  2CPR A;  3VC8 A;  4OUI A;  2W03 A;  4FZM A;  4KMO B;  2E5S A;  1DRG A;  4IBC A;  4NZ1 A;  2KNJ A;  3LYS A;  1PVQ A;  2KJ9 A;  3OPX A;  2H3Z A;  3H0M B;  3NUQ A;  4ICA A;  2Y2I A;  2KIW A;  2RRD A;  3CYM A;  3PST A;  1F44 A;  4OJ6 A;  2F76 X;  1T94 A;  4ACO A;  3DEE A;  3L3F X;  4P0Q A;  4QIW C;  2BG1 A;  2KOB A;  2Y2O A;  4NLB A;  1WUD A;  2ZIV A;  3HKZ F;  2ZIW A;  3PSF A;  4JMU A;  4QIW F;  3RFA A;  2E1E A;  2N1R A;  3KFU F;  2LHT A;  3AL0 B;  2UWX A;  4NZ4 A;  4OJO A;  2H3I A;  4A8E A;  2E1F A;  2KJ8 A;  4BUG A;  2KEY A;  2KHQ A;  2K89 A;  3D2Q A;  2KKV A;  3ONN A;  1A0P A;  3SMV A;  2VJ4 A;  1XNS A;  2DGZ A;  1YU0 A;  3M7D A;  1YU3 A;  4FZL A;  3O0F A;  3SAF A;  2Y2H A;  2ZIV B;  4NYY A;  4IC9 A;  1GO3 F;  3KZX A;  1L6N A;  3HON A;  3KS4 A;  2WAQ F;  3L2A A;  4PL1 A;  2ZIX A;  2KD1 A;  2G5I B;  2F8L A;  1HIW A;  2KIC A;  2Z7J A;  3N7S C;  3RF9 A;  2XD1 A;  4U6P A;  4IBI A;  3L25 A;  1P7D A;  3AQF A;  2HOF A;  4OO1 J;  3L29 A;  3H0L B;  2ZXI A;  3L28 A;  4NZ5 A;  4BJQ A;  2WB1 F;  3D2N A;  2KKP A;  1Q3V A;  3N3F A;  2JH7 A;  3AQE A;  4NV0 A;  5BPV A;  2XIC A;  2Y0S C;  2K8B B;  3ICX A;  3C28 A;  2Y2N A;  2Y0S F;  2YB1 A;  4NLC A;  2K8A A;  4IBD A;  4NZ3 A;  3CP8 A;  2JGA A;  4P0Q B;  1SZH A;  4FE3 A;  3HKZ C;  2Y2Q A;  2G07 A;  2G09 A;  2GH1 A;  4CGZ A;  3M6K A;  5CRX A;  2A3V A;  1ECW A;  3F2B A;  4IBJ A;  3IG8 A;  4NWI A;  3F2D A;  3F53 A;  4OJL A;  2W04 A;  3VCB A;  5KL1 B;  2LYB A;  3F5E A;  1A6S A;  4KX3 A;  2ZXH A;  1PVR A;  2LKY A;  2JHD A;  2OYY A;  2VJ5 A;  1MA7 A;  2RP5 A;  3N7P D;  2MA1 A;  4PL2 A;  2K4E A;  2VIX A;  2LBO A;  3SAH A;  3IN5 A;  3F5A A;  2ZIU A;  2JH1 A;  3NRW A;  4QNL A;  4GH9 A;  2H3V A;  3L27 A;  2OXO A;  2VKQ A;  3GU3 A;  3F2C A;  2XI9 A;  3PSI A;  4IBG A;  3M6Z A;  4IBF A;  1YT3 A;  2K4I A;  2Q4T A;  4CRX A;  1D8B A;  2BDU A;  2G06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...