4QNLA

Crystal structure of tail fiber protein gp63.1 from e. coli phage g7c
Total Genus 244
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
244
sequence length
847
structure length
847
Chain Sequence
b'TGILTNKQAIARHFGVKQSEVVYFSVGAVLSGYKVIYDKGTQRAYSLPANIGSGVTAISLSPAGVLVHSAGSVDLGALAVTRKEYVTLPDTFTSGSVIQTKNELLTHNGTQYRWAGGLPKSVPLNSTPVSAGGISPTAWVIANDELIRQELNNGLIPPVGSTSVYDVPGIVVNTTTDNRAAAYAFPGKIFIPNGVTIRCNLLPDDDVRKFVGEGKLIVKNQWYAKDHTFDIAASMNGNNKTVNDEIYCAFRDQTFCRIGIIGDSITDGAWGKQDWSSPPTNSDGDLDAPSTYNHSLSGGSHSWTEHWMNGLLLTQSRRSGETIYQSANCSVSGKKLSDGWGYRNFDRGFFGNTRYGAEAPRVCILAMGWNDSSASIATYRDQIDKFVRKAWGYGCAVGIVTVNDNDSVRMAFELSTKKYMADKLGVEYFNLGPNLTSASSRNEQTGYYYYVKKDGTWDTTHPQELGQMAMGNAMYMQTLGNKYCRRVRPGDMLTQAAVENYWDCVGYPSGTHYAPQYVPVSGAPALNVFRFLSKCVTNENVTMTTMVWCEEEGMTVSLLEPWTNAAVVGQSHNIRVESPVGKALFESGEYQERNTQINAYRTVLNGKTAMSYFGGGKTLTTYMGRLRKGLNFIRYIIDGSPTDAYFPMLKFGSYKTDGVKLPMVRLSKEPNMTRPAPVMKQSNANDYGVFGEVLSGTQFSKTADSHLYNGASVGYLAVPRGLKKNTYIALNYNPLTNVGVLVGVNAAGNMCIGTFNNANPTDWVVFGDTTREDKGFKVWEYTSSSTGAHTFTVESDDGTATTSAFSTTVATSGYVGLYNPSASSQLFTLEYSMTIGNVGLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail fiber protein
molecule tags Hydrolase
source organism Escherichia phage vb_ecop_g7c
publication title Function of bacteriophage G7C esterase tailspike in host cell adsorption.
pubmed doi rcsb
total genus 244
structure length 847
sequence length 847
ec nomenclature
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18668 Tail_spike_N Tail spike TSP1/Gp66 receptor binding N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.800 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4qnlA01
2.10.10.80 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 4qnlA02
4OJOA 4OJLA 4OJPA 4QNLA 4OJ5A 4OJ6A
chains in the Genus database with same CATH superfamily
5CR0A 1JXLA 3K75D 5J2GA 3RJGA 5KFUA 3KS8A 1COOA 3JPPA 3M6KA 5CWRA 1ZD5A 4RQ2A 1TAUA 5KFBA 4YD1A 1V9PA 3L4PA 3EWAA 4RQ3A 5HMMA 1HJPA 1L3UA 1D8LA 4GC7A 1H0IA 5ALGA 2XIDA 2HHWA 3NVWA 4C0ZA 4DFKA 2JEGA 4YCXA 4EENA 5L1MA 1S10A 5J2JA 4IBDA 5ALOA 2E8PA 1TVAA 5HMLA 1FO4A 2HBLA 2UWXA 3SENA 5AICA 4Y2XA 5J8YC 4Y2TA 4YR2A 4DS4A 1WWUA 2KTQA 4UB5A 2Z7JA 2G0AA 5AI0A 3PSIA 1NZPA 3WD2A 1X9WA 5DG9A 2WFAA 1DGSA 4EZ9A 1ED7A 1W1PA 3HT3A 3UMGA 2W9AA 1YU0A 2OXOA 4P2HA 5ALKA 2JV3A 4DOCA 5AM0A 4USAA 5J2FA 3BDPA 5HR6A 2KJ9A 2H3VA 1FIQA 8ICYA 1GPFA 4EX7A 4M0AA 3TFSA 2B6GA 1SV4A 1ZD2P 1ED1A 4F4WA 3Q8MA 1S76D 2EANA 5EWGA 1TK8A 2FDRA 4YR0A 4QZGA 1JALA 2FPKA 2H3ZA 2VA3A 4Y2PA 4DFDA 1N2XA 5KT5A 3GFKB 2YN4A 1KFDA 5J2AA 1SXEA 5J2EA 3TAQA 4QJFB 4RPZA 2BQ3A 1QSYA 7ICIA 2KVSA 4IRKA 1NJXA 5KL1B 3OHAA 2UVVA 1AROP 4BX9C 1L3SA 2ASLA 7ICMA 2JGAA 4R8UA 3BS5A 2M9NA 5AKKA 4OJOA 3G6VA 8ICWA 4M9NA 1PK1A 3KKAC 2KN7A 4C80A 1KW4A 4CF4A 1JIHA 2P35A 3VC8A 9ICMA 4QZAA 1UR8A 1UPHA 5DBBA 3RB3A 1SKSA 4C8NA 1S9FA 3RRHA 5L1IA 5ALNA 1UCVA 3KFUF 3H40A 2W54A 4IQVA 2Q4TA 1E6ZA 2LM4A 4KLTA 4AP9A 4J03A 5DQGA 4GXIA 4ECQA 4O3MA 4NLNA 1NOMA 3DV9A 2MSNA 3S6JA 2IHNA 5BOMA 2AGOA 1ZQPA 1N62A 8ICOA 1Z3EB 2G09A 3RH4A 2K8BB 2IBKA 3MFHA 1F5SA 1ZQIA 2A1JA 5HP4A 1IIPA 2PMZF 2C2EA 4B9NA 1MA7A 4R63A 3WKEA 1EXNA 2BCVA 3WKAA 5KAFU 2WF6A 8ICUA 5AKEA 1AQ6A 2E8OA 1F44A 2A19A 1J7MA 3RJEA 4DQQA 3N97B 8ICEA 3RFAA 1M6YA 2KKVA 2W3RA 3N3FA 1YZ6A 1MQ3A 1NJYA 2KZ3A 3TI0A 4ELUA 3D2SA 1YU2A 4O5EA 2W8KA 3M9OB 3UXOA 2LYBA 4NM2A 2ZIWB 3TADA 4FS1A 3PR4A 3AU6A 3SAFA 2F3NA 4IC9A 3OTQA 4I2EA 4K4HA 3OHBA 9ICUA 2MUTA 4UB3A 2BQUA 1K5OA 2HBJA 9ICXA 4UARA 4C8KA 7ICQA 1RYUA 5KFIA 3D2NA 2I9GA 3PSPA 3NVVA 3UPQA 3PMLA 2UVWA 9ICCA 1S5LU 4BGDA 3TAPA 3E0FA 2IOFK 3KHHA 2PI5A 3KD3A 4QWBA 3FYHA 4DQSA 4F4YA 2YQEA 3MGVA 5ALRA 3I28A 5KTQA 3M7DA 4EBEA 2BR0A 2B21A 4P4PA 4ELVA 4YMNA 4F4KA 4GXKA 3ISDA 3PW5A 3T5KA 5ALIA 2Y2MA 4KMOB 5L1KA 1WYGA 1CRXA 2F8KA 4PH5A 4Y2YA 1XU4A 2DUYA 4UB2A 3WK8A 1PVQA 4IBGA 1HUOA 1ZQOA 2MUTB 1BGXT 3PX4A 3AMZA 3AEVA 3WX7A 5J2DA 3ZD9A 4KLGA 1RYRA 4Q43A 1X66A 4ZOHC 4DL2A 4OD0A 2D8CA 3JPTA 2UVUA 5IIJA 3WD0A 2G08A 3WK6A 2JXJA 4QZBA 2D3DA 4IR9A 2RP5A 3C5FA 2C2DA 2Q0ZX 1SIJA 2B0CA 4P0QA 3L5KA 2KV2A 1N56A 1MC8A 4I2CA 5DG8A 1YU1A 5AK5A 1O08A 5AIBA 4PZOA 1SZPA 2FI1A 4F5RA 5TISU 1ZQMA 4LZDA 2QB0B 2HHXA 2KZMA 2XCPA 1NK6A 4EX6A 2K4HA 4HMDA 7ICEA 1Z00A 3F5EA 3QNMA 5AHXA 1BNPA 5DGBA 2RLTA 4RQMA 9ICNA 7ICRA 3PSFA 4OCZA 4KLFA 3GIJA 8ICFA 2Y2IA 2HI0A 4Z2JA 4EZ6A 4PL2A 4R65A 1TE2A 4Q8FA 4JB3A 2FN2A 1ECWA 2E3TA 3RJKA 2HHQA 1Y88A 2EAPA 1SWVA 4RU9A 4EEYA 3NVYA 4MF8A 2ASDA 3OJUA 2GOLA 4IBCA 3K4GA 2HHVA 1DXSA 2FE9A 4DOAA 1SV0C 2FPLA 3FAHA 2F44A 3QUQA 3OJSA 4EEKA 4IRCA 3RJHA 4NLCA 1W1VA 4UAZA 4R8UB 3GIIA 1ZQGA 2F2AB 2FJ6A 2Y2PA 3MBYA 8ICZA 3L27A 4UBBA 3I76A 3QU2A 1D8BA 1N5WA 2KE7A 5KFTA 5KFPA 2FMQA 3PR5B 2W7OA 4ED2A 1Z4NA 4NLKA 3MC1A 3ETRA 3LWMA 2XVTA 5KG4A 4KX5A 3B9JA 1N63A 5KT3A 3UMCA 2DFLA 4C8OA 4AYBC 4P0PB 4E0DA 3H8SA 1L5UA 2DBYA 2H3FA 2CPRA 2JRZA 1RM6C 4QW8A 2Y2HA 3PV8A 2ZUBA 5DG7A 3T5JA 2OYYA 1S0OA 2DGZA 2KHVA 3QUTA 1T94A 1ZRNA 4MFCA 3WKBA 3T79A 5J0WA 2JHDA 5KG6A 3B0YA 4PPXA 4MF2A 3PW0A 3HWTA 3N7RC 2JCHA 5AM5A 5AIAA 4QWEA 3EPIA 4RUCA 4PL1A 4J9SA 1GO3F 4RQ0A 4ED7A 1T4GA 4MB3A 1XSNA 3PZPA 1QCKA 2KG5A 2KP7A 2O6KA 3IDWA 2DQNB 2V9WA 3SAHA 1FEZA 3M8SA 2WF5A 1X9XA 3KBBA 1N61A 3JPNA 3KOOA 1Z1VA 2YMQA 9ICFA 4C7YA 4KLMA 1AIWA 4UAYA 4FZLA 2K4EA 3UMBA 2XD1A 1D8YA 5KFOA 4YN4A 8ICLA 2ZTDA 3BS7A 2Y1IA 3QYPA 4O9MA 4O3NA 2HBMA 2Y9TA 4B6JA 4QIWF 4NY8A 5J0YA 2KVCA 2KKPA 4I2HA 2VA2A 4IBBA 4NY2A 5FP0A 5L9XA 1A76A 4I2JA 4M9HA 4HYKA 1WCLA 5CA7A 4XQ8A 1XNSA 4F4XA 9ICRA 1C20A 4Q8EA 5KFVA 3GDXA 3D6JA 2WF9A 7ICGA 4Y2QA 3PY8A 3IM1A 3KZXA 4BWMA 4KLHA 2Y2JA 2HOQA 4AYBF 1ZD4A 1KKXA 3MR2A 2ZJ8A 1K1SA 3IRUA 1XO1A 2R18A 5ALVA 9ICIA 1U49A 2UVRA 3KTQA 4FS2A 5JRTA 3O0FA 4MB5A 3AL0B 5ALPA 3C1YA 3MGHA 4NZ3A 7ICNA 4NLZA 1KTQA 1LV5A 1NK7A 2ZIUB 2W9BB 3RTVA 1X42A 5EWEA 3WU2U 3GV8B 4GC6A 4RPYA 1H0GA 3T5LA 3F2DA 3RR8A 4DSLA 3C1ZA 4PGYA 1L7NA 1L3VA 5EOZA 5EWFA 4ED8A 4YG2A 2XY5A 5D49A 1NK0A 4B9UA 1PDCA 3GQCA 4BDPA 1KS0A 2IHMA 1OW5A 3E58A 4F71A 4F4ZA 3AN1A 4O5CA 5ALYA 2FMSA 2JEJA 4IR1A 1SWWA 3GU3A 1U48A 2CRXA 4GLXA 1NK4A 1XWLA 3V7JA 1BPEA 2ES6A 3UXNA 1LVHA 3L25A 4DLGA 5AKLA 5KFSA 1UHUA 4QZIA 2ISOA 3HKZC 3KZIU 4XA5A 3SV3A 1ZQQA 3V6JA 4KLIA 5L1JA 3C5GA 2D6FC 2ZIVB 3JPQA 3F2CA 2WB1C 3GV5B 2PFNA 5KG5A 4UATA 3WD4A 2R8IA 4RZRA 5F9LA 3SR6A 5JUMA 5DQHA 4OJ6A 1X40A 2ZIWA 2Y2OA 1DRGA 2H3QA 2Y2GA 4P4OA 8ICMA 4PGQA 3B0XA 1RDFA 8ICVA 4B9VA 1TK5A 1IXRA 2KICA 2ZIXA 7ICTA 4Y2SA 3RB4A 3EZ5A 4PHDA 5AKGA 1E88A 2E5SA 1TKDA 1N60A 1L7PA 5J8YA 4NXZA 8ICNA 4NV0A 1J2NA 5AKHA 3Q8QB 4NL9C 5KL8B 2BPCA 5H2FU 1WWVA 4UASA 1CK7A 7ICHA 8ICRA 8ICGA 4RNNA 2HDOA 1Z4OA 1ZQWA 1JN3A 4IS7A 3GIMA 7ICOA 8ICSA 2EAMA 1OGBA 3FC4A 4CDGA 3MR5A 4RQ4A 5KFRA 3QZ7A 4Z6DA 3SI8A 4M9JA 3RB6A 3GILA 2YMPA 1OUQA 4MFFA 5KT4A 5DDMA 1W1YA 1HIWA 3BQTA 2AU0A 3JPOA 5JTIA 1TK0A 4I2AA 2M0NA 2WF7A 4M6WA 3H4DA 4J9PA 1ZJNA 4US9A 1JRPA 5IIIA 1S8OA 1K1QA 4I2FA 1U9LA 4IBIA 3QU9A 2GH1A 5KFKA 3CRXA 5DBAA 1SZHA 3EYZA 3NVZA 2ZIVA 1UT8A 8ICPA 1YU4A 1RZTA 1MSWD 4DF8A 1XC9A 4O3PA 4KMUA 1J2MA 2PFOA 1SL0A 2P6RA 3LK9A 4F5OA 4DOBA 2DWQA 2DL0A 5KG2A 1EAKA 4ECRA 5AK4A 2DKXA 2OWOA 3WKCA 1RYSA 3RAXA 5J0OA 3BZCA 2BDPA 4F72A 3PX6A 3QEBZ 4DF4A 4NLGA 2W9CA 2V5OA 3C28A 1S0NA 2HVIA 4GHAA 3SAGA 4KLEA 4Z6EA 2DPIA 5GTHU 4ECSA 3CYMA 3N7SC 3UQ0A 4X5VA 2BQRA 4NM1A 1L8OA 2F1HA 3IHQB 3RJIA 2KIWA 1ZQNA 5B66U 4YP3A 5AK6A 3D2QA 5KFXA 4CGZA 5CEHA 2WHEA 1PVRA 1YT3A 2NRWA 1GOIA 3V6KA 4Q45A 2I5HA 2JH7A 3HX0A 3H7IA 3HILA 1UA0A 3BS5B 3UM9A 9ICPA 3HRDD 2VA8A 1E15A 4RT2A 1X6JA 4PGXA 1UR9A 3NASA 4FE3A 2ZTEA 1CXWA 3DEEA 2Y0SF 9ICTA 2FLNA 1WUDA 5KFFA 1L7MA 1MQ2A 4F3OA 3N4MB 2K89A 1ZQEA 4Y2VA 1Z19A 5DB7A 5ALUA 4OUIA 1NI3A 5ALDA 3RR7A 2ZJ5A 4TUPA 3EUB2 4MEXA 1B4FA 4J9NA 4DQRA 2FFFB 3C23A 3LDAA 5KT7A 4QZDA 3SEIA 5C0YA 2D49A 3H0MB 5KFLA 3PO4A 4RQNA 2OHFA 4MFAA 5JU5A 5TZVA 2OCEA 3KHGA 4Z2IA 2RHFA 3THVA 3IV6A 1FFVA 7ICVA 4DL3A 5KFGA 2XCAA 4Z2LA 4NLBA 1KL9A 5J0XA 2IOUA 5CP2A 3SQIA 4KTQA 7ICLA 2A3VA 4R64A 2QB1A 4O3SA 3ISBA 2BZFA 2E1EA 5ALZA 3IG8A 2MA1A 1ZQLA 1A0PA 2F1IA 1ZQZA 1Q3VA 2G5HB 1ZJMA 1YUEA 1DOQA 5EE0A 2FPMA 3GV7B 4M47A 2LHTA 5AKJA 2W8LA 1GXDA 3ORYA 4DSIA 2KOBA 2YTUA 2H5XA 5KNIA 4Z2GA 2AQ4A 3KKAA 2H3IA 3CW2C 4ECXA 2N1RA 1Q46A 5KFQA 1KRPA 1QQ5A 4RT3A 4NYYA 2JR5A 3EPGA 1RXVA 3RBEA 5F3XB 2JEFA 5K4LA 1OXJA 3WD3A 4DQPA 2AGPA 3SD7A 1ZQCA 4MHVA 2JEIA 4KN7A 4U7CA 1IG6A 3NRZA 4Q44A 4QNLA 3TANA 2NV3A 1X2IA 2QKQA 1X9SA 1PUZA 5J2IA 3N28A 4FO6A 2ZIUA 2EH9A 4O3RA 3QE9Y 1SXDA 1L6JA 1KBUA 3T5HA 5CHGA 2G5IB 1NJWA 1D9FA 3V6HA 1L8LA 3R9KA 4IBFA 1RQLA 1ZQKA 2EDUA 4Z6FA 3BJYA 1KSPA 3FDSA 2AJQA 4J9MA 2WAQC 2DKZA 2MRLA 5IINA 4NYUA 5ALMA 2C28A 1CUKA 2RDJA 2VIXA 2J6SA 8ICJA 3DDHA 3AQEA 3H8WA 1NZBA 4G9BA 2EZZA 5DB6A 2YB4A 4GH9A 4F92B 2RTSA 4IQUA 1W1TA 4K4GA 4QWCA 1ZOLA 2QARA 5T14A 2PFPA 1O6IA 4ECVA 2FLLA 1KFTA 3C2MA 3F5AA 9ICLA 5KT2A 3NGDA 5J0UA 3MDCA 5IILA 1TFRA 2A1AA 3AQFA 2YX8A 1B22A 1YZ7A 3ONNA 4JV1A 1UT5A 1SV0A 2ZTCA 2F76X 3LYSA 4UB1A 4IRDA 3L29A 3ISCA 2R8JA 2HHTA 1L3TA 5DDYA 3ZDBA 4I2GA 9ICOA 1ZQXA 4O0IA 2ODGA 5ALXA 2AHOB 2HMXA 5AKXA 1O03A 3NS1A 1F0MA 2KZZA 3MABA 4BXOA 2XD5A 1NKEA 8ICAA 1VDVA 2K4PA 2Y0SC 2LM1A 5KFEA 3NUQA 3IG5A 3QUBA 7ICPA 2HHSA 3F53A 2KSOB 4YR3A 2F77X 2C22A 4ECWA 4K4IA 3L28A 1ZQFA 3L2AA 3WK9A 1WCNA 2PI4A 3FM9A 3M1YA 5AI5A 4YXMA 5DB9A 3V72A 2JZBA 2NRVA 3K1ZA 4BUGA 5KG7A 4UB4A 4OJPA 4QZ9A 4EBCA 2YB1A 5KG1A 4YD2A 1ZQJA 3BQ1A 1V85A 4HMEA 4NZ4A 3ALRA 2WF8A 3M7PA 5KFMA 1BPZA 1QQ7A 5AM2A 2ZJAA 4B9LA 4EYIB 1ZQBA 5HR7A 1JXEA 3G6YA 4M6WB 4KLOA 1A77A 2ESEA 4DSEA 4DCCA 2RQ5A 5KG0A 2W04A 3WKDA 4G3IA 1ZQ1C 1Q8KA 5KFCA 2R8HA 4YMOA 1V97A 4MEYA 2MU2A 2ISPA 7ICKA 2KEYA 4NZ5A 1DK2A 3JPRA 2R8GA 4DFJA 4C8LA 2IMWP 5KT6A 3JPSA 3ETLA 5KFHA 2OEHA 2K60A 9ICHA 2ASJA 3TQ1A 1KDHA 2LMRA 4KLJA 5AKIA 5IIKA 2ZXHA 2V4RA 5ALEA 3HP6A 4GXJA 2NO4A 4RNMA 3H0LB 3TADC 4UQGA 2K8AA 2KFZA 1SB3C 4F2RA 1HEKA 1LB2B 4IJEA 4ICAA 4UB8U 5DB8A 1E6NA 1BPXA 1NJZA 4RQ7A 3ZDCA 4JV2A 3IN5A 1DK3A 2E8MA 3RH6A 3M8RA 4B9MA 1QTMA 1J97A 2Y2KA 2HBKA 5HNKA 5B5EU 2WAQF 4DFPA 2V4QA 3ZI4A 4EBDA 1T7PA 5AKYA 4WJ3B 4TQRA 2HOFA 4YQWA 1NKBA 4LZGA 2EZXA 4PZNA 2KJ8A 9ICSA 4UAUA 4CRXA 5DLFA 3SV4A 3BQ2A 4IBJA 5KAIU 5ALQA 2ZG6A 2KFNA 1KQQA 3ED5A 4UAWA 1YU3A 2W9BA 9ICWA 4QWAA 5ALLA 2NYVA 1ZD3A 4BJQA 3FKEA 5EE3A 8ICIA 4F8RA 4O3OA 3PSTA 2E1FA 2HSZA 5KFJA 1VJ5A 4RPXA 2ZIXB 4M9GA 4Y2UA 4ECZA 1T3NA 2GLEA 4EYHB 2ATLA 3L26A 4XUSA 3QUCA 1DGJA 4B9TA 2OH2A 3E2EA 1B0XA 5C5JA 1ZQHA 1KFSA 2WTFA 4IBEA 3HSHA 2VJ4A 4J9OA 4I2IA 3A0BU 2W9CB 9ICBA 4OJLA 5E79U 4DL5A 1Q3UA 2BCRA 2AQ0A 3J81j 3RAQA 4C7ZA 7ICJA 2BDUA 1BPDA 4ED6A 3GZFA 2AH5A 4UAVA 4U6PA 4ED0A 2LYAA 3TACB 2J6TA 4KLQA 5GTIU 3PO5A 4DS5A 5J0PA 2Y1JA 1T8EA 2JMGA 3CP8A 8ICKA 7ICFA 4P0PA 5ALTA 1HUZA 2HCFA 4KLUA 1RG6A 2NRXA 5HHIA 3NTUA 5J0QA 2Y2NA 1XSLA 1E8BA 4PHEA 5IIOA 3LVVA 5CJ7A 3OSNA 3QXGA 4C4SA 4DL4A 4FFDA 1Z1BA 1Z00B 2MAXA 1ZQDA 4J9LA 1C7YA 3Q8LA 2NRZA 4JUZA 3BQ7A 4BWJA 4ED3A 4JV0A 1N48A 1MN8A 4YFKA 3KHLA 4RNOA 1N5XA 5BPVA 1U47A 3RH5A 5AK3A 2KK0A 2KSOA 3QZ8A 4KLSA 4UW9A 1L7OA 2E8NA 3ZDEA 4KITB 1XO0A 4UB6U 1TAMA 3OPXA 3QU7A 2KJ5A 2LI6A 4ECUA 2BPFA 4ECYA 3UXPA 1QH9A 4DQIA 7ICSA 3M9MB 4F5PA 3HW8A 2KIVA 3U26A 2LBOA 3V7KA 5D4BA 1TV9A 5J2BA 3EW9A 5KFDA 8ICQA 4NZ1A 1QQ6A 5AM3A 4NJ8A 1S77D 1PK3A 4J9RA 2PFQA 1LKYB 1TAQA 1JI7A 1SKWA 3AU2A 3PW2A 4QIWC 2JZBB 2QLTA 3NRWA 3RBDA 4XRHA 4DSFA 1OGGA 5J0SA 2BHNA 2F8LA 1L6NA 3PX0A 2L5YA 4F2SA 2Y2QA 5J0RA 2VANA 2JH1A 9ICAA 1X6IA 4I28A 2Y9UA 1S0VA 4MB4A 1D9DA 4HAIA 4ECTA 4YMMA 1S97A 3PW4A 4OJ5A 5AM1A 3LVWA 4TUSA 1ZQRA 2HVHA 8ICTA 4FZMA 4CE6A 3QEAZ 3QU4A 3WK5A 4QZFA 3C2KA 2W03A 3KS4A 3SMVA 3HONA 4C8MA 2BG1A 1ZETA 3MR6A 1WG8A 5J2CA 4QWDA 4CF5A 2ALZA 2BPGA 1FFUA 5J29A 2K8CB 4R66A 3WK7A 2DF4B 4IBKA 2IOFA 4RQ1A 3C29A 3OSPA 3BZKA 4DL6A 1X9MA 5AM4A 2P66A 4Z6CA 2W43A 2YY6A 4QZEA 4RQ5A 2YMMA 1P7DA 5AI8A 5ALHA 4I29A 4KLLA 3N7PD 1NNLA 4I2BA 4O5KA 3RJFA 1ZQYA 5J2HA 3MFIA 1BNOA 4IL6U 2KNJA 4Y2RA 4DSKA 2C2RA 4LVSA 1PK1B 4LJXA 1UQVA 4NL9A 3PVXA 3K1RB 4QZHA 3MQLA 4DL7A 3ZDDA 3F2BA 4F5QA 4HMCA 4IQWA 3MGIA 2KD1A 9ICJA 2W55A 4CNQA 2I6XA 4F93B 5KFZA 1XSPA 4PJ0U 4YVZA 1V38A 3I1YA 1SKRA 2Y2LA 5AI6A 4JWMA 2DPJA 3TFRA 5AI4A 4IJFA 4ELTA 4C4RA 3ZDAA 2BKEA 4F5NA 4KX3A 1KN5A 1S0MA 4F91B 2RRDA 4TX8A 1QSSA 3M9NB 3QX7A 3T3FA 4P0QB 3A0HU 4A8EA 1ZXIA 4OO1J 1KEJA 2CN1A 3HPOA 4F50A 4ED1A 1PZNA 3Q8RB 1QSLA 4YXJA 1ZQAA 3WD1A 2NO5A 3PNCA 1JX4A 1ZRMA 4I2DA 3SYZA 3C21A 2XC9A 3VCBA 2AGQA 2XY7A 5KFNA 2LYHA 1LKYA 2CXYA 1SL2A 5D46A 3RJJA 9ICQA 3MR3A 2KMDA 2XICA 5DBCA 4I27A 1H38A 2F1JA 2RDIA 2GWSA 1COKA 4RUAA 2K4IA 5ALFA 5DGAA 3TARA 8ICCA 3C2LA 3M6ZA 4DFMA 4CF3A 2AXTU 3UQ2A 2R8KA 4DLEA 2W3SA 5DKWA 2QB0A 5ALSA 3AUOA 5AI9A 2FMPA 4DSJA 4B9SA 3KHRA 4US8A 5KFYA 3HKZF 4DO9A 3QU5A 1JUDA 4RQ8A 1SL1A 5EE9A 4FBTA 3RRGA 3GIKA 2EQYA 2BCSA 4J9QA 4EELA 2XGPA 2W7PA 2IA6A 3AM9A 4RQ6A 3Q8SB 1H8PA 4M9LA 4TURA 4KLDA 1E6PA 1T3QA 1ZQSA 2JE5A 2VKQA 2XGQA 1KLNA 2ZUCA 4QZ8A 1URJA 4LG2A 1ZQUA 5DQIA 5ALJA 5AKZA 3CNHA 4ACOA 4TUQA 3PMNA 2NRTA 2PMZC 1NKCA 3TKAA 4GHLA 2G07A 1JROA 1XS9D 1QLNA 5IIMA 2GO7A 4IQTA 4C4TA 4NWIA 2W11A 4Z2HA 9ICVA 5KG3A 1PVPA 4O3QA 3ICXA 2P6UA 2ZXIA 8ICBA 3H4BA 1JMSA 3MDAA 2XO7A 1IM4A 9ICGA 3L3FX 3WK4A 2I1QA 4QZCA 3ZD8A 3HJEA 3H8MA 5BPCA 2VJ5A 1IV8A 1NK9A 5CB1A 2XY6A 3Q8KA 4PHAA 1QO6A 1NK8A 1RXWA 1B43A 4M2YA 4ZH4A 9ICEA 4BXOB 1ZQTA 5A0LA 5KFAA 1RQNA 3Q8PB 8ICXA 1RPLA 2KHQA 1BPYA 2HOIA 1E6RA 5HHHA 2BCQA 7ICUA 2EZYA 4M04A 2QARB 4FBUA 5G5HA 1VLBA 1NK5A 2YMLA 5J2KA 4P4MA 8ICHA 4J9KA 1U4BA 4CCHA 4Z2KA 3BQ0A 1CI4A 2HW3A 4DEZA 4DWIA 4TQSA 5DLGA 5L1LA 5ALWA 3H8JA 1CEZA 4GIBA 2BGWA 2FLPA 5KFWA 3RF9A 4Y2JA 2OM6A 2WB1F 1ZYQA 5CRXA 4JWNA 2BCUA 2W9MA 3IP4B 5BOLA 5F9NA 1UA1A 1U45A 2XI9A 9ICKA 3OGUA 3H0RB 5J0TA 3RB0A 3V7LA 2PKEA 2G06A 4PHPA 5EE1A 5G5GA 2J6UA 1BVSA 2A1JB 4JMUA 1A6SA 3PW7A 2HHUA 3LWLA 4JK1A 3SZ2A 2LKYA 2IOHA 4UBCA 1ZQVA 1BPBA 2EAOA 4FZNA 4GFJA 4KN4A 2LPEA 2PXIA 3G6XA 2ZUDA 1SGGA 4QW9A
chains in the Genus database with same CATH topology
2VJ5A 2ZIWB 4NLBA 2IOUA 3SQIA 2WAQC 2WAQF 2MRLA 1YU1A 3LVWA 4AYBC 4P0PB 3K1ZA 4BUGA 2KICA 4WJ3B 4IBIA 2R18A 2ZIXA 4OJPA 4NYUA 5KL1B 3M6KA 4FZMA 2H3FA 2HOFA 2CPRA 3SAFA 3VCBA 2A3VA 4IC9A 2VIXA 4BX9C 2Y2HA 2YB1A 2KJ8A 2W03A 3C28A 2JGAA 3SMVA 3KS4A 4CRXA 3HONA 2OYYA 2BG1A 3AQEA 3O0FA 4GHAA 3SAGA 2E1EA 4IBJA 3IG8A 2E5SA 4OJOA 4NZ4A 2MA1A 2HBJA 3ALRA 2DGZA 5A0LA 3AL0B 1A0PA 5BPVA 1NZBA 3CYMA 2XIDA 2ZG6A 3N7SC 2XICA 1Q3VA 2K8CB 2KHVA 2YB4A 4GH9A 2G5HB 3KS8A 4NZ3A 1T94A 2DF4B 2KHQA 4NV0A 3VC8A 2KIWA 4C0ZA 3D2NA 2HOIA 5HR7A 1YUEA 2K4IA 1UPHA 4IBKA 2ZIUB 3D2QA 4CGZA 2K4HA 1YU3A 5T14A 3T79A 3M6ZA 3PSPA 5KL8B 3C29A 4IBDA 2JHDA 3F2DA 2HBLA 1XO0A 2LHTA 3F5EA 1YT3A 1PVRA 1TAMA 3N7RC 2UWXA 3OPXA 2KJ5A 2JCHA 3F5AA 3KFUF 2W04A 3E0FA 2JH7A 1ZQ1C 4BJQA 3FKEA 2KOBA 4PL1A 1P7DA 3PSFA 3HKZF 1GO3F 2Q4TA 2YX8A 2E1FA 3AQFA 3PSTA 3N7PD 3ONNA 4CDGA 2Y2IA 2H3IA 2ZIXB 3MGVA 3M7DA 2LBOA 2F76X 3LYSA 2N1RA 4PL2A 3L29A 4O3MA 3L26A 2KNJA 2W7PA 3PZPA 2Z7JA 2G0AA 1OUQA 2KEYA 4NYYA 4NZ5A 1ECWA 2DQNB 3PSIA 4FE3A 2OH2A 3SAHA 4NZ1A 3RF9A 2OM6A 1HIWA 2WB1F 3DEEA 5CRXA 3GU3A 2Y0SF 2CRXA 2M0NA 4IBEA 2Y2MA 3F2BA 1WUDA 3HSHA 2VJ4A 2G09A 4KMOB 2KD1A 2K4EA 4FZLA 2GOLA 2JE5A 2XD1A 2K8BB 1YU0A 3IP4B 2OXOA 1CRXA 4IBCA 3L25A 4OJLA 4QIWC 2K89A 2XI9A 2ZXHA 1Q3UA 2HMXA 2HBMA 4U7CA 3HKZC 2BDUA 1IIPA 2PMZF 2VKQA 4QIWF 4QNLA 1Z19A 5HR6A 3NRWA 2GH1A 2KJ9A 2KVCA 3H0RB 1PVQA 1MA7A 2H3VA 1URJA 4IBGA 4OUIA 2KKPA 3GZFA 4LG2A 2Y2LA 4NLCA 4IBBA 4NY2A 3CRXA 2NV3A 4ACOA 4GHLA 2G06A 4U6PA 2F8LA 1SZHA 2PMZC 1L6NA 2XD5A 3H0LB 2ZIVA 2F2AB 1F44A 2D6FC 2ZIVB 4IJFA 2K8AA 2G07A 2LYAA 3WX7A 1ED1A 3F2CA 2Y0SC 1HEKA 2WB1C 3IG5A 3NUQA 2FFFB 2Y2PA 4NWIA 4IJEA 3RFAA 4ICAA 2Y2QA 1PVPA 4KX3A 4JMUA 3L27A 3F53A 1XNSA 3ICXA 1A6SA 2KKVA 2ZIUA 1YU4A 2JMGA 5C0YA 3N3FA 3H0MB 2ZXIA 2JH1A 2RRDA 3CP8A 2F77X 1D8BA 2LKYA 4P0PA 1KBUA 4OJ6A 4OJ5A 2G08A 4FZNA 2H3ZA 2ZIWA 2G5IB 3KZXA 4P0QB 3D2SA 2Y2OA 2Y2JA 4A8EA 1YU2A 4GFJA 4OO1J 2RP5A 2W7OA 2CN1A 2HOQA 4AYBF 3L28A 3IN5A 2RHFA 1DRGA 2XVTA 2LYBA 2Y2NA 3L3FX 4KX5A 2H3QA 3L2AA 2Y2GA 2Y2KA 3LVVA 4P0QA 4QJFB 2HBKA 4IBFA 1Z1BA 2KV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OJO A;  4OJL A;  4OJP A;  4QNL A;  4OJ5 A;  4OJ6 A; 
#chains in the Genus database with same CATH topology
 5CR0 A;  1JXL A;  3K75 D;  5J2G A;  3RJG A;  5KFU A;  3KS8 A;  1COO A;  3JPP A;  3M6K A;  5CWR A;  1ZD5 A;  4RQ2 A;  1TAU A;  5KFB A;  4YD1 A;  1V9P A;  3L4P A;  3EWA A;  4RQ3 A;  5HMM A;  1HJP A;  1L3U A;  1D8L A;  4GC7 A;  1H0I A;  5ALG A;  2XID A;  2HHW A;  3NVW A;  4C0Z A;  4DFK A;  2JEG A;  4YCX A;  4EEN A;  5L1M A;  1S10 A;  5J2J A;  4IBD A;  5ALO A;  2E8P A;  1TVA A;  5HML A;  1FO4 A;  2HBL A;  2UWX A;  3SEN A;  5AIC A;  4Y2X A;  5J8Y C;  4Y2T A;  4YR2 A;  4DS4 A;  1WWU A;  2KTQ A;  4UB5 A;  2Z7J A;  2G0A A;  5AI0 A;  3PSI A;  1NZP A;  3WD2 A;  1X9W A;  5DG9 A;  2WFA A;  1DGS A;  4EZ9 A;  1ED7 A;  1W1P A;  3HT3 A;  3UMG A;  2W9A A;  1YU0 A;  2OXO A;  4P2H A;  5ALK A;  2JV3 A;  4DOC A;  5AM0 A;  4USA A;  5J2F A;  3BDP A;  5HR6 A;  2KJ9 A;  2H3V A;  1FIQ A;  8ICY A;  1GPF A;  4EX7 A;  4M0A A;  3TFS A;  2B6G A;  1SV4 A;  1ZD2 P;  1ED1 A;  4F4W A;  3Q8M A;  1S76 D;  2EAN A;  5EWG A;  1TK8 A;  2FDR A;  4YR0 A;  4QZG A;  1JAL A;  2FPK A;  2H3Z A;  2VA3 A;  4Y2P A;  4DFD A;  1N2X A;  5KT5 A;  3GFK B;  2YN4 A;  1KFD A;  5J2A A;  1SXE A;  5J2E A;  3TAQ A;  4QJF B;  4RPZ A;  2BQ3 A;  1QSY A;  7ICI A;  2KVS A;  4IRK A;  1NJX A;  5KL1 B;  3OHA A;  2UVV A;  1ARO P;  4BX9 C;  1L3S A;  2ASL A;  7ICM A;  2JGA A;  4R8U A;  3BS5 A;  2M9N A;  5AKK A;  4OJO A;  3G6V A;  8ICW A;  4M9N A;  1PK1 A;  3KKA C;  2KN7 A;  4C80 A;  1KW4 A;  4CF4 A;  1JIH A;  2P35 A;  3VC8 A;  9ICM A;  4QZA A;  1UR8 A;  1UPH A;  5DBB A;  3RB3 A;  1SKS A;  4C8N A;  1S9F A;  3RRH A;  5L1I A;  5ALN A;  1UCV A;  3KFU F;  3H40 A;  2W54 A;  4IQV A;  2Q4T A;  1E6Z A;  2LM4 A;  4KLT A;  4AP9 A;  4J03 A;  5DQG A;  4GXI A;  4ECQ A;  4O3M A;  4NLN A;  1NOM A;  3DV9 A;  2MSN A;  3S6J A;  2IHN A;  5BOM A;  2AGO A;  1ZQP A;  1N62 A;  8ICO A;  1Z3E B;  2G09 A;  3RH4 A;  2K8B B;  2IBK A;  3MFH A;  1F5S A;  1ZQI A;  2A1J A;  5HP4 A;  1IIP A;  2PMZ F;  2C2E A;  4B9N A;  1MA7 A;  4R63 A;  3WKE A;  1EXN A;  2BCV A;  3WKA A;  5KAF U;  2WF6 A;  8ICU A;  5AKE A;  1AQ6 A;  2E8O A;  1F44 A;  2A19 A;  1J7M A;  3RJE A;  4DQQ A;  3N97 B;  8ICE A;  3RFA A;  1M6Y A;  2KKV A;  2W3R A;  3N3F A;  1YZ6 A;  1MQ3 A;  1NJY A;  2KZ3 A;  3TI0 A;  4ELU A;  3D2S A;  1YU2 A;  4O5E A;  2W8K A;  3M9O B;  3UXO A;  2LYB A;  4NM2 A;  2ZIW B;  3TAD A;  4FS1 A;  3PR4 A;  3AU6 A;  3SAF A;  2F3N A;  4IC9 A;  3OTQ A;  4I2E A;  4K4H A;  3OHB A;  9ICU A;  2MUT A;  4UB3 A;  2BQU A;  1K5O A;  2HBJ A;  9ICX A;  4UAR A;  4C8K A;  7ICQ A;  1RYU A;  5KFI A;  3D2N A;  2I9G A;  3PSP A;  3NVV A;  3UPQ A;  3PML A;  2UVW A;  9ICC A;  1S5L U;  4BGD A;  3TAP A;  3E0F A;  2IOF K;  3KHH A;  2PI5 A;  3KD3 A;  4QWB A;  3FYH A;  4DQS A;  4F4Y A;  2YQE A;  3MGV A;  5ALR A;  3I28 A;  5KTQ A;  3M7D A;  4EBE A;  2BR0 A;  2B21 A;  4P4P A;  4ELV A;  4YMN A;  4F4K A;  4GXK A;  3ISD A;  3PW5 A;  3T5K A;  5ALI A;  2Y2M A;  4KMO B;  5L1K A;  1WYG A;  1CRX A;  2F8K A;  4PH5 A;  4Y2Y A;  1XU4 A;  2DUY A;  4UB2 A;  3WK8 A;  1PVQ A;  4IBG A;  1HUO A;  1ZQO A;  2MUT B;  1BGX T;  3PX4 A;  3AMZ A;  3AEV A;  3WX7 A;  5J2D A;  3ZD9 A;  4KLG A;  1RYR A;  4Q43 A;  1X66 A;  4ZOH C;  4DL2 A;  4OD0 A;  2D8C A;  3JPT A;  2UVU A;  5IIJ A;  3WD0 A;  2G08 A;  3WK6 A;  2JXJ A;  4QZB A;  2D3D A;  4IR9 A;  2RP5 A;  3C5F A;  2C2D A;  2Q0Z X;  1SIJ A;  2B0C A;  4P0Q A;  3L5K A;  2KV2 A;  1N56 A;  1MC8 A;  4I2C A;  5DG8 A;  1YU1 A;  5AK5 A;  1O08 A;  5AIB A;  4PZO A;  1SZP A;  2FI1 A;  4F5R A;  5TIS U;  1ZQM A;  4LZD A;  2QB0 B;  2HHX A;  2KZM A;  2XCP A;  1NK6 A;  4EX6 A;  2K4H A;  4HMD A;  7ICE A;  1Z00 A;  3F5E A;  3QNM A;  5AHX A;  1BNP A;  5DGB A;  2RLT A;  4RQM A;  9ICN A;  7ICR A;  3PSF A;  4OCZ A;  4KLF A;  3GIJ A;  8ICF A;  2Y2I A;  2HI0 A;  4Z2J A;  4EZ6 A;  4PL2 A;  4R65 A;  1TE2 A;  4Q8F A;  4JB3 A;  2FN2 A;  1ECW A;  2E3T A;  3RJK A;  2HHQ A;  1Y88 A;  2EAP A;  1SWV A;  4RU9 A;  4EEY A;  3NVY A;  4MF8 A;  2ASD A;  3OJU A;  2GOL A;  4IBC A;  3K4G A;  2HHV A;  1DXS A;  2FE9 A;  4DOA A;  1SV0 C;  2FPL A;  3FAH A;  2F44 A;  3QUQ A;  3OJS A;  4EEK A;  4IRC A;  3RJH A;  4NLC A;  1W1V A;  4UAZ A;  4R8U B;  3GII A;  1ZQG A;  2F2A B;  2FJ6 A;  2Y2P A;  3MBY A;  8ICZ A;  3L27 A;  4UBB A;  3I76 A;  3QU2 A;  1D8B A;  1N5W A;  2KE7 A;  5KFT A;  5KFP A;  2FMQ A;  3PR5 B;  2W7O A;  4ED2 A;  1Z4N A;  4NLK A;  3MC1 A;  3ETR A;  3LWM A;  2XVT A;  5KG4 A;  4KX5 A;  3B9J A;  1N63 A;  5KT3 A;  3UMC A;  2DFL A;  4C8O A;  4AYB C;  4P0P B;  4E0D A;  3H8S A;  1L5U A;  2DBY A;  2H3F A;  2CPR A;  2JRZ A;  1RM6 C;  4QW8 A;  2Y2H A;  3PV8 A;  2ZUB A;  5DG7 A;  3T5J A;  2OYY A;  1S0O A;  2DGZ A;  2KHV A;  3QUT A;  1T94 A;  1ZRN A;  4MFC A;  3WKB A;  3T79 A;  5J0W A;  2JHD A;  5KG6 A;  3B0Y A;  4PPX A;  4MF2 A;  3PW0 A;  3HWT A;  3N7R C;  2JCH A;  5AM5 A;  5AIA A;  4QWE A;  3EPI A;  4RUC A;  4PL1 A;  4J9S A;  1GO3 F;  4RQ0 A;  4ED7 A;  1T4G A;  4MB3 A;  1XSN A;  3PZP A;  1QCK A;  2KG5 A;  2KP7 A;  2O6K A;  3IDW A;  2DQN B;  2V9W A;  3SAH A;  1FEZ A;  3M8S A;  2WF5 A;  1X9X A;  3KBB A;  1N61 A;  3JPN A;  3KOO A;  1Z1V A;  2YMQ A;  9ICF A;  4C7Y A;  4KLM A;  1AIW A;  4UAY A;  4FZL A;  2K4E A;  3UMB A;  2XD1 A;  1D8Y A;  5KFO A;  4YN4 A;  8ICL A;  2ZTD A;  3BS7 A;  2Y1I A;  3QYP A;  4O9M A;  4O3N A;  2HBM A;  2Y9T A;  4B6J A;  4QIW F;  4NY8 A;  5J0Y A;  2KVC A;  2KKP A;  4I2H A;  2VA2 A;  4IBB A;  4NY2 A;  5FP0 A;  5L9X A;  1A76 A;  4I2J A;  4M9H A;  4HYK A;  1WCL A;  5CA7 A;  4XQ8 A;  1XNS A;  4F4X A;  9ICR A;  1C20 A;  4Q8E A;  5KFV A;  3GDX A;  3D6J A;  2WF9 A;  7ICG A;  4Y2Q A;  3PY8 A;  3IM1 A;  3KZX A;  4BWM A;  4KLH A;  2Y2J A;  2HOQ A;  4AYB F;  1ZD4 A;  1KKX A;  3MR2 A;  2ZJ8 A;  1K1S A;  3IRU A;  1XO1 A;  2R18 A;  5ALV A;  9ICI A;  1U49 A;  2UVR A;  3KTQ A;  4FS2 A;  5JRT A;  3O0F A;  4MB5 A;  3AL0 B;  5ALP A;  3C1Y A;  3MGH A;  4NZ3 A;  7ICN A;  4NLZ A;  1KTQ A;  1LV5 A;  1NK7 A;  2ZIU B;  2W9B B;  3RTV A;  1X42 A;  5EWE A;  3WU2 U;  3GV8 B;  4GC6 A;  4RPY A;  1H0G A;  3T5L A;  3F2D A;  3RR8 A;  4DSL A;  3C1Z A;  4PGY A;  1L7N A;  1L3V A;  5EOZ A;  5EWF A;  4ED8 A;  4YG2 A;  2XY5 A;  5D49 A;  1NK0 A;  4B9U A;  1PDC A;  3GQC A;  4BDP A;  1KS0 A;  2IHM A;  1OW5 A;  3E58 A;  4F71 A;  4F4Z A;  3AN1 A;  4O5C A;  5ALY A;  2FMS A;  2JEJ A;  4IR1 A;  1SWW A;  3GU3 A;  1U48 A;  2CRX A;  4GLX A;  1NK4 A;  1XWL A;  3V7J A;  1BPE A;  2ES6 A;  3UXN A;  1LVH A;  3L25 A;  4DLG A;  5AKL A;  5KFS A;  1UHU A;  4QZI A;  2ISO A;  3HKZ C;  3KZI U;  4XA5 A;  3SV3 A;  1ZQQ A;  3V6J A;  4KLI A;  5L1J A;  3C5G A;  2D6F C;  2ZIV B;  3JPQ A;  3F2C A;  2WB1 C;  3GV5 B;  2PFN A;  5KG5 A;  4UAT A;  3WD4 A;  2R8I A;  4RZR A;  5F9L A;  3SR6 A;  5JUM A;  5DQH A;  4OJ6 A;  1X40 A;  2ZIW A;  2Y2O A;  1DRG A;  2H3Q A;  2Y2G A;  4P4O A;  8ICM A;  4PGQ A;  3B0X A;  1RDF A;  8ICV A;  4B9V A;  1TK5 A;  1IXR A;  2KIC A;  2ZIX A;  7ICT A;  4Y2S A;  3RB4 A;  3EZ5 A;  4PHD A;  5AKG A;  1E88 A;  2E5S A;  1TKD A;  1N60 A;  1L7P A;  5J8Y A;  4NXZ A;  8ICN A;  4NV0 A;  1J2N A;  5AKH A;  3Q8Q B;  4NL9 C;  5KL8 B;  2BPC A;  5H2F U;  1WWV A;  4UAS A;  1CK7 A;  7ICH A;  8ICR A;  8ICG A;  4RNN A;  2HDO A;  1Z4O A;  1ZQW A;  1JN3 A;  4IS7 A;  3GIM A;  7ICO A;  8ICS A;  2EAM A;  1OGB A;  3FC4 A;  4CDG A;  3MR5 A;  4RQ4 A;  5KFR A;  3QZ7 A;  4Z6D A;  3SI8 A;  4M9J A;  3RB6 A;  3GIL A;  2YMP A;  1OUQ A;  4MFF A;  5KT4 A;  5DDM A;  1W1Y A;  1HIW A;  3BQT A;  2AU0 A;  3JPO A;  5JTI A;  1TK0 A;  4I2A A;  2M0N A;  2WF7 A;  4M6W A;  3H4D A;  4J9P A;  1ZJN A;  4US9 A;  1JRP A;  5III A;  1S8O A;  1K1Q A;  4I2F A;  1U9L A;  4IBI A;  3QU9 A;  2GH1 A;  5KFK A;  3CRX A;  5DBA A;  1SZH A;  3EYZ A;  3NVZ A;  2ZIV A;  1UT8 A;  8ICP A;  1YU4 A;  1RZT A;  1MSW D;  4DF8 A;  1XC9 A;  4O3P A;  4KMU A;  1J2M A;  2PFO A;  1SL0 A;  2P6R A;  3LK9 A;  4F5O A;  4DOB A;  2DWQ A;  2DL0 A;  5KG2 A;  1EAK A;  4ECR A;  5AK4 A;  2DKX A;  2OWO A;  3WKC A;  1RYS A;  3RAX A;  5J0O A;  3BZC A;  2BDP A;  4F72 A;  3PX6 A;  3QEB Z;  4DF4 A;  4NLG A;  2W9C A;  2V5O A;  3C28 A;  1S0N A;  2HVI A;  4GHA A;  3SAG A;  4KLE A;  4Z6E A;  2DPI A;  5GTH U;  4ECS A;  3CYM A;  3N7S C;  3UQ0 A;  4X5V A;  2BQR A;  4NM1 A;  1L8O A;  2F1H A;  3IHQ B;  3RJI A;  2KIW A;  1ZQN A;  5B66 U;  4YP3 A;  5AK6 A;  3D2Q A;  5KFX A;  4CGZ A;  5CEH A;  2WHE A;  1PVR A;  1YT3 A;  2NRW A;  1GOI A;  3V6K A;  4Q45 A;  2I5H A;  2JH7 A;  3HX0 A;  3H7I A;  3HIL A;  1UA0 A;  3BS5 B;  3UM9 A;  9ICP A;  3HRD D;  2VA8 A;  1E15 A;  4RT2 A;  1X6J A;  4PGX A;  1UR9 A;  3NAS A;  4FE3 A;  2ZTE A;  1CXW A;  3DEE A;  2Y0S F;  9ICT A;  2FLN A;  1WUD A;  5KFF A;  1L7M A;  1MQ2 A;  4F3O A;  3N4M B;  2K89 A;  1ZQE A;  4Y2V A;  1Z19 A;  5DB7 A;  5ALU A;  4OUI A;  1NI3 A;  5ALD A;  3RR7 A;  2ZJ5 A;  4TUP A;  3EUB 2;  4MEX A;  1B4F A;  4J9N A;  4DQR A;  2FFF B;  3C23 A;  3LDA A;  5KT7 A;  4QZD A;  3SEI A;  5C0Y A;  2D49 A;  3H0M B;  5KFL A;  3PO4 A;  4RQN A;  2OHF A;  4MFA A;  5JU5 A;  5TZV A;  2OCE A;  3KHG A;  4Z2I A;  2RHF A;  3THV A;  3IV6 A;  1FFV A;  7ICV A;  4DL3 A;  5KFG A;  2XCA A;  4Z2L A;  4NLB A;  1KL9 A;  5J0X A;  2IOU A;  5CP2 A;  3SQI A;  4KTQ A;  7ICL A;  2A3V A;  4R64 A;  2QB1 A;  4O3S A;  3ISB A;  2BZF A;  2E1E A;  5ALZ A;  3IG8 A;  2MA1 A;  1ZQL A;  1A0P A;  2F1I A;  1ZQZ A;  1Q3V A;  2G5H B;  1ZJM A;  1YUE A;  1DOQ A;  5EE0 A;  2FPM A;  3GV7 B;  4M47 A;  2LHT A;  5AKJ A;  2W8L A;  1GXD A;  3ORY A;  4DSI A;  2KOB A;  2YTU A;  2H5X A;  5KNI A;  4Z2G A;  2AQ4 A;  3KKA A;  2H3I A;  3CW2 C;  4ECX A;  2N1R A;  1Q46 A;  5KFQ A;  1KRP A;  1QQ5 A;  4RT3 A;  4NYY A;  2JR5 A;  3EPG A;  1RXV A;  3RBE A;  5F3X B;  2JEF A;  5K4L A;  1OXJ A;  3WD3 A;  4DQP A;  2AGP A;  3SD7 A;  1ZQC A;  4MHV A;  2JEI A;  4KN7 A;  4U7C A;  1IG6 A;  3NRZ A;  4Q44 A;  4QNL A;  3TAN A;  2NV3 A;  1X2I A;  2QKQ A;  1X9S A;  1PUZ A;  5J2I A;  3N28 A;  4FO6 A;  2ZIU A;  2EH9 A;  4O3R A;  3QE9 Y;  1SXD A;  1L6J A;  1KBU A;  3T5H A;  5CHG A;  2G5I B;  1NJW A;  1D9F A;  3V6H A;  1L8L A;  3R9K A;  4IBF A;  1RQL A;  1ZQK A;  2EDU A;  4Z6F A;  3BJY A;  1KSP A;  3FDS A;  2AJQ A;  4J9M A;  2WAQ C;  2DKZ A;  2MRL A;  5IIN A;  4NYU A;  5ALM A;  2C28 A;  1CUK A;  2RDJ A;  2VIX A;  2J6S A;  8ICJ A;  3DDH A;  3AQE A;  3H8W A;  1NZB A;  4G9B A;  2EZZ A;  5DB6 A;  2YB4 A;  4GH9 A;  4F92 B;  2RTS A;  4IQU A;  1W1T A;  4K4G A;  4QWC A;  1ZOL A;  2QAR A;  5T14 A;  2PFP A;  1O6I A;  4ECV A;  2FLL A;  1KFT A;  3C2M A;  3F5A A;  9ICL A;  5KT2 A;  3NGD A;  5J0U A;  3MDC A;  5IIL A;  1TFR A;  2A1A A;  3AQF A;  2YX8 A;  1B22 A;  1YZ7 A;  3ONN A;  4JV1 A;  1UT5 A;  1SV0 A;  2ZTC A;  2F76 X;  3LYS A;  4UB1 A;  4IRD A;  3L29 A;  3ISC A;  2R8J A;  2HHT A;  1L3T A;  5DDY A;  3ZDB A;  4I2G A;  9ICO A;  1ZQX A;  4O0I A;  2ODG A;  5ALX A;  2AHO B;  2HMX A;  5AKX A;  1O03 A;  3NS1 A;  1F0M A;  2KZZ A;  3MAB A;  4BXO A;  2XD5 A;  1NKE A;  8ICA A;  1VDV A;  2K4P A;  2Y0S C;  2LM1 A;  5KFE A;  3NUQ A;  3IG5 A;  3QUB A;  7ICP A;  2HHS A;  3F53 A;  2KSO B;  4YR3 A;  2F77 X;  2C22 A;  4ECW A;  4K4I A;  3L28 A;  1ZQF A;  3L2A A;  3WK9 A;  1WCN A;  2PI4 A;  3FM9 A;  3M1Y A;  5AI5 A;  4YXM A;  5DB9 A;  3V72 A;  2JZB A;  2NRV A;  3K1Z A;  4BUG A;  5KG7 A;  4UB4 A;  4OJP A;  4QZ9 A;  4EBC A;  2YB1 A;  5KG1 A;  4YD2 A;  1ZQJ A;  3BQ1 A;  1V85 A;  4HME A;  4NZ4 A;  3ALR A;  2WF8 A;  3M7P A;  5KFM A;  1BPZ A;  1QQ7 A;  5AM2 A;  2ZJA A;  4B9L A;  4EYI B;  1ZQB A;  5HR7 A;  1JXE A;  3G6Y A;  4M6W B;  4KLO A;  1A77 A;  2ESE A;  4DSE A;  4DCC A;  2RQ5 A;  5KG0 A;  2W04 A;  3WKD A;  4G3I A;  1ZQ1 C;  1Q8K A;  5KFC A;  2R8H A;  4YMO A;  1V97 A;  4MEY A;  2MU2 A;  2ISP A;  7ICK A;  2KEY A;  4NZ5 A;  1DK2 A;  3JPR A;  2R8G A;  4DFJ A;  4C8L A;  2IMW P;  5KT6 A;  3JPS A;  3ETL A;  5KFH A;  2OEH A;  2K60 A;  9ICH A;  2ASJ A;  3TQ1 A;  1KDH A;  2LMR A;  4KLJ A;  5AKI A;  5IIK A;  2ZXH A;  2V4R A;  5ALE A;  3HP6 A;  4GXJ A;  2NO4 A;  4RNM A;  3H0L B;  3TAD C;  4UQG A;  2K8A A;  2KFZ A;  1SB3 C;  4F2R A;  1HEK A;  1LB2 B;  4IJE A;  4ICA A;  4UB8 U;  5DB8 A;  1E6N A;  1BPX A;  1NJZ A;  4RQ7 A;  3ZDC A;  4JV2 A;  3IN5 A;  1DK3 A;  2E8M A;  3RH6 A;  3M8R A;  4B9M A;  1QTM A;  1J97 A;  2Y2K A;  2HBK A;  5HNK A;  5B5E U;  2WAQ F;  4DFP A;  2V4Q A;  3ZI4 A;  4EBD A;  1T7P A;  5AKY A;  4WJ3 B;  4TQR A;  2HOF A;  4YQW A;  1NKB A;  4LZG A;  2EZX A;  4PZN A;  2KJ8 A;  9ICS A;  4UAU A;  4CRX A;  5DLF A;  3SV4 A;  3BQ2 A;  4IBJ A;  5KAI U;  5ALQ A;  2ZG6 A;  2KFN A;  1KQQ A;  3ED5 A;  4UAW A;  1YU3 A;  2W9B A;  9ICW A;  4QWA A;  5ALL A;  2NYV A;  1ZD3 A;  4BJQ A;  3FKE A;  5EE3 A;  8ICI A;  4F8R A;  4O3O A;  3PST A;  2E1F A;  2HSZ A;  5KFJ A;  1VJ5 A;  4RPX A;  2ZIX B;  4M9G A;  4Y2U A;  4ECZ A;  1T3N A;  2GLE A;  4EYH B;  2ATL A;  3L26 A;  4XUS A;  3QUC A;  1DGJ A;  4B9T A;  2OH2 A;  3E2E A;  1B0X A;  5C5J A;  1ZQH A;  1KFS A;  2WTF A;  4IBE A;  3HSH A;  2VJ4 A;  4J9O A;  4I2I A;  3A0B U;  2W9C B;  9ICB A;  4OJL A;  5E79 U;  4DL5 A;  1Q3U A;  2BCR A;  2AQ0 A;  3J81 j;  3RAQ A;  4C7Z A;  7ICJ A;  2BDU A;  1BPD A;  4ED6 A;  3GZF A;  2AH5 A;  4UAV A;  4U6P A;  4ED0 A;  2LYA A;  3TAC B;  2J6T A;  4KLQ A;  5GTI U;  3PO5 A;  4DS5 A;  5J0P A;  2Y1J A;  1T8E A;  2JMG A;  3CP8 A;  8ICK A;  7ICF A;  4P0P A;  5ALT A;  1HUZ A;  2HCF A;  4KLU A;  1RG6 A;  2NRX A;  5HHI A;  3NTU A;  5J0Q A;  2Y2N A;  1XSL A;  1E8B A;  4PHE A;  5IIO A;  3LVV A;  5CJ7 A;  3OSN A;  3QXG A;  4C4S A;  4DL4 A;  4FFD A;  1Z1B A;  1Z00 B;  2MAX A;  1ZQD A;  4J9L A;  1C7Y A;  3Q8L A;  2NRZ A;  4JUZ A;  3BQ7 A;  4BWJ A;  4ED3 A;  4JV0 A;  1N48 A;  1MN8 A;  4YFK A;  3KHL A;  4RNO A;  1N5X A;  5BPV A;  1U47 A;  3RH5 A;  5AK3 A;  2KK0 A;  2KSO A;  3QZ8 A;  4KLS A;  4UW9 A;  1L7O A;  2E8N A;  3ZDE A;  4KIT B;  1XO0 A;  4UB6 U;  1TAM A;  3OPX A;  3QU7 A;  2KJ5 A;  2LI6 A;  4ECU A;  2BPF A;  4ECY A;  3UXP A;  1QH9 A;  4DQI A;  7ICS A;  3M9M B;  4F5P A;  3HW8 A;  2KIV A;  3U26 A;  2LBO A;  3V7K A;  5D4B A;  1TV9 A;  5J2B A;  3EW9 A;  5KFD A;  8ICQ A;  4NZ1 A;  1QQ6 A;  5AM3 A;  4NJ8 A;  1S77 D;  1PK3 A;  4J9R A;  2PFQ A;  1LKY B;  1TAQ A;  1JI7 A;  1SKW A;  3AU2 A;  3PW2 A;  4QIW C;  2JZB B;  2QLT A;  3NRW A;  3RBD A;  4XRH A;  4DSF A;  1OGG A;  5J0S A;  2BHN A;  2F8L A;  1L6N A;  3PX0 A;  2L5Y A;  4F2S A;  2Y2Q A;  5J0R A;  2VAN A;  2JH1 A;  9ICA A;  1X6I A;  4I28 A;  2Y9U A;  1S0V A;  4MB4 A;  1D9D A;  4HAI A;  4ECT A;  4YMM A;  1S97 A;  3PW4 A;  4OJ5 A;  5AM1 A;  3LVW A;  4TUS A;  1ZQR A;  2HVH A;  8ICT A;  4FZM A;  4CE6 A;  3QEA Z;  3QU4 A;  3WK5 A;  4QZF A;  3C2K A;  2W03 A;  3KS4 A;  3SMV A;  3HON A;  4C8M A;  2BG1 A;  1ZET A;  3MR6 A;  1WG8 A;  5J2C A;  4QWD A;  4CF5 A;  2ALZ A;  2BPG A;  1FFU A;  5J29 A;  2K8C B;  4R66 A;  3WK7 A;  2DF4 B;  4IBK A;  2IOF A;  4RQ1 A;  3C29 A;  3OSP A;  3BZK A;  4DL6 A;  1X9M A;  5AM4 A;  2P66 A;  4Z6C A;  2W43 A;  2YY6 A;  4QZE A;  4RQ5 A;  2YMM A;  1P7D A;  5AI8 A;  5ALH A;  4I29 A;  4KLL A;  3N7P D;  1NNL A;  4I2B A;  4O5K A;  3RJF A;  1ZQY A;  5J2H A;  3MFI A;  1BNO A;  4IL6 U;  2KNJ A;  4Y2R A;  4DSK A;  2C2R A;  4LVS A;  1PK1 B;  4LJX A;  1UQV A;  4NL9 A;  3PVX A;  3K1R B;  4QZH A;  3MQL A;  4DL7 A;  3ZDD A;  3F2B A;  4F5Q A;  4HMC A;  4IQW A;  3MGI A;  2KD1 A;  9ICJ A;  2W55 A;  4CNQ A;  2I6X A;  4F93 B;  5KFZ A;  1XSP A;  4PJ0 U;  4YVZ A;  1V38 A;  3I1Y A;  1SKR A;  2Y2L A;  5AI6 A;  4JWM A;  2DPJ A;  3TFR A;  5AI4 A;  4IJF A;  4ELT A;  4C4R A;  3ZDA A;  2BKE A;  4F5N A;  4KX3 A;  1KN5 A;  1S0M A;  4F91 B;  2RRD A;  4TX8 A;  1QSS A;  3M9N B;  3QX7 A;  3T3F A;  4P0Q B;  3A0H U;  4A8E A;  1ZXI A;  4OO1 J;  1KEJ A;  2CN1 A;  3HPO A;  4F50 A;  4ED1 A;  1PZN A;  3Q8R B;  1QSL A;  4YXJ A;  1ZQA A;  3WD1 A;  2NO5 A;  3PNC A;  1JX4 A;  1ZRM A;  4I2D A;  3SYZ A;  3C21 A;  2XC9 A;  3VCB A;  2AGQ A;  2XY7 A;  5KFN A;  2LYH A;  1LKY A;  2CXY A;  1SL2 A;  5D46 A;  3RJJ A;  9ICQ A;  3MR3 A;  2KMD A;  2XIC A;  5DBC A;  4I27 A;  1H38 A;  2F1J A;  2RDI A;  2GWS A;  1COK A;  4RUA A;  2K4I A;  5ALF A;  5DGA A;  3TAR A;  8ICC A;  3C2L A;  3M6Z A;  4DFM A;  4CF3 A;  2AXT U;  3UQ2 A;  2R8K A;  4DLE A;  2W3S A;  5DKW A;  2QB0 A;  5ALS A;  3AUO A;  5AI9 A;  2FMP A;  4DSJ A;  4B9S A;  3KHR A;  4US8 A;  5KFY A;  3HKZ F;  4DO9 A;  3QU5 A;  1JUD A;  4RQ8 A;  1SL1 A;  5EE9 A;  4FBT A;  3RRG A;  3GIK A;  2EQY A;  2BCS A;  4J9Q A;  4EEL A;  2XGP A;  2W7P A;  2IA6 A;  3AM9 A;  4RQ6 A;  3Q8S B;  1H8P A;  4M9L A;  4TUR A;  4KLD A;  1E6P A;  1T3Q A;  1ZQS A;  2JE5 A;  2VKQ A;  2XGQ A;  1KLN A;  2ZUC A;  4QZ8 A;  1URJ A;  4LG2 A;  1ZQU A;  5DQI A;  5ALJ A;  5AKZ A;  3CNH A;  4ACO A;  4TUQ A;  3PMN A;  2NRT A;  2PMZ C;  1NKC A;  3TKA A;  4GHL A;  2G07 A;  1JRO A;  1XS9 D;  1QLN A;  5IIM A;  2GO7 A;  4IQT A;  4C4T A;  4NWI A;  2W11 A;  4Z2H A;  9ICV A;  5KG3 A;  1PVP A;  4O3Q A;  3ICX A;  2P6U A;  2ZXI A;  8ICB A;  3H4B A;  1JMS A;  3MDA A;  2XO7 A;  1IM4 A;  9ICG A;  3L3F X;  3WK4 A;  2I1Q A;  4QZC A;  3ZD8 A;  3HJE A;  3H8M A;  5BPC A;  2VJ5 A;  1IV8 A;  1NK9 A;  5CB1 A;  2XY6 A;  3Q8K A;  4PHA A;  1QO6 A;  1NK8 A;  1RXW A;  1B43 A;  4M2Y A;  4ZH4 A;  9ICE A;  4BXO B;  1ZQT A;  5A0L A;  5KFA A;  1RQN A;  3Q8P B;  8ICX A;  1RPL A;  2KHQ A;  1BPY A;  2HOI A;  1E6R A;  5HHH A;  2BCQ A;  7ICU A;  2EZY A;  4M04 A;  2QAR B;  4FBU A;  5G5H A;  1VLB A;  1NK5 A;  2YML A;  5J2K A;  4P4M A;  8ICH A;  4J9K A;  1U4B A;  4CCH A;  4Z2K A;  3BQ0 A;  1CI4 A;  2HW3 A;  4DEZ A;  4DWI A;  4TQS A;  5DLG A;  5L1L A;  5ALW A;  3H8J A;  1CEZ A;  4GIB A;  2BGW A;  2FLP A;  5KFW A;  3RF9 A;  4Y2J A;  2OM6 A;  2WB1 F;  1ZYQ A;  5CRX A;  4JWN A;  2BCU A;  2W9M A;  3IP4 B;  5BOL A;  5F9N A;  1UA1 A;  1U45 A;  2XI9 A;  9ICK A;  3OGU A;  3H0R B;  5J0T A;  3RB0 A;  3V7L A;  2PKE A;  2G06 A;  4PHP A;  5EE1 A;  5G5G A;  2J6U A;  1BVS A;  2A1J B;  4JMU A;  1A6S A;  3PW7 A;  2HHU A;  3LWL A;  4JK1 A;  3SZ2 A;  2LKY A;  2IOH A;  4UBC A;  1ZQV A;  1BPB A;  2EAO A;  4FZN A;  4GFJ A;  4KN4 A;  2LPE A;  2PXI A;  3G6X A;  2ZUD A;  1SGG A;  4QW9 A; 
#chains in the Genus database with same CATH homology
 2VJ5 A;  2ZIW B;  4NLB A;  2IOU A;  3SQI A;  2WAQ C;  2WAQ F;  2MRL A;  1YU1 A;  3LVW A;  4AYB C;  4P0P B;  3K1Z A;  4BUG A;  2KIC A;  4WJ3 B;  4IBI A;  2R18 A;  2ZIX A;  4OJP A;  4NYU A;  5KL1 B;  3M6K A;  4FZM A;  2H3F A;  2HOF A;  2CPR A;  3SAF A;  3VCB A;  2A3V A;  4IC9 A;  2VIX A;  4BX9 C;  2Y2H A;  2YB1 A;  2KJ8 A;  2W03 A;  3C28 A;  2JGA A;  3SMV A;  3KS4 A;  4CRX A;  3HON A;  2OYY A;  2BG1 A;  3AQE A;  3O0F A;  4GHA A;  3SAG A;  2E1E A;  4IBJ A;  3IG8 A;  2E5S A;  4OJO A;  4NZ4 A;  2MA1 A;  2HBJ A;  3ALR A;  2DGZ A;  5A0L A;  3AL0 B;  1A0P A;  5BPV A;  1NZB A;  3CYM A;  2XID A;  2ZG6 A;  3N7S C;  2XIC A;  1Q3V A;  2K8C B;  2KHV A;  2YB4 A;  4GH9 A;  2G5H B;  3KS8 A;  4NZ3 A;  1T94 A;  2DF4 B;  2KHQ A;  4NV0 A;  3VC8 A;  2KIW A;  4C0Z A;  3D2N A;  2HOI A;  5HR7 A;  1YUE A;  2K4I A;  1UPH A;  4IBK A;  2ZIU B;  3D2Q A;  4CGZ A;  2K4H A;  1YU3 A;  5T14 A;  3T79 A;  3M6Z A;  3PSP A;  5KL8 B;  3C29 A;  4IBD A;  2JHD A;  3F2D A;  2HBL A;  1XO0 A;  2LHT A;  3F5E A;  1YT3 A;  1PVR A;  1TAM A;  3N7R C;  2UWX A;  3OPX A;  2KJ5 A;  2JCH A;  3F5A A;  3KFU F;  2W04 A;  3E0F A;  2JH7 A;  1ZQ1 C;  4BJQ A;  3FKE A;  2KOB A;  4PL1 A;  1P7D A;  3PSF A;  3HKZ F;  1GO3 F;  2Q4T A;  2YX8 A;  2E1F A;  3AQF A;  3PST A;  3N7P D;  3ONN A;  4CDG A;  2Y2I A;  2H3I A;  2ZIX B;  3MGV A;  3M7D A;  2LBO A;  2F76 X;  3LYS A;  2N1R A;  4PL2 A;  3L29 A;  4O3M A;  3L26 A;  2KNJ A;  2W7P A;  3PZP A;  2Z7J A;  2G0A A;  1OUQ A;  2KEY A;  4NYY A;  4NZ5 A;  1ECW A;  2DQN B;  3PSI A;  4FE3 A;  2OH2 A;  3SAH A;  4NZ1 A;  3RF9 A;  2OM6 A;  1HIW A;  2WB1 F;  3DEE A;  5CRX A;  3GU3 A;  2Y0S F;  2CRX A;  2M0N A;  4IBE A;  2Y2M A;  3F2B A;  1WUD A;  3HSH A;  2VJ4 A;  2G09 A;  4KMO B;  2KD1 A;  2K4E A;  4FZL A;  2GOL A;  2JE5 A;  2XD1 A;  2K8B B;  1YU0 A;  3IP4 B;  2OXO A;  1CRX A;  4IBC A;  3L25 A;  4OJL A;  4QIW C;  2K89 A;  2XI9 A;  2ZXH A;  1Q3U A;  2HMX A;  2HBM A;  4U7C A;  3HKZ C;  2BDU A;  1IIP A;  2PMZ F;  2VKQ A;  4QIW F;  4QNL A;  1Z19 A;  5HR6 A;  3NRW A;  2GH1 A;  2KJ9 A;  2KVC A;  3H0R B;  1PVQ A;  1MA7 A;  2H3V A;  1URJ A;  4IBG A;  4OUI A;  2KKP A;  3GZF A;  4LG2 A;  2Y2L A;  4NLC A;  4IBB A;  4NY2 A;  3CRX A;  2NV3 A;  4ACO A;  4GHL A;  2G06 A;  4U6P A;  2F8L A;  1SZH A;  2PMZ C;  1L6N A;  2XD5 A;  3H0L B;  2ZIV A;  2F2A B;  1F44 A;  2D6F C;  2ZIV B;  4IJF A;  2K8A A;  2G07 A;  2LYA A;  3WX7 A;  1ED1 A;  3F2C A;  2Y0S C;  1HEK A;  2WB1 C;  3IG5 A;  3NUQ A;  2FFF B;  2Y2P A;  4NWI A;  4IJE A;  3RFA A;  4ICA A;  2Y2Q A;  1PVP A;  4KX3 A;  4JMU A;  3L27 A;  3F53 A;  1XNS A;  3ICX A;  1A6S A;  2KKV A;  2ZIU A;  1YU4 A;  2JMG A;  5C0Y A;  3N3F A;  3H0M B;  2ZXI A;  2JH1 A;  2RRD A;  3CP8 A;  2F77 X;  1D8B A;  2LKY A;  4P0P A;  1KBU A;  4OJ6 A;  4OJ5 A;  2G08 A;  4FZN A;  2H3Z A;  2ZIW A;  2G5I B;  3KZX A;  4P0Q B;  3D2S A;  2Y2O A;  2Y2J A;  4A8E A;  1YU2 A;  4GFJ A;  4OO1 J;  2RP5 A;  2W7O A;  2CN1 A;  2HOQ A;  4AYB F;  3L28 A;  3IN5 A;  2RHF A;  1DRG A;  2XVT A;  2LYB A;  2Y2N A;  3L3F X;  4KX5 A;  2H3Q A;  3L2A A;  2Y2G A;  2Y2K A;  3LVV A;  4P0Q A;  4QJF B;  2HBK A;  4IBF A;  1Z1B A;  2KV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...