4QNNA

Crystal structure of phospholipase a 1 from hornet(vespa basalis) venom
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
297
structure length
297
Chain Sequence
PCPYSDDTVKMIILTRENKKHDFYTLDTIKKHNEFKKSTIKHQVVFITHGFTSSADTENFLAMAKALSDKGNYLVILIDWRVAACTEEMSGIQLAYYSYAASNTRLVGNYIATVTKMLVQKYNVPMANIRLIGHSLGAHTSGFAGKKVQELGLGKYSEIIGLDPAGPSFKSNDCSERICKTDAHYVQIIHTSNHLGTLVTLGTVDFMNNGYNQPGCGLPLIGETCSHTRAVKYFTECIKHECCLIGVPQSKKPQPVSKCTRNECVCVGLNAKTYPKTGSFYVPVESKAPYCNNKGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phospholipase A 1 from hornet(Vespa basalis) venom
publication title Crystal Structure of phospholipase A 1 from hornet(Vespa basalis) venom
rcsb
source organism Vespa basalis
molecule tags Hydrolase
total genus 96
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.32: Phospholipase A(1).
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00151 Lipase Lipase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qnnA00
2QJRA 3MUNA 4KJXA 4OB7A 3BWXA 1AGYA 4IQ4A 3T52A 1LPBB 1XLWA 1A8QA 1L7QA 2VJDA 2CJPA 3FVTA 2X5XA 3V1NA 5ALMA 1CUXA 1XZIA 4K5QA 5IKXA 5I9IA 4B6GA 5AKXA 4AZ0A 2BGRA 2AJDA 5K3FA 2VTVA 4JYMA 1CUHA 2B61A 2GBIA 1EA5A 3WK8A 1AKNA 4Q05A 3KWFA 1QJ4A 2YH2A 3VDXA 1XLVA 4ZV9A 2PVSA 5AK3A 4B0OA 4DMFA 4AO7A 4LYDA 3I1IA 1K8QA 4AXBA 2ZVDA 3BDIA 5BOVA 2V9ZA 3N0TA 4W1PA 1QIFA 3EIOA 3CCBA 3VVLA 1KEZA 2HFKA 1ZD3A 1JT2A 4UBKA 1LLFA 3HC7A 2XUQA 2K2QB 4X90A 3RARA 3QH4A 4KRXA 2HA4A 2VT7A 2VJCA 3H1AA 4CG1A 4GXNA 2YYSA 3PUIA 4MJ3A 3ESDA 3LIPA 3AZQA 4W1RA 5J3JA 5ALKA 4DNFA 7YASA 5EHNA 1TRHA 4MXDA 3GA7A 5AKIA 1XQVA 5JAPA 1P0MA 4P93A 1YB7A 1EDDA 4I19A 5IVIA 3DOHA 2QRUA 2ZJFA 5BV7A 1QGED 4H7KA 4PF1A 3I6ZA 5CH8A 5DNVA 1CVLA 4LXIA 5ALFA 1AC5A 5CT4A 4UHCA 1QFMA 4F5ZA 1F0PA 1QLWA 5ESRA 3EQ7A 1IMJA 4OD0A 4C89A 2BUCA 5SYNA 4BP8A 1B41A 3VXKA 3OG9A 4F60A 1TCBA 4DTCA 5CXUA 4P92A 1XQYA 4OU5A 2PBLA 2XMBA 1QE3A 1GKLA 2VAXA 2B9VA 2ES4A 1XZBA 2H7YA 2R11A 1CUGA 3V1KA 1JI3A 4X93A 5AI4A 5DYWA 1GQSA 5AI0A 3IA2A 5AH0A 1ZD4A 2OCIA 3TEJA 2ZYRA 4FDMA 4XIIA 1SCIA 3G9UA 3VJMA 3KOOA 3O0DA 3IDAA 4G5XA 1CUDA 4C01A 1XFDA 2OQIA 3QMMA 1BE0A 2CMFA 2XMDA 5FRDA 2XMSA 1Q0ZA 1O6GA 1UZAA 4CIAA 1R9NA 5EIAA 5AOCA 5ALUA 4HRXA 1UWCA 4IO0A 3WI7A 2CB9A 1XQWA 4MWSA 1EX9A 2PUJA 3PFCA 3QMVA 4CIBA 4ZREA 1CUAA 2QKYA 2WUGA 2CBGA 2OAGA 3WKAA 1EXWA 2Y6UA 1FFDA 1DT3A 2HHAA 2WQZA 3W9UA 4MYSA 5ALEA 1M33A 2XUDA 4BYMA 1DWQA 1YASA 2VSQA 3LCRA 4UUQA 4IHAA 1SFRA 5DTJA 4DLNA 3EF3A 3QPDA 2CUTA 5AO9A 5F4ZA 2XUFA 1CUCA 2WTMA 1VA5A 3FLAA 3A2NA 2AJLI 4W63A 3STXA 5FKJA 2VQ6A 5ALXA 3AUKA 1XZCA 3PF8A 5AICA 4QDUA 4HTAA 4X00A 3W9BA 4Y2JA 5EGNA 2PSFA 5AK5A 2AXEA 5DNWA 4IH4A 4Q3OA 4XWGA 1TCAA 5AOBA 5D7BA 2JEYA 5CXXA 3DYIA 1CUEA 2ACKA 2FUKA 2PPLA 3VKFA 4JH0A 2VA9A 1HKHA 4TGLA 2JGJA 1XZFA 5JAUA 3CCCA 3Q8WA 4OU4A 4GLBA 2ONCA 5BWBA 3UMJA 1LBTA 3C6BA 5FPQA 4UFNA 3M82A 4KAFA 1Y7HA 3IB3A 1LBSA 1THTA 1W52X 3R41A 4P08A 5HFNA 1A8SA 2FX5A 3PI6A 1WHSA 4GWLA 2IITA 2O7RA 4J0IA 1KU6A 1YS2X 4U2CA 3WMRA 3QYJA 4J0CA 4C4YA 5HF6A 1USWA 4EY7A 1FFAA 2Z5GA 2XQGA 2O2HA 5AK4A 4KYVA 5ALLA 4WJLA 2I03A 3NUZA 1J1IA 1R9MA 3DNMA 4U2FA 1K6EA 2XMRA 4AQDA 1OILA 5CW2A 1ZOIA 1XZAA 1XRNA 5K3AA 4Q3KA 4B7ZA 3MVEA 5JAOA 3WIBA 1AURA 3BIXA 1Q0RA 3PE6A 1XZKA 4FTWA 2HL6A 3DL7A 4EY5A 2BJHA 4HRYA 5AP9A 1ODTC 5LLSA 4BC1A 2FJ0A 3ZI7A 5E2IA 1UK7A 3FLBA 1XRMA 2V96A 2XUPA 1OXMA 1C4XA 2WIFA 3QZUA 3FYTA 3IUQA 4NVRA 5ALJA 3PUHA 3I2GA 2XLCA 1AZWA 3V1MA 1VOTA 4Y2RA 4FNGA 1W75A 5KWIA 3GROA 2PU7A 3I2HA 2QS9A 4I4CA 3E4DA 4BCDA 2QXUA 4UPDA 1ORVA 3AZPA 4EZIA 1UK9A 2H7XA 4O08A 3B5EA 1XROA 5FXMA 1ZJ5A 3O4JA 1EHYA 1G5FA 3EBLA 3S2ZA 3D2CA 1UKCA 1BEEA 1CUJA 3FLEA 1Q84A 2P8SA 2Q0XA 3DKRA 4TPKA 2GZSA 3BF7A 1D07A 4GHWA 2XUKA 5E4TA 4V2IA 4FFVA 2ZJ6A 1A88A 2JEZA 3PDCA 5HK9A 5D3KA 1CUYA 3ICVA 3VJKA 2XQFA 1LGYA 1LPSA 4H7FA 4QLOA 3DJYA 5LZ9A 3WZMA 3V9AA 5LKRA 1JKMA 4H77A 2DHCA 5FLKA 1CUSA 1UOOA 4C6HA 3RK4A 2HADA 3HRHA 5D6OA 2R8BA 1WCYA 2QOEA 4HXFB 1RYYA 2I78A 4GW3A 5EI5A 3O9VA 5ALPA 5FP0A 1L7RA 5CMLA 4QWMA 4QDTA 1QIEA 1UOPA 5HKAA 2ECFA 1WPXA 1H23A 4EBBA 2VAVA 2IX9A 3A70A 1XZEA 2QXTA 1NU6A 1NX9A 3FVRA 3OM8A 5HF9A 1EVEA 4CI9A 1SCKA 2QTBA 2WHPA 2Y6VA 3STVA 5AI9A 1G4HA 4CG2A 2J3QA 3T4UA 4CFSA 3DS8A 4GECA 2PKYX 1T4MA 5AIBA 4W9RA 2J4CA 3FBWA 3G0BA 5HF5A 1XQXA 2Y2UA 1IVYA 3HI4A 5JANA 2C7BA 5A6VA 3W2TA 2Z3ZA 2OCLA 2WSLA 4BDTA 1WB6A 5LZ7A 1CUUA 4Q3LA 3WWPA 5LZ2A 4KRYA 1XRPA 3STTA 3DOIA 3FOBA 5AKKA 3TGLA 1XRLA 4EUSA 4Q1VA 2XUOA 3H19A 4X94A 3IIIA 2WG2A 2OCGA 1UFOA 2B20A 2C58A 3H2JA 2LIPA 5C8ZA 5ALZA 3IVMA 2PSEA 2XUGA 1IZ8A 4GI1A 4HS9A 3SC2A 1QTIA 2WU4A 4L0CA 2BCEA 4E15A 4DMHA 4BTLA 5DWDA 3ZV7A 3LIIA 5AM0A 4HVTA 3ED1A 4UHEA 1BEZA 3B12A 4G8BA 3FCXA 4B9AA 3R3YA 4BCCA 3G7NA 2D0DA 2WUFA 3WJ2A 3D4LA 3DYVA 4FBLA 2B4KA 3BDVA 2JIDA 2PM8A 3F67A 1N1MA 4J03A 5ISMA 2EDCA 4G4IA 5CT9A 4K6KA 4C88A 4H35A 2JGLA 1CIJA 2HA6A 4OYYA 1K5PA 5HF8A 1LPOA 1GXSA 4X95A 1JJIA 2VATA 1ODCA 3W04A 3V1LA 3WK6A 2ZSHA 3GUUA 4WFIA 3A6ZA 3O4IA 4INZA 3WJ1A 5FV4A 3O95A 1FJ2A 4L3WA 3FYUB 4A16A 3I2IA 5JALA 2JGFA 4BVKA 4QLAA 1VA4A 1N8SA 2ORYA 2HA7A 1YAJA 3F9CA 2ROQA 1QIKA 4PNZA 1VE7A 2RIPA 1CUVA 3WL6A 4XVCA 4KE7A 2RAUA 1WB5A 4U2GA 2OCKA 4H7JA 3IULA 2WFLA 2WHRA 1YS1X 2GYWA 2O2GA 5YASA 2XUJA 1TK3A 2HIHA 4G8DA 1O6FA 1R88A 3ICWA 5ALQA 1P0IA 1RWQA 5KBYA 3E3AA 4ARAA 1BRTA 1NU8A 4N8SA 4X6XA 1CV2A 4BAUA 1CUIA 1X2BA 4EY6A 3BIWA 4W1QA 2RGUA 2OG1A 1ZICA 2OGZA 4OB6A 3L1HA 4H7IA 1XZHA 5K3FB 4LHEA 4BBZA 4LKOA 4BB0A 2XB6A 1QIHA 4KEAA 4RE5A 3UUEA 1UKBA 1LNSA 1GKKA 4RPCA 2QUAA 4BVJA 5AOAA 3I1YA 4B80A 5EFZA 4Y2VA 4B9EA 2DCMA 4MWTA 3H1BA 3EQ8A 1ODSA 1U65A 1LPAB 3BL8A 2C5GA 4NS4A 3C5VA 2BAGA 3BF8A 2ZSIA 3LLCA 4WDRA 1DWPA 2JGKA 1QIIA 1BN6A 3DQZA 5K3DA 5JARA 4MQLA 2HM7A 4MQMA 1ZD5A 2QZPA 1E3QA 3GBSA 5AKHA 2DR0A 1BU8A 5CURA 5K3BA 3STWA 5FPPA 1XZDA 1EVQA 5JZ9A 3AFIA 4FLEA 3WWDA 1ZI8A 4Y2TA 3G0GA 4FKBA 2Z8XA 1BS9A 4UFOA 5ALNA 1G66A 3E0XA 3HXKA 5ALTA 5H3HA 1WOMA 2ZYHA 3G9ZA 1L7AA 2WFMA 3HACA 3F98A 1QFSA 5CRIA 4AN0A 3D7RA 3WK4A 4Z49A 5AKEA 4DGQA 5EIHA 1E66A 1CLEA 2DHDA 4JYPA 1ZIXA 4J0JA 4LXHA 1EI9A 1BN7A 2QUBA 4NMWA 4Y7DA 1GPKA 4H7HA 4L9AA 3FSGD 5HCUA 1E8DA 4WCVA 1WPRA 4E11A 3G8YA 4PSDA 3H18A 3R3XA 1G42A 1MU0A 4QNNA 1XKTA 1WHTA 3I6YA 3DEAA 4M0EA 2WUDA 2AJ8A 4X91A 3ANTA 3MUOA 5SYMA 3LS2A 2PL5A 2ZYSA 3I2KA 4OPMA 4K2AA 4IH9A 3WL7A 3HABA 3WQHA 5ALVA 4MEAA 3ZLUA 5EHXA 6YASA 1P0QA 2WIGA 4U2BA 1W1IA 5AKZA 2UZ0A 2WJ3A 1CEXA 4K6GA 1YA4A 4G1FA 4PQEA 4HXGA 3WL5A 1XRQA 3WL8A 4QZVA 1W4LA 4LIPD 3WKEA 4BZZA 3STUA 3QM1A 2PSJA 4XJVA 4H7DA 2JBWA 3WK9A 2D5LA 4QWWA 5IH7A 5JADA 2HDWA 3C6ZA 1EK1A 4WY8A 2C4HA 1XLUA 5DLPA 4EB0A 3E1GA 2YASA 2Z8ZA 4J0GA 4KE9A 3OTQA 2HU8A 1SOMA 1H2WA 2GYUA 4Y2QA 3NWOA 5ALGA 4UHDA 5D3ZA 1MX9A 1XZGA 2XUHA 2PSDA 3V48A 4AO6A 2WJ4A 3AZOA 1AX9A 3K6KA 4Y2SA 1YCDA 1J06A 2H7CA 3R3ZA 4AZ3A 4CCWA 1OCEA 4DMCA 1UK8A 1K4YA 2PU5A 1MX5A 4TVKA 3KD2A 4BRZA 3X3HA 2QVBA 1H2YA 2DQZA 3LP5A 2JGMA 1GPLA 3PFBA 5K5EA 1EH5A 3AINA 3SWWA 3WA7A 4G4GA 4PSCA 3OURA 1XKLA 1DWOA 4BATA 1P0PA 1CPYA 3QITA 3C70A 4G4JA 4C4ZA 4JNCA 4X6UA 1LPMA 4S0XA 5T4BA 2QJWA 2WKWA 1E89A 5CBKA 2J3DA 1AMNA 1TCCA 2OLEA 4G9GA 2OGSA 4RE6A 1VZ2A 4OYLA 3D2BA 2DFPA 2AJBA 1UXOA 5AHXA 1THGA 2WLSA 1CQZA 1CUFA 4WDQA 4AN1A 3ESAA 4EHBA 4I3FA 1N5MA 4DIUA 4CCYA 5FOQA 3RKSA 3C43A 2OQVA 1A7UA 3M81A 2WM2A 4UBMA 2BGNA 2O7VA 2FJPA 4DYHA 1DX4A 3WKBA 2W6CX 5AKLA 1MO2A 1Q83A 1Y7IA 2WTNA 4X85A 5AM5A 1R50A 1PV1A 4Y2XA 3D2AA 1GGVA 3FWHA 3VJLA 2QR5A 3G02A 4Y2PA 3O9MA 3I2JA 4UHFA 1BCSA 3O4HA 4OSEA 4WFKA 3HZOA 4L72A 2HU7A 1ZI6A 3DLTA 4DSZA 1GZ7A 4ZRDA 4WY5A 4B0PA 3IBTA 4EA6A 1TQHA 4CG3A 1QZ3A 3O4GA 1LPNA 1IUOA 5LZ4A 2V98A 1Z68A 3U0VA 1QIGA 4BC0A 4B82A 2XI4A 4X71A 4YX9A 4F21A 2WFZA 3WYDA 3ILSA 4KACA 1MPXA 2BUAA 3HYSA 4B85A 1AUOA 4UBLA 3H2IA 5LIPA 2CKMA 5ALOA 4Y9SA 1R3DA 4KE6A 1YA8A 4ROTA 3I2FA 2G63A 2WG1A 5LKAA 1XRRA 2VT6A 5DTIA 1CUBA 4A23A 3C8HA 3QVMA 3C45A 3L1JA 4BP9A 1WB4A 5CT6A 1U8EA 3OPMA 2XE4A 1E8MA 4DNPA 3FSGA 4Q34A 5ALWA 2XDWA 3DL4A 1VJ5A 4FWBA 4DSAA 4N5HX 1ZGBA 1JJFA 3C6XA 4H7EA 4Y2YA 2HA5A 1FFEA 3G0CA 4FLFA 1CUZA 3D3NA 5ALRA 2HRQA 3H2HA 1PJAA 3SK0A 2XMQA 3R3UA 2EEPA 1ZJ4A 2JGEA 1IUNA 2ZJ7A 4ZV7A 3WK7A 1U4NA 2XT0A 4QE3A 1CQWA 1TKRA 1EDBA 1SCQA 3WKDA 3GFFA 4C4XA 5CH3A 2IIVA 2C0QA 2DSNA 5AM3A 1PFQA 2WHQA 5JIBA 3K9BA 3W06A 2RHTA 3ZPXA 4H0CA 2VJBA 3WLAA 1WM1A 1U2EA 2E3JA 1BCRA 3R0VA 3WWEA 1SC9A 1MJ5A 1KU0A 4G8CA 4U2DA 4OCZA 2WHPB 4UBNA 3A2MA 2X8BA 5JD5A 5A7FA 4FLMA 2GBGA 2V97A 3NOXA 5HFAA 4ITVA 4JUIA 1ORWA 4PO3X 5LZ8A 1FFCA 3STYA 3IUMA 1EDEA 5A7GA 2HA0A 3C5WP 5K3CA 4Q82A 4QDOA 4AX4A 4MEBA 1GQRA 2GBCA 2G5PA 2XMZA 4RGYA 4WFJA 3C8DA 4XX1A 2WILA 3FAKA 4QDXA 3VISA 4ZWNA 5HKBA 1UOQA 3Q0TA 2OXEA 3HEAA 4FOLA 5EHQA 1H22A 2NW6A 5DYTA 2RONA 4PSUA 3GZJA 4RNCA 3DKKA 3CN7A 4EY8A 3PF9A 2Y1KA 1JMKC 5AKYA 5IVDA 1CFJA 2GBFA 3RLIA 2WJ6A 2BKLA 2ACEA 4KAJA 5DJ5A 4J0DA 5JZSA 4AB1A 3JW8A 4Y2UA 1X70A 1MNAA 2C0PA 4E14A 1H2XA 4DNQA 5JZBA 1ZGCA 3ZWQA 4OUKX 2QM0A 4UHBA 4YASA 5C8VA 1Y37A 3AIOA 1C7JA 4BCBA 2PUHA 4B84A 1QIJA 5JAHA 5IVHA 4ARBA 2WIDA 1ACJA 4FHZA 4LXGA 5CTAA 3JYHA 5T4HA 2XQIA 3F97A 1MNQA 4B81A 1R1DA 3QMWA 2EDAA 1UK6A 3M83A 4J7AA 3QPAA 5ALYA 1JU4A 2HA2A 2HU5A 5JD4A 3D0KA 5EHZA 2ZYIA 1QOZA 5AJHA 2JGIA 2QMQA 2I3ZA 3H2GA 5IVKA 1CRLA 3KDAA 5CT8A 4NZZA 2RHWA 3D59A 1ISPA 1YSCA 3DCNA 4ZGBA 2YXPX 4E46A 2WU3A 1RP1A 1XZMA 1A8UA 3G9TA 3IUNA 4BAZA 5LYYA 2WFLB 1DX6A 1CR6A 3ANSA 4U2EA 3HJUA 4UFPA 3BE8A 3AIMA 2I3DA 3C87A 5A2GA 5AM1A 3AIKA 4DNOA 3I6MA 3WYNA 2VJAA 4F0JA 2BFNA 1S8OA 4BZWA 1VLQA 5ALDA 4B83A 3H04A 2O2IA 1XZLA 4P9NA 2G5TA 2W22A 1QIMA 1W76A 5C7YA 4DMKA 3HLKA 4N8EA 5JASA 1ZIYA 3L1IA 2HA3A 1H2ZA 2XLBA 3H17A 1VXOA 1J2EA 3U1TA 3WZLA 4BVLA 4YPVA 2OAEA 1VZ3A 4K6HA 5ALHA 3QPCA 3A2LA 3WKCA 2Y2VA 2H9YA 1FFBA 2RI6A 2JF0A 3UUFA 3ESBA 3G9XA 3P2MA 3DD5A 1QTRA 5T4FA 1FSSA 1K63A 4N5IX 5E4JA 4QA9A 4M0FA 4KR0A 3S8YA 1EINA 1ETHA 3NGMA 1YAHA 1MTZA 5A7HA 3PICA 4J3JA 3EQ9A 3OC0A 4FFWA 3R3WA 2X76A 5KREA 5ALIA 3H2KA 4GEGA 3ZLVA 4LYEA 3FCYA 3R40A 5A62A 3HSSA 1ACLA 5AKJA 4D9JA 5HQ3A 4JEIA 5BWCA 3CXUA 4J0KA 1I6WA 4FBMA 2Z3WA 5CH5A 1J07A 5AI6A 5AM4A 4BE4A 5FDFA 1YR2A 1QIDA 3G0DA 4AMZA 2CZQA 2GZRA 5DYYA 4UBOA 1MT3A 2XQJA 3N2ZB 3WWOA 1W6RA 3VVMA 1JJBA 1XZJA 3WK5A 2AJCA 1JFRA 2HFJA 1GPNA 5KWJA 5C81A 2C5FA 2J4FA 3IUJA 1B6GA 3ZLTA 3G0IA 1F6WA 1LZLA 5AM2A 5DNUA 3WWCA 4ZI5A 2WIKA 4FMPA 4H18A 4KAAA 2XUAA 1HDEA 4X3CA 2WUEA 1VE6A 4HXEB 1VXRA 4X6YA 1ZD2P 3AILA 4BAGA 1EB8A 3W05A 3F8SA 5I7UA 5HK8A 3FYUC 4FNMA 5AI5A 1E8NA 4X7BA 4A5SA 3I28A 2OPHA 2HRRA 1ZI9A 4QDZA 3KWJA 5FUMA 1TIBA 1DU4A 2VF2A 1QO7A 5JATA 5EIEA 1N5RA 1DT5A 3GELA 3YASA 2XUIA 3MGAA 5HZGA 1MAAA 1JU3A 1F8UA 5LP1A 3M3DA 5JD6A 3R3VA 4IH1A 5AKGA 5AI8A 5JYCA 5HQ3B 1LZKA 1MX1A 3JWEA 4EY4A 5C8XA 4UBJA 3SX4A 4BRSA 2WIJA 4GBGA 4C87A 3OOSA 2DQYA 3ESCA 1JMYA 4YK7A 4AO8A 3B3QA 2GYVA 1QONA 2BUBA 1VKHA 4KE8A 4ZXFA 4W1SA 2WG0A 4OB8A 4ETWA 2H1IA 3IURA 3TJMA 4HAIA 4GDMA 1DINA 1CUWA 2XMGA 5AK6A 1R4ZA 4HZGA 1E5TA 2QT9A 2XQKA 4J0HA 4UHHA 1BROA 5LZ5A 1F0NA 4M0MA 5E4YA 1C7IA 4BE9A 2G4LA 4X92A 1HLGA 3BJRA 1EB9A 1IUPA 3KSRA 3RM3A 1GT6A 3CN9A 3QBJA 1TAHA 1DQYA 3D5EA 5K3EA 1HL7A 3FNBA 1UKAA 4UBIA 1MAHA 4AMYA 4QEKA 1EK2A 4CCYB 3BJMA 4BDSA 5T4EA 1YB6A 3K2IA 3F96A 2XMCA 4PV7A 3WA6A 2PX6A 2VEOA 1X2EA 1DQZA 4X97A 4MYDA 1T2NA 1HQDA 2CEKA 4N8DA 4G9EA 5ALSA 1AQLA 3KXPA 3TRDA 3WIOA 3H0CA 5I8PA 1LPPA 4PW0A 1IZ7A 3BXPA 5AIAA 1HBJA 1QO9A 4BTVA 5A71A 3FYUA 2PSHA 1MN6A 2DHEA 3C6YA 4DM7A 2OGTA 5CT5A 3AJAA 1DTEA 3DDUA 1HPLA 1UT6A
chains in the Genus database with same CATH superfamily
2QJRA 2DKNA 2NSDA 1SR8A 1WQ1R 3MUNA 4KJXA 2YUIA 4KO2S 2CLFB 1T4DA 2HIGA 1H4TA 4FR2A 4FE3A 4HQNA 4DPLA 3V8EA 1L7BA 1INLA 2B82A 3AVTA 3PPWA 4PZUA 1PJ2A 3ND8A 3DZFA 4TMWA 4R51A 3T52A 2IYWA 2WW8A 3R5HA 1WCWA 1FXSA 2CNKA 4N6NA 3NX4A 2CJPA 4IDBA 2GM5A 3A9CA 3S40A 1LTKA 1ZVVA 1AUVA 1TJPB 3FTFA 2X5XA 4QREA 3VRHA 3V1NA 2VUSA 3I05A 1AQUA 3MQ2A 4QELA 5CHEA 4N7MA 2MDTA 1H3NA 2A7QA 5BT8A 1P1FA 1DZ3A 1PJSA 4KSBA 4DV0B 4G09A 2QP9X 3D8TA 2LIVA 4FPXA 4K5QA 1YFKA 5IKXA 2OHFA 1M8PA 2VRWA 3TRJA 4PTZA 2UUOA 4G1VA 1QRUA 5DX0A 1OAAA 4D9MA 3FM9A 1WSAA 1L4YA 2HK6A 4KIFA 5CM9C 3NW9A 3F6CA 4RZUA 3MWDB 2QR3A 1XJCA 4I9GA 4QUAA 1I9GA 2HI0A 3UXHA 3FVVA 4L6AA 5K09A 1IBSA 2BGRA 4LYHA 1V16A 1DCKA 1EYZA 2P0EA 3T0GA 2B92A 4YP0A 5JFTA 5JQGF 2IUYA 3RV4A 2B61A 3MTAA 1ZQ9A 1KIMA 4MV3A 4AYTA 4LF5B 1FUKA 2LGJA 2DLNA 1XCJA 2GEKA 4MWBA 4Y9DA 1RKUA 1MOSA 1D2GA 1QJ4A 2VDRB 1EFRA 2YH2A 3KQVA 3RG2A 2PVSA 5REQA 2FMUA 1GPH1 1CVRA 5E9JA 5AVYA 1QMGA 2RBKA 4YCLA 3DLHA 3URMA 3LBNA 3SCZA 3PGXA 4B87A 3LQ4A 2IXTA 3ZBQA 4AXBA 2Q3BA 4LOHA 5HMMA 4W9MC 5BOVA 1Z25A 3NRJA 2PGDA 4XAQA 2V9ZA 3N0TA 2XNJA 4MI6A 1DIHA 1KMMA 2OXCA 3EIOA 5FUWA 2OO5A 4BZQA 2CXHA 2FPWA 1PBTA 4UEWA 1QRDA 1DZIA 3MWEA 3B82A 4I5DA 3VVLA 4RPLA 4AJ1A 5LDGA 3WLRA 1ZGJA 4IDHA 4UBKA 4K9DA 5H70A 3EGXB 5EUBA 3QH4A 1KI1A 3PI7A 5BNWA 1ZXBA 5FBLB 3OCYA 3ICEA 5EZ5A 2JIPA 3NBKA 1HR0B 3HMKA 3OEHA 1ZISA 3NPAA 4WA7A 3WRYC 1HTBA 1K3FA 2GKSA 5JXWA 1UDXA 1F4VA 2QWXA 4JQCA 4CG1A 1NULA 2AZMA 1KZYC 4MJ3A 1S4MA 3OM0A 3QYAA 1PR6A 2PT7A 3GEBA 3OHSX 4GWGA 3UEOA 3TZEA 1QZTA 2PKWA 3KOXA 4WOBA 4M8IA 5AVJA 3ZVRA 5J3JA 1JQLB 1O03A 4PHHA 3EZ6A 3RPEA 1DQSA 2Z4RA 5EHNA 2GMWA 2V5VA 4MXDA 3KYIB 3DXFA 4ESEA 4MPJA 4JCOA 2QRMA 4RMGA 3M3HA 3RIYA 1C7FA 1XQVA 3NHYA 4IIUA 5AKIA 4PE5B 4F6RB 3B7WA 5M7EA 4GX5A 1P0MA 2PGLA 1DI0A 4HCJA 3U37A 4QUBA 4WCFA 1XE3A 4JS0A 3RC2A 5HPYB 1EDDA 1N5LA 3E15A 2CHFA 3FIUA 4I19A 1DO0A 1SOAA 2L2QA 3QYFA 3RRYA 3U3JA 1LV8A 5KYUB 3GQVA 4RJTA 2NPIA 2PLFA 1T8PA 5FT9A 1E2NA 3NIGB 4S24A 3BFJA 4H7KA 4FW9A 1B74A 1GSHA 4K9KA 4EA8A 3RSSA 4EEZA 3A2KA 4Q03A 2H59A 2XHEA 2XTNA 4ZO7A 4CQLA 4HEJA 1VIVA 2CL0X 3LX4A 5ELXA 4TL9A 5GJCA 1ZZEA 4Q1AA 1DIAA 4EFMA 3H6GA 1VCOA 2ZSFA 3ZUPA 2DR2A 2W6ID 1KI2A 1RDFA 1FQKA 5ALFA 1WPQA 3TBFA 3AC0A 1AC5A 1Z35A 2C95A 2FSPA 4P4TA 4Z1MD 2HSZA 3LT5A 1IXYA 4CTJA 3KKKA 1VGRA 2Z95A 2FF5A 3WIDA 1KDTA 1CQJB 2CXRA 2JRCA 2Y4OA 1HZJA 5DLEA 5K8IA 4IIGA 3DE5X 4MMZB 5E4FA 4DLSA 3CNQS 5SYNA 5L3SA 3SJBA 3VXKA 3DUFA 1OYOA 1YQ9A 4KXFB 5EPUA 3LLMA 1V16B 4F60A 4JLVA 1NN0A 1TCBA 3NR2A 1EXNA 1FDRA 4LRSB 4DTCA 1QR6A 3KYJB 1X80A 2IK8A 4YRCA 3ICQB 5LMUB 2PBLA 3F3KA 1WL8A 3H97A 2XMBA 3O83A 5IMSA 2B5WA 1QE3A 3U5TA 2VAXA 1VQ1A 1V8ZA 3Q7PA 2ES4A 5CA0F 5DX1A 4AJ4A 3IEMA 4NXNB 1TO2E 4Z3DA 2R96A 3N6VA 2HNKA 4YIKA 3R9KA 2AFRA 4Y6PA 4DIMA 1V1MA 2Q46A 3CPHA 1E0KA 4JFRA 1SVKA 1T3HA 5IAKA 5J5CA 2LCQA 4J1QA 4EUHA 1MOZA 1NJ8A 3G2OA 5KJ6A 3P0IA 4DB4A 4X93A 1HRKA 1ZGGA 3QVWA 4YT2A 2A8YA 1Q12A 5JXJA 1K5HA 3M33A 3IA2A 5FIUA 4C7JA 4QUJA 2YFQA 3GLSA 3J80A 2CVOA 4KGXA 1K6IA 2EKBA 1VP3A 3TEJA 4Q1BA 1QYIA 4FDMA 3ZE9A 3ZH2A 1IJEA 4XIIA 4Z2YA 1KAQA 1NQVA 3KXKA 4MUMA 3HYRA 2R0QC 2ZR9A 3R6TA 1G6HA 2I55A 2W2OA 3G9UA 4JSTA 3VJMA 2Z2JA 3O0DA 5CEJA 2GNPA 4OKNA 4G5XA 4JB3A 4JLUA 1GN8A 4WLUA 4WW0A 2AR0A 2VNJA 3OZXA 5K0NA 2NADA 3SZLA 3G3EA 3VH3A 1ONNA 3ZGNA 1NMQA 1BE0A 2E49A 2ZRGA 3L8YA 3MTGA 3R7LA 2BGWA 4YJ3A 1NVBA 2NUTA 4XFDA 2CHGA 2PZMA 4GLOA 3UH0A 4ME6A 4D8TA 1MPTA 5ED4A 3S1LA 4HATA 1DEXA 4CIAA 5AOCA 5CDFE 1IHDA 3SQMA 1A69A 2A4KA 3L40A 1IG0A 3WI7A 1TM3E 2LZ0A 3CPEA 2JJQA 2OXIA 1NHWA 4TXMA 3V6MA 3OQHA 4BRUA 3LQFA 4CIBA 4FR5A 5HILA 3TIXB 4RVOA 1LQ2A 1T9KA 2OB1A 1WO8A 3RV3A 3EB9A 2OAGA 1E3WA 5DMXA 2PT6A 3SAJA 1AH2A 1QF7A 2R8XA 2P9GA 3FCCA 4IQ0A 1A97A 1GDDA 3VOBA 3LVBA 4ZZ2A 8ADHA 4LVOA 2V7EA 1RWOA 1QU2A 3BTVA 3R7WA 2Y6UA 4BV8A 1FYFA 2H2DA 3LX8A 3MSCA 4P7BA 4D4LA 4DLKA 3ND6A 5J47A 3RYCB 1PYOA 3PJEA 1RCTE 3GRKA 1LVUA 3IOEA 4A6EA 3L7YA 3UK1A 2J46A 3JU3A 4EHFA 3CUEF 3DL2A 1M33A 3LRTA 1BJRE 1U81A 3FNEA 5JTTA 4BYMA 3DWGA 4RXTA 5KJFA 5FOXA 2C3UA 2QPAA 2YQ5A 2I0FA 3K92A 1SFRA 1DG9A 4DLNA 1VRVA 5DCUA 3QPDA 5IJ0B 1SUDA 1G3RA 2GHQA 3C4JA 3KZKA 4WBSA 3D5QA 2ZRBA 2P0AA 1LF0A 2GBPA 2XVZA 2ZWPA 1L1FA 2DTDA 2CE2X 4WK6A 1J8QA 1VG9B 1Z5GA 5C3MA 4XLZA 3EVDA 4RVFA 1VA5A 4E51A 1YRAA 3FLAA 3WLLA 1HEUA 3DTTA 1M5RA 1YB2A 2AJLI 2FZ5A 5KI6A 1T9AA 3STXA 3VHXB 1O8CA 2VQ6A 3DUFB 3K16A 1QCZA 5TMPA 3KVYA 1UMDB 4NATA 5CD1A 1EUDA 2OMEA 1FVHA 1CETA 4LC0A 1QQBA 2B99A 5EEGA 2WWFA 4EI2A 3C2QA 3NHSA 4RD1A 1CR1A 3T41A 1Q2XA 2PSFA 2WZQA 3ESXA 3HKDB 2D1FA 3KFXA 5CIQA 1M8GA 5HQTA 1F1BA 3FBTA 1ORIA 1V1MB 5CXXA 1P7CA 5TRTA 4NOMA 1NXQA 4PC1A 1CUEA 2FUKA 1NGSA 4NAUA 3GVXA 3L9XA 5C8YF 2EGHA 3LRXA 4LV5B 3VKFA 4AKGA 4RJKA 1Q7GA 2YRXA 1Y33E 1LDBA 1FJXA 4Z0HO 5JQGA 3HKBB 4M8LA 1BDIA 2Q6IA 1XB2A 3MCWA 3AXSA 3Q8WA 3PGMA 1O0SA 1N7GA 3WQQA 2XD4A 4OQPA 3H5RA 2V5AA 2CXPA 1PKXA 2IKQA 3RSZA 3WADA 4KPEC 1PL8A 3BHNA 1L2TA 3S3TA 3B8HA 1LBTA 1O95A 4JQOA 3QXGA 1FYVA 4FGKA 2HTEA 3K8OE 1A7AA 3Q9SA 3TX6A 5FPQA 3PG5A 3VR5A 2R1VA 4ACBA 4FM9A 3K0EA 2MT9A 4RPHA 5H1YA 2ZSJA 3M82A 1DCFA 4W9NA 4YFYA 3WLMA 3IP9A 4R1NA 1Z4JA 1I2ZA 1F9EA 3LY9A 3MIZA 4N76A 4UXIA 1Z36A 1Y7HA 3E3OA 4MEJA 1ISSA 1QO0D 1U0GA 2CHUA 3DT6A 4GPTA 5HFNA 1P4GA 5JWHA 3DMPA 5BXQC 1EFPA 3DXXA 1A5ZA 3A9UA 4IDCA 1T1SA 1TUBB 2W8ZA 2IVZA 3D02A 1T43A 4GWLA 3KU4A 3GUZA 2IITA 2O7RA 1EQAA 2J85A 1YS2X 3GDWA 3WMRA 1OBFO 4A0GA 3PHBE 4RORA 3PHLA 2OD7A 1Z74A 2BTOA 3NC0C 1OROA 2PT5A 3I5XA 4G84A 2VG8A 3R7WB 1QH8A 3AT1A 1QG4A 1YR3A 3ESQA 1CTQA 3OAAA 3D8RA 3VYRB 4EY7A 2FZEA 2LVBA 3AYXB 1SHZA 5K6TA 1ECJA 2O2HA 1I1QB 4LZNA 1UWKA 3ZLBA 3LLUA 4CHGA 3GVCA 4EF4A 1A5SB 4ZZIA 5C18A 1E3TA 3AP2A 1FJGB 3NUZA 2FGJA 1J1IA 4G5YA 1Y3CE 1R9MA 1XLTC 4BBJA 2BI7A 4GXQA 3LC7O 4YJKA 4BO5A 1CNMA 2E5LB 1KSJA 2ZE5A 2WU0A 4RK4A 3AMVA 1C1YA 2PMDA 2P69A 5BSUA 5G02A 1XZNA 2ZJZA 1CIVA 3THXA 2ADMA 4RHCA 4U0JA 1QRTA 3EWNA 3JQAA 4GMXA 3WGZA 4BQEA 3C3JA 2A5GA 5IJXA 4BO3A 2GK3A 3WHPA 2VRCD 4RJLA 3O73A 2FRDC 1T0JB 4OM7A 3L43A 5DSZA 5K3AA 1N2SA 4MP6A 5KNBA 3Q6MA 1KI6B 1SKQA 3BWVA 3MTIA 1GNSA 4Q3KA 4B7ZA 1WCIA 4P81A 2JLSA 1SBQA 1VJ1A 1DG1G 3GT3A 1AURA 2PJZA 1JDBB 3NM6B 1EUDB 5C31A 1NYQA 3RH0A 4RF3A 1O5TA 3EDCA 2Z1DA 1UJ5A 3GG9A 4H1TA 3T5BA 4F3KA 1LC0A 5FEUA 4RZIA 1J7JA 2C2MA 1RHUA 2OORA 3JQDA 1Q7CA 1R9GA 3PKZA 4LOIA 4TRRA 1N9ZA 1WXGA 1JJAA 1VHWA 1ZOOA 3D3JA 2UAGA 2BJHA 5KJCA 1EQ2A 2ZP1A 1T5HX 2M2IA 3I39X 1HSZA 3L0SA 2VNIA 2AW3A 3P97A 5AW0A 5AP9A 2FR1A 4YRMA 4ALIA 1GL6A 2PAFA 2WDPA 4QFCA 4EHDA 5ELMA 2DAPA 1FUYB 2QE7D 4QUHA 4KXNA 4TZTA 1LI5A 1QYXA 2FP4A 5E2IA 5AOVA 2OZLB 2OZKA 2VOJA 4L6IA 5MF6A 5JQGB 1J9GA 1XRMA 3LQRA 4DLUA 5FD8A 1TW3A 3HEBA 4DMGA 2WA1A 3K9LA 3H87A 5EWJB 3EN0A 1C4XA 3DAOA 2F8TA 2FMIA 3HYLA 1ONPA 5GGXA 2PWAA 5CA0A 5KMGB 1JQ3A 1PCXA 2C5BA 1XPUA 5FBHA 3EDMA 3IUQA 4KQ6A 1MA0A 3WLTA 3ZU3A 4P3YA 2COUA 1JH8A 1TVMA 4MQBA 1UT5A 4UQOA 4QQ8A 1H85A 4C43A 1K4KA 2R1VB 1DTWA 2VK2A 3FNRA 4LJ9A 4FMBB 1U31A 5EZ6B 1A5AB 1C2YA 2Q21A 1VOTA 5BWLA 4GDFA 4LX0A 2VBGA 1P2GA 2G17A 3Q3IA 4MUHA 2JAWA 1P29A 1GZSA 1HE8B 1ZOLA 4I4CA 3K6JA 1BIFA 3RASA 3D8UA 5B2FA 3CC8A 5EQFA 3ZGLA 4NBRA 1ZMRA 3CWQA 3TEFA 2AG1A 2AF3C 1FP4B 2Q0HA 1ORVA 3E9MA 4JEUA 3FMOB 5DO9A 5JE8A 5P8WA 5K0TA 3KSBC 1UK9A 4L5CA 4UHKA 5AJTA 3ROTA 1OWPA 4O08A 3AF6A 3A6EA 3NTVA 1VPVA 2PMCA 2F3UA 3X1JA 4ZDJA 2XKKA 2A5FA 2MTBA 2KYRA 4LFAB 5CR9A 4UTOA 1G5FA 3AHDA 3S2ZA 2XGMA 4Z7OB 3EMDA 4RY9A 1M75A 3ORRA 3D2CA 4X60A 1R9JA 4MGKR 3D4IA 1L9XA 2AOTB 4M2LA 2VDNB 2NZVG 1VIAA 4JJAA 2VL7A 3M5CA 1OUMA 2Q0XA 4CMIB 1EP3B 1L5OA 1D0SA 3QEBZ 5AW9A 5MHTA 4XQ9A 3UW3A 1AK1A 4TPKA 2GZSA 3BF7A 1NBAA 1TF5A 3LECA 3QHAA 1ZLXA 4UPVA 3INTA 3RAJA 3THXB 1CJVC 1FSZA 3UV6A 6Q21A 3QE9Y 2EX4A 1OTHA 2PFGA 1T6NA 1TEVA 4IPTA 3E1SA 1A88A 2J6HA 1XD9A 3B9QA 1PLKA 2GZMA 1ZVQA 3KWLA 3PDCA 5GOTA 3BSWA 2CFSA 3SI7A 2WJHA 4NY1A 3H4VA 3A1WA 2WWGA 3MS7A 3ZZUA 3FKJA 1KFKB 4H3HB 4DY6A 1GGFA 1UM9B 2G06A 1MLDA 1JPUA 2P3SA 3HRKA 2GF9A 2OZVA 1LPSA 3B1XA 3F4KA 4H7FA 4L0MA 4O4HB 2IE8A 4IYRA 5LZ9A 4FYHA 3WZMA 5HJEA 1KMHB 2YL2A 1A72A 2ZR0A 4HGZA 4R8VA 2J30A 1TTHA 5ER6A 2V1XA 2GD0A 4CNBA 3ITDA 3GHYA 3ZCRA 1YZNA 3OPXA 5JCOC 3IA7A 4ZEVA 1LS1A 1KC1A 1L4UA 1BKDR 1IULA 1OFUA 2E4YA 2OECA 2Y92A 2HADA 3GJ5A 4YUVA 3K4QA 3M5DA 2IDZA 2V0GA 1F8FA 4UNSA 4EHLA 4ZT5A 4EO4A 1N6RA 2YWFA 4DRXA 1WCYA 2B21A 2ODWA 4JGGA 1NUHA 2I78A 3OPYB 4GW3A 4MQEA 3ZUGA 1YVPA 2Q4RA 4K2HA 2JIZD 5KO2A 2QW8A 3JVEA 1H65A 4KO4S 1PNTA 1SQ6A 3DHWC 1PBNA 1U8AA 1D1QA 5CMLA 1P2TA 3P27A 5HKAA 4CMKA 4JV5B 3AF2A 3BERA 1WPXA 4EBBA 3HVIA 2HF2A 2ZG6A 4IWYA 4NYJR 4GFDA 4B6SA 3DE3X 1CHNA 2IT1A 4QNRA 1XXHB 5FORA 4KXQA 4D74A 1O9HA 1XZEA 4PO1A 1VIYA 3OQBA 2QXTA 3IRUA 4PSKA 2OFOA 3A4NA 1T1IA 2JK1A 5IULC 3FZEA 1NXSA 4RWEA 1NX9A 3VSCA 5A5VA 3OM8A 4YRAA 4QM6A 1VI2A 2Q6TA 5EXEA 1NN5A 3DTVD 1EVEA 2EW2A 1SCKA 1X7ZA 2O2JA 4BFXA 4OFBA 1KOGA 1F6BA 1MAVA 4UMFA 1XL0A 4EG7A 1EWKA 1OIVA 4D9NA 2WB2A 3GGJA 4UCQA 3VHQA 1G4HA 1P8AA 2B98A 2O52A 3E8XA 4MI9A 3AR4A 4C20A 4CG2A 4D92A 1PEKE 1UBMS 3AI7A 2X6TA 5AXCA 1GT91 3NMUF 2CFCA 2AEFA 1U8CB 3PTLA 3V33A 1KIAA 1QB7A 3DS8A 1IOWA 1G17A 3KVVA 1M2KA 1IOZA 4W9RA 3FJ1A 3V8MA 5HF5A 1NBIA 3DF9A 3GMIA 3OUTA 2RHHA 4ZK6A 3TGPA 3IJPA 5CJ2A 4HNAB 1H9BA 4PYOA 5JANA 4PR3A 2HMVA 2C7BA 5H68A 4B09A 1D1TA 4YV7A 2TMYA 4FHEA 3W2TA 5JCXA 2GLUA 4QQRA 3TZBA 4CMCA 1YZKA 3NHLA 4GAEA 3O91A 4MKGA 3S1AB 4B4KA 2F3SA 4EECA 4RPJA 1RC8A 3NHKA 1WB6A 5FI1B 5LQUA 5HDBB 1TZ2A 3ONEA 5F52A 1TC1A 3QWBA 4MHSA 4QU8A 3VZDA 5LBIA 1HDXA 7GPBA 2H2HA 3JPYA 4KRYA 1AKUA 1OX4B 1J20A 1JXAA 1PEDA 4H1HA 4M0KA 4CM8A 2ORVA 1X1EA 2HQRA 3FOBA 3NJ8A 3S29A 4R0VA 4EF6A 1N9GA 4RHFA 4QYTA 3FDFA 2W6ZA 5AR1A 4F8EA 2F8LA 2V6GA 2VTDA 4QPDA 3UJNA 4R2IA 5FWXA 2GAIA 3CW8X 3MBKA 5J2UF 2JDID 2YZMA 1J7KA 2ZDQA 4X94A 4AMGA 4CFZA 3HB0A 4HPWA 4BKOA 2WG2A 1E18A 4US0R 1TMKA 2GZ1A 1UFOA 2AA3A 5E9AA 2BKXA 4B3DA 2C58A 4N6GA 1BFDA 2Y1GA 2RGNA 4HFMA 4HWTA 4UUAA 4CM7A 4F2WA 3H2JA 3ZVKA 4LWQA 1SHJA 2R7LA 4CIVA 1SIBE 4ASUD 2OHIA 4Z4CA 3GYBA 5C8ZA 1E4YA 1MABA 1SC1A 1TK9A 1ZUNB 2D5CA 2P30A 3EK2A 4NYIQ 3T1YB 4FU0A 3DNFA 2AXNA 3ZHXA 2HQ1A 1F3OA 3SZ3A 4PWZA 2F43B 2DGDA 2NZ8A 1CQIA 4GI1A 1G21E 4HS9A 4RM2A 1P1JA 4B80A 3PNOA 1VKOA 4I1PA 1XVAA 4Q3NA 3TQTA 3E9CA 1VYUA 4DRXB 3CVXA 1ECPA 1NAHA 1POXA 3TH5A 4E15A 4JWTA 4NAHA 1XP8A 4P98A 3KLOA 2OFPA 1NBME 3ELUA 1YZFA 5DWDA 1HORA 1KI8A 2HHJA 1H8ED 3ZV7A 3KG2A 4MVJP 2Q4DA 4LRXA 3GUHA 4G81A 4BUCA 2RAPA 5DBHX 3AEYA 3RIMA 2IYPA 3FA2A 1N1GA 2OV2A 2LDXA 2XVAA 3ED1A 1SKUA 1PJTA 1XPJA 4OQQA 1UBUS 4DLXA 4OQXA 4G8BA 3FCXA 3WNCA 3VNAA 3ADPA 3WHKA 1ISMA 4BWVA 4ZYXA 4RTQA 5I9LA 5IKEA 1MXFA 1ZKDA 3CUWA 2D0DA 1GZ4A 1LH0A 2JLQA 2WUFA 4P3OA 4PC3A 4M7RA 1U98A 1CQPA 4PX2A 5BVHB 1TF2A 5DNCA 2PR2A 3O38A 3QG5A 2QRKA 4JEHA 1WIWA 3TBHA 1Y7PA 3AV3A 1YFLA 2B4KA 1RAHA 1US8A 1NY5A 1F0KA 1N6HA 2Q99A 3D6JA 3RSLA 2MYNA 5E8RA 2DKFA 3BDVA 3ZIDA 4A03A 3EYWA 4BFSA 1N7HA 4DWWA 2AGVA 1N1MA 1T2VA 2DUNA 3RS3A 2H63A 1VBFA 1WU7A 4DA8A 721PA 5ISMA 2AV6A 2EDCA 3AY3A 2A5JA 2CSUA 4YCCA 4DYDA 1ZK1A 1OXBB 2IYVA 2NXCA 3BZUA 1G8JA 3OFSA 1SVMA 1GPMA 2BKEA 4YMSA 4CEHA 3FNFA 1CIJA 1I9CA 3W6NA 3U4AA 5K20A 4OYYA 1MIHA 1K5PA 1I3KA 2WZBA 4I1OA 3CEPB 1AO3A 2H85A 3N2LA 4QIHA 4DM4A 5JR3A 2AF4C 2GJAA 4ZICA 5CA1B 4X95A 2ZRIA 4LJ4A 2HB6A 4PLZA 1K6MA 3ID6C 4UC0A 3GAZA 3WK6A 2KSQA 1Z5OA 4H0NA 3O1LA 1VCIA 5IBPA 4BX9A 3U7GA 4WFIA 3A6ZA 4CDGA 4ARAA 4DIFA 1YUBA 1AUQA 4UXJA 3O4IA 4DILA 1SG0A 1V8FA 1Z38A 3C6MA 5EKXA 1G7CA 3EEFA 3HLYA 3IC5A 4Q6WA 2P9YA 1YDWA 3RNOA 3WJ1A 4ENPA 2IYQA 4F2GA 5FV4A 4JI8B 3CW2A 1P2BA 3NHRA 2A33A 3T1NA 5T3UA 1NZJA 2MINA 3UENA 4WXEA 4L3WA 4EEXA 4F97A 1CWUA 3TTXA 1NN3A 5JALA 1QH0A 1XVTA 3OD5A 1MIOA 4KX5A 3BMCB 4QLAA 4V24A 4WZ6A 3UAWA 1DIOB 3F7TA 2Q2QA 1RRVA 2C31A 1RACA 3RU2A 2ORYA 2ZJ8A 2I6UA 4PNZA 1O5OA 3GT4A 2RIPA 3CUYA 4WECA 4CKXA 2OQRA 3GH1A 3KOMA 3WL6A 4BMPB 2PGOA 1JYSA 1WRBA 3EMBA 3L7IA 2RAUA 1GR1A 1WB5A 3N3AC 4KWHA 4DCGA 3DVRX 4F5WA 4U2GA 2A9VA 4JKOA 1JVSA 1ADBA 1E7QA 3F0TA 5ICCA 3AHIA 4KREA 3HWWA 2HZ7A 1EWQA 4H7JA 3UANA 3IULA 3WZ2A 4YV0A 2QV7A 3M6AA 5CCDA 4UW9A 2NO7A 1PR1A 4LJ8A 2CFTA 2YFKA 4R05A 4KZPA 4IZOA 2ECKA 4U9HS 5KHOC 5M2QA 1NVKA 2WWYA 2P65A 3SBEA 2BBOA 3Q8LA 3QKSA 1W88A 2X2PA 2ADOA 1K8YB 3HBMA 2AC7A 4UXHA 4YJGA 2F48A 4HEA1 2OXTA 4AZWA 3EMKA 1U9ZA 1RWQA 4KLAA 1XCBA 1ZNWA 4RF2A 4UZEA 1EHIA 4LJYA 4A1FA 5KBYA 5HKOA 3OOWA 3AQ4A 1NKSA 4RS4A 1H1LA 4R0MA 4Y9RA 2DR3A 1EU1A 2CXXA 3LBAA 2ZJ4A 1NVVR 3E9DA 2PQ0A 3Q11A 10MHA 5CB0A 1NP7A 3GFPA 1Z5WA 3VU8A 1BVRA 2BZ0A 2YBDA 1TKCA 4FHGA 2DY0A 3WV5A 3GWGA 5F77A 4E5NA 1XMSA 3O3MB 5EINA 1JAYA 4OXNA 4BU0A 2XRMA 4Y0NA 4OB6A 2LBPA 1O3YA 4N54A 5THKA 2A2ZA 4H7IA 2A5YB 2EJTA 1D6SA 2ON6A 3GDHA 3PA6A 5J58A 2O8DB 3NOOA 5TC4A 1XEWX 1Z2DA 1GCUA 3W5JA 4B6JA 1E1CB 2FPUA 2XB6A 1MFZA 1I51A 4WXHA 5HJ2A 5JC8A 1QIHA 2JGNA 1D4FA 2RGWA 3DMRA 1TVEA 4WY2A 4XQEA 5FJJA 1U7WA 1UZMA 3LY5A 2PMEA 3RKUA 4FFBA 3S28A 4EMBA 1OFIA 1SVWA 1AF7A 4HB3A 3QFSA 1TM1E 2YXEA 1A4IA 1J0AA 2AK2A 3A4MA 3C4VA 4IQ8A 2WF9A 5JPCA 4BTEA 2IYSA 4BP1A 4Q39A 5I5GA 3R7AA 3HCAA 4RVGA 5EMNA 5D8DA 3CLSC 3QQPA 3JVUA 2R1UA 2VHJA 3UJ3X 4QGSA 1JKIA 1K89A 1EFCA 3C1OA 2V8BA 4IDGA 4TROA 1PU2A 1KO8A 2VVTA 3FWNA 3BWDD 3HU5A 2V7WA 1WZEA 2QRGA 1T2DA 2QG6A 3PP8A 4LY9A 1VI5A 1AS3A 1QCCA 3C5VA 4XRRA 2IEIA 3BF8A 4X1KB 1DOZA 3H86A 3I8OA 4FMCF 2JGKA 3DQZA 2ZI3A 1QIIA 4UUNA 3OHMA 5K3DA 4DR1B 5DHUA 4ZCQA 3OTIA 3VO1A 2BF4A 5A02A 5EGSA 2P90A 3UT6A 2OKGA 4A0FA 3KZOA 4B3JA 1BZYA 3H4IA 4DSOA 4FDTA 5M29A 3D6TB 3JCZA 4RMHA 1T9ZA 3GRPA 2OT3B 1OH8A 5AKHA 4R5MA 1BGXT 1EX1A 3X1KA 2IYOA 1JX6A 2QF7A 3UIEA 2G5GX 4BO6A 2IP4A 1XK6A 3R0QA 5CFQA 1PFVA 1BU8A 1RYNA 3OM9A 3TD6A 2QW1A 3B52X 5I8WA 1B15A 5FPPA 1MIOB 5CW1A 4EFDA 1FS5A 5JZ9A 2IFTA 3LQQA 3GX1A 4QOSA 4KGZA 4O4IA 3AFIA 1H0KA 4XPZA 3BBLA 3NOQA 4CEIB 1YKGA 3WLSA 4DAOA 3WWDA 5EESA 4NBLA 2ADFA 2Q49A 3DDWA 4L57A 2NQTA 2JBAA 5C8DA 2EFCB 4UUPA 4JQYA 3UMMA 1NJ2A 4RACA 1AG9A 1GNLA 1QX3A 1Y3BE 3AJDA 3MJ4A 5JLJA 5DI3B 1G66A 2P8JA 2OBFA 3QI7A 4MDYA 1GUAA 5ALTA 5H3HA 1BA2A 4WZAB 2ZYHA 1GPWB 3G9ZA 4DM3A 2BSQA 4P0TA 1MV5A 2DUWA 1G98A 1ZBDA 3QKSB 5HEKA 1NVWQ 4TYWA 2Z9BA 4ZCMA 5ARBA 2Q1YA 1LLDA 1DJOA 2P67A 1GGMA 2W7TA 3M4YA 3OTHA 4PLWA 3PR3A 4Z49A 4FFDA 1TECE 4L1KA 4JVNA 4QUKA 5AKEA 5BSEA 1SXHA 1I4DD 4DGQA 3N0XA 3V8QA 8GPBA 1TCVA 3IP1A 2QD5A 2WKPA 3UT5A 4ZK2A 1P4JA 4BLTA 2CNWD 2QMOA 1CLEA 2DHDA 2KE5A 3KQOA 3PHJA 4JYPA 3A1FA 1ZIXA 2VDLB 3H16A 4J0JA 5CLLA 4TWAA 5BSFA 2OV4A 2X9VA 1VG1A 1EI9A 1ZGZA 3LSTA 3KBOA 4NMWA 2NO5A 3HHEA 3UAZA 1J09A 1GPKA 1YD7A 4Y7DA 3CX8A 1GKUB 2HDNB 5IAGA 4P4LA 3JQ6A 3JQBA 2XNDA 4JOSA 1I1NA 5HCUA 2O6HA 4D9CA 1NW3A 4GUAA 4JU8A 1N5DA 1TAUA 2HF8A 3G8YA 4UM9B 1YWGO 3R3XA 7ADHA 4L9WA 1G42A 4C7MA 5EP4A 2PD6A 5BQ5A 1CP2A 2PO5A 3LCMA 4M0EA 5SYMA 2CGEA 4G67A 4IKPA 2X5KO 4R8LA 2OB2A 1WUTA 3WGGA 2XPCA 1KAHA 2GHRA 2ZTUA 3I2KA 4Z9FA 1LRJA 4PN7A 5I3ZA 3K9FC 2GZ3A 1XVLA 2XR1A 3RWOA 1Z3CA 1K86A 2UYYA 3NV9A 4J7CA 4II3A 3WNBA 3ZZ1A 4QHSA 1T8RA 1T24A 2VAPA 1KRWA 4ZMRA 4XCQA 3CEHA 3DZJA 1LLCA 1UXKA 5D51S 1WBDA 2REBA 5GVSA 1E4VA 1JLRA 4UAUA 4C6SA 1KK2A 4QBFA 5EHXA 3OZ7A 1JILA 1MUUA 3DFIA 4IIBA 1C9JA 3V34A 1P0QA 4XR4A 3T95A 1W1IA 2HUPA 5JO0A 1KH3A 4I50A 4FUQA 4K6GA 3VTFA 4LVUA 4A36A 3INRA 2O3RA 2R4TA 1N3IA 4BGDA 5LJIA 4G1FA 5F5LA 1BNCA 3E9QA 4HXGA 5B1HA 5CFNA 1PL0A 3I0NA 2ZSAA 1KY3A 1IPHA 3W2GA 2WYIA 3THSA 2VUHB 1PW5A 1USGA 2PQ2A 5G0TA 4D0GA 2NUPB 5KCMA 1B7GO 2ZREA 3ENNA 1X3LA 5TQ0A 3UBTA 3WK9A 4DE5A 3OU6A 3FPBA 1CZKA 4HLCA 5IH7A 1PZGA 4IXDA 1RIFA 3GH3A 3N6XA 1U2DC 5AJXA 3RC1A 2VCYA 1GN9A 3MINA 4O3MA 4EZBA 2RGAA 2ZWOA 4UVIA 3C6ZA 2IEYA 3QFFA 4KHPB 1G5QA 2G25A 3KELA 3QX8A 2J0VA 4W7SA 4RZ2A 5EWMB 1KZ7B 1RQXA 4TLMB 3A4VA 4ZA2A 4AJPA 3QU9A 2QRHA 5F1YA 3A7DA 3T0FA 1J0BA 5COBA 3HXLA 4OGGA 3U80A 1H2WA 1PJBA 5KU7A 1ACMA 1DELA 4KO1S 4FXOA 4RLFA 4KYIB 1C2TA 4ZGGA 1ZIDA 2AD5A 4E5VA 1ECCA 1O89A 1I0LA 1W34A 2QAJA 2ZQYA 3DBLB 3DKPA 4JC5A 4UHDA 3VDRA 4V0MA 1K7XB 1NW6A 3GAAA 4L16A 4Z0TA 2GUGA 4YO7A 2Y1XA 4BECA 2LTAA 5J2UB 5KOHA 3IVGA 1L8AA 3M6FA 2JJ2A 1A2OA 3PXEA 3RTBA 3FE2A 3R7FA 3UA3A 1STOA 4AO6A 2Q3JA 3F3YA 4PRLA 2ST1A 2FFQA 5JNUA 5CIWA 4OI1A 3AZOA 3MAJA 4AMVA 4Y2SA 4E3ZA 3QI2A 1S89A 4KXYA 5ER9A 2VLBA 2H7CA 3C48A 4IJVA 4LC1A 2RKOA 1HQCA 5GINE 1VFNA 4FT2A 1C4KA 3UMFA 5D3MA 1DQRA 4X3PA 2I5PO 4DCPA 3BWYA 2G1UA 2YXNA 4IDDA 4DMCA 2X1MA 1HA3A 2ZYGA 4NABA 1U4OA 5GM1A 3VGPA 3TXAA 2B2CA 1UK8A 1K4YA 4JWKA 3Q40A 2O8BA 3ML1A 4O1IA 2W6QA 1PTJC 1ZUIA 3ZHYA 3E7XA 2HMSA 2FSVA 2I76A 4P5EA 3X3HA 2QVBA 2Q1WA 1RMYA 3FH0A 1H5UA 3C14C 2C9CA 2PL9A 3ZVLA 1YBVA 5F7JA 2ZDGA 3W3ZB 2NUBA 5BV8A 1M6EX 1XHEA 3RIXA 2LV8A 1F2UA 5B4UA 3JALA 1RYHA 3OURA 4GKVA 4JLWA 2NU9B 1QZXA 3ZWWA 1CT9A 4P7JA 4UUBA 4Z54A 2FN9A 1KR2A 1D04A 3RCBA 4B4VA 3A1SA 3THYA 1ICEA 1LTHR 3HJGA 4QL3A 4K7JA 4R9VA 1VKRA 5BV0A 1LPMA 1NFQA 2IF2A 3GFGA 3K1TA 3HY6A 2FDRA 2WKWA 3CM0A 5CBKA 2GN9A 3FF1A 3ILXA 3EEYA 2EW8A 2P7HA 4GOMD 2QTZA 3EAQA 5KVQA 1P1KA 3SFTA 2YOFA 1RPJA 5KKAA 3VBEA 3R6DA 3K70C 1OU0A 3E3MA 4RE6A 1VZ2A 1KMCA 2OBBA 1COWD 4L5JA 5FA5A 5CAEB 3U7FB 3FDIA 4EGSA 1OHHA 1YQQA 1WZUA 3D4BA 3TTWA 3DHVA 2UXCB 1KA9H 2YQ4A 5J23A 2GR9A 2AZXA 3TCKA 1E2QA 3NS7A 4NV0A 3ZHBA 1W29A 1CUFA 2O0HA 3SHOA 3CMMA 3SQDA 4AN1A 4BGUA 1I3LA 4H0FA 2WUVA 3Q3EA 1P7WA 2LP4Y 4FEEA 5D2CA 2AT1A 4M99A 3T7IA 4CCYA 1OBOA 2EKLA 1PR2A 3TQIA 3BFXA 3MINB 1VHTA 3VO9A 3JR3A 4A8JA 3IS3A 4IYJA 3L5KA 2VPTA 5BR4A 3WYEA 5ELLA 2O4UX 3K4HA 5CX1A 2Y76A 1ABFA 2FWBA 2PLWA 4UBMA 1P0FA 2WJAA 2BGNA 1L1QA 3EGDA 1O58A 1GAWA 3K0KA 2GDJA 3X1YA 1Z0AA 2VTBB 2ZBGA 4NYMR 2DWOA 4WKPA 1Z0UA 3KPWA 4LAFA 1DO2A 8ABPA 3BAFA 4DYHA 4JUFA 1I6MA 1E1LA 1NATA 3A3YA 1F2TA 1PGPA 3KJFA 5KNCA 2Z9CA 3RFXA 1ZK2A 2JAPA 2ATVA 3VAAA 3FYHA 4QTYA 2GAJA 5EHIA 2ZRFA 2PWYA 5HDQA 1TX4B 5ES4B 4G5SA 4YJDA 1M3SA 2QSJA 3F3MA 2HJHA 1GEGA 2GB4A 3AUUA 5DX8A 4KLRA 2V9CA 4BWGA 2WOJA 1WNTA 1Z2PX 1R50A 4PFJA 1Z33A 4HEQA 2X9GA 2ZYUX 4ILKA 4Y2XA 5E8JA 1GGVA 3M1AA 4N1AA 4MKFA 4Q9JA 5D00A 3PT5A 4UNQA 3ZY6A 1E69A 4KGVA 3ZHRA 3G02A 1O7JA 4E5UA 3I2JA 4XUCA 2BH2A 5I8ZA 2R7NA 2GEUA 1QVWA 1BCSA 4OSEA 2CVQA 1JHYA 3DD1A 1IWBB 4L15A 4WGFA 1JNYA 4GNKA 3HZOA 2Q3LA 4OXQA 5JHGB 4UE3S 1P72A 4PYQA 3QXXA 3EDOA 1HFWA 1ZI6A 1RQGA 4BPBA 1G2QA 4NZMA 1UCFA 5ETJA 4XD7D 1MORA 4DSZA 1OSNA 4PYLA 5LUAA 3P2OA 1E0AA 1GVNB 4L8LA 3GN2A 2KBEA 1F6DA 2WPDD 2YY6A 2EYUA 1ZDMA 3NUQA 2OQ2A 1S3SA 4RTRA 1B0AA 4HD8A 1IWOA 1JEQA 1JSCA 4TMYA 4UAVA 4DCVA 3U4QA 1M2OA 2ZJBA 4C78A 3HP4A 1S1CA 3OVMA 2C20A 1IXRC 4IJ5A 4NULA 4DZTA 2PUBA 3DHNA 2OCDA 3MFYA 1QRRA 3R1IA 1C1XB 5DGDA 3Q3VA 4B82A 1A5TA 2ZVQX 3S81A 1JH9A 4WXPA 3ZKAA 3OH8A 1XLTA 2EF0A 5FEMA 4OUDB 4A2CA 4QUEA 2BR4A 2WFZA 3ILSA 2DF8A 4WQMA 2YS6A 1G5RA 1U80A 2HPAA 3RC3A 3AEQA 3ZCSA 4PFKA 5C37A 4M98A 4PS0A 4UBLA 1SBTA 1KDZA 3RUEA 3ZQKA 1SQ5A 1V26A 4G2TA 1HTTA 1PWYE 3OPVA 4MS3A 2PA0A 3REQA 1YBAA 1N2HA 2IXDA 3PV0A 4UASA 3HA7A 4FMCB 3GEHA 3GGOA 1YZGA 1I7LA 1PGQA 1QG2A 2GERA 3G2IA 1R3DA 1J9ZA 3GXBA 4I36A 3K8QA 4WGGA 5DGHA 5ALOA 4URVR 1CR0A 5EMJA 3DM9B 2Y71A 2X8JA 2COKA 3I2FA 2G63A 1WY5A 1W5BA 2JB9A 3PEUA 4YI3A 2VXCA 1EIZA 3WGVA 2IPXA 1T8SA 2CXUA 1Y1SA 2DECA 3GJQA 5DBOA 5FOTA 3ISJA 4Y18A 2XF8A 1YKFA 3W0LB 1MB0A 3QVMA 3C45A 1EGAA 1QGYA 5IJWA 2PUDA 3RBAA 4EI9A 1RXVA 5IUJC 1YKSA 3CVOA 2DPHA 2A14A 1LI4A 3PU6A 1X7GA 4JLJA 2CKDA 2A3NA 4XARA 4YRJA 1YB5A 1FQJA 2QRJA 2QI9C 4K0KB 3GC6A 3Q2IA 4DNPA 3HCCA 2GPTA 4INPA 2NWQA 4RTPA 4Q34A 2QTAA 4Y98A 4W8HA 4B3RB 1UP7A 4IAOA 1TA4A 2WJZB 3O4FA 4DJTA 2XDWA 3GCWA 1HQKA 4IOLA 1JVBA 1VJ5A 3O47A 2AE1A 3RTEA 4WE3A 1HZZA 1RXCA 4N5HX 1H8HD 1ZGBA 1RJGA 3KX2A 4Q9DA 3NIBA 4BNNA 4CMHA 3VYTB 2VHYA 3C6XA 1IZ0A 4H7EA 4DYVA 3BSSA 1CSEE 1YNOA 3MJFA 4I9UA 3WL3A 4EKYA 5DGTA 1VG8A 1I2DA 2O0MA 2ZUWA 1PSDA 4OMDA 1JHPA 1FFEA 3GJ3A 3EQZA 1EUCA 3VO2A 3QLJA 5DFAA 2ZZNA 3QIVA 4II7A 2W2LA 3B1VA 3FXAA 3OUZA 4K9RA 4B35A 1CZUA 3HO8A 1ZUWA 1W85B 5EIBD 4B7UA 1YBMA 4ZOQI 5A4JA 3TW8B 2B4QA 4MUNA 2VSFA 5D85A 3H2HA 8MHTA 4G0ZA 3HVJA 2FPKA 3SOPA 4FMDF 1A9XB 1T8TA 1F2DA 2POCA 2SCUA 3D9QX 2FN3A 4GPD1 2BEUB 1E1NA 2QP3A 2D00A 1IIBA 5IDQA 2G9UA 3BILA 3GRCA 4ZCIA 3CH6A 1JDVA 1IUNA 1LDNA 2E48A 2ZJ7A 1XEAA 5E7IA 2P2GA 4QBHA 1FMJA 4C14A 1QB8A 4C6TA 2RHBA 4TTTS 4B1FA 1TKRA 3L0YA 5B37A 2IHUA 3E82A 4K86A 4DW8A 3QX3A 1MG5A 1I4WA 2VQFB 3E03A 3LF1A 3U4QB 4RGVA 1R6DA 2OXFA 2FW6A 4HBGA 3RWMB 4G63A 1BVYF 4BVAA 4MWEA 1XXHE 2BGMA 4YHHB 4MARA 3PZBA 3IQDB 4O2BF 2HQSA 3QJYA 5F3RA 2Y1EA 4RD0A 3H2SA 4F9EA 1G18A 1W8IA 2HGZA 3ZPXA 5MGNA 2FLWA 2AEEA 1ZCAA 2O5RA 4ZYTA 2Q3CA 3UCXA 3QKUA 1E32A 3O8LA 1CG6A 5EJEA 1RE1A 1BCRA 4GEKA 4ZKEA 3R0VA 4M9SA 4WL0A 4MS3B 1F7UA 3REQB 3S7TA 4D96A 2WHEA 3V4PB 1QTQA 3NQ41 4GR4A 4RMIA 4OCZA 1BE1A 2WHPB 2W2NA 3BCHA 1FW8A 3A2MA 4LE0A 4KN6A 4LS3A 5JNVA 4YCNA 2IRWA 1GGEA 1RM3A 1Y8QB 3GV0A 4EL5A 1Z15A 2X8JB 4DG9A 1WTCA 1XAHA 4HB4A 4RD6A 3PX3A 2I1QA 2V97A 3NOXA 5DM60 2O8FA 4QGGA 2ZI4A 2J7KA 3CNHA 2AWOA 2VP4A 3PGA1 1GILA 1UKVY 3DW1X 5CPBA 1XJ0A 1ZXXA 5AJWA 3VU1A 4P7KA 9MHTA 3TW4A 4DXDA 1YIAA 4LOLA 1ULHA 5LZ8A 3M0EA 3L01A 1EDEA 1RBMA 1I2CA 1L7XA 1U6KA 2FU5C 2QJFA 3ENWA 5JCOA 1U2PA 1G64A 3L6DA 4R9UC 4P58A 4N18A 3C5WP 2PY6A 4HMPA 2RH8A 3H8JA 4QDOA 3PD0A 3RYIA 2ODAA 5C5DA 2W9XA 4NWIA 3VU0A 1KFJB 4GGMX 4KK4A 2DC1A 3G8AA 2N46A 4X64B 1JXMA 4OHZA 3SR3A 2IUFA 5BOSA 5EZSA 3O8DA 1BDBA 3IVAA 4MUGA 4NYJQ 1JHOA 2D4AA 2Z5LA 4XX1A 1I32A 1P61B 3KE9A 3UYLA 2RGDA 1UBNA 3VISA 3PITA 1JL3A 1Z2OX 5DTRA 3CA8A 1YJAA 1ZG3A 4LK3A 2J87A 1SK8A 4Q15A 4I4NA 1EUCB 4ZOLF 2OXEA 3CO5A 3HEAA 4AUMA 2H2AA 5FI3A 1QQ6A 1WXHA 2QTWB 3WYGA 4LF7B 4O3FA 5D86A 4NQZA 4IIYA 4PZYA 2BBWA 1ESNA 3DV0A 5A1TA 1NBMD 2I1VB 3H6KA 5DYTA 4PSUA 1DRVA 2XTJA 3GZJA 3IH5A 5IK2A 1GIAA 2OHGA 3TECE 3TINA 5CVUA 1TYEB 2E55A 1SKYE 2YVAA 1LI7A 3E58A 3TFWA 3O6VA 4ZI7F 5FOUA 5IVDA 2YZKA 1KI3A 3OWOA 2QYSA 2GBFA 3ZS9A 1VYHA 5E1DA 1KE1A 1W2HA 5HA5A 2BKLA 2OCBA 4I55F 2ACEA 1G5TA 1ECLA 4KVAA 4ZU1X 3USES 3RTDA 2B5OA 2ZUBA 1I4LD 1CZLA 4O33A 1KYIA 3P5SA 4RVDA 3OQMA 5JZSA 4IDFA 4ENUA 1ADYA 4GU5A 4CL2A 2TSYB 2ZBPA 1AKMA 1CE8A 4H27A 3JW8A 2ZLBA 4Y2UA 4O8CA 1X70A 4HO1X 3CT4A 4HH3C 4ZC8A 3PC2A 3PQ6A 4E14A 4HWKA 2I2XB 4U1RA 3ROGA 4DG5A 3TL3A 2P9QA 5B58T 4DNQA 3ZWQA 2WWXA 5A4AA 3G5TA 3OIFA 3NUGA 1IH8A 1TA0A 1ZGAA 3HXPA 4NMXB 2JFYA 1SY7A 2A0UA 1QS0A 1MQAA 3QPWA 4IQFA 3WMFA 1NFFA 2ODBA 2H52A 1WXWA 3JTMA 3QYPA 3SLGA 3LD9A 4X20A 2D54A 3SZRA 2FEWB 3X1XA 1E9FA 1XCPA 3CNNA 2HREA 3QY0A 4OQDA 4OP2A 5DN9A 3RE1A 2N1MA 2YJNA 4MHOA 2HAEA 4UARA 3AVYA 1J1UA 2CXQA 2JNWA 1W5SA 4NV1A 1GZVA 3MGGA 5IVHA 3K9QO 3MRSA 3Q12A 4IS2A 4NH4A 2QD3A 4XASA 4ARBA 4C1BA 3DCIA 3FCEA 1QYCA 1QHEA 1KZGB 3GLKA 4LXGA 1RCFA 4B31A 1AV7A 3HU1A 1E3JA 4RDHA 4C08A 2CLLB 3DEKA 3F97A 3BGWA 1L7OA 1EWRA 1Y3HA 1ZM3A 2EX1A 2FSGA 2NUAA 4N39A 5LB2A 4B81A 5JDIC 1GXSB 4LRQA 2GWRA 4KR2A 4RHTA 4WJZA 2ZRQA 3WAKA 1UK6A 1FLVA 1T5IA 2Z08A 5JZOA 1USIA 4EJMA 2RG7A 4HDNB 2HA2A 4AURA 1VE3A 1FF9A 5JD4A 4A15A 1T3LA 3ZIAA 5EHZA 5JSFA 3D6VA 4Y6QA 3VR5H 4YC7A 2AN3A 3DBIA 3ELBA 1QOZA 1HRDA 1E5DA 1MB9A 1J1ZA 2Y0DA 4HG2A 5HE8A 5IYZF 1F8GA 3H8VA 4JL6A 2YHAA 2XZLA 3DC2A 1DGQA 4HAXA 2YJTD 3M2PA 2FG6C 5IVKA 3HA3A 5HW0A 3I30X 3K5PA 3QXHA 4C4TA 2ZUEA 3TG2A 5CT8A 5BOSB 1CJMA 4INJA 3W1WA 1LX6A 4L4ZA 1QOQB 2HV8A 2RHWA 1C0PA 4XOUA 1ISPA 2P75A 3EPHA 1YSCA 3OPYI 1L4BA 4N3AA 5HKKA 2YCLA 2FMTA 4YRDA 2FQXA 3KZMA 3AM1A 1P18A 2IXFA 1GZ5A 4K9QA 3ZWVA 1DBSA 5JSUA 3KR1A 2DFDA 2IHZA 3G5UA 3RUDA 3VTAA 2YBEA 1RKXA 2KB0A 4ICIA 2X8LA 1LUAA 4A0HA 3PC4A 4L2IB 2E1PA 4RNDB 2WFLB 5A3JA 3GRAA 5I7RA 4V03A 5KQPA 3PXUA 3TFOA 3HN7A 3K1AA 3HYCA 1K88A 2QTGA 3WYFA 4B6OA 1N7IA 1RS0A 1X3SA 4B73A 1P62B 1R4AA 4JNKA 2QPOA 1ATZA 1M66A 2YJGA 1SXPA 2J3HA 2Q29A 3B1YA 2DT5A 4S1WA 3AIMA 1TQDA 3TI7A 3PNMA 1OI2A 4CR8A 4MULA 1KVQA 2NO1A 5CDUA 2MSLA 4NRDA 4EAAA 1PDOA 3LL7A 1DKUA 1JT9A 4BNJA 1NURA 1AO0A 3QK7A 3FW1A 4BVEA 4OK6A 1LNZA 4UVEA 5LMCA 2HWWA 2J5BA 3MGKA 5CTJA 2JASA 2QJOA 2C7OA 1N36B 1YGYA 3Q3CA 3SY8A 1DOAA 1Y48E 1YHZA 2NTYC 2RSLA 1FXWF 3O3OB 4HYYA 4J16C 4P83A 2P2ZA 1RRCA 4REQA 2F8MA 2PRJA 2OBXA 3DE4X 4ND3A 5PNTA 3TNJA 1AA9A 5KNBH 1A82A 3OSZA 3A9VA 1NW5A 3N28A 5AYVA 5ALDA 3W6ZA 3ADKA 1D6NA 4LRYA 4CF3A 3H04A 4MVJG 1XTSA 3SP1A 4J2OA 2PWZA 3ONFA 3CEJA 4PO9A 2G5TA 5LVAA 1QIMA 4ETIA 1YRYE 1EWVA 2H65A 1TJ5A 3F6RA 2X1HA 2WF6A 1C7ZA 1W76A 4FP9A 3NLLA 3K31A 3HLKA 3KO8A 4AI6A 3LJKA 4QEDA 3ERCA 1WU8A 3UOWA 5JASA 4EAQA 3F78A 2IC5A 3TOZA 1I8TA 2D1SA 4X20B 5CLIA 1JQAA 1QHFA 3LG2A 4BQQA 2BGGA 3SDBA 1M1NA 5ALHA 5FL7D 4S12A 4RZ3A 4D44A 4W5OA 4IDAA 1XX6A 3WKCA 5JFOA 3FOAA 2H9YA 1W0KD 2QN2A 4OATA 1Z56C 5KYXA 1FFBA 3BH7A 2QYTA 3PJFA 4GLFA 5FFMA 1KNXA 3FTNA 1GNVA 4FEYA 1G2PA 4M36A 2DPXA 1YZVA 1ZL2A 2PV7A 3KSDO 4WTOA 3WL4A 5JYBA 1H6DA 3ROXA 1C9DB 1MG0A 1S0UA 2OV8A 1FSSA 2CZGA 2JJ1D 1VHJA 2BN4A 2X7HA 2AZDA 3IQZA 4M0FA 4MKRA 4PZCA 5E4JA 5L7YA 2AZ4A 3VU9B 5IFLA 1PP4A 1VPTA 3AW8A 4GSKA 5AW4A 2EL7A 3EXIB 4ZODA 3ZE6A 4BKQA 1VYTA 3Q5EA 1RJEA 4RABA 1DBQA 3I1FA 1R0RE 4KVZA 5LQRA 3M49A 1MTZA 2XZTA 3LO8A 1M0WA 3L3BA 3TM4A 2EP8A 4DZRA 1XRSB 3ZHUA 1FDIA 1LBEA 3NBXX 2Z3VA 2QTMA 4X24A 2OVFA 1E6LA 4RL4A 5IZ4A 3IEXA 3IUBA 2Z4SA 2CDNA 2QTRA 3PR1A 4YPFA 1OXTA 1T9CA 1X94A 4BNDB 3T38A 4C4PA 1O97D 3KKZA 4CG0A 3PDUA 3I58A 4JP2A 3ZLVA 3C5EA 2CV2A 4LYEA 1ULAA 1CVIA 2XA2A 1SVOA 2RHDA 2W2TA 3R23A 4ND8A 4NQRA 5FJIA 1RFGE 3JY6A 4ABYA 3HCNA 4XKJA 1KDVA 4OYHA 4DDMA 3CJTA 2LW7A 1U3FA 3OOEA 4M22A 1E0SA 3EA5A 2AMYA 1JFSA 3PJRA 3OFJA 1M72A 2GHIA 4JEIA 4LY3A 5BWCA 5CB8A 4J0KA 1KKUA 1I6WA 1P6UA 4FBMA 3VU3A 1VE1A 4GKBA 4UCXA 1C0IA 2Z3WA 1M1ZA 5CH5A 4ZVOA 1NWCA 4CKCB 4GL4A 3VOTA 1C8KA 3UK7A 3VZSA 1KXZA 3R9XA 3M6IA 1IDN1 2XCRB 3DZBA 3Q1LA 4WV3A 3K0FA 4OLAA 2XVYA 4MIEA 3DOEA 3V8BA 3TQFA 4CXMA 3EISA 4KPFC 1EFRD 3C3YA 1YR2A 3E05A 4BE4A 3HADA 4V38A 1R0BA 2R6ZA 1ESCA 1PV2A 4ZANA 3AI2A 4YP6A 4ZOLA 2CZQA 1N2GA 2GZRA 2IVFA 1M6NA 4PXSA 3NIWA 4CKWB 4LMRA 5C5EA 1N77A 2Q5QA 3FCUB 4I5FA 3BSFA 1GGHA 2X4LA 4MWOA 4REQB 5JAQA 2VHVA 3SIRA 5H81A 4D26A 3O8QB 3VVMA 3M8KA 5EJIA 3CFYA 3DBRA 3W9UA 2F00A 2IPMA 2ZBDA 2A59A 2D2XA 4OP1A 3SS7X 5AFSA 1JI0A 4LNAA 4FMDB 2AJCA 1JFRA 2WT9A 1OLUB 1B1CA 4WZBA 5BV1A 1R37A 4D9FA 4YRKA 1E2HA 4ZI7A 2HFJA 1GPNA 3I23A 3P9XA 2W0MA 2C5FA 4HRVA 2J4FA 3T3NA 3AF0A 1CB7A 3PPVA 5DTMA 3UWDA 3PGLA 3ZLTA 4X5OA 1PK7A 1MHPA 4G5FA 1U94A 1R7RA 3ZCUA 1F6WA 4WOPA 2PZEA 4IRMA 3IAXA 4HPXB 5DNUA 2HCFA 5A9SA 3B6ZA 3HXTA 2A0FA 4FMPA 4ZI5A 3WWCA 5INTA 1FDUA 5FTJA 1LRLA 4Q7JB 1P5HA 1PLLA 3FNQA 5EUQB 4EYGA 4RXMA 2ZSKA 3ZBTA 4ZAGA 2FK7A 4PZEA 1XN4A 3UXYA 3QW2A 4X3CA 1L4KA 5KYXB 3VKHA 2CFRA 3BJZA 4LJ7A 6REQB 2FHSA 3LW8A 3R7DA 3T7RA 1QWOA 3AILA 5C32A 4IILA 4NBKA 5JNTA 1W36D 3EA0A 2QGFA 4HB0A 4O2BB 4B40A 2IEGA 4YI5A 1VP9A 2XA1A 3O4RA 4LZAA 5HK8A 1TQ8A 2FEOA 1OI7A 4IGIA 2EWWA 3JTEA 4UNNA 5TGDA 1WEHA 5AI5A 4GI7A 2R2GA 1E8NA 3LZ6A 1N3BA 3E9RA 2FDCA 4BJ5A 2UVDA 2O54A 2EJVA 3U13A 1PQYA 3H5AA 4KVFA 2OPHA 3AOEC 4M0DA 2ZS9A 4RF5A 1YS7A 1E4OA 2HRRA 4UDNA 3MCUA 3BMQA 1P39A 3O3NB 4QDZA 4EBFA 3OZVA 3PUZA 1DLIA 1XD8A 2IGBA 2X8WA 5IH3A 2XYVA 2FCAA 3QPVA 5AK0A 5G0WA 3RT9A 3JARB 4Q02A 4BKPA 1FS6A 5HZKA 4ZRMA 1N5RA 5EXTA 1IATA 3ONWA 4RWZA 1PGJA 5DHFA 1ZCZA 2P77A 5LQMA 3AUSA 2EQAA 3K7EA 4Y3UA 4ZYVA 4KR7A 4EKIA 4HDSA 2IV2X 1PE0A 5KTKA 3BE4A 1QK3A 5LP1A 2A30A 1Y5LA 3R3VA 3OE4A 5AI8A 4M76B 1W49A 4YR7A 3OESA 2C5EA 3QEMB 1JKJB 3AVQA 4CLDA 2B94A 2NGRA 3G88A 4J3NA 1BQ4A 2I6GA 1WDKA 1MX1A 3OZFA 3S2YA 3JWEA 5C8XA 2BH9A 4MQ5A 2BGIA 4LHZA 2W6IA 1EUZA 4UBJA 2IHJA 4PNHA 1GITA 4LJRA 4D82A 1P1HA 2ZCUA 1A2BA 2OG2A 2WIJA 2CNBA 1IY0A 1DCMA 2QGZA 3LQ1A 3MN1A 4DUZB 4YCAA 3DBHA 5A3SA 1CS4C 2NV0A 2L17A 1BOOA 4GBGA 1GY8A 3DPIA 4M7OA 3W77A 4RD3A 2C42A 2PK3A 3PLAE 1S02A 4NS1A 1EEHA 4ZI2A 2DBVO 4YV1A 1MJHA 1P31A 3OIVA 3OMXA 3Q41A 3U39A 2VPPA 3AUJB 16PKA 4G1EB 4AF6A 3B3QA 3DOCA 4DCCA 2GYVA 3K30A 1QONA 1A0OA 3U19A 2AX4A 5GJVC 2YVUA 2V7GA 7MHTA 5B7QA 3HUEA 3L6CA 4I1VA 4JFAA 4ZVPA 2PLNA 3DBRB 1RM0A 3A6DA 2AOWA 4AZ3B 4C0SA 2WG0A 4DUGA 3MILA 2GX6A 1DDOA 3U44A 1LY1A 3AG6A 4ETWA 5AUPB 2H1IA 3SJ7A 2PRYA 4HAIA 3URKA 4ENSA 3P0FA 2FPGB 3HJRA 5ADWA 4I5GA 3VSEA 4UNIA 5B7GA 1FTNA 2ZYTX 4I55B 1FJHA 4HZGA 5DKFA 3ZCXA 4D43A 1ADJA 2DULA 1CDOA 1XIVA 4B76A 621PA 4D6XA 1FXWA 3SHFA 1LFAA 3UOAB 1W19A 2QI9F 2BHNA 5A9SB 2PEYA 3RLFA 1MC5A 4J1TA 5TY0A 2FSFA 1FY2A 4M9QA 3UFXA 4A1OA 3AJRA 5AVQA 5DT2A 1CZOA 3C16C 3WB2A 1EP9A 3R0XA 4PANA 5K6AC 2M6RA 4MQFA 5H02A 1P9LA 2HK7A 3GPLA 1N2XA 1G63A 1P4SA 2G4LA 2PYZA 3AUAA 3E0QA 4IFEA 4R01A 2BEWA 4HGQA 4X92A 5CG1A 4RFLA 3VV2A 2HIAA 1ILWA 4N48A 1UUFA 2WMYA 2A88A 2ZS7A 3ITNA 1G8PA 5AQ1A 2BT4A 3PDWA 1JIQA 2I2WA 1PWXA 1ZNZA 2FH5B 3HS3A 1HG1A 1T5DX 3FWKA 2YQZA 2E0IA 4ER3A 1DUVG 5E3JA 5KSWB 5GZ1A 4JI7B 1KYQA 4EYOA 2BD0A 3E4CA 4JX8A 5DM4A 1X0VA 1A77A 2P6RA 2QSYA 3QBJA 1MRNA 3E9ZA 3S70A 4OL9A 1TAHA 2DERA 2VPZA 4XA8A 4RZHA 1L5GB 1V8OA 1T3SA 4JGIA 4MW1A 3WC4A 5BN1A 1XVUA 3D5EA 2HPVA 2WSBA 3BMQB 3HB7A 4S2UA 2VJOA 1KJIA 3Q5DA 3FNGA 1UKAA 1R0ZA 1FNSA 3OIDA 3PRJA 5EUCA 2IODA 4DDKA 1IYZA 5A6SB 4C5BA 3F49S 1SG6A 4MQ4A 1MAHA 4CKBB 4QEKA 4OLBA 4TYNA 5MFZA 1UAAA 1JG2A 4OMCA 5K8LA 2ZCVA 1V3VA 1Y4AE 3K2IA 3QWAA 2YWCA 4HDSB 2PYIA 4U8HA 3V1TC 2GF0A 5CITA 1XR3A 1ECFA 1N3LA 2P41A 4W4TA 3SR4A 2QAIA 1ZK4A 3LP8A 4A5OA 3L6RA 5IYZB 1X2EA 1U6IA 1I0IA 4Q1CA 1T2NA 3IV6A 1PTJA 2W93A 4JJZA 1G1AA 4JJFA 4BOYA 5BN5B 1X42A 2C4TA 2BV3A 4G9EA 3LOPA 2OYSA 2YHBA 4U9IS 2VDJA 4D42A 1QSGA 3K2EA 3WGOA 3U4MA 1TE2A 4V0ME 2GM9A 4J4BA 3DBHB 4JR0A 3ROFA 4PGHA 4HXYA 5LU8A 2F3PA 2FQQA 1Z62A 3QE0A 4JD5A 3R0ZA 4U5QA 3NEAA 3WIOA 4EO7A 2PKRA 3TRFA 4BX2A 1PJRA 3N8DA 5GIPE 3U1VA 1PN3A 4RH1A 3QX9A 1LPPA 3NNNA 3T3IA 4RZSA 4YIHA 1XDGA 3OQVA 4X84A 1R64A 3T06B