4QNNA

Crystal structure of phospholipase a 1 from hornet(vespa basalis) venom
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
297
structure length
297
Chain Sequence
PCPYSDDTVKMIILTRENKKHDFYTLDTIKKHNEFKKSTIKHQVVFITHGFTSSADTENFLAMAKALSDKGNYLVILIDWRVAACTEEMSGIQLAYYSYAASNTRLVGNYIATVTKMLVQKYNVPMANIRLIGHSLGAHTSGFAGKKVQELGLGKYSEIIGLDPAGPSFKSNDCSERICKTDAHYVQIIHTSNHLGTLVTLGTVDFMNNGYNQPGCGLPLIGETCSHTRAVKYFTECIKHECCLIGVPQSKKPQPVSKCTRNECVCVGLNAKTYPKTGSFYVPVESKAPYCNNKGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phospholipase A 1 from hornet(Vespa basalis) venom
publication title Crystal Structure of phospholipase A 1 from hornet(Vespa basalis) venom
rcsb
source organism Vespa basalis
molecule tags Hydrolase
total genus 96
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.32: Phospholipase A(1).
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00151 Lipase Lipase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qnnA00
3VKFA 2DHCA 1E89A 3F98A 3O4HA 1XRLA 1LPAB 1QIMA 2I3ZA 2WUFA 1VA4A 1EDDA 5FOQA 1TCBA 4IH1A 3BE8A 1G42A 1F8UA 3HABA 4FNGA 2VATA 1QIHA 2W22A 1DTEA 3IUQA 2QJRA 2BJHA 4C4XA 2XMBA 1JJBA 1D07A 4FHZA 5AI0A 2O7RA 1YCDA 5DLPA 4JNCA 1DWOA 3O95A 4ARAA 1YASA 2QT9A 4EB0A 4IO0A 5ALPA 2DQYA 4H77A 1PJAA 1W52X 3AJAA 3R3WA 5ALUA 5AO9A 4P9NA 2Z3WA 4ETWA 1VZ2A 4X90A 5CRIA 2RHWA 1CFJA 2NW6A 1XZMA 1CUVA 4J0IA 3V9AA 3VJMA 1EK1A 4E15A 2CEKA 5ALXA 1TQHA 3HZOA 5JZBA 1MX5A 3O4IA 1QIGA 1DU4A 4M0FA 4X00A 2GZSA 2CBGA 4KAJA 1C7JA 4KJXA 4DSAA 3G0GA 1QFSA 4KACA 3IA2A 5EIAA 1FFDA 3VDXA 4LYDA 1NU8A 2WFMA 4F21A 1EINA 2ACEA 5JAPA 1YB6A 4XX1A 1EA5A 4NS4A 3KDAA 5ESRA 5ALHA 1UKBA 1SFRA 1LPMA 1T4MA 3HRHA 4Y2VA 3BF7A 3WWCA 1LBTA 3GFFA 1EHYA 2CKMA 4UHHA 3FLAA 2D5LA 5JALA 5EHQA 2EDCA 5C7YA 2BGRA 4LXGA 2QKYA 4C88A 1N5RA 3O0DA 4F0JA 3WIOA 3AFIA 1WB4A 4L9AA 4OUKX 1XQYA 1XZJA 1VE7A 5HCUA 4PO3X 4KAAA 4B7ZA 5AM4A 2Q0XA 4P93A 4BCDA 5AI6A 3LS2A 3IURA 3ANTA 4G9GA 1WB6A 3F67A 4G4IA 1EDEA 1BCSA 2QUBA 5FP0A 3STYA 5AI4A 5AK3A 2WU4A 1E5TA 4FOLA 2VEOA 1XZKA 4DMFA 1JKMA 2BCEA 1Q83A 2HA2A 4Y2RA 4C4ZA 5A62A 4JUIA 2HA7A 4LIPD 2YYSA 1XRMA 5HZGA 1J06A 4AO8A 2DSNA 4H7FA 2WG2A 3EQ7A 3O9VA 3TJMA 3AUKA 3IDAA 1E8NA 1WB5A 4OB6A 5SYMA 1BCRA 3R0VA 4IH4A 2QXTA 2XI4A 4YK7A 1IMJA 4FWBA 1VZ3A 5CBKA 1BE0A 2OQIA 2PUHA 3M81A 4UBLA 2K2QB 5CT4A 1H23A 3ZI7A 1LBSA 3QPCA 3C45A 2HL6A 3OG9A 4BTLA 1QE3A 5LZ7A 3G0CA 4KYVA 5AI8A 3DOHA 4D9JA 3D4LA 3KWFA 2XT0A 1DT3A 3I2JA 1XZAA 2QXUA 1IVYA 3AZPA 4BE9A 4X91A 5YASA 4M0MA 3U0VA 5DNWA 1B41A 2QOEA 2C5FA 1LPBB 5ALDA 5AICA 2HIHA 3S2ZA 4UBMA 1FFBA 2XUAA 5AKZA 2CMFA 3DLTA 1JFRA 1CRLA 2WHPB 1OCEA 2DQZA 5AHXA 3FWHA 5AM1A 4X6YA 5AOCA 3WWDA 2V9ZA 5BWCA 1DQYA 4OYLA 2JGFA 2ZJFA 2C0QA 1K4YA 1QONA 2V96A 3NWOA 2PL5A 5ALRA 1AUOA 1UZAA 4HTAA 1EI9A 3A70A 1RWQA 2RAUA 3V1MA 5EIEA 3AIMA 4Q3OA 2RONA 5D3ZA 2WFLB 3WKCA 2VT6A 2WTNA 4UHDA 4QWWA 5ALMA 2JGJA 5T4FA 1ZD5A 4EZIA 2ECFA 2OAGA 3WK9A 4Q34A 1K5PA 1ACJA 1QFMA 4CIBA 1GQRA 3EQ9A 3M83A 1XZEA 2WIDA 1THGA 2OLEA 6YASA 1E66A 2QJWA 5EHNA 5K3CA 3F96A 3R3ZA 3I1IA 4I3FA 4N8SA 4U2GA 4Y2YA 5CT8A 1SC9A 1KU6A 3F8SA 1WOMA 3PF9A 5K3AA 4WY8A 1WPRA 3WL7A 4H7JA 1TCCA 2AJLI 4NVRA 3M82A 3VVMA 5ALLA 1CVLA 3V1LA 1G4HA 1HBJA 3ICVA 5AKEA 3R40A 3CCCA 4Q3KA 3HSSA 4I4CA 3I2GA 3EF3A 4DNOA 1P0QA 4X85A 3KWJA 3QVMA 5C8ZA 2BGNA 3ZPXA 2XUDA 4J0CA 1UXOA 4CIAA 3G0IA 1WHTA 3AIOA 3DYIA 2JGLA 4J0KA 1XRQA 2RGUA 2Z3ZA 3RKSA 2I3DA 1K6EA 2WG0A 3DOIA 2J4FA 4QEKA 1Q0RA 1CQZA 4V2IA 3RM3A 1CUFA 4U2FA 2XMRA 3WA6A 2G5PA 4BZZA 2CUTA 4X71A 1BS9A 3HACA 5DJ5A 1YA4A 2J4CA 4LXHA 2OCLA 3E3AA 4DMCA 1FFAA 3WJ2A 4Y2JA 1YS1X 4GBGA 5ALYA 4AN0A 2UZ0A 3YASA 3KD2A 5AM0A 3CN7A 5CT5A 1FFEA 2WLSA 4QLOA 3STXA 3FSGA 1CQWA 4X94A 4K6KA 1WM1A 2PSFA 1XZIA 3G02A 2FJPA 2WUGA 4BATA 4ROTA 3EBLA 2VJCA 1LPPA 5C8XA 2BAGA 4AMZA 2JBWA 1IUOA 4Y2UA 4Q1VA 5JD6A 2XE4A 4AB1A 5HKBA 3ESDA 4OD0A 2PX6A 2HFJA 2PKYX 1ZI8A 3C6ZA 3WMRA 4OU5A 4E46A 4MEAA 1DT5A 2C4HA 4PSUA 4QDXA 1NU6A 2ZYRA 1CUYA 5ALQA 4ZI5A 5CXXA 4B6GA 1XZFA 1XLWA 5CTAA 1EVQA 3AINA 2WTMA 1TK3A 1R4ZA 3R3YA 4DNFA 5BOVA 2H7YA 5JAOA 4U2DA 3KOOA 1QTRA 5T4BA 3UMJA 1F6WA 1C4XA 2GBGA 2O2HA 1MN6A 2B61A 4RE6A 3LLCA 4H7DA 4MXDA 3PI6A 1XKLA 2D0DA 1R1DA 4C89A 5LZ2A 2HFKA 2FX5A 2XUGA 3LP5A 2ZYSA 3PE6A 4N5IX 1HKHA 1BRTA 2YASA 2QRUA 1O6GA 2XMQA 3QH4A 3QBJA 1JU3A 3HYSA 1ZD4A 2RIPA 4AO6A 1U4NA 3N2ZB 3MUNA 1CIJA 1ZD2P 3WKDA 1XRPA 1GQSA 5A7GA 2W6CX 3D7RA 3FVRA 5IKXA 2WHPA 5FDFA 4P92A 3HI4A 3W9BA 4F60A 3C5WP 3ED1A 5JD5A 4YPVA 1UFOA 4WY5A 1QGED 3EQ8A 3AZQA 2GBIA 2LIPA 3WA7A 4W1QA 5D3KA 5CMLA 3E1GA 4H0CA 4L3WA 4DGQA 5SYNA 5C8VA 3HEAA 2WIKA 4H7EA 4W9RA 5K3EA 2QTBA 4DM7A 1GT6A 1XROA 2ES4A 2PSJA 3WWEA 2QUAA 1UOOA 4FLMA 2WFLA 3WYDA 2BUBA 1GPKA 3FYUC 1VXOA 2FUKA 1MJ5A 4X95A 4DSZA 5IVHA 1XQWA 5E4TA 3JWEA 2H9YA 2XUIA 4JH0A 4GEGA 1A8SA 1LZLA 2VAXA 1J2EA 1GPNA 1QIJA 1P0PA 1XZCA 3V1NA 3DKRA 3MUOA 3OPMA 1Q84A 1L7RA 1MAHA 1AX9A 4B0OA 5AKIA 4C01A 1MTZA 3I2IA 5D7BA 3H19A 5DNVA 1AKNA 1H2YA 1KU0A 5HKAA 4C87A 3OM8A 2WQZA 5F4ZA 3IBTA 4DMHA 5AOAA 3G7NA 2WM2A 3Q8WA 1M33A 1ZIXA 4HAIA 3STWA 3PUHA 1E8DA 1CPYA 3SX4A 3VVLA 3DDUA 4KE9A 1N8SA 5ALKA 3WKBA 4FKBA 4Y7DA 4OYYA 3BDIA 2HU5A 2C5GA 2V98A 1TCAA 4Y2SA 1ZGCA 1QZ3A 1CUJA 3C43A 3BF8A 3A2MA 1K8QA 5AI5A 5ALIA 4EUSA 5JARA 2WIGA 1SCKA 1DX6A 5CT9A 2HU8A 1WPXA 4NMWA 3DEAA 1LPOA 1XLUA 1X2EA 4UFOA 4EY4A 3BJRA 4DLNA 2GZRA 1R50A 1R88A 3QMMA 3GBSA 1UWCA 4E11A 4HZGA 3WK5A 3HLKA 4Y2XA 2BKLA 4H35A 1IZ8A 2GBCA 3U1TA 2VQ6A 1LNSA 3ESCA 1MX1A 1QLWA 1GXSA 1E3QA 4CG2A 2JEZA 2HRRA 4QWMA 5JIBA 4BAZA 2XMGA 4FMPA 4K5QA 3HJUA 4GXNA 2Z8ZA 4BE4A 2HM7A 4B83A 4H18A 4WJLA 4UBNA 3WL5A 2WHQA 2O2GA 2BFNA 2J3DA 4MWTA 4HXGA 3EIOA 1CUHA 1LGYA 4B80A 1THTA 2VJBA 1CLEA 1XQXA 4J03A 2G63A 1J07A 1EB8A 1WCYA 4KE6A 3WK7A 2WU3A 1YSCA 4MYSA 4DYHA 3D2AA 4S0XA 3H2JA 3H1AA 7YASA 4HXFB 1AC5A 2ROQA 4UHFA 1L7QA 4OCZA 4EY7A 1JJIA 3STVA 1SCQA 3W2TA 4Q05A 2ACKA 1BEEA 4G5XA 3ZWQA 4XWGA 5LZ9A 3F9CA 5EI5A 1HL7A 5HF9A 1UOQA 4KE8A 2BUAA 2XUPA 4J0HA 1XZLA 3NUZA 1RYYA 3ILSA 5H3HA 5I9IA 3WLAA 1ZICA 3OTQA 3I28A 3G0BA 2R8BA 4LXIA 3I6ZA 3WK6A 4UBJA 4CCWA 1BN6A 1ETHA 4H7HA 3FOBA 2IIVA 2Y6UA 3QPAA 5AM2A 5ALFA 3VISA 4C4YA 1JT2A 1GGVA 1FFCA 1CV2A 1TIBA 2OCKA 4UFPA 2VA9A 2ZVDA 3OURA 2CJPA 3TEJA 2X8BA 4GI1A 3H2HA 4KRXA 1FJ2A 3MVEA 4BB0A 1MNAA 4QDOA 5AKYA 3B12A 4YASA 5AKHA 2G4LA 2PU7A 1W1IA 2VJDA 3PDCA 5JADA 4W1RA 5AI9A 5CH8A 5JASA 2AJDA 1XRRA 1IZ7A 4X6UA 2JGKA 1UK8A 1LZKA 2WIJA 2YXPX 2OCGA 1JMYA 1CUXA 4WDQA 2ZSHA 1W75A 3ZLTA 3DL7A 5LKRA 1ZGBA 4CFSA 1R3DA 2OQVA 5EGNA 4GW3A 2Y1KA 5AP9A 4H7IA 2PM8A 3A6ZA 5LZ8A 1EVEA 1CUIA 1YB7A 2XLBA 4XJVA 5LKAA 2ORYA 1QO9A 4IHAA 2WHRA 4WFIA 2OCIA 4HS9A 5LLSA 3E4DA 3L1JA 4Q82A 2WJ3A 3O9MA 1PV1A 3C6BA 2PVSA 1X70A 2X5XA 3LIIA 3WWOA 4A5SA 4AX4A 1EH5A 1VJ5A 4G9EA 5JD4A 1YAJA 2PSEA 1ZJ4A 1ZD3A 2QZPA 1SOMA 3LIPA 3T4UA 5IVIA 3UUEA 1VXRA 1EB9A 5E4JA 1VLQA 2C0PA 4HVTA 3G9TA 5A7HA 3C6YA 3RARA 2CB9A 4MQLA 4UFNA 3KXPA 1TAHA 3WQHA 4U2BA 2HRQA 1U2EA 2VSQA 4MYDA 3AZOA 5AOBA 3SWWA 4K6HA 2Y6VA 5K3FB 4AN1A 1XKTA 1CUSA 4J3JA 1XLVA 3O4JA 2YH2A 4OB8A 5JATA 3ZLUA 1XQVA 4DTCA 3G8YA 4QE3A 3NGMA 1P0MA 5EHZA 4CI9A 5FXMA 3OC0A 3FSGD 4FBLA 4G8CA 3RLIA 5AKGA 1CUCA 1FSSA 4BTVA 2OAEA 4F5ZA 2H7CA 3DQZA 4Q3LA 3W9UA 3FYTA 4BP9A 5A71A 5AM5A 1K63A 4MJ3A 1DWPA 5K3DA 5KBYA 2JGEA 2QVBA 5BWBA 5AK4A 4WFJA 1O6FA 1LLFA 4P08A 4MWSA 1MNQA 4L0CA 4GDMA 3BL8A 2IX9A 4GWLA 2QM0A 1F0NA 2OPHA 4DIUA 3QMVA 3IULA 1DINA 4HXEB 4K2AA 2AXEA 1VKHA 3GA7A 4HRYA 4TPKA 4KEAA 4BBZA 3QITA 1XRNA 5CURA 2QR5A 5HFNA 3PFBA 1I6WA 1ACLA 4B82A 2XUOA 1G66A 3R41A 4OPMA 4AZ3A 2XMZA 4AXBA 3H04A 1JI3A 4BYMA 3O4GA 1IUNA 4ZXFA 1QIKA 3WL6A 1PFQA 2VF2A 5A2GA 5DTJA 4WFKA 3FCYA 3HC7A 4B9AA 3IUJA 2JIDA 4B81A 1CUAA 1DWQA 3IIIA 1JJFA 4ZV7A 2QS9A 2G5TA 4BC1A 1R9MA 3L1IA 3V1KA 1XZHA 5DYTA 1H2WA 2XUJA 2HA5A 2B9VA 3BWXA 2XQKA 3R3XA 2BUCA 1A8UA 1CUDA 4W63A 4TGLA 3L1HA 4CG1A 1MPXA 5AK5A 1XZBA 2OGZA 2DHEA 4KRYA 1ZI6A 1XFDA 3UUFA 1Y37A 5AM3A 4E14A 4XVCA 3AILA 4FLFA 3DKKA 1ISPA 1Y7HA 4UBOA 5K3BA 5D6OA 2EEPA 4PNZA 5LIPA 2HDWA 2VT7A 4G4JA 1AZWA 3DYVA 1A7UA 1UK9A 4UHBA 5KWJA 3PFCA 1RP1A 3QM1A 3R3UA 3ZLVA 2DFPA 1J1IA 4BRZA 1UK6A 4RE5A 3D0KA 3ICWA 5CH5A 5JANA 5DWDA 5ALJA 4BAUA 4BAGA 2CZQA 3WK8A 4U2CA 3ZV7A 5DTIA 4DNQA 4N5HX 4IQ4A 1NX9A 1QTIA 2R11A 3QZUA 3ANSA 2QMQA 1EXWA 4UUQA 2PSHA 1HDEA 3TGLA 3C70A 1AQLA 4LHEA 2XQJA 2WJ4A 4B85A 5JAHA 5EIHA 1E8MA 3K9BA 2WUDA 4ZGBA 4PSCA 3NOXA 3K2IA 4PW0A 2PUJA 1HQDA 3PF8A 4RNCA 2RHTA 4X6XA 2O2IA 4KR0A 1W4LA 4A16A 4W1PA 3GELA 4BCCA 4J0JA 4FBMA 3QYJA 4PF1A 3G9ZA 4X93A 1H2ZA 3FAKA 2I78A 3LCRA 4ZWNA 4QA9A 3V48A 5AKLA 5ALSA 2XDWA 5HQ3B 3ESAA 5HK8A 4TVKA 4N8EA 3SC2A 4AQDA 1G5FA 3QPDA 3RK4A 1ODCA 1YS2X 2Z8XA 3C87A 2ONCA 3VJLA 1EX9A 4EY8A 1BU8A 5FLKA 3FYUB 3B3QA 5K3FA 1Y7IA 1W6RA 1HPLA 3DS8A 3I2HA 3FLBA 4QLAA 2WSLA 5AH0A 1UT6A 3VXKA 4Y2PA 2JEYA 3IB3A 3WZMA 5EHXA 4FFWA 2C7BA 4QZVA 1GKLA 2ZJ7A 2IITA 1HLGA 5FKJA 2PSDA 4NZZA 4N8DA 4WCVA 3ESBA 3WKEA 2GYVA 1DX4A 4OB7A 2JGIA 2ZYHA 5ALVA 1VOTA 4QDZA 4X7BA 1UKCA 5ALZA 4ITVA 3HXKA 5K5EA 1QIFA 4YX9A 4RPCA 5FPPA 4A23A 1XZGA 4AMYA 3P2MA 2HHAA 4DMKA 1MAAA 4U2EA 1QIDA 2J3QA 5I7UA 2AJ8A 2JGMA 2B4KA 2V97A 5AJHA 4FFVA 4MEBA 3S8YA 3PUIA 2AJBA 4BDSA 3CN9A 3PICA 5A7FA 1ORVA 2XLCA 4BVJA 2XQFA 5HK9A 2ZYIA 4Z49A 2XMDA 2JF0A 4BDTA 3WK4A 3A2NA 5KWIA 4QNNA 4ZV9A 3STTA 1T2NA 5FRDA 4CCYB 5KREA 4J0GA 3TRDA 1QIEA 5DYWA 4EA6A 3WIBA 4LYEA 3C5VA 5ALOA 3FVTA 1C7IA 4OU4A 3SK0A 1GPLA 2WFZA 3X3HA 4JYPA 4OSEA 1BEZA 1ZJ5A 4EY6A 3GUUA 2VTVA 1EDBA 2VAVA 3JW8A 4EHBA 2HA3A 3WZLA 1AGYA 1SCIA 4Y2QA 1ODTC 3H2KA 3FNBA 3H17A 3I1YA 1TRHA 1YAHA 5JYCA 4Y2TA 2WG1A 3MGAA 3DNMA 3GROA 4BVKA 3F97A 3I2FA 2XUQA 3G9UA 2HA0A 2OG1A 1CUEA 1UKAA 4QDUA 4CG3A 1CUUA 2FJ0A 5BV7A 1Z68A 5LP1A 4ARBA 2VJAA 2ZSIA 1YR2A 1CR6A 5AKXA 4M0EA 2DR0A 5AIAA 2PU5A 1BROA 4BCBA 4DNPA 3D2CA 5JZ9A 3FBWA 3BIXA 4QDTA 2B20A 5CW2A 3W05A 2WIFA 5HF8A 3FLEA 4FLEA 4O08A 4AZ0A 3BXPA 3WL8A 3DD5A 4KAFA 4EBBA 2Y2UA 1BN7A 1U65A 5ALEA 3QMWA 4JYMA 4C6HA 5HF5A 4ZRDA 5T4HA 5CXUA 1W76A 1S8OA 2H7XA 2GYWA 4UBIA 4J7AA 5LYYA 4INZA 1N1MA 5ALWA 1QO7A 1IUPA 3H18A 3VJKA 5LZ4A 3C8HA 4JEIA 4G4GA 1MX9A 1WHSA 3JYHA 3T52A 1ZI9A 3B5EA 2XMSA 2EDAA 4GECA 3M3DA 3WKAA 2I03A 1H22A 3C6XA 1CEXA 1X2BA 1OILA 4HRXA 3I6YA 4MQMA 2GBFA 3DJYA 3STUA 1P0IA 3D2BA 1L7AA 4X3CA 4FTWA 1R9NA 3Q0TA 4W1SA 3GZJA 3W04A 3N0TA 1B6GA 2Z5GA 5CH3A 5HQ3A 4LKOA 4AO7A 1USWA 1GKKA 1H2XA 2P8SA 4G1FA 4PQEA 1A8QA 3H2GA 3C8DA 2ZJ6A 5ALTA 5DYYA 5FUMA 1MT3A 3CXUA 5CT6A 3BJMA 1AMNA 1VA5A 4PV7A 4X97A 4G8BA 1CUZA 4L72A 4B84A 1GZ7A 1LPNA 1VE6A 4K6GA 3FYUA 3K6KA 1QIIA 2XUKA 2HU7A 3G9XA 4J0DA 2GYUA 4GHWA 5IH7A 2WKWA 1OXMA 4BP8A 1QJ4A 4B9EA 4UHEA 2XQIA 4UPDA 4BZWA 1MO2A 2HADA 2WJ6A 3E0XA 2DHDA 1MU0A 1EK2A 2HA6A 1ODSA 4H7KA 5AK6A 5LZ5A 4BVLA 4XIIA 3BDVA 5I8PA 1A88A 5ISMA 5E4YA 3H0CA 1N5MA 1QOZA 5DNUA 3WI7A 3D59A 1U8EA 3A2LA 3WJ1A 1JMKC 3WWPA 3OOSA 5HFAA 3D3NA 1F0PA 1YA8A 3AIKA 3KSRA 5E2IA 4GLBA 4EY5A 2X76A 3BIWA 2C58A 3H1BA 3DCNA 2XQGA 1CUGA 3G0DA 4X92A 2XUFA 2O7VA 1UOPA 2OGSA 2PBLA 3W06A 2XB6A 1AURA 2XUHA 2Y2VA 5AIBA 5EFZA 1LPSA 2WILA 3I2KA 4FNMA 5JAUA 1Q0ZA 5J3JA 3I6MA 2E3JA 1ZOIA 5HF6A 4UBKA 5IVDA 4CCYA 1UK7A 3CCBA 5AKJA 1DQZA 5AKKA 1ORWA 2OGTA 5JZSA 1CUBA 5A6VA 5FV4A 4RGYA 4Y9SA 4IH9A 3H2IA 1CUWA 3D5EA 2H1IA 4WDRA 2OXEA 4BC0A 1JU4A 2WUEA 2PPLA 4I19A 4G8DA 3FCXA 5ALGA 2HA4A 4UHCA 1TKRA 5IVKA 3DL4A 3IVMA 1KEZA 4BRSA 4PSDA 2AJCA 3WYNA 2XMCA 2RI6A 3R3VA 5T4EA 5FPQA 3IUMA 4ZREA 2DCMA 1ZIYA 3IUNA 4KE7A 5C81A 4B0PA 4FDMA 5ALNA 1XZDA
chains in the Genus database with same CATH superfamily
3N2NA 4GSYA 2GF0A 1E89A 4QU5A 4AROA 5CDTA 3CIOA 1XRLA 2ZDHA 3W7BA 2GO7A 2YOFA 2OMKA 5K2MA 1I33A 4EFDA 1QIMA 5T8KC 2IBMA 3QVOA 5ICMA 4WLVA 2C2OA 4PYJA 2E82A 3BHNA 1RZRA 3GP5A 3MERA 4HEJA 2NVOA 1IN6A 3MPOA 4BN5A 3MTBA 2E5WA 4ZU3A 3R76A 4PPNA 5HXAA 4IIDA 5FOQA 1MQAA 4X84A 1BIFA 3CC8A 4PXYA 1WXFA 2CNWD 3FUUA 1OI2A 2RGRA 1LNZA 2C2GA 1FP1D 3ANMA 3KJZA 2QQGA 4PQFA 4ZYXA 3P19A 1RZUA 1DTEA 4AY5A 2XBMA 1E98A 1TZJA 1M8JA 4KBFA 2W0MA 3VPDA 4AP6A 2OHFA 4DA6A 5AI0A 1QFZA 1YCDA 221PA 4TTJA 1NHWA 5DLPA 1R4MA 2V4MA 3T0IA 2D2XA 4DV2B 2ZXFA 4D98A 1GWNA 2FGJA 3I5UA 2X0FA 4QXOA 4JEHA 2WVAA 1YASA 4D9IA 3K3PA 3ZW8A 1JSLA 1NY6A 1KQGA 4RADA 4K6MA 4I5FA 2DQYA 1KEEB 2Q62A 1PJAA 1W52X 4NU8X 4BYGA 3PHGA 3EEYA 3R3WA 5ALUA 1C1XB 5BV1A 4P9NA 1BFUA 2VJKA 2DKFA 4NWIA 3T6KA 5HHTA 4K9RA 5F9FA 2RHWA 1QZTA 3IPAA 2Z83A 2B5VA 4KOEC 1X1QA 3SEAA 1GTZA 2NW6A 1C4OA 2GPJA 2QRPA 1XZMA 4R68A 2RH9B 4UM8B 1CUVA 1N3BA 4UE3S 2YNMC 3VJMA 5BR1A 1RIIA 3AKYA 4DR5B 5BSMA 1EK1A 2RGWA 1MQSA 1JDJA 2W2PA 2FUCA 1SCUB 2XAUA 2OHOA 2OV2A 4MGZR 2RH8A 4C5CA 2BDEA 4ONEA 5BVGB 5KINB 4OMDA 3GFRA 1XVIA 3SXJA 2P0YA 3RUPA 2GA9A 2VF7A 2XRMA 1DU4A 4GT1A 2BMEA 4JKOA 2OBYA 4DCUA 5JYEA 3TM4A 1EZ4A 2ZM5A 3PD0A 2C3MA 4RF5A 3R0JA 4C22A 3PE4A 2YN0A 3ETJA 2P6UA 3HP4A 3JALB 2GZSA 4HAUA 2AQKA 4E21A 1G55A 2VJYA 3EA4A 4AMUA 1N3LA 2GXQA 3ROGA 1N2BA 3RC7A 4KJXA 4KQ1A 1TT5B 1RACA 3GH1A 4H0NA 3DEZA 3T7AA 3QKSA 2NSHA 2K2WA 3TD9A 3WR5A 4PZLA 1EVZA 2SKEA 4CEIB 2XRYA 2OUIA 3QI2A 1DDOA 3KKQA 1MGPA 2BSXA 1KVTA 4WV3A 4J0EA 1NU8A 2Z4SA 1EINA 1LNQA 3B9QA 3QOYA 5C8DA 4LY9A 4AYTA 5IMSA 5JAPA 1JN0A 1Y98A 4OQMA 2J9ZB 2IX3A 3FRHA 4RLSA 4C3UA 3GLFE 3PJEA 4FDVA 3PUXA 2OSBA 3WGYA 4W99A 2JFYA 4NS4A 3U3RA 4DC0A 4P36A 4BNVA 1BKDR 3O21A 4G56A 2QD5A 2JZNA 3LC0A 1KI9A 1SFRA 1K27A 2XPCA 3BWBA 3E81A 4GMFA 5CG1A 4ZT3A 3DA8A 3FCOA 2NXJA 1I1NA 3G49A 4Z7NB 4G5HA 4WOPA 2OK7A 2R1TA 4HDMB 1WVGA 2A5FA 1XTBA 5I9LA 5K6AA 1A2KC 2GBPA 2VYQA 2XOKD 1H69A 3GFFA 2ZUSA 3H5VA 4GU5A 1QGUB 3BFJA 1O2DA 2FSIA 5E9QA 1Z37A 2PKCA 4BJ3A 3X43A 3A14A 3PFKA 1TTHA 1UQUA 1C29B 2FPPB 4UTZA 1TVMA 3LCCA 4PS0A 2NQ8A 3R9IA 1Y8ZA 1E63A 5IAJA 5B2EA 3LUGA 1CY7A 3UXEA 1GFWA 2QRGA 3BD7A 2H1WA 2AN3A 2TSYB 2GKOA 1MIHA 1G6OA 2B99A 4HJRA 3TNDA 1B16A 4LXGA 1OAAA 1NSYA 1XHFA 3PFNA 3I1JA 3ST7A 1NUHA 3TTXA 1S8AA 3P9NA 2JFQA 4F0JA 1EXVA 5ERYA 1V8FA 5BYKA 4YDRA 3RUFA 3AONB 4LOHA 4GG1A 2R4UA 4BTEA 4CNQA 2HMAA 1Z5ZA 4RL4A 1XQYA 5MFZA 3EPKA 4YWHA 3BA1A 3OMWA 1VIYA 2W70A 1RWVA 2FPKA 2WI8A 2NVUA 3V2HA 2QRQA 4N7BA 3UFBA 4ZEMA 4P93A 3FFWA 4A27A 1A5BB 2YWEA 3FPBA 4B6EA 4QGHA 4DC1A 2D1SA 1Z4OA 3I23A 1U0SY 5MHTA 3IURA 1T3LA 4B34A 3ANTA 5A4KA 5IRCD 1R0WA 4DYVA 2LR0A 2OL4A 2V45A 5AUNB 4RK7A 1WB6A 1UBKS 4TLDA 2G0AA 4O4HF 1BCSA 4BP1A 1TM7E 4MI1A 2D06A 5FP0A 3STYA 2VF8A 2GZAA 3ZHXA 4C7MA 2ODPA 1PE0A 4HVCA 1IFXA 5EMLA 4XQCA 4TWIA 5AK3A 2H18A 1GAEO 2VK4A 2VXBA 3H7IA 4PPFA 1H8HD 1TVEA 3TQCA 4EJSA 3DTYA 4DMRA 4KR2A 2FEMA 4R1TA 2VEOA 1XZKA 4GLJA 1N3IA 1T3TA 1S3SA 3L0CA 3AVXA 1JKMA 1WETA 1T25A 4EW6A 4A6XA 2NPFA 5DM1A 2B82A 1P80A 3DZ8A 4R2IA 5E1MA 4EQZA 3EH2A 2P5TB 4JUIA 4NJEA 3RYHB 4Q1CA 1NVFA 4LIPD 3HUDA 4K9NA 3RAJA 1RMYA 3S2IA 4KTVE 3GD7A 4Y9DA 4QOGA 5T5QA 4XX0A 4BL5A 4ZYZA 2JZOA 4PX2A 3FSEA 4NG5A 3A1SA 5AJXA 4WXPA 4YT8A 3TZKA 1CZKA 2G9ZA 4H7FA 4HV4A 2JFOA 2J6HA 3EX7C 1WB5A 5BQPA 3CZ9A 2NAPA 5SYMA 2ZWIA 1XB2A 1RBZA 1RWKA 3R0VA 1V1MB 1BWPA 3VM6A 1ESZA 2XI4A 2JIMA 1INLA 4KO1S 3QU2A 2PT7A 3ZXIA 4BV3A 4RV4A 2IY9A 5ES3A 3T3EA 2OQIA 4E03A 3M81A 5CT4A 3DZGA 3PFIA 1VBFA 2VRCD 4WTOA 5FNVB 1LBSA 3VKVA 3EXG2 3P9QA 1J9GA 4UASA 3HXOA 1A9YA 2ERCA 1P9LA 3ZBQA 4OY3A 2RI0A 1NJ5A 1E94E 1Q1AA 2BEUA 4Q03A 4D9CA 3ROKA 1P1RA 4PGGA 1I4OA 1V45E 1T6XA 2L69A 3AFNA 3DOHA 3IKMB 4IR7A 4P5PA 4QYWA 2VDRB 4JGGA 3CX7A 3FPCA 3PJGA 3WWYA 1FMLA 1JIJA 1L2TA 3KWFA 4TKZA 2XDYA 3K5IA 1TZMA 1NQOA 5EP4A 1LFDB 1MW9X 1E2UA 3RNOA 1EJBA 3O7WA 5E1DA 2X3FA 3SXPA 1RJ9B 4QRIA 2ID7A 2V7GA 4L5AA 2H16A 4WOJA 2G4VA 1J9EA 4M0MA 5KU7A 1QVAA 3BQNB 2VHEA 4YYEA 5CGQB 4CM8A 4ESVA 5C7IO 5L3VA 1TXGA 1Q0HA 4P4GA 2A4KA 2P75A 4JBIA 1FU8A 4P4SA 3RS3A 5CR9A 2ODWA 4EL0A 4IZIA 1USKA 1LQUA 1PG2A 1U7UA 4GWKA 4DMUB 2QPTA 3PYLA 3TH5A 1DARA 1BDHA 1QE0A 4CMIA 5EYPA 4P2BA 3P0HA 1RE1A 2UUBB 1AV6A 3CEHA 3PZBA 2W93A 3S1AA 2WHPB 2DR3A 5JAQA 2H3HA 4IF6A 3DJFA 1IZYA 3LV8A 4OHCA 3EG9A 3I01M 4X6YA 3GJYA 1J2RA 2V9ZA 5EJFA 2VP0A 4E5YA 5BQFA 5HJ7A 3T5MA 2KE5A 5HBGA 1BOFA 3CHYA 1ZGJA 3RG8A 5EE9A 1T26A 2HJGA 4KZKA 5GJCA 2PZBA 1L4MA 1NUSA 5BUCA 4HMQA 4ND4A 3LCUA 4JYBA 4D0RA 1DMRA 2O0JA 5M04A 1AK2A 5HFJA 1LBQA 1NVAA 1RTTA 2WF5A 1P7VA 4JNKA 1VIAA 2FH5B 2E87A 3KSUA 1G5HA 3KTAB 3AGPA 4R3WA 4WK2B 1BRMA 1IE3A 4ZEOA 2ZANA 4YRPA 2YZGA 1DC7A 2CHQA 1XTSA 5CW1A 5DP2A 4C0SA 2H5LA 2W8BB 2Y9MB 1AUOA 3DT9A 1UZAA 2QE7D 1ESNA 4M89A 4HTAA 1VMKA 2FPLA 2IF0A 3DEIA 4X5OA 4IDOA 3HFRA 3GJ5A 1OU0A 1RWQA 1Q1GA 2RAUA 4CQMA 3O8QB 4FYIA 1FRQA 5EIEA 1QKKA 1JQDA 3HO6A 2B8EA 3A8TA 4I50F 4J76A 5D3ZA 1EFAA 1RVV1 3KVVA 2WFLB 4U6QA 4NR0A 2VT6A 2EZ8A 2WTNA 3S7ZA 3VC3A 2V8BA 2JGJA 2C98A 4I6GA 4PICA 3DHNA 3GR6A 1Y9AA 1FP4A 2B4YA 4BMZA 3WK9A 4F3KA 3U7QA 1K5PA 1MB4A 1ACJA 4ARSA 3MINB 4GNKA 2OM2A 1YZVA 3GDGA 1HH4A 4R3NA 1KZ6A 4Q5IA 4V0RA 2YXDA 1GQRA 3LRPA 5E38A 5MDHA 5KHLB 5BPHA 3KTOA 2HKIA 3DBLB 4L27A 3ICOA 3V7WA 4FCWA 1RW4A 1V8BA 1E66A 2ZR0A 3PA8A 3ISVA 4LRTB 4MA0A 5EHNA 2HSZA 3THYA 4DPLA 4OLFA 2OAP1 1NNLA 2WSBA 1X80B 3CSDA 3K5WA 3L1KA 2PZAA 2EQAA 4G2NA 5EP3A 4PYKA 4QG3A 3CNQS 2P9CA 3W4IA 4N8SA 2DBVO 3G8CA 1SR8A 1MABA 1XL1A 2EVWX 2QR3A 3GLUA 3OEED 3HEMA 4KV7A 4PBRA 4UHKA 1B3BA 2ABWA 1OLOA 1DC3A 2CY0A 3QKRB 5ED4A 3VR5H 1EUCA 3F8SA 3PR1A 1H6AA 4ARZA 4EF6A 5K0EA 1HSZA 1QM5A 2GAJA 2WWRA 3L7OA 4ZQBA 3WL7A 4E5NA 5BSVA 1NF9A 5LQDA 2R48A 2IH4A 4ZI2A 5HCIA 1YONA 2XCUA 4D41A 2MMGA 4K9DA 4NVRA 3M82A 2ZE7A 5BXYA 2OCBA 5ALLA 3OJWA 1ZGGA 1LFAA 3KLOA 3UXMA 1J97A 1HBJA 3X1ZA 3PQDA 5H3LA 2ZUCA 1P1BA 4Q16A 2O9JA 3AQ4A 3LVRE 5GONF 1SC3A 3U4CA 5T67A 2Z43A 2P8JA 5KEIA 2D6FA 7GPBA 3QVGB 4JOSA 1MG5A 3QLVA 1U4SA 3ZPXA 2MINB 3MFYA 3NWEA 5ICCA 3JZAA 5BQOA 4MWBA 1UXOA 5CCDA 4CIAA 5T64A 4C1NA 3U09A 4Q3DA 4OJQA 4PFSA 4RKFA 1BHQ1 1QH8A 2ZVJA 2JGLA 4J0KA 1Y8CA 4XR4A 3OQPA 4R2WA 5AT1A 4B33A 1E9AA 4RHXA 4ZVNA 4EF5A 5TC4A 2HJ9A 2RGUA 2ECKA 3MGKA 1P73A 1HFKA 2Z04A 2F8LA 1DRVA 2Z3ZA 3DNPA 4JJ4A 5MFPA 1IAVA 2O8EA 4QODA 2CXXA 2VNJA 2XB9A 4IDCA 2CXTA 1PFKA 4ZC1A 3BBLA 1FUYB 2C07A 2CLIB 1ABFA 2XECA 3OKPA 3R74A 3DEJA 4G1EB 4U2FA 1JPJA 4IXMA 4K9MA 4S1OA 3WA6A 4BVGA 1NMSA 4G85A 1YQDA 1UEJA 1JDUA 3CF4A 3FNQA 4MULA 1VBNA 1R00A 2WA1A 3ZQUA 1CJBA 1WL8A 4BZZA 2PLAA 3L93A 2MSEB 1Z8HA 1V25A 3NCHA 4NNPA 3E3AA 3RUDA 3U48A 3UY4A 4K8OA 2IW3A 3KUDA 4JJZA 1KDTA 1VHWA 2H1CA 1XRSB 4P4TA 3IRVA 4Y2JA 1NMQA 2PIDA 1KERA 3WLFA 2QX4A 3JQQA 1JPUA 1GPDG 3V8BA 2YOHA 4Q37A 3D3EA 3G8DA 3EAFA 3BICA 4R8RA 5K8IA 1UM9A 4FWTA 4ZMSA 4GLLA 3S40A 2BFMA 3SFVA 3FD8A 1DDGA 2ZUDA 3KAPA 1FS6A 1BHO1 5TPWA 1PGNA 1EFHA 1FFEA 1B1AA 1QGZA 2AK2A 2YXEA 5FOXA 4C43A 3WX0A 4UW9A 4ETIA 1VHDA 4O2AA 4JYAB 4QPNA 3MSCA 4PXAA 4R51A 1Q92A 2BLNA 4K6KA 4Z9AA 2PSFA 1P18A 2JDID 1CEYA 1WZUA 3KBBA 2G6TA 4MKXA 1P3Y1 3F71A 1K0UA 1P6QA 3KKPA 2BSQA 2FJPA 2B4RO 4ROTA 4BVAA 3V42A 2FETA 1TDJA 1SXJE 3EBLA 2QTVB 3CUVA 3SM9A 5B30A 2J3JA 4ZHQF 5IASA 4PAMA 2JATA 1KYTA 4ZCIA 1TMYA 4TX1A 4QU9A 5IJXA 2Z4TA 4V1CI 2W71A 4KXMA 5FWXB 1OLSB 2GPYA 1OMOA 1T4DA 3M49A 3HUUA 4HTFB 1X8KA 3TN7A 3W0LB 4BASA 4D9HA 2ZIXA 3CKMA 3HJCA 5JISA 3F46A 5H4GA 3IE1A 1SN7A 3TMKA 5B3KA 4UPEA 1WA5A 4IKOA 4JLKA 5C3MA 2HEGA 4OX9B 2O0HA 5AMXA 2MT9A 3U4GA 1D6NA 1FQOA 4OQNA 4MUIA 3GRAA 2DF8A 1NDQA 4NLLA 4OU5A 4X45A 3GLTA 1DT5A 1NLMA 1T36A 3LXUX 2VQFB 4PBSA 5BN5A 2O3UA 4WZBE 2O8FB 3KVYA 3TOXA 4NXMB 5A0VA 4OJYA 1QE5A 1S2NA 3ZV3A 2M9MA 4BNUA 4MRNA 4B3JA 3F49S 3MHTA 4ZZ3A 1LW6E 3FOCA 4GGMX 3OH8A 1PT7A 2QB5A 1EFUA 1E9FA 4NBVA 5KNBD 1XCGB 2PGDA 5G0SA 4B6GA 1XZFA 821PA 4WEQA 1M2VA 3KQTA 4BNLA 5CDSA 4GICA 4R8LA 1EVQA 4CIVA 3F7NA 2ZJYA 3OY2A 3LX4A 3GLIE 1R6VA 2P30A 2ERYA 2AGVA 2PXAA 3LO5A 4RELA 1LD3A 1QAMA 1QG0A 3RU9A 3AY3A 4Q4LA 3FNGA 1JZQA 2P9GA 3OE1A 5CVUA 3LUDA 4LVNA 5L3RA 4TROA 3RC9A 3SI7A 3THSA 3ZU3A 1J0BA 2C92A 3VDQA 3CF2A 4CLEA 1V7ZA 2FCAA 3RPEA 5I4KA 1E9RA 1XF9A 3B8HA 3VNSA 2HV8A 2GEUA 2YQZA 3GRUA 2VA8A 1ABEA 4H60A 4QBIA 2H7YA 3U7EB 3KOOA 4MKHA 2X22A 3JQAA 4M2LA 4M7WA 4KYUA 3RSFA 5FUBA 4NU6A 3RRFA 1F6WA 5E95A 3KEMA 1Z4KA 4UMEA 3GFSA 2O2HA 4PSVA 1FTYA 4XR9A 1A9SA 4H7DA 4KWIA 2NM0A 3HJAA 4MXDA 4RZIA 4EZEA 1OXXK 2HFKA 1CJKC 5KJ1A 3H6GA 3INTA 5K8CA 3QX9A 3HK2A 1WLYA 1IY1A 3DBOB 3TRIA 1W4RA 2QTAA 1ORIA 2Z1DA 2ZRPA 3OVMA 4ACAA 1NW3A 1A76A 4CEHB 1AHNA 1NZFA 3D4NA 3WB9A 1L4GA 3OZXA 4CHTA 2EL7A 4C4AA 3CNHA 2BP7A 3EW9A 2YASA 4BLRA 2QRUA 5FPHA 2Q5QA 4WKNA 3B6EA 4P7JA 3OU2A 4L16A 4O02B 1RWXA 3I73A 3G5TA 1O6GA 3WAKA 1ZFNA 2Q07A 3U19A 1HMYA 1XDGA 3JQDA 3QBJA 4ZT2A 3IAAA 5A9TA 1V9LA 3NZEA 5KQGA 6REQB 1LX6A 1IY2A 1KYIA 2NNWB 2DYKA 1YH3A 3OZGA 4EB3A 1ZD4A 3RFTA 2RIPA 2EG5A 4YCSA 1P2GA 4E07A 4I55A 4NFYA 4XQ9A 5G3ZA 1PFYA 2NU8A 3T9EA 1CIJA 1YBMA 2YINC 3IIJA 4YCBA 3ETCA 4NYIR 4CMCA 1A50B 3FNHA 1UDBA 1G9TA 4KDEA 4TSRA 3OOHA 3CVYA 3QXCA 4K86A 1ZXBA 4PSAA 2QD1A 1UAGA 1TLLA 4H4DA 3AHFA 4L3OA 5A7GA 4JLOA 1M34B 2I6GA 3UTDA 4DN6A 2VQEB 3K1ZA 3C3PA 4FFBA 4HSEA 1E0KA 3VHXB 5EIOA 5IKXA 1MOQA 1LJUA 2J5XA 4G5SA 1WDWB 3MQ4A 3TLBA 2GPNA 3K92A 1T0UA 3A25A 2AOUA 3B48A 3HU2A 4GPBA 2QNIA 4P92A 1UZNA 2WPDA 5LCXA 4BZXA 1GQ2A 3C5WP 1BZYA 3O1IC 1HV8A 3VUFA 3CZ4A 3WMGA 1IPHA 3ED1A 5JD5A 2AI3A 3O8NA 2WOJA 3LVBA 1KNXA 4P83A 4U2KA 1E7RA 3FUWA 4HK4A 4L51A 2GBIA 3Q88A 4W1QA 1S8FA 4FZJA 1UZMA 3RSQA 4IOJA 4YJHB 4Q7QA 5CITA 3N2KB 3IUYA 3E1GA 3ICQB 4G63A 3GRCA 4H0CA 3U6KA 4JDUA 3N3AC 3K0FA 2OHHA 1HLDA 3EF1A 3JSXA 3KQQA 4GUDA 4S1NA 4U7DA 3GLGA 2AZXA 3NHMA 2VQ3A 1SVUA 2CMHA 4L95C 1MC5A 3GP8A 3U62A 2HMTA 4YWJA 4XCVA 1KVQA 2DFLA 2PSSA 2YXNA 5ITVA 3M4YA 3DHVA 5LC1A 3CRQA 1XTUA 1XROA 1UM8A 4CM1A 2CNWA 2Y0PA 5M29A 3SDSA 3WWEA 1QS0B 3TD2A 1ZJ6A 1Z47A 4FLMA 1F2VA 2ZSFA 4HAWA 3WYDA 4F4CA 1FB5A 4WKBA 2TMKA 2R66A 1SULA 1DAEA 3KHTA 3NOOA 3Q15C 1G20B 4GOOD 4XEUA 5G4LA 2Q5IA 3A1CA 4NDZA 2BUBA 4S2EA 3T7CA 3I04A 5BUSA 3AUYA 1M0EA 5DTMA 2FV8A 1NULA 2X5OA 3AETA 4ZD6A 2JCGA 4BX3A 4C0AC 1R6BX 1Y6GA 3L18A 4AICA 4KR3A 3ONWA 3RIYA 4NK4A 3T15A 3UMCA 1RM4A 3DDNA 1Q2UA 3I9V1 4RIIA 4ZYUA 1F06A 4DSZA 5K4GA 2ZGVA 3EIWA 3P52A 4RHCA 5IVHA 1Z25A 3KPUA 1HZJA 1SRRA 1AKTA 1GUFA 2H9YA 5FHRA 3RRXA 4HR7A 4YRRA 4LHWA 4BQPA 1P2DA 1CKEA 3DF7A 4PC6A 4PHFA 2CDRA 4UEQA 3E1SA 3GAFA 4YR9A 1KMMA 5NULA 5KTSA 3UB3A 1TM2A 2YWHA 4PGAA 2IOFA 3HKCB 1VCMA 1M7HA 4O2BF 3TX2A 1J2EA 1GPNA 2REQA 4HYEA 1ONOA 3TQFA 2HJWA 3CBQA 1RJDA 1UEXC 4IEIA 4MVJG 4W5HA 3E7PA 3K31A 1FTGA 1UFVA 1Q84A 2AT1A 1L7RA 2VSYA 1J33A 2X0RA 2X7JA 2ZYTX 3ZUPA 1RMQA 1KZ1A 2QR2A 1CZUA 1EDZA 2H2WA 1AXGA 5LYJA 5AVKA 3AHJA 1H2YA 2IZ7A 4BU1A 2EP8A 5HKAA 1U0TA 1A96A 2AC7A 2DJ5A 4NDNE 5I51A 1TPZA 1IZ0A 7REQA 5EN4A 4IRUB 2GUGA 2PWAA 2VP6A 5C5EA 1QU3A 3QFFA 1UMCB 3FJ1A 3EPJA 1IYZA 5I9SA 3EZ6A 5SV2A 1I3LA 4I3GA 5GV7A 3PRJA 3QF7A 3W4KA 4A0HA 2C7RA 1DRKA 1SHUX 1RWBA 1F2TB 1SHJA 1U0HC 2PR2A 3I4LA 1Y5RA 4K0RA 4MP3A 2H1OA 4QNRA 3AF6A 2H31A 2W6OA 1ZIXA 3STWA 3TNYA 2XNHA 1IBLB 3IBSA 1DE0A 1E8DA 3CKYA 3UHJA 2W90A 1N36B 4GLOA 1Y6JA 1N8SA 3PT9A 1KF0A 3VO9A 2VJMA 2A6PA 2PMDA 2QP3A 1CK4A 4O5OA 1IZZA 1H0RA 1KI4A 1GTJ1 4QFDA 4F9EA 5DM60 2BEVA 4GAEA 4DQ0A 2KX7A 3I0MA 3U1VA 1GQOA 3UV6A 3WQBA 2F3SA 2IGBA 1YZGA 1PU2A 4D56A 1EP3B 2C9MA 3L4JA 4QDKA 4BRWA 4DDWA 1R27A 4ENQA 1OWOA 3FLMA 3CB4A 3WLJA 1Z75A 3P9RA 4QPDA 3N75A 3L7BA 1M1YA 1R10A 1WDKA 2CLLB 3DULA 2G83A 5AI5A 1MDBA 1RYNA 4K2HA 1EP2B 2B6NA 4OM8A 2ZPUA 3RSLA 1TUGA 3OE7D 2XODA 5F1PA 3ZGNA 1SCKA 2BTEA 2YVLA 1DX6A 3U17A 3KJIA 4NULA 2AE1A 1V4NA 4IL5A 1PJ8A 3T9CA 5D1HA 3CZRA 3KV1A 1P7CA 4U9UA 1UBJS 3IO5A 5G1NA 1JJ7A 2E6UX 4DXAA 3AVOA 5JFTA 1CJUC 2DWUA 3LYLA 4YP9A 3O2SB 3TINA 1MEJA 1KPHA 1X2EA 3HO8A 2QMZA 1JVNA 2ZKIA 1OGYA 1K89A 3TKAA 3D4OA 1GG9A 2H00A 2HX1A 2GZRA 3QWIA 3VKUA 4F97A 4FX2A 4AVYA 3TCKA 2JA2A 3HBMA 2VJQA 3QMMA 1CZRA 1QNLA 4RQBA 2J30A 2OYCA 2AMYA 3DTVA 3MGGA 1K4KA 1V26A 1VG9B 4IZ6A 3WK5A 4E5SA 4Y2XA 4F93B 2AH5A 4FB5A 2BKLA 2Y77A 4H35A 3GMTA 1FYXA 2HD4A 2VQ6A 3S1LA 4GO1A 4PYRA 4ZO7A 1M1XB 2BLLA 1B23P 4AZVA 1QLWA 1UJ6A 1UF9A 5AOVA 5AW5A 4ZGWA 3KSMA 1NVGA 1V71A 2I2DA 2A9KA 3A9RA 4D8VA 1XXHB 1YFZA 2C4MA 1D03A 1S01A 3IR6A 4X66B 3KOMA 5JIBA 2MHCA 3LVFO 4FP9A 1CZOA 3FCCA 4ID9A 1E9DA 4QPCA 3L5OA 2Q1WA 2I65A 2LDBA 1MJGA 1A2OA 1NG9A 1UFQA 4AFNA 3AOEA 3LDFA 1QHGA 4IUDS 4C1BA 1WZ2A 1VJDA 1GFSA 4YLYA 1H8HA 3QVJA 2DX7A 5FR2A 3K70D 3U3ZA 2AK3A 4BE4A 4B3BA 2IZOA 3OQHA 4HGNA 4A36A 4F1JA 5IM5A 3AWDA 5F4BA 1UJNA 4R31A 4XDGA 3UT6A 1AE1A 4EHDA 1T3ZA 1DKQA 3P9SA 3EBPA 5E0KB 3RVDA 2IOYA 1C9EA 2AUMA 3N0XA 1DEHA 3PITA 4MINA 5FWAA 1EM6A 2FPIA 1M73E 1J8DA 2I2BA 1QOQB 4BB6A 1UPBA 1OV4A 2XQVA 1FXUA 3GVCA 5KTMA 5FBRB 5HVNA 3EIOA 4GMGA 1TMOA 4DLWA 3KKNA 5EJAA 4Y1GA 5EPOA 4O4HA 2D8AA 3E2MA 4QUKA 4D3ZA 4Z4HA 3FG9A 5FO1A 1GPBA 3MGBA 3CH4B 3MJVA 1CLEA 2M1ZA 3G1WA 3I52A 5D5PA 3ZJ5A 4J03A 2ZE5A 3LK7A 4Y18A 1J07A 2IBTA 2XKKA 3TPZA 3HCBA 1KK0A 3T1NA 5C1OA 2WT4A 3ETDA 1NV8A 2B94A 4A10A 1ZVMA 3OCZA 3PIRA 1JNXX 3VKWA 3D2AA 4S0XA 4RZHA 2RHHA 3CLKA 5GY7A 3C5HA 5JJLA 2VRCA 3ZY3A 3FF1A 3PFWO 1H2RS 1J7KA 2EGGA 4HXFB 4OGWA 4PYNA 3VR6H 2FVYA 4N5MA 4B7UA 4LF6B 1AKMA 4O4IB 1YK1A 1YKGA 4FE4A 1AGPA 4RC9A 1OYOA 2W2KB 1SCQA 2RHRA 1YVEI 3STVA 3ZK7A 3GAAA 1QGYA 4JI4B 1DJQA 3W4JA 4YLGA 1QX4A 2E1PA 3ZLBA 2ZSAA 1IXRC 2JIZD 4NFHA 4B46A 3ZWQA 4FCCA 1UL1X 1F8YA 5CTJA 4UE6A 3F9CA 3BCRA 1BXGA 2ZI3A 3GT7A 3KUUA 5L8VA 2HNKA 2VF5X 2HHLA 4HH0A 5EXPA 2YTZA 5TNXA 3WL3A 2ZR8A 3ZK9A 5CYGA 4BGIA 3RVKA 3ZGLA 4HSGA 3RVJA 5HF9A 1UOQA 1E69A 1Y34E 2CUZA 4KE8A 1IK6A 4D46A 5IARA 1Z07A 1BX0A 5BSGA 2BUAA 2CFCA 2G72A 3P9IA 3Q10A 4EX7A 3ZG6A 1SEPA 5EXEA 1RTKA 1IC6A 2TMDA 1MX3A 4KQ2A 1PD1A 2HDNB 3GLFB 1JG4A 2IKQA 3ILXA 3CLVA 1QB7A 1BJRE 1R0XA 1CHDA 1GO2A 1PEKE 1Z0UA 3ILSA 1PVDA 1U7WA 3BZWA 5D7NA 4FGZA 4U3JA 5FUQA 1SWWA 2IPNA 1H6CA 5C1IA 5I9IA 1Y9DA 2OHIA 1IOLA 3OTQA 3I28A 4NECA 3REQA 4KXWA 1ZU5A 5BQ5A 1EIWA 3MF4A 3LUKA 1Y6RA 3FDIA 1TMGE 2J0SA 1H8ED 3GNTA 3IQFA 3KKKA 5LD2C 2VPXA 2X2PA 5DM2A 4KITB 4FZ5A 2BBWA 4QICA 4OOEA 1DAPA 2OP1A 1ODLA 1YQQA 1CR0A 4UU0A 3M2PA 1IG0A 1BN6A 3D6JA 2G71A 1RE0A 5SICE 1W8DA 1SVMA 1N8KA 4OSOA 1V47A 2XKBA 2ZWPA 2R2GA 1BVYF 3FOBA 3PKIA 4JP5A 2Q27A 2YQ5A 2J6IA 2JGAA 2KM1A 4IDAA 2ZI9A 3NMUF 3D0OA 4IJUA 5AM2A 5JSZA 5ALFA 3X2EA 8LDHA 3A7EA 4C4YA 1ULBA 2ZIUB 5CA1B 2OHXA 4HGRA 1CQPA 5K0NA 2HCRA 2G6BA 4Q24A 2VBCA 5FT9A 1CV2A 2ZETA 4IILA 4UFPA 3L0OA 2WVHA 2J41A 2P2LA 1AY0A 3A11A 1EKXA 2QE7A 2X40A 1E62A 2EBUA 2QN8A 3G2IA 5AVOA 3BULA 2CJPA 4YRTA 2ZTMA 3GAZA 5T7BA 2P2DA 3AJ8A 4RA9A 4CKCA 1XDZA 3TLGA 4JI0B 3D6TB 3MVEA 4ZAFA 3LTEA 4XB1A 1C9DB 3L1VA 4BB0A 4QDOA 2R9VA 3SIPA 1OFVA 2IEDA 1N75A 4N0PA 4QEDA 4BWVA 3KQKA 1JP7A 4F92B 2OTCA 1W1IA 2VJDA 1QC5A 1O54A 2XWPA 4MS1B 4CT5A 3BIJA 2R60A 2I7DA 4JCOA 3H4MA 5AI9A 5KYVA 3QFRA 3MUEA 3H6KA 3UVEA 3E5RA 3NTUA 3NQ41 3WLNA 1WNTA 2BFCA 3RK0A 5JASA 4QBGB 2OBFA 2FN3A 3LHIA 2Z4RA 1NRXA 4XJSA 3VOBA 3A26A 1K98A 5FH9A 3KR9A 4MS3B 4JHXA 4X6UA 2YV2A 3PHHA 4PC3A 4YRFA 2A9PA 3WXMA 3DWEX 1G41A 4GI5A 3B78A 4J9VA 4E3WA 2YV1A 1HDXA 4RVDA 5P8WA 5JE8A 2CJWB 2F4VB 3L1UA 4MQ4A 4F6RA 3TG8A 4I50A 3OEEA 3ON5A 4TQGA 3HLTA 3P9ZA 1AT1A 2EFYA 4JASB 1OREA 1YB1A 5LKRA 2G5GX 1XU9A 1YB5A 4UXHA 2QMUA 2ZBRA 5TT0A 1EQUA 1ISHA 4QBKA 4YGYA 1AUPA 4CUKA 4DV0B 3QKUA 4YMSA 3ZDCA 5AP9A 1RI3A 1X14A 1HNWB 1GRQA 3TZEA 1LS6A 3WP0A 3RJMA 1L5OA 2ZZMA 3O1HB 3UJHA 3IL2A 1P5ZB 1MJGM 2XLBA 4A1OA 1FFXB 4HNQA 1A4RA 1CY1A 4CMBA 5JSFA 3RRYA 3BJEA 4JC4A 4IHAA 2WHRA 3OQIA 1YZFA 2OCIA 4HS9A 2WHXA 3HM2A 3QNMA 1X1BA 1FSGA 3G0HA 3L1JA 4OHPA 4Q82A 3SHWA 1ZHOA 3NVAA 1GRCA 4G01B 3O9MA 4HOYA 4KVAA 1PV1A 1J1UA 4HEQA 1F4LA 3X1JA 4YRIA 1YQTA 1ZJJA 4LZNA 2PS0A 1N2CA 4RMIA 1JEYA 1GQQA 3NHPA 1JDNA 5EJGA 1DMSA 2ZRMA 2DPYA 5ITWA 2X5XA 3CF0A 3UA3A 1R15A 2XMPA 3D6MA 1SIOA 3R3JA 2D2FA 1U3FA 2WEKA 1ZPDA 1F9EA 1O03A 1PP4A 1QZZA 3LF1A 2W2QA 4AX4A 4BLTA 1R6XA 4GOND 3QRWA 5KHOC 3GL9A 2D0OB 2FSGA 2O0MA 1E4EA 1ITZA 1HDOA 1R74A 3DL0A 4G9EA 5JYDA 4MRMB 5HQJA 1CC1S 2B35A 1BA2A 2PSEA 2QX6A 5CB6A 1L3IA 1YZTA 3IMCA 5J1TB 5IVIA 4JA0A 1YJ8A 5GONA 2R6DA 3U81A 3NTLA 3CB2A 1P2TA 4D8TA 5SZJA 1JIUA 5FJIA 5LA6B 4Q00A 1LEHA 1J24A 1EGQA 4BXOB 4OLBA 4R9SA 4IDGA 2PWYA 4TYWA 1HO3A 1BS2A 2ZBFA 1X8LA 3UAGA 1Q7CA 2CB9A 4DCPA 5K8UA 1Y4UA 4MI9A 2X3YA 3HU3A 4O63O 1VYUA 3TEMA 4DDMA 3FRJA 4W5RA 2PYDA 1TAHA 1Y6QA 1R9JA 4U2BA 4HWKA 3USZA 2CVQA 1OWMA 1E2HA 1VKRA 4OVKA 5JAMA 3N5KA 4H31A 5KOJA 3ETGA 3F0TA 5FFFA 2WWXA 3RTDA 2UZ3A 4E1AA 2ZTUA 3AZOA 3LDGA 4OK5A 5AOBA 1X19A 4QTTB 3FETA 4AC9A 3O8OB 4BJ1A 3CRW1 1VRVA 1FRNA 4H17A 3VU0A 5BNWA 2WYHA 1FYEA 4OP1A 1SO8A 4URHA 4LXQA 3EVCA 4BMSA 5KOIA 3F6CA 2F6RA 1CXZA 5TQVA 5BSKA 5KNLA 2GWRA 2FW6A 1GU0A 3AY7A 1UBTS 3KFVA 3QVLA 4K3VA 3SJBA 3ZLUA 5JATA 1UJ2A 5C80A 1PFUA 2VT2A 5DI3B 2OILA 1CRWG 1ECFA 1NC1A 4DTCA 5KQPA 3QVUA 3P0IA 1HORA 3GEPA 3M9LA 5EHZA 4CI9A 3NGLA 1NVDA 2JFZA 3O3NB 4IS3A 5FWYB 2QJFA 3OC0A 2IBSA 2JRLA 1TTQB 4A73A 4TVSA 3HGTA 4G8CA 1A9OA 2C5LA 3HGMA 5K0JA 4ND1A 3DV0B 1JIQA 2C83A 2VJNA 1LBEA 2VHYA 1UWLA 3K7EA 1CUCA 1OZ0A 1K2WA 3UMBA 4D9MA 1RQRA 2OV4A 3V8RA 4CETA 5IWCA 3OZIA 1FSSA 5F76A 3BAFA 5BOSB 5L3QB 2R1VB 1OHHD 2GF9A 2QF7A 1EM8A 1NC3A 1PNTA 1PUXA 1XNHA 1Z22A 4EGFA 2H7CA 3PX2A 2OBMA 2X8AA 3G6WA 4N6GA 1KMHB 5DGTA 2GUWA 3O73A 2IODA 3P2YA 1B74A 5F2EA 4H15A 4XB6B 3ZU5A 2IYZA 3OPQA 1VFPA 1LWOA 3CZQA 1TB4A 4BECA 5FAXA 1TM5E 4Q3LA 3JZDA 1ZK2A 4E12A 2CF6A 1A7AA 5JCZA 3FYTA 4PZPA 3VNRA 4O33A 1YBFA 2J31A 5I7VA 3VTZA 3CNOA 3HBAA 4U0KA 1G0NA 2NTJA 3G2KA 4CN8A 2XYVA 13PKA 1SVIA 4ZHQA 4PNEA 4U02A 4QXAA 1XCLA 3K6SA 1FNDA 3IAHA 4CF3A 3I39X 2JGEA 2VCYA 4RWEA 4AIRA 1SHZA 4ZYLA 3T1YB 3K0KA 2ZZKA 3JQPA 3O8RA 1F2UA 1TECE 1YBHA 2F64A 3NUQA 4UUBA 5H0IA 3U5ZB 1GCUA 3Q3CA 2COUA 4IDDA 2D8MA 3I58A 4HQNA 4GDMA 1GGMA 2AFVA 3RS9A 4DC9A 3FUVA 2DFVA 3NASA 4KIGA 2IX9A 4J2TA 1ISFA 2VTBB 3L4BC 3PRKE 1II8A 1SXIA 3OCJA 3PGA1 4IF4A 2GTIA 2OB2A 3EVBA 4DDVA 1KPIA 3PNYA 4IBOA 3DHEA 2O8DB 1DBWA 3NCTA 1L4HA 5TQ2B 4BGEA 1GSIA 4KQHA 4FD2A 4Q9IA 3R7WA 5GIPE 4UOQA 2A5GA 1L5QA 2A88A 1QLHA 5GOTA 1NXTA 5KVVA 1MH9A 3PX7A 3HB9A 4W5TA 5JEEA 3EMDA 1I8TA 1VLMA 5F3RA 1RJFA 2QR5A 3M5CA 4HUQA 5CURA 2XNDD 5DH9A 1FC0A 1JKJA 3PFBA 1I6WA 4BMCA 1CR2A 5EXXA 1PR9A 3HBFA 3O0TA 4NHOA 3DKVA 3ODGA 2XJ4A 1PX2A 4QC2A 4B82A 4MB6A 4MWGA 1E6UA 4DEXA 4AZ3A 4OPMA 2RSLA 1N0WA 5J43A 3KLNA 2NP7A 2DPLA 2IXFA 1BW9A 4FT2A 2GD0A 3NFRA 3ZKAA 1Q0TA 1G6Q1 3COJA 4NMMA 2WK1A 4HFRA 4J0QA 5LMUB 1C3EA 1E32A 1QF6A 1QIKA 3ZQJA 9ATCA 3UQZA 4F4UA 1DIGA 1SKQA 1DKRA 4PG6A 5EWJA 1VMDA 2E2WA 4MR9A 3ZX5A 3F5MA 5DTJA 3MJTA 2QWXA 4TMYA 5A06A 1RKBA 3COPA 1MTOA 3HC7A 4CWAA 2VYCA 4B9AA 1DP4A 4MUBA 5FKJA 2BHSA 4LGMA 5IYZB 5KKCA 4FT4A 1NW6A 2O19A 1D5WA 2QTWB 1CUAA 1DWQA 1ECCA 1Q20A 2WSYB 3IIIA 1Z4QA 4TKMA 3NBMA 4G0VA 3ANNA 4ZV7A 3QEAZ 3ZWDA 3VKGA 1DFIA 4QYMA 2QS9A 3W5VA 4BC1A 3L1IA 1U5BA 4O1HA 4RDCA 2RARA 4IINA 3DO5A 2GRAA 2VK1A 1FDVA 5DYTA 4IP0A 3WC4A 2P27A 3Q6IA 4KLCA 2B9VA 3TI9A 1N5IA 1NPTO 1F8FA 3MWEA 3UJBA 4L6IA 4DA0A 2PT9A 3W7AA 3EPLA 1DG9A 2FP3A 2GVZC 2J48A 1JR3E 2IRWA 3KWLA 1E6WA 5ICFA 1VYTA 3VX3A 4MKRA 1X7GA 1CUDA 2YWCA 1VP9A 4TSKA 3WLKX 2YFHA 1DOHA 2JK1A 1CQIA 5LSAA 6ABPA 2X1HA 2WAOA 2IYSA 5FFNA 2IUTA 4CG1A 2ZSUA 1A71A 4I6EA 1Z62A 1U1EA 4ZPJA 4BMOB 5L3SA 2OBBA 3LZDA 4TRRA 4D0LB 4KPUA 1SU6A 2WU8A 3CW2A 2LCQA 5JWOA 1WSAA 1ZI6A 2QU7A 3GRPA 4X41A 3UUFA 2PQ2A 3V8PA 3PNKA 4QL3A 5FOUA 4RF3A 3H5TA 4EPYA 2Z9BA 3TBFA 4E14A 3WBJA 4WXYB 1KGDA 3LHKA 4KCGA 5BR7A 1P44A 4DRZA 4UEOA 3EE6A 1TW3A 1THZA 5LB4A 5KPDA 1P5HA 1MW8X 1SXJB 4A6PA 5KOYA 5IJWA 5D6OA 4J43A 2EEPA 5TARA 1K7SN 4PNZA 3RVBA 5IUNC 1J5EB 4FSXA 3Q3JB 5LIPA 4WCFB 2HDWA 2CEAA 3EWSA 1WULS 2BTQA 4NYIQ 1KEUA 4ARVA 1MVNA 2V74B 2GCIA 4I1IA 4XE5A 2JFXA 3BM5A 4N6NA 5DRYA 3V4VB 1IBCA 1XPJA 2QROA 5GOZA 1PQUA 1W88B 2HJSA 4LSGA 2ZQYA 4WFQA 5LQRA 1JSZA 4FQ5A 1D6MA 2FZKA 3ND8A 3QX7A 2YBEA 5F64A 3R3UA 1B93A 2WR8A 3ZLVA 3QY0A 2FUEA 2ZZNA 2I1QA 1Z08A 3WGGA 3AP3A 2ZTSA 3A1EA 3D0KA 3ICWA 2YJ6A 4MUHA 4XTCS 2WWIA 5CH5A 3A6JA 3OPYB 4FOTA 4XM1A 4EB6A 4RIHA 5ALJA 5I7EA 2E89A 2CZQA 1GGEA 4K1XA 4ISBA 2C7OA 2YFYA 5DTEA 3WK8A 2YMMA 2HMWA 1A9XA 1ZGAA 1AH2A 1TJPB 5A05A 4CI0B 3BVPA 3FB4A 2FRVA 3IT1A 5DTIA 2E1RA 3AL3A 2Y4OA 4N5HX 4KSCA 3RODA 1L4NA 4IQ4A 1NX9A 1QTIA 3SU8A 3GLIB 3KELA 2DETA 3L8DA 1N7GA 4IDFA 3FPSA 1OLXB 2OHJA 3OZEA 1KWKA 1IEQA 1DADA 1GN9A 1YVDA 2I4TA 1QH1A 2EZ4A 4NCAA 5DHUA 1KAGA 2DQ4A 3MOSA 1AKQA 3H1PA 1WXDA 5DEIA 4IW3B 3RAGA 1KL7A 1GL3A 1DQSA 2WJ4A 1K08A 3FVQA 4JR1A 4L1KA 4RJTA 5F7XA 2LKCA 5EIHA 2MTBA 1JWLA 5E2AA 1V9SA 3RHZA 4AKIA 1F17A 3NOXA 4I5GA 1M6VA 1ONSA 2OYRA 1TT7A 4PW0A 2GFHA 4FUTA 2PUJA 2ZRQA 3HY3A 5D51S 2GGSA 3LJKA 4YJ3B 1YZHA 3TS1A 3ZDQA 3JQBC 4Y6SA 4NJOA 1M8KA 4L75A 5K3SA 1ZVVA 4B3GA 4EDHA 3GMDA 1MOZA 1EPUA 4BNYA 1DAIA 2JLRA 2WWWA 4O2BA 4JP1A 4TUYF 4X6XA 5HIMA 2M6KA 3RUIA 1DJOA 3L7LA 2F8TA 5KHAA 4KJZA 1NONA 2J9GA 3E0QA 4G9BA 4MGEA 3UB2A 4DQDA 4A16A 4C6TB 1EUQA 4Z4QA 2SKCA 4KR7A 5ADUS 1XPOA 1ZA2A 2FPGA 2GK3A 3QG1A 3MJRA 4NCJA 2X8JB 5K4HA 3S2FA 2FFBA 4G0WA 4F4HA 1Y1PA 2ZT8A 3OZAA 4X93A 4BPRA 4HN2A 1N6HA 4UM7A 1U9CA 4IQFA 3SMVA 3VPCA 2KQUA 4QUDA 4ZWNA 1UBMS 3SQWA 4HWOA 3COWA 1WVIA 4ES6A 1HYGA 1YI0A 4M1QA 4M7OA 3FHCB 1BVHA 2G1JA 5DM4A 1W0JD 1M0WA 5ALSA 4B71A 2O6HA 1U1GA 3VO1A 2Q9BA 2VQSA 4LWOA 1OROA 4BN0A 3RV3A 3CVUA 4RK1A 2GETA 1K7CA 1DTWB 4EY3A 2OE2A 4N9WA 4NYMR 4TVKA 4I1VA 5IPFA 2IEGA 2C9ZA 2DQKA 4UZEA 3OQNA 2WQ6A 1VE1A 2D13A 2H4WA 3WFJA 3M6LA 5EWMB 5HX7A 1NF3A 3LGXA 2G06A 4IJ6A 5CVDA 1E20A 5D85A 1UC5B 1T2UA 2W6ID 4C4OA 5IFLA 1JQ3A 1L7NA 2V3CC 1G5QA 1YZKA 2R6R1 5B1EA 1XMPA 2Z8XA 1HDIA 5TQ0A 1JFSA 1JFVA 3AM5A 3ZWMA 5TS2A 3VJLA 4F91B 2AZDA 1PX0A 1ZKDA 3WSTA 3M6AA 4HQRA 4EJMA 1QR6A 2QN2A 1T5TA 2ZE8A 2I3BA 4B3HA 2I2WA 2V7UA 4X3OA 1FYWA 2KJQA 3AHGA 1YR7A 1UDRA 4GM1A 5DMXA 3DS8A 3CTMA 3I2HA 3QVXA 1PG0A 4YRMA 4EUFA 4FKZA 2W6NA 4RFSA 3E48A 4LOIA 3GNSA 2F7SA 3QFSA 4ZCSA 4F4DA 1SQFA 4Y2PA 3VFDA 1GDDA 1NRJB 1ZM4A 2I54A 3W9YA 4EPRA 5B6IA 6CHYA 1A2QA 3MWLA 2I6FA 4YR7A 2P9EA 1WR8A 4UAJA 2TMGA 5EHXA 2XGMA 5FA6A 3GLGE 3ERCA 4MWZA 3N53A 3KHKA 4FFMA 1OI7A 2GHRA 1JYSA 4EYEA 5BW6B 5EZ6B 1WBDA 4JC0A 2JNWA 1Z0SA 4AF8A 2IITA 1HLGA 2Q3CA 2QYOA 4GX2A 2F3TA 4HXYA 3GGOA 1RBMA 2PSDA 3RSCA 5JTUA 2VDQB 1M1NA 5CB4B 1V5WA 1PZNA 4FXOA 4G36A 2P79A 4LHSA 4WVLA 4N8DA 4YXWD 4ZI7B 2ZULA 4K40A 5K0TA 1F7UA 1DI0A 2WC1A 2GZMA 4O0MA 4I1PA 4MLDA 2OP0A 4DIOA 1Z0JA 1TPYA 4CF4A 4BBJA 5JXHA 3R5JA 3MTDA 3PNLA 2CCKA 4ZQFA 3LXXA 1P8AA 3LY5A 3W34A 2O07A 1U99A 2GD1O 4H4CA 2GN4A 1TZBA 1BG6A 2JGIA 2OV6A 1MFPA 2P5SA 2YIMA 3GXOA 4RV9A 3OPVA 4UD6A 3NH9A 2IH5A 3GH3A 5MGBA 1B76A 5A3RA 3IAEA 4UMFA 3I5MA 2D7CA 4PM4A 3H8JA 2A9JA 2DTXA 5C34B 4AJ1A 4CIXA 3Q87B 3OOYA 1UEIA 1P62B 2W4MA 3KYBA 5EJ7A 4HFJA 4JLDA 5CLHA 3UENA 3ZVRA 4A23A 3NI2A 3WWZA 1YZNA 1PYGA 3AR7A 1XZGA 3K8OE 1GTL1 3ZW9A 3IXQA 4NZNA 4AMYA 4JSRA 3HJHA 2ECOA 4YHBA 2HHAA 1S9DA 4WSOA 2V7PA 1MAAA 4Q9HA 3BGDA 1UT5A 1QIDA 2IZ0A 4ALKA 2J3QA 1FFGA 2NO7A 1LDNA 2Q9CA 4ZP1A 4PIMA 1X77A 4URVR 4R81A 1NPYA 1MC4A 2V97A 3AC0A 3NS7A 3RBVA 3KCNA 3AK4A 1FTNA 5HM8A 4KQJA 1Z7GA 4FE7A 2PX2A 4HLDA 4UKDA 2WWYA 2W58A 2I6UA 2EJUA 3CN9A 4L8GA 1CJVC 3KXDA 3WYFA 3OX3A 2I33A 3KR0A 4WZAA 2DECA 2GSWA 2ZEJA 2XE8A 2ZYIA 2BGLA 3FPJA 3IOBA 2IXBA 1QHNA 4M1MA 5L51A 2XMDA 3FFXA 3A2NA 1Q21A 2GEVA 2QYTA 1N0IA 3BRSA 3CYFA 4QNNA 1DEXA 5IW8A 3W5SA 1Q1QA 2D74A 4H4EA 3AT1A 4ZQEA 3SXUA 2J5KA 2C1EA 2EEZA 2HPHA 3BILA 3TR5A 4X54A 4W5QA 4BNDA 1N7IA 3HKBB 1LV7A 2O2EA 5GWXA 1W87A 1DPGA 3UHOA 1CERA 3O4VA 3RVQA 4F8JA 4IRMA 2H2GA 4BQSA 2AWNA 1F4VA 1E1RD 1QIEA 5DHSA 4ER6A 1FDTA 2JIZA 1N9ZA 1LTHR 3ND6A 2QTLA 2XD4A 2LGJA 1F8GA 4R1OA 2BZ0A 4RH3A 2BVNA 1PLKA 2GZHA 4LBWA 4OU4A 4DM3A 3ULKA 1L0BA 5T41A 4C5BA 4L08A 2WFZA 2PMEA 3ZCSA 4XJXA 5HKKD 3ZD9A 1MORA 2F8MA 3B53X 1JAXA 1JPVA 1XTRA 5TE9A 1E0DA 5HILA 5JHGB 2GNOA 3JAKA 2SCUB 4QJ4A 1XCJA 1ZJ5A 4LK2A 4DS3A 5H4HA 4EY6A 2FJUA 3E7XA 4M9XA 4AJEA 4Q19A 2EJWA 3B1JA 3DAPA 2J8ZA 4TTAA 4WADA 3KXKA 3ASZA 1WY5A 2CL5A 3T0FA 2HA3A 2FRDC 1JMVA 1M1YE 3Q7SA 3BYZA 3KVRA 1IN4A 2IEBA 4LBZA 2AKAB 1G8HA 1SCIA 1VFNA 2OKCA 2VH1A 3OLYA 4G67A 1NR7A 4EG1A 5CFMA 4DA7A 1KJ9A 5DHPA 2VRNA 3ZHUA 3O4RA 4OGGA 3EZGA 2QVGA 2WZQA 4RIFA 4RYLA 4CDMA 4CM7A 1YAHA 1ECPA 4KSYA 3BXGA 5JYCA 2VWGA 2J0UB 1D2GA 2X0NA 3MGAA 4K9SA 3TXAA 3DNMA 4MP8A 4YP7A 5FYDA 4D0NA 4JI7B 3WYEA 1T8TA 2E18A 3DEYX 3IIEA 2AR7A 1UC8A 1O0SA 4BEBA 4IDNA 1XZ8A 2CLKB 2A9OA 3ORFA 4MAAA 2IKSA 3C3AA 1JEQB 4AS1A 3SZGA 2CBZA 3HYTA 2P67A 5DBOA 4GKJB 1MIOB 1Y4SA 1L8XA 3A6KA 3BD6A 5K0LA 1J9ZA 3UWKA 1VL8A 4F11A 2VLBA 1CUEA 2Y99A 1D4FA 3VOSA 5IJ0A 1CUUA 4QAQA 1XNJA 2H1RA 3BMCB 2B8NA 2XTZA 4JQCA 5D5HA 2YVQA 4YV2A 2VJAA 2JD0A 1JG3A 2HXSA 3U49A 2QM3A 2QVLA 4NP6A 1XD2A 4B3IA 2QN7A 5DIZA 3T9BA 4F12A 2FSSA 3E7DA 2GAOA 5D87A 2DR0A 4JT4A 2W7TA 4BBAA 5AIAA 3KEOA 3SE0A 1ZH4A 4UTXA 3O8LA 1Y4DE 4R8MA 3H9UA 1XCOA 2E4VA 1HOXA 2XY4A 3VDRA 3CKKA 4B6OA 3N0RA 1Q44A 4PX9A 3KJFA 2MR6A 2XR1A 5CFPA 2Q45A 2Q5CA 3RR2A 3FB1A 3BIXA 4RMJA 5C53B 4JUBA 4U6SA 2CKDA 1FCJA 1O6ZA 3KUCA 5FBKA 5EC8A 5HS6A 1GFIA 2R8PA 1XZNA 4YAIA 4HAXA 1NXWA 1E6MA 1R4MB 4NZPA 1XX6A 3PGVA 2WU0A 3GJ0A 5AVRA 2I8LA 4CE6A 1NI4A 4P33A 4EBBA 2Y2UA 1BNCA 3BMNA 2GO1A 3LK6A 4WLNA 1SZPA 2ZREA 3QQPA 5JZMA 3ZOKA 1G2OA 4UVHA 1M2JA 4DCOA 2QHXA 4OFBA 4DIKA 9LDBA 3GJ8A 3AEZA 3OLQA 2PD6A 4XKJA 5HF5A 3DG9A 3FROA 4ZRDA 3FWZA 3VC7A 3QLUA 2R87A 3NHJA 5IT4A 1WX1A 1UPXA 3A1NA 3OCUA 4HWPA 4GGOA 4CV3A 2DMRA 1NUTA 2NV6A 5FJJA 4YQYA 2PZMA 3KYIB 1T6ZA 4IVNA 1Y3AA 4J7AA 3UB4A 5KSZA 1SD5A 2EKBA 1YQXA 2IP1A 2O2DA 2PYIA 2FMXA 1LJLA 3LC1O 3OEHD 1UUFA 4P0TA 1AUVA 3UFXA 1QO7A 1HE5A 1FA9A 2B0JA 3PEEA 4GMXA 3E9MA 3IERA 4RMNA 1LS1A 2P2SA 1U0EA 2IL1A 4ZO6A 3REFA 5KU1A 4JELA 3BK7A 1VE9A 3ET4A 4Z8XA 2IFTA 2W2XA 1TD9A 1DOAA 2ATCA 1HYQA 2H4HA 5DHRA 1ZX1A 4LXYA 2QMEA 3HJBA 1WHSA 3JYHA 1YKFA 1TZ2A 2F1KA 4GVPA 4MTCA 5IKPA 3B5EA 5J2TF 1GPH1 1F0KA 1EEHA 3BE6A 4KI0A 2Q50A 3KB1A 4R1PA 4EM6A 2EDAA 1ZR4A 2PA0A 4RXUA 1TTTA 2CHVA 4ZVVA 4MZXA 4BNKA 1VDMA 1VCHA 3BBPA 4NE7A 4NF2A 2D5IA 3ZCTA 4LPSA 3Q8MA 4B44A 1CEXA 5GJWC 1IONA 3HCRA 2IS4A 1THMA 2EFHB 4JOBA 4MQ5A 4BRUA 1N5JA 5L7TA 1OILA 3H4VA 3KJEA 5JJKA 2GEBA 4G37A 1D2MA 1KZ9A 3H6HA 2Z1MA 1I2MA 4I4TF 3DJYA 4I81A 1NV9A 2R8RA 4EYGA 4X3CA 5LNK6 1NW9B 4BX8A 4FTWA 3EC2A 3G7SA 3SLKA 1IQRA 3UCFA 4ZYYA 1LC3A 4FGJA 2WSIA 3QI7A 1MUUA 4W1SA 2OD7A 3GZJA 3W04A 3N0TA 5ARBA 5FQOA 2JH3A 4TN1A 4JN6B 5HQ3A 1T5OA 1JHMA 1U3WA 4D3DA 3MQ2A 3VC1A 1EYZA 2IDMA 3O5AA 4KFSA 2BFDA 3AEQA 2OM6A 2MYNA 2FRXA 1M10A 3C16C 4DLZA 5KNCH 3AWIA 3BD9A 1A8QA 2Q1YA 2QL5A 2RGAA 3H2GA 2MSKA 2ZJ6A 2RH4A 3HWWA 3Q5DA 4OL0A 4UU8A 4LWZA 4C3OB 1JXOA 2ZTLA 4TZKA 2AFIE 3DBRA 1ZN8A 3FMOB 3NHKA 4PG7A 3WNZA 4V0QA 5A4FS 1XAGA 2YWBA 1G6KA 3BJMA 5J40A 5KNDA 4X97A 4FS3A 1IIBA 2R1TB 1TJNA 1V6AA 1JLLA 3LO8A 4B84A 1QVZA 2VZEA 3UN1A 1LPNA 3H16A 3KPVA 3NG1A 2IVFA 1HM5A 1M75A 2DY0A 2PKWA 3K6KA 1QIIA 2XUKA 1A9TA 3L7JA 3LLSA 3PGLA 3LZ6A 4G89A 4J7CA 3FTQA 1V16A 3IX7A 4PANA 4DCMA 3EQZA 4J0DA 2C04A 3I53A 5CX1A 1GCGA 2ORWA 5IH7A 3IP7A 4F96A 1QCYA 5KKNB 4HDQB 3UF0A 1OXMA 4G0XA 4YALA 1Z28A 3BZBA 4PN3A 4AX8A 5JBNA 3PPWA 3K6RA 3VZCA 5I8ZA 1SUWA 4Q9AA 3GEIA 3KJNA 2VLIA 3PTZA 1R0BA 1Z0FA 1EK2A 2HA6A 4H7KA 3CRRA 3GZ4A 2BCJQ 4M8KA 3WGJA 2NVUB 2AFHA 3BDVA 4CF5A 2BYTA 2UUAB 1KAMA 1NFRA 2XF8A 4C2BA 1R5BA 3LY7A 4AIIA 2XBUA 1N6PA 1EK6A 1OHHA 3AR5A 3LG2A 5HR5A 4RIGA 2WJZB 2PGOA 3BS4A 5IN4A 3KQPA 1U3UA 3A2LA 3WQSB 3OIDA 4ZK6A 4M38A 4PIPA 3IV9A 3OOSA 1YD7A 1EVJA 2HRCA 2W4QA 4R9NA 5HDQA 3CCFA 3UV7A 2H1HA 2Z2XA 3T06B 2DY1A 1YA8A 2KSQA 2Q5EA 2D1TA 3A1FA 3I0NA 3IMKA 3LA6A 4IS2A 4EY5A 1G8FA 4YMUA 4AF6A 1BCSB 4UUMA 4DHWA 3BIWA 1GPAA 4NE9A 2PDAA 2AD1A 5DHTA 1GYPA 3PNQA 5H68A 5ULLA 3W2EA 3ZU6A 4UTVA 5L6MB 1FMFA 3QU7A 1KSHA 4UU7A 2CV1A 1P9RA 5TLSA 1B6RA 1GZSA 4OAPA 3UK7A 4D81A 4Z4IA 3C1UA 1O9BA 4EJSB 2EATA 4M8NE 5ILQA 3A58B 2I5PO 4RMGA 3JAWA 1P5RA 4DWVA 1VJ0A 2VH2A 4ME6A 2FOLA 1Y1SA 4V0KA 1JHZA 4C0HA 3OJOA 1UOPA 1W581 3QPWA 3FGOA 4MLZA 2BR4A 2AOWA 4NJEB 2Q9AA 2V65A 2CJYA 1GHTA 3DVQX 3S28A 1BMQA 3LXRA 3VH3A 4GBJA 4F9FA 2DCUA 4L28A 3W06A 1P4JA 5LDDC 1UKVY 4XX0B 1UJCA 1E2IA 4UULA 4RKWA 4B74A 3IEPA 3AR3A 1SOUA 3H4IA 4LHZA 4O4IF 3PX3A 4F3RA 2JJQA 3F5QA 1SXJC 2CLDX 2IXEA 1FNMA 3CZCA 3KXLA 3A3OA 4ZOAA 4U4AA 1YDFA 3E58A 1A1SA 5EHIA 3SR0A 4V1CA 2Z6AA 1W85A 3WBBA 1OV6A 3JWJA 4WINA 4P22A 2CLMB 3V7UA 1M0TA 2WJYA 4Q9NA 2A0WA 5IVDA 1EFVA 1T34A 3CMMA 3P94A 3NTOA 3CCBA 1VBMA 3CO0S 3WTCA 1ZQ1A 1DQZA 2N1MA 1LSUA 1ORWA 4JI3B 4PYIA 1T3HA 5ILGA 5TVGA 1N2CE 4A6DA 3ZJTA 5JZSA 1U1CA 3T94A 2BEUB 3QKWA 5A6VA 1NLZA 2VWQA 5FV4A 5IM4A 1PL6A 2CNLA 2QIOA 3ETNA 2VHJA 3SLRA 1OC2A 4J8PA 1JI0A 1VSUA 1WQ4A 4RQUA 1YDWA 2F43B 3JR7A 3JZIA 4CDNA 4YYZA 2H1IA 4PG8A 5G4KA 1PR6A 1ISGA 5AHOA 1RM5A 3UICA 1XEXA 3BG5A 5F1YA 1B6SA 2UXCB 2Y0CA 2Q1SA 3BXZA 3UGKA 1CR1A 2V6MA 4AKTA 1UKEA 1F8XA 2AG6A 3AKDA 1X7WA 3E3MA 3TE6A 2FB9A 3TLZA 4FEYA 1QHHA 3VR3A 3K05A 4P3PA 2Q2VA 1CYDA 3T3IA 2PPLA 4I19A 4L4RA 1T9HA 3Q7EA 2AUTA 1Q7TA 3ECSA 3FCXA 4CM8B 1VHJA 3AR4A 4P4SB 1IXZA 4JL5A 2AHOA 4HHEA 1IG3A 2H17A 3A4VA 2HA4A 3A1VA 3GARA 4JVSB 4GRDA 3VYRB 1ID1A 4CR7A 4HDNA 4CMIB 5EYPB 2HMYB 1RXEA 1U8UA 3R20A 1XL0A 4G1BA 1PN3A 3A1TA 4BWGA 4ENVA 2A33A 1IM5A 2XEDA 3O92A 4OUDA 3W8EA 1C7QA 3JVVA 4QRHA 2QQ5A 4BNJA 3EG9B 5F2NA 1VRWA 3ZHSA 1YFLA 2XMCA 4JI6B 3R3VA 1X1CA 4NARA 1SUBA 2EQBA 4WN3A 2SICE 5T4EA 1UBOS 2IPMA 3OEYA 3DDZX 3LW8A 1E4VA 5BN1A 4ZREA 3BAZA 4BLUA 5FULA 1OZGA 2CFSA 1ZIYA 4BFTA