4QNNA

Crystal structure of phospholipase a 1 from hornet(vespa basalis) venom
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
297
structure length
297
Chain Sequence
PCPYSDDTVKMIILTRENKKHDFYTLDTIKKHNEFKKSTIKHQVVFITHGFTSSADTENFLAMAKALSDKGNYLVILIDWRVAACTEEMSGIQLAYYSYAASNTRLVGNYIATVTKMLVQKYNVPMANIRLIGHSLGAHTSGFAGKKVQELGLGKYSEIIGLDPAGPSFKSNDCSERICKTDAHYVQIIHTSNHLGTLVTLGTVDFMNNGYNQPGCGLPLIGETCSHTRAVKYFTECIKHECCLIGVPQSKKPQPVSKCTRNECVCVGLNAKTYPKTGSFYVPVESKAPYCNNKGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of phospholipase A 1 from hornet(Vespa basalis) venom
rcsb
source organism Vespa basalis
molecule tags Hydrolase
molecule keywords Phospholipase A 1 from hornet(Vespa basalis) venom
total genus 96
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.32: Phospholipase A(1).
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00151 Lipase Lipase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qnnA00
2XUQA 2HL6A 4W1QA 1EK2A 1YSCA 4NVRA 2J3DA 3C43A 4J0JA 4J0KA 2WFLA 3Q0TA 5D3ZA 2GYUA 4M0MA 3H2IA 3STWA 4PW0A 3X3HA 1U4NA 1G42A 4AO7A 3WK5A 4FBLA 2HA3A 3FYUC 3AZQA 5KWIA 3NWOA 5FOQA 1H2WA 2VSQA 1TCCA 4AO6A 1J06A 1CUFA 2O2HA 5HFAA 3R3UA 1H2ZA 4RGYA 3DOHA 3D2CA 4X85A 4G8BA 1QIHA 1R9NA 4PQEA 4EY7A 3BWXA 3R0VA 3RLIA 3MUOA 2DR0A 3F97A 4BCBA 3IB3A 3U0VA 4B80A 3K6KA 5AKHA 4H7KA 2XMSA 4ARAA 1R88A 3W2TA 3IUQA 1UK8A 1J2EA 1AQLA 4PV7A 2PSHA 1VA5A 3DYVA 3FCXA 3BF8A 1LPOA 1WOMA 3I6ZA 3PUHA 1XZAA 3R3XA 1CUGA 4UFNA 5JZBA 3WL7A 4LIPD 4G4JA 3HC7A 5ALGA 5K3AA 4BDTA 5HKBA 1QFMA 5I8PA 5AI6A 4MJ3A 1CFJA 4LXIA 4E11A 1QOZA 4BVLA 1HPLA 2WKWA 4YX9A 3PF8A 2RONA 2WJ6A 5AM0A 2VAXA 3GFFA 3WIBA 3BIXA 1W1IA 1L7QA 4AQDA 5JZ9A 1XZFA 4H7JA 3M3DA 1XFDA 2QTBA 4NMWA 1SOMA 3EIOA 4H7EA 4QLAA 5ALZA 4F21A 3HJUA 4C4YA 4ZV9A 3CN7A 2XUAA 5EHNA 3VJLA 5DYTA 5EGNA 3STTA 3OPMA 3DKRA 2XMGA 5CW2A 5JAOA 2OQIA 5EFZA 4FFVA 2CMFA 4QZVA 4OYYA 1LPMA 4KR0A 3GELA 2WTMA 1ZD5A 1DWOA 1MX9A 1E8DA 1LBSA 3GA7A 4Y2TA 5BOVA 1XLWA 1G4HA 1QJ4A 2FX5A 1ZI6A 1MX5A 3TGLA 2JGEA 1F6WA 5DNWA 3MGAA 1WB4A 5EHZA 4BTVA 2HU5A 3E4DA 3VKFA 1GT6A 5ALWA 5IVKA 3FBWA 4AZ0A 5AM1A 1LPBB 3I2IA 5DJ5A 1PFQA 3A70A 1DT5A 3I2HA 5LKRA 4DMFA 2QJWA 3WJ2A 4X93A 1Y37A 3FYUB 3G9XA 5JD4A 4KEAA 4W1SA 4YK7A 1Z68A 3WI7A 3O9MA 4L3WA 2RGUA 1DX4A 1VZ2A 4HXEB 4UBJA 2XQFA 4LXGA 2V97A 3FWHA 1AMNA 1UOQA 3ZLVA 2WIDA 4RNCA 1CUHA 1WPXA 2G5PA 2BFNA 1EHYA 4G5XA 1XQYA 2ZJ7A 5K3DA 2X76A 1ZJ4A 1P0IA 4WFJA 2BAGA 4OB6A 3ED1A 3C6BA 1AC5A 3PFCA 2XUJA 1GKLA 4G4GA 5ALOA 4AN1A 2QS9A 2HU7A 2XUDA 3WK8A 3WWEA 4QEKA 3IULA 1YAJA 1DTEA 3DL4A 3I28A 1ZIXA 5ALVA 3EBLA 1ODCA 1MTZA 3C5VA 2C5GA 1GQRA 2D0DA 4B81A 2JGMA 2XUFA 1QO7A 5K3FA 1CUZA 1CUAA 1P0PA 3V1LA 2ZYHA 4JEIA 1XLUA 2ACEA 4OD0A 5AM5A 4RE5A 1ODTC 5J3JA 3D2AA 4D9JA 4EY5A 5AP9A 3G9ZA 4KAJA 4JH0A 5EIHA 2HDWA 2BGRA 2G5TA 4BVKA 1GZ7A 3U1TA 2H7CA 1QIKA 3ZLUA 2XUHA 4FLMA 4BC0A 5CH3A 4KAFA 3IIIA 5ALDA 1QLWA 1IMJA 1FFCA 2WHPB 1ORWA 1BCRA 4NZZA 4UBNA 4J7AA 4CIAA 4DMCA 1MN6A 3EQ8A 1DWPA 1E89A 2ZVDA 1XRNA 4X3CA 2XQIA 4BC1A 5CT9A 2V96A 2C0PA 5K3BA 4N8DA 1YR2A 2PM8A 3DLTA 5F4ZA 1TQHA 3DJYA 3WJ1A 4OU5A 1HLGA 5FV4A 2VATA 2ONCA 1QIFA 4GWLA 2QUBA 1LGYA 2BUBA 3DD5A 3HABA 5LYYA 1BS9A 3H2HA 2VQ6A 1RP1A 5ALFA 2DHEA 1EX9A 3WYNA 1XQVA 2QKYA 2XMDA 1GKKA 2JF0A 3DKKA 1TAHA 4P92A 4QE3A 4ZI5A 5HF6A 2CB9A 4QNNA 3W9UA 2I78A 4DYHA 2B20A 5E4JA 3B3QA 4INZA 2XDWA 4P9NA 2XMZA 1VKHA 2EDAA 1W4LA 3WZMA 3EQ7A 1ACJA 4WFIA 1QZ3A 1HQDA 1UWCA 2O2IA 3ZPXA 5JAHA 5DTJA 2PSJA 3V1KA 4F5ZA 3ZLTA 4Y2QA 4BAZA 2GZSA 4K6KA 4X6YA 1XRQA 4UHHA 3KXPA 4OSEA 2H7XA 1LNSA 1QIIA 2JGFA 1N5RA 1G5FA 4BZWA 1R4ZA 1EB9A 1EDDA 2WUFA 5HF8A 4ARBA 3BL8A 2PVSA 3QMMA 2GYVA 4FNGA 3UUFA 4FMPA 4PSDA 4Q34A 1J07A 1XZGA 4C01A 1R3DA 4ZRDA 4A5SA 5A62A 5JYCA 5A7HA 2JEZA 1HL7A 2ZSHA 2CKMA 5JASA 3KD2A 3AINA 3I1IA 3WKEA 5JAPA 1UK6A 3UUEA 5T4HA 5DNVA 2GBCA 5ESRA 5YASA 2VA9A 4YPVA 1QTRA 2BUAA 3FVRA 4BB0A 4FTWA 1JU4A 2W6CX 1E8MA 5K3EA 4C4ZA 3EF3A 1XZEA 1CUEA 4BRSA 4JUIA 1BEEA 3A2NA 3H2GA 2E3JA 5ALUA 4DNPA 1MT3A 5JATA 3WWCA 2WUGA 2G4LA 3I2KA 1SCIA 2WILA 4Y9SA 4AO8A 3TEJA 2ZYRA 4KE8A 3TRDA 2HFKA 4NS4A 3CCCA 2YXPX 3IUJA 5LZ5A 3WL6A 3PFBA 2AJBA 4Y2YA 4RE6A 1BEZA 4B7ZA 5CH5A 1YB7A 2RHWA 2JGLA 1W75A 4WDQA 5ALLA 5AO9A 5KREA 1VOTA 2WIKA 5JZSA 1X2BA 4M0EA 3WMRA 4H7DA 3KWFA 4AX4A 3A2LA 4GI1A 1EI9A 4Y7DA 5CH8A 3AIOA 1CUBA 4L0CA 4G8CA 1DU4A 5AKGA 2WLSA 1XZJA 4MEBA 5ISMA 3WK4A 2WU4A 5ALQA 2XQJA 1LPNA 5CTAA 5EHXA 1TRHA 3STVA 1LBTA 3I2FA 4I3FA 4J0IA 3FSGA 4EUSA 3IURA 1AKNA 3ESAA 2Z8ZA 4Y2PA 5AKLA 3HLKA 5DNUA 1K5PA 2W22A 3OM8A 4QDUA 3R3YA 1BE0A 2OGTA 4KACA 1U8EA 1C7IA 4DSZA 1ZGBA 5HKAA 2RAUA 5ALSA 1CUWA 4IH4A 4UPDA 5E4TA 1F8UA 2DFPA 5I9IA 4QWWA 4UFOA 1VJ5A 5AOCA 5DYYA 2JEYA 3FLEA 4BTLA 2C58A 1XZLA 2WUDA 4HS9A 1L7RA 4TGLA 2Y1KA 4WY5A 2O7RA 2Y2UA 5AKJA 4UUQA 1XZBA 2Z5GA 3I1YA 1HBJA 5LP1A 3ZV7A 1EXWA 2HA5A 1EINA 2PSDA 2XUPA 4E15A 4H35A 1JU3A 5C8ZA 5C8XA 4J0DA 5JANA 1XZMA 2XE4A 3BXPA 4FWBA 5ALYA 1BCSA 2Z3WA 3G8YA 2HM7A 2QXUA 2V9ZA 3IUNA 1QIJA 4J3JA 1MAHA 1ZD2P 3WL5A 3WKDA 2XUGA 1MAAA 5AOAA 2YYSA 4EHBA 1ISPA 4OB8A 2QUAA 1UKCA 5DWDA 4GBGA 1TCAA 2V98A 1XRLA 3WK7A 2JGJA 1JJBA 5FXMA 1CR6A 4ITVA 4C4XA 4DLNA 5HQ3B 3ZWQA 4GXNA 3DDUA 3F8SA 3UMJA 1QGED 3E3AA 4U2DA 3ICVA 2OLEA 3G0BA 4Y2RA 1YAHA 3G0GA 5D3KA 1Q83A 3L1IA 1EB8A 1O6FA 1CUDA 5HK9A 2ACKA 3BF7A 3IUMA 4EY4A 4QDTA 1VE7A 2C5FA 3BE8A 4PO3X 3QMVA 1YA4A 3FLBA 2PU7A 1ORVA 2ZJ6A 2K2QB 3R3WA 5HQ3A 2GBIA 1H22A 4H0CA 4Q3OA 1LZLA 3GBSA 5FLKA 4BCCA 4HXFB 4HXGA 1JFRA 3PUIA 4H7IA 1IUOA 4C87A 2RI6A 3R40A 1THTA 5I7UA 1ZI8A 3D5EA 3H19A 5HZGA 5ALIA 1BN6A 4B6GA 3WA6A 2GBGA 4UHCA 5AI5A 4TPKA 1Q84A 1K6EA 4QDZA 3V48A 4A23A 2Z8XA 4U2GA 2AXEA 5HF9A 4X6UA 4B84A 1CUXA 3VXKA 3H0CA 4CG1A 3WKBA 1MPXA 1HKHA 5LLSA 3FAKA 5AK5A 1DT3A 3FSGD 2DHCA 3AFIA 4F60A 3ESBA 2WUEA 3AJAA 4GDMA 3SX4A 1ZJ5A 1MJ5A 4U2CA 3WA7A 3WLAA 1CUVA 2C7BA 1THGA 4G4IA 1KU6A 5E2IA 2O7VA 4S0XA 3V1MA 3FLAA 3N0TA 4DNOA 4BRZA 4JYPA 1W76A 4CCYA 2XMCA 4P93A 2IITA 5K3FB 5FPQA 1AX9A 4LYEA 5CBKA 5ALNA 1H23A 2XUIA 3ILSA 2JBWA 3H2JA 1WPRA 3IDAA 2OPHA 3DCNA 4X6XA 3C87A 5IKXA 5BV7A 1EH5A 2Y6UA 4DGQA 3SK0A 1AUOA 2CBGA 4X95A 2HRRA 4DM7A 4IH9A 1A88A 2WHRA 3IA2A 5AM2A 1A8QA 3WQHA 3BIWA 5H3HA 2OCLA 3CCBA 4B0PA 3FVTA 2AJ8A 3R3VA 4Q82A 1RWQA 4EA6A 1WB5A 3ESDA 4F0JA 4HRYA 2WSLA 1ZICA 4G9GA 3WZLA 5SYMA 3T4UA 1N1MA 3AIMA 4G8DA 1OCEA 2JGKA 1GGVA 1OXMA 4WCVA 4CFSA 4FLFA 3WL8A 1Q0RA 1UK7A 2ECFA 3I2JA 4XWGA 1UKBA 1IUPA 4C6HA 2WHPA 1JJIA 3AZOA 2LIPA 5AKXA 2WHQA 1FFBA 4CCWA 2OCKA 1BRTA 2QM0A 4U2EA 1CUSA 2DSNA 3AIKA 2X5XA 4U2BA 1B6GA 4QLOA 1JMKC 2DQYA 5IH7A 4ROTA 2WTNA 4BBZA 2FJ0A 3S8YA 3QH4A 4MQLA 1K63A 4UBIA 4G9EA 3A2MA 4BATA 1WHSA 5AJHA 4HVTA 2ORYA 1QO9A 2GYWA 4QDOA 1UKAA 5IVHA 4EZIA 4FNMA 2PL5A 2XB6A 2WJ3A 1E5TA 5SYNA 5ALMA 5JD5A 1KEZA 3QMWA 4AZ3A 1XKTA 5A7FA 2OXEA 3RK4A 3AUKA 4FBMA 2ZSIA 5BWBA 3C5WP 5CT5A 3STYA 3ESCA 2WG1A 3FYTA 4CCYB 3WIOA 5T4BA 4KRXA 1IZ8A 3H17A 1VA4A 2ROQA 2VT7A 4FHZA 4JNCA 4X94A 2WFMA 2XQGA 4XX1A 5T4FA 5HCUA 1PV1A 2BGNA 3I6YA 3AILA 1NU8A 4FOLA 2PUJA 1SCKA 5JADA 1QFSA 1GPNA 4GEGA 2PU5A 3CN9A 4EB0A 5ALJA 5DTIA 2QVBA 5AH0A 1NX9A 4H7FA 4FDMA 1X70A 1CUIA 1ODSA 3ANTA 4J0CA 3VJMA 3YASA 5C81A 3VISA 1XROA 2DCMA 3NUZA 2JIDA 5AHXA 1GPLA 1LPPA 3IVMA 3L1JA 4QA9A 1UXOA 3BJRA 2H9YA 1TK3A 2OCIA 1H2YA 3DEAA 4AXBA 1BN7A 2HA0A 3HACA 2QT9A 3FYUA 3PICA 1HDEA 3DQZA 5C7YA 1DX6A 3C8HA 1ZGCA 1G66A 1N8SA 4TVKA 4MYDA 4EBBA 1EK1A 3H1AA 1A8UA 3F67A 4HAIA 1L7AA 4DIUA 2HHAA 3VVMA 1F0PA 1ZD4A 3QPCA 1UOPA 4E14A 1VXOA 5FUMA 2VJAA 1WB6A 4UBLA 3KOOA 4ZV7A 3JYHA 4IO0A 4FLEA 2Z3ZA 4FFWA 3VDXA 3C8DA 1K4YA 3R41A 5A7GA 5AK6A 4B9EA 5JAUA 4GECA 1BROA 2H7YA 3H04A 3O4IA 4MYSA 2AJLI 1ZD3A 4UBOA 2Q0XA 4O08A 1Y7HA 4BP9A 5LIPA 3D3NA 4K5QA 4BE4A 4A16A 2ZYSA 2O2GA 5JIBA 4IH1A 5KBYA 2PUHA 2WG0A 4BE9A 4BP8A 2I03A 2XMQA 1T2NA 1EVQA 5CMLA 2XLCA 2OAGA 5ALTA 3O4HA 1W52X 3G02A 5ALRA 5AKYA 1E3QA 2PX6A 3STUA 2VF2A 1JKMA 4M0FA 3STXA 2J4FA 5ALPA 1UK9A 1NU6A 3H18A 4GW3A 3QM1A 1QIMA 3PE6A 3RARA 3FOBA 4OUKX 5LZ8A 4MQMA 4B85A 4AB1A 3F96A 4C88A 1D07A 1CEXA 4CG2A 5AI4A 4Y2UA 5AM4A 4U2FA 2HADA 4BVJA 3HZOA 2CJPA 2XMBA 3L1HA 3LP5A 3K2IA 4IQ4A 3R3ZA 2VAVA 4UBMA 2XQKA 1XLVA 4K6GA 1BU8A 3QZUA 4X7BA 5AOBA 4WJLA 2G63A 2PSEA 5HFNA 4OPMA 5LZ2A 4B9AA 2VJCA 4MWSA 2HA7A 1DINA 4ETWA 5KWJA 3BDIA 1SFRA 5HF5A 3D0KA 4WFKA 1X2EA 2AJDA 1EVEA 3GZJA 2B61A 1UZAA 4W1RA 2VJBA 1DQYA 1OILA 3Q8WA 3B5EA 3T52A 3I2GA 1MNAA 1JJFA 1SCQA 1MO2A 2RHTA 4X92A 3WWDA 4MWTA 4UHBA 4OYLA 5CURA 3W9BA 5CXXA 4RPCA 3QYJA 3WKAA 1VLQA 2ES4A 2WU3A 3N2ZB 5CRIA 3WK9A 4ZREA 2CUTA 3W04A 1GPKA 4I19A 2QRUA 1JI3A 1XZIA 2UZ0A 4N8SA 2PBLA 3CXUA 2OAEA 3QVMA 1K8QA 3M82A 4N5IX 1U65A 5HK8A 4XIIA 4J0GA 5ALXA 2B9VA 5LKAA 1FSSA 5FKJA 4OU4A 1XZKA 3QPAA 1YS1X 3NOXA 1ZOIA 2C0QA 4UBKA 1CUJA 2WG2A 4N5HX 3LCRA 2P8SA 4Q3LA 3HEAA 2B4KA 3D2BA 2XUOA 4E46A 1O6GA 2Y2VA 1RYYA 5D7BA 5ALEA 3OOSA 1EDBA 2PSFA 1P0QA 1H2XA 4DTCA 2XT0A 5AKIA 4CG3A 5D6OA 3B12A 5JD6A 2YASA 1LZKA 1IZ7A 2WJ4A 2VTVA 1XRMA 5K5EA 4FKBA 1WCYA 3W06A 1J1IA 3JWEA 4BAGA 1R9MA 1YS2X 5IVDA 3DL7A 3HXKA 2BCEA 5LZ7A 3V9AA 4H18A 3QPDA 5AKEA 4B82A 4DNQA 4Y2SA 3H1BA 5DLPA 1IUNA 3C6YA 2D5LA 3IBTA 1ZIYA 3E1GA 1LPSA 1AZWA 2QR5A 4YASA 3LIPA 1I6WA 3O9VA 5A2GA 4MEAA 2FJPA 4BYMA 4Z49A 1PJAA 2HRQA 2R8BA 2WM2A 4LXHA 5FPPA 4OCZA 4Q3KA 1QIEA 3O0DA 3PI6A 4C89A 1C7JA 4H7HA 2BUCA 4ZWNA 2Y6VA 3A6ZA 3C70A 1WHTA 2C4HA 5A6VA 3D4LA 1XQWA 1CUYA 4AN0A 1MU0A 5AKKA 4EY8A 1SC9A 1UFOA 1QTIA 1AURA 1XKLA 2NW6A 4K6HA 3LLCA 4Q1VA 3ANSA 4B0OA 2CZQA 4V2IA 5AK4A 3WWOA 3EQ9A 4K2AA 3G9UA 2WIJA 3D59A 5AICA 4B83A 4N8EA 1VE6A 1JT2A 2IIVA 1CLEA 3QITA 2IX9A 2FUKA 5AM3A 4MXDA 5K3CA 1TIBA 1E8NA 3K9BA 3OC0A 1GQSA 3VJKA 1VZ3A 4Y2VA 2WFLB 1YA8A 2QMQA 3O4JA 2ZYIA 2PPLA 4WY8A 7YASA 4AMZA 2XI4A 3FCYA 2I3DA 3F9CA 5ALHA 4BDSA 2QJRA 4X90A 3QBJA 2EDCA 4I4CA 1W6RA 5AI0A 1A8SA 3D7RA 2OGSA 4KE7A 1N5MA 3O95A 1XZHA 5AIBA 1MNQA 5FRDA 2CEKA 4UHDA 4XVCA 2QXTA 3NGMA 1XRRA 3DNMA 4UHEA 5EHQA 4W1PA 1WM1A 1A7UA 4PSCA 1DWQA 1S8OA 3LS2A 1LLFA 3P2MA 4KE6A 2GBFA 4GHWA 5AKZA 3WK6A 3DOIA 5AI9A 3PF9A 5CT8A 3H2KA 1JMYA 4UHFA 4DNFA 3DYIA 1DQZA 1E66A 2WIGA 2BKLA 2EEPA 3KSRA 4JYMA 3S2ZA 4X00A 3RM3A 4UFPA 3ZI7A 3PDCA 4G1FA 1FJ2A 1KU0A 3G0DA 1C4XA 1LPAB 2WIFA 1CPYA 1ZI9A 1CQZA 3GUUA 2XUKA 1F0NA 3GROA 4HTAA 3HI4A 2VT6A 5ALKA 2BJHA 3VVLA 6YASA 3G0CA 4BCDA 5AK3A 2OQVA 2HFJA 2HU8A 3I6MA 2WFZA 5EIEA 1M33A 2YH2A 1CV2A 3WKCA 2DHDA 5CT4A 4CIBA 3V1NA 2I3ZA 5T4EA 4ZGBA 3SWWA 1AGYA 1QIDA 1UOOA 5EIAA 5CXUA 3F98A 2OG1A 3ICWA 1U2EA 4KYVA 2HA4A 3SC2A 1YASA 1FFEA 3KWJA 1XZCA 4QWMA 2GZRA 4PSUA 4BZZA 2X8BA 4WDRA 5LZ9A 1USWA 1CVLA 1CQWA 3HSSA 1TKRA 4BAUA 2RIPA 2JGIA 1ACLA 5JARA 4EY6A 5BWCA 2J4CA 5A71A 3OG9A 2OCGA 1Y7IA 3DS8A 4CI9A 1T4MA 4J0HA 4HRXA 3FNBA 2XMRA 4LHEA 4DMHA 2AJCA 3G9TA 1UT6A 1P0MA 4KRYA 4KJXA 5FP0A 1QONA 5IVIA 3C45A 4XJVA 1VXRA 2HIHA 1B41A 2XLBA 5EI5A 1EA5A 4DMKA 1YCDA 4Y2XA 2PKYX 1CIJA 3WWPA 3G0IA 4KAAA 1FFAA 2J3QA 1XRPA 1GXSA 4L72A 3M83A 2H1IA 2VJDA 1XQXA 3RKSA 2R11A 1MX1A 4LYDA 1R1DA 5JALA 3KDAA 2QOEA 4DSAA 4PF1A 4Y2JA 5AIAA 5DYWA 4KE9A 4X71A 1EDEA 4PNZA 5E4YA 3AZPA 1TCBA 1QE3A 4LKOA 3OURA 2OGZA 4L9AA 1R50A 3E0XA 5AI8A 5CT6A 4X91A 1CUCA 1QIGA 3OTQA 3HRHA 4J03A 3WYDA 4IHAA 4GLBA 4AMYA 1FFDA 5FDFA 4X97A 2ZJFA 3TJMA 3MUNA 1ETHA 5C8VA 1IVYA 1XZDA 2HA2A 4QDXA 3G7NA 4W63A 1Q0ZA 1CRLA 3LIIA 3JW8A 3M81A 3C6ZA 3W05A 2QZPA 1CUUA 4H77A 4OB7A 4W9RA 4HZGA 3BJMA 3HYSA 3O4GA 4P08A 2VEOA 2WQZA 4Q05A 3BDVA 3C6XA 5LZ4A 2DQZA 1YB6A 4ZXFA 2HA6A 3MVEA
chains in the Genus database with same CATH superfamily
2HL6A 1JL3A 3MRTA 3UGJA 3AFOA 1WNFA 5J4VA 3JZAA 2GASA 3DEJA 3K0CC 1K6IA 1PAUA 2PZAA 4Q18A 4RY8A 4IMIB 5B1IA 4TT3D 4IHJA 4J0JA 2P2CA 4QOHA 4DJTA 1VDZA 5M7EA 4JLUA 3B2QA 5KNBD 5D3ZA 1UMKA 3SBOA 2XCUA 1G3UA 4XR9A 2X6QA 5LQSA 3STWA 5E0KB 1LSSA 3T0IA 5LYJF 3PCXA 3X3HA 2FMUA 1A9OA 3ZU3A 3IPLA 4YT8A 1K3FA 3ZVLA 2FW0A 1D2CA 4LHWA 3TNFA 2QTMA 2OT3B 3QLVC 4Q3EA 2YUIA 3LC1O 2FV8A 3QFHA 1BMTA 5DISB 1ULTA 3ZYZA 2B2XA 3S81A 2WKPA 2W4QA 4K9NA 4FMCB 3TVTA 4P5DA 3EAQA 3AZQA 2XWPA 3NWPA 3SKXA 4LRQA 4IV8A 3BTSA 1KEEB 1E9BA 2YXEA 5FOQA 1C0IA 1TT5B 4XDZA 4XXHA 3RBZA 1WO8A 3SHWA 3SR3A 2W98A 3C3KA 1XU7A 1BIFA 1ISMA 2M98A 1UEXC 2A0XA 2Z5VA 3NJ8A 4GPTA 1TCCA 2C59A 4U39A 4CL3A 3OJWA 3QSGA 2W6JD 4PLGA 3O1JC 4BHTA 5DVZA 2JLXA 1XTJA 1ZU4A 4EKNB 1HDZA 3KEQA 3EWNA 1YQTA 3C3AA 3HDHA 4ICIA 4TMKA 3VH3A 4RGYA 2PR2A 4UNIA 2R0QC 3DOHA 4DC1A 2DEUA 1WXDA 4EGFA 4G0NA 4D26A 1DXOA 3IESA 1R9NA 2Q45A 3ICOA 3S2IA 3TI9A 1VHDA 2JAWA 2YZMA 3AEKB 4PQEA 4TTPA 3SYLA 2A9RA 5A05A 1WF6A 3B48A 2XYPA 4FEEA 1CY4A 1P8AA 3BXXA 4KR7A 4U00A 4JUAA 3VNSA 3PPXA 5FL7A 3KELA 2DR0A 3PDWA 2DX7A 4MI3A 2UYOA 1PT7A 1AA6A 4P0PB 1DIRA 1SXJA 4NMHA 4B80A 4RXTA 4DCSA 1AQYA 4FHFA 1WETA 2GF2A 4RCYA 4L5JA 3ZZ0A 2FCRA 1NI4B 4TSKA 3W2TA 1H4VB 4P81A 4YAEA 2QTCA 3ZZTA 4PV7A 1C8VB 1HA3A 1OFUX 1SCAA 5M2QA 1WDMA 3I04A 5H81A 4L4YA 7GPBA 3T0FA 1ZJZA 1W0KA 3AJRA 1TE2A 3K94A 3TNDA 4HV4A 5I9BA 5EE1A 3REGA 2XTMA 5IJZA 4OQQA 1MRZA 1ONBA 2YVLA 3VR6D 1C7ZA 4JJFA 5JXHA 2VWHA 2ZATA 2WSSA 4MW6A 1EXDA 3IVGA 4EX6A 1NQOA 3MLEA 4EPXA 2E89A 4ZT3A 3W78A 4IGEA 5BVGB 5L95A 4HS4A 1V16B 2RB5A 4FSDA 2P2LA 3G1UA 4MWBA 5BV0A 3VGPA 1SOWA 3WJAA 2OC4A 2WI8A 4ZHSA 5ADHA 5FFFA 1H3EA 5AFSA 1OXTA 3PUHA 3WSWA 3P9CA 3AHIA 3A26A 3USCS 2H9IA 2VP3A 3LQ2A 3OCYA 1CUGA 421PA 3MRXA 3TQTA 1FFHA 4N12A 5JZBA 3RYHB 4W5NA 2HLPA 3A37A 1I4LD 1DBPA 1Z8DA 2VUSA 1QBGA 4LIPD 4LUCA 3IIJA 2ZGVA 3PA6A 4I4TF 4UCFA 4FGJA 4S1OA 5LMNB 5K3AA 3L7YA 4L75A 4XVQA 5F98A 3TSAA 3E0QA 2GPJA 3KZKA 1E2FA 3COWA 4C2TA 1CFJA 5GPBA 1K5HA 5L53A 1RZRA 2QSZA 1SU7A 1HF3A 2QX9A 4KV9A 3IOBA 4E11A 2G06A 4C22A 2PUCA 3PXCX 4ZAXA 2BMVA 4JFAA 2IZ6A 5A3JA 5CYFA 1HPLA 1KEUA 2QSJA 2OMKA 1HO3A 4YDHB 1LX6A 3UMVA 5F64A 4NIMA 3WHLA 2XTJA 1W4CA 4I3GA 1H3FA 3WZ2A 2JFGA 4KSYA 4P83A 4ACAA 5JZVA 1AU9A 5KWSA 2G8LA 2C3MA 2PZKA 3Q8MA 2WD9A 1RACA 3KRTA 4JYBA 1M1UA 1ZIDA 1H8HA 3GPIA 4LRWA 2ZBFA 4RK1A 2K7FA 3L4JA 5CX4A 3BIXA 3TQRA 1W1IA 3TZKA 4AQDA 5HKKD 5JZ9A 3TCKA 3MW8A 3JAMA 4EB8A 4F86A 4AK9A 1YE8A 4TS4A 3ANLA 4I1SA 2C9YA 2I3AA 1XA0A 4RY0A 3S1AA 3PSHA 2AFRA 2Q8QA 4OMUA 4PPNA 2A86A 3HE3A 1JDZA 4L8YA 4D1YA 3L93A 3OZAA 4FW8A 3L9WA 3FHCB 4LN1A 1XFDA 1D2EA 4CNQA 2ZIXA 3L43A 3EIOA 1ADJA 1KEWA 1V2GA 1FQKA 1XMVA 2C99A 2OBXA 2WP0A 3C5EA 3MS7A 4MVJH 5FOVA 3BKXA 3RBAA 4D96A 4XAQA 4Z8XA 2B6HA 3PNOA 4RSMA 3K5HA 3X2FA 1DUSA 1MA3A 1XQ1A 2EBWA 2H4XA 1EVLA 2WJPA 3AOGA 3OMWA 4LXUA 5CM8B 1V16A 3M6IA 2O7NA 2J5BA 1HX7A 5FTMA 1Z2DA 4C4YA 4D79A 4QVIA 1MO3A 2DLDA 3CN7A 4PN7A 2G72A 3BRQA 5HIKA 3PRKE 1Q7RA 1ADFA 1DDGA 4HWKA 5EQFA 4AY3A 2HGZA 3D4BA 1DUIA 3UPDA 3GLIB 1NP7A 3ZK8A 2D6FA 3WLQA 2CNKA 2QQGA 4NNJA 1RMQA 3GCDA 1TIKA 1PL6A 2GHIA 2NXJA 3DKRA 3PGXA 4WK4B 2AFHB 5ECYA 4AG6A 4QGSA 2BYTA 1X0VA 1ADGA 3W6ZA 4D57A 5C32A 5EFZA 1G8MA 1H2EA 5JAOA 3DAPA 2QLTA 1UC8A 2CMFA 1UEIA 1K8YB 2DFLA 1VG1A 1XD8A 2A9PA 3LE8A 3N6RA 4WOKA 3CEHA 4QZVA 3EDQA 1LPMA 3KLMX 4E32A 4ZAWA 1CDDA 3GELA 5SZJA 1U1DA 4R1MA 3OZBA 1OFIA 4IXDA 4BXOB 3IQXA 3KQKA 2OFWA 3I3SR 5F1KA 3G68A 2L42A 4EPTA 1RJDA 1VE3A 2D1FA 2CFIA 1LLQA 3PNMA 4Y2TA 3L6UA 4HUTA 1XLWA 2PFKA 3FY4A 4BE9A 2D5IA 3QU2A 4YCJA 5LQMA 3IILA 3LM8A 1QR6A 1B73A 1ZIPA 4JN6B 3X0DA 1Z74A 2JGEA 4RHEA 3OAAA 2ZRAA 2AHRA 5DNWA 1J4AA 3MGAA 4PBRA 1NP3A 1G21E 4UM8B 1ISHA 5BSFA 1E4OA 4BX2A 2H29A 3JVVA 3LQ1A 3VKFA 1KZ1A 4YO8A 3IEKA 4CQJA 3DF9A 1HNWB 3FMIA 3MWKA 4PHTA 5ELMA 2R6CA 4N48A 2I4LA 1X1RA 4OUDA 3D7MA 1XC7A 3K0CA 2VZ9A 4FFRA 4KVZA 4M8SA 2O8DA 2AZMA 4N41A 2GK3A 1G2PA 3SSAA 5K6TA 4LNHA 1ADYA 3EVFA 1LPBB 1O8BA 3A70A 4IIDA 5AYVA 1W5BA 4ND4A 4P38A 2C9CA 4FYJA 1VRWA 2Y71A 1MDFA 1WX1A 4PYNA 5KTNA 2GVDC 1YK1A 3VDNB 1BWSA 4J1NA 4LSWA 3SYRA 5TJ9A 4GX2A 3PQEA 3FOWA 3WJ2A 4CM7A 1T5IA 2YUTA 4JITA 5GV7A 3N8GA 1NBMA 4M88A 4DLPA 4F8EA 2Q5FA 4WVFA 3CR3C 1RMTA 4A8HA 5I8WA 2V7BA 1A4XA 4OGFA 4WCDA 1ABBA 4DV6B 3H1PA 4PLYA 2AG0A 1J23A 4DIOA 1TM7E 3HVUA 1U7WA 1R74A 3BE4A 5BR8B 2BC9A 4FD2A 3KWMA 1RAFA 1TKBA 1MP0A 1MIHA 1P29A 2F43A 2YQZA 2RGUA 2F90A 1T1GA 1L8XA 1UDCA 1XXHB 2HYDA 3DEHA 2L82A 3GRFA 3H6KA 3EEYA 3IJEB 4LYAA 5H3LA 3ESZA 4F4HA 1VZ2A 5E7MA 2AUMA 5I7VA 1SXJD 2XQFA 3MTGA 4S2UA 3NVKI 4LXGA 2DXIA 1B1AA 4HMPA 3AYZB 2QX8A 4F5WA 2ZJZA 3F6YA 4N3AA 2CYAA 2OHOA 4MUXA 4DYVA 2WB4A 3X1XA 3GJXC 3B20A 4J29A 2AR0A 2I2DA 2IHZA 4NENA 3LTNC 4P22A 3ZGLA 1S01A 1WPXA 1PD1A 1QU2A 4JB0A 5JRJA 1V8PA 1VHTA 4G5XA 3IUSA 1NI4A 2G0NA 2V9PA 3MF4A 5FI1B 5KOIA 4JBHA 5K3DA 3FA2A 1ZJ4A 3VI3B 4Y2HA 3V7WA 2NSHA 3ZCTA 1IONA 1J39A 2ZE8A 1T4CA 4WFJA 1UBCA 4DQKA 4IIJF 3GFBA 1SKYE 1W44A 2BAGA 1EVIA 1O1YA 2IHYA 2RGXA 3GLHB 2OCBA 3N75A 4QECA 4EA7A 1G98A 2FETA 3O4FA 4BJ1A 4DMGA 4LF9B 5F3RA 2GN9A 3DFUA 1I7NA 3ABSB 3FCOA 4AN1A 4D2IA 4ENQA 1Z0SA 2J9FB 5EJ8A 3FETA 1DXYA 2YVQA 1B42A 1X0XA 2QUZA 1AGRA 1F17A 1K8XB 2ZB7A 1UOEA 1B3RA 3IULA 2QRLA 4LYYA 1W46A 3JQGB 3R9KA 2ZTHA 1KI6B 1YV9A 5FIUA 5IPFA 5IAJA 3B6JA 2W37A 3CZQA 2OAP1 3TMAA 1EHIA 3GDOA 1UT5A 3IAAA 2FQ1A 3G8AA 2REOA 4K2HA 5TGDA 6AT1A 1Z37A 2V7TA 3A32A 2BHRA 1OHHD 2V3WA 2JGDB 3DPUA 2GB4A 1GQRA 3EIFA 3TIXB 1NG1A 2D0DA 5BMVF 2H5IA 3QOYA 3HKBA 1NHGA 2FEOA 4HTFB 1E3MA 5GJBA 4PVDA 4F92B 3JQFC 3LD9A 3MGGA 4B81A 1XNQB 2JAOA 1FDOA 2YDYA 2X3YA 2PAAA 3H84A 4NYIR 4XI9A 3BQ9A 1X1TA 2E37A 1ZO8A 3T5CA 1XJWA 3F5MA 3GG9A 3P9SA 4ARVA 1NSFA 2NACA 4RMHA 5MDHA 1KWGA 1XLUA 2HBZA 2PD4A 3EIXA 5AM5A 1QHIA 2I7XA 1W5SA 4V3BA 4MP8A 2QBYB 4D9JA 1JA0A 3FTQA 3NHZA 1L6RA 2V6BA 3QIVA 3TTVA 3AFMA 2CXXA 3IP5A 4V0QA 4CKEB 4ZGGA 3AJEA 4KAJA 2FPIB 3DCJA 3IPRA 4KXNA 4DR2B 2HJ9A 4KTTE 3GHHA 2YNMD 3CZ4A 5EIHA 4DCNA 1KQPA 2HDWA 3NKVA 4QDKA 2VQFB 1QVRA 4MA4A 2NSJA 1S2DA 2G5TA 4MW4A 1OFUA 4F2DA 2BHLA 4FE4A 4G89A 3LX5A 3FW1A 1MEJA 1L5HB 2J6CA 2RAVA 3TM5A 1DELA 3R8XA 2XR1A 1W93A 3GLHA 1WULS 4NARA 5ECDA 4RH3A 3GEBA 4BC0A 5CH3A 2XKKA 3HWRA 3EQ6A 1FQWA 1GILA 4F1WA 1IMJA 5EHZA 1FFCA 1G3IA 1I1QB 1Z7GA 1N2HA 3F6EX 3H5TA 3HTXA 1ZITA 3X1JA 4WUVA 1E77A 3H5IA 3LL7A 4ND8B 1ORWA 1ZFNA 2N47A 3UENA 4G9BA 2X1HA 4O2LA 1UJCA 1UFRA 5KTYA 3TRHA 1HRDA 2YS7A 1YI1A 1R3UA 3FKSD 2BR5A 4DMCA 7ADHA 1RWKA 4IIJB 5HXAA 1UBSB 3DV0B 2O06A 4I1RA 3AVYA 1P7WA 3EQ8A 3GJ3A 3NBZC 1PG0A 1RPAA 4A1FA 5DZSA 1ZM9A 1NVBA 1K06A 3H0KA 1K6XA 1NWCA 2CYBA 5CT9A 1KSGA 3U26A 5C1OA 2JKYA 3E2IA 3S2GA 2OV6A 1O97C 4M7WA 3B1JA 4LX8A 5B4TA 3SJUA 3USZA 3OTOB 4N8DA 8OHMA 2BBSA 2PM8A 4CLOA 1LJUA 1KY5A 3ZD7A 3FNQA 3G49A 4ZOLB 2A5JA 3JQAB 1WZIA 4KN8A 4D6YA 1D9ZA 3VU0A 3FYHA 1V11A 3QE0A 4LJSA 2WJVA 4ND7A 4UQLA 1HLGA 3LKVA 3ZDCA 4FBGA 1XAJA 1JFFB 4QYWA 2JLVA 4OXIA 2ONCA 4BL5A 1M6HA 3FE2A 3V4VB 2GLXA 2RH4A 4N49A 6ADHA 2FMTA 2JIPA 4OJTA 4OQFA 4R16A 5JT1A 4UCWA 3TJRA 4WMLA 3TUZC 3I92A 5HMLA 1YRBA 1ISSA 2GN0A 3IO3A 4PLHA 3GLQA 5LYYA 4HH0A 1MXFA 2VQ6A 1TU4A 1L5VA 3NAQA 2VF7A 2D3WA 2PPVA 4M86A 4PQGA 3PNBA 2PLWA 3WYNA 3SOPA 4BNHA 4DCOA 3P27A 1E3JA 1EVZA 2IU6A 3ORSA 1V8DA 4HLCA 1ZUWA 4N5MA 4WADA 4GUDA 4AUMA 3BA6A 1ZBQA 3QE3A 1QVVA 2ZJAA 1TAHA 4HQ6A 2Z3VA 3HUFA 1WUYA 4QUHA 3RB8A 5CFOA 5KYXA 2WVGA 1FJXA 1VHLA 1ORTA 1NF3A 1VLMA 3RIEA 3VO2A 1RM3A 2PGNA 3MMXA 3PUYA 4E6PA 2P3OA 4QNNA 3RT7A 3M9XA 4C43A 2R1VB 3QKSA 4DYHA 1WMBA 1VYHA 2AX4A 1QVAA 1UXHA 5E4JA 3B3QA 1JA1A 4HY3A 1JHMA 4JMPA 1E1KA 2NO5A 4YP1A 5I4BA 4P2GA 1E1RA 2A14A 2GCPA 3KYDA 4MKXA 1P4JA 3HN2A 3DLAA 1CCWA 4YVFA 1I3KA 1K5DA 1GNSA 4Z4HA 4JVOA 4QYXA 4IVNA 2J59A 1IEWA 1O4WA 3K9CA 3VTFA 4KXFB 1DOHA 2NTNA 1L4YA 3P26A 4HEHA 1NXVA 1QH9A 3GRZA 2QAGA 2UZ1A 3NRBA 4CKXA 5IYZA 4IDGA 2R1TB 3WYEA 2O5EA 5GQSA 2AEEA 3R5KA 4R9RA 2UAGA 4ESVA 3FHLA 3KQQA 4F5ZA 2GTHA 4PYMA 4MQEA 2UZ4A 4HUQB 1GL9B 5EYPB 3UHFA 3CGWA 2IYSA 4Y2QA 4BAZA 2IOYA 3GJSA 5EWJA 2CZCA 1XRQA 5DLYA 5FO0A 1O94D 4G0OA 1JIXA 4UHHA 3RDPA 1EVKA 1RC0A 2Y9MB 3EB9A 2VRNA 1NP6A 1SNYA 4JR2A 5LP6C 2VJNA 3ROZA 2JL1A 1LNSA 1OZHA 4IRUB 1UC4B 2VP2A 2O59A 1J9GA 1ZH2A 1OFVA 5HCIA 1R8QA 1NJSA 1PNTA 1NNLA 3PLAE 1XDBA 3FNGA 1YRLA 1NLZA 2WUFA 2QRMA 2QTRA 4U0KA 5IZCA 3CVUA 3E1SA 1YDFA 1E0JA 2CN1A 3BL8A 3ASVA 4RFSA 2LPMA 2QRPA 5A0VA 5KYYA 3MGCA 2VTBB 2HIMA 4LE2A 1TKAA 1GXSB 3QMMA 1GZVA 3PR2B 5BN5B 3BEDA 3E81A 4MQFB 3VRHA 4C1NA 1ABEA 2GAOA 3LPDA 3PLRA 3WGYA 4HKTA 4Z0TA 2GPBA 5EKDA 3FUUA 3OOYA 4PSDA 5I6DA 4J0EA 4Q34A 2BM1A 5FTWA 3W4KA 1R3DA 3GUCA 1G20E 1OV6A 3WDMA 5A7HA 3FM9A 4ZYTA 2WJGA 5CA1F 3LUCA 1OA0A 2ZSHA 1A50B 1SKAA 1Q95A 2PYIA 3OLYA 5FADA 2D2FA 5FOUA 3AINA 1NXTA 5DHAA 5DKFA 1COWA 1MENA 2C2HA 4PG5A 2W4IA 1KJWA 1OASA 2Y1DA 3IEPA 5AT1A 1XAHA 4KQEA 1BGWA 3IA7A 4P5EA 1BA2A 2XA1A 4FILA 5FOXA 2D1RA 4ZTBA 1JEAA 5D8DA 5K4AA 3KKQA 1P44A 5DN9A 1NZJA 2G7ZA 2OK7A 4EJ2A 1HRKA 2OV1A 4O29A 3RV4A 1JFVA 4RTLA 4B7UA 2QYHA 4AS2A 4DV2B 3DO6A 3GLUA 3R24A 4YMSA 3TXYA 2OP0A 3TW6A 1FPQA 2FFBA 4M87A 2HBRA 4K26A 1QUFA 1X77A 2ADMA 3ECCA 4MP3A 3BCSA 4FS3A 5C7LO 3WNQA 2OHJA 2X4IA 4REMA 5DBGA 4Z5XA 5DMXA 4KFCA 1G2QA 1I3NA 5IKPA 3E15A 1IQPA 3LW8A 1PFWA 2YWFA 1XNRB 2VHEA 1HMYA 3QEAZ 5FFMA 5BQXA 2AN3A 2YJTD 1H4TA 1O95A 1G17A 2V5VA 4QHYA 2Z9DA 1NJ2A 5JRZA 1ODIA 1N7HA 4IJWA 3NHAA 4ZHQF 4YNBA 2JJQA 2ZT7A 4U4AA 4Z51A 3SJBA 2WWWA 4RD4A 4YQZA 2P41A 3PUXA 3I4CA 1KK2A 1WKBA 2WUGA 2G4LA 4IZHA 4MWCA 2ZIZA 4RLQA 1TQ2A 3I2KA 2A5FA 4ZCSA 4DBZA 1NQ5A 4RYLA 3UJDA 4C0HA 4PC3A 1NBWB 2C7GA 2GJSA 1N34B 4ZVMA 3PC7A 4CQLB 1M1YE 1SZJG 3U1TA 3L6BA 4TS3A 2CL7X 4ZOBA 1UAGA 3AUAA 5LZ5A 2CXPA 1ZSNA 2P6OA 4RE6A 1HOXA 4BN4A 1CZKA 4PONA 3QBEA 2PE5A 1FMCA 1E5QA 1PZMA 5CH5A 2RHWA 1XCOA 1ZL2A 2OE2A 2VPQA 3N07A 2P2GA 5L3SB 1SCDA 4RA9A 1WU7A 4X61A 3RS5A 1R9JA 1SH7A 2CC2A 3AF0A 5LBUA 2R6ZA 3K0KA 3CUUA 5KREA 1N8NA 4P3XA 3Q5DA 3HDTA 4WE3A 3DEKA 1PN3A 1Q19A 2DWPA 4P35A 3ZQ4A 5HUQA 1WDWB 2RH9B 1KYTA 2RHLA 3DT8A 3VUEA 3U56A 3JAKA 1VLLA 4TRJA 1FEZA 1BZYA 2A0KA 4P36A 1UJBA 4CE6A 3VDQA 1YR1A 5KTMA 3CMMA 4Y7DA 2GVNA 2WWGA 3ECSA 2EIXA 3MZ0A 1D1PA 4YLYA 3MFQA 1Y9DA 4L9WA 4UE3S 1H2AS 5EMMA 3EPHA 2V0CA 1V5EA 2IC5A 3N7UA 4DCJA 1E2EA 1PWZA 3R6TA 1CT9A 1CUBA 1JPJA 3UMFA 4ON9A 2YVUA 3GWGA 4QM6A 3OIDA 4TWAA 1QKIA 3RG8A 4QC2A 1E0KA 1YNSA 1LDNA 4DSOA 3RGGA 5AKGA 1U7XA 1XPRA 2WLSA 3CRRA 4C2UA 4MEBA 2VYCA 1QZTA 2FPGA 4JVNA 1KSFX 2ZB8A 3DE0X 2A1TS 1VBFA 5TPZD 2H5LA 1N7JA 1GFZA 1RAHA 2A5DA 2ZKLA 4MYUA 3DXFA 2XF8A 4AP6A 3LW7A 4JJIA 1GKYA 1R00A 3FTFA 4I5FA 1PNVA 1LPNA 1SKYB 5CTAA 1U98A 1N5IA 2D2XA 3Q2KA 4IWXA 4LOIA 3GPBA 3PQDA 3HVIA 2JJ1A 2R8ZA 4I50B 2VUIB 3N1UA 1IIBA 2B35A 1R0XA 4E09A 4LGVA 4E5SA 4F97A 3LNTA 3A6KA 4XFDA 3VAYA 1CDOA 1KF0A 4N01A 1YJAA 1HT3A 1YR8A 3FROA 1EWKA 2ABWA 5LB4A 2I8AA 3IURA 4ODIA 4GGOA 4JQZA 4GLFA 4PXSA 3KOYA 5KQRA 4MHSA 5B36A 3HLKA 1FDVA 3OJFA 2HDOA 3WV4A 1E1RD 1Y3IA 1K5PA 2WF5A 1IY9A 4IICA 4EELA 4ZAGA 3K96A 4E6EA 4WXMA 1Z08A 2N75A 2FSVA 5DW0A 4CF7A 4C0AC 5KO2A 4UNNA 1NDUA 4XDHA 3NWJA 1U8EA 3CWQA 2AGVA 3V34A 1ZW6A 1C7IA 1JXOA 1VCHA 1YC2A 1E1NA 2AK2A 3E9MA 3H1TA 1QE0A 3NYIA 3BGVA 3U3MA 4DSZA 2RAUA 4ZO4A 1R0KA 3IT2A 3QLUA 4NNOA 5ALSA 1DHRA 4IH4A 2Z9CA 5FR1A 5BN1A 3A4LA 2KBEA 4CMAA 2RFLA 2X40A 3FNHA 5K99A 3QEMB 1GR1A 4UPDA 5SY6A 1QRSA 2FSVC 4F38A 4DLSA 2ZJYA 5I9IA 3VX4A 3OZCA 2ZRGA 3KJGA 4MEJA 1GSHA 1ZH4A 3TLAA 4XX0B 2P62A 3VAAA 1RQNA 3HH8A 1D2MA 5DYYA 3TKLA 3X1ZA 1JTVA 4N6NA 3FLEA 1QQTA 2ZJ8A 2CYCA 3IPCA 3NRJA 4MUHA 4OXQA 4HQOA 4DQ0A 4PZ9A 1SKMA 1POWA 2HK9A 3ZE0B 1U3VA 1EJ2A 1NW5A 3LCUA 4TGLA 2Y1KA 4WY5A 5DI3A 3RKRA 1EAYA 1AHIA 4C0WA 2J9XB 3KKKA 2Q2VA 4A4DA 3MINB 4G67A 4GEKA 3CZ9A 4URXR 3I1YA 1SXIA 2ZYDA 4MRRA 4A3SA 3BCUA 2J32A 1EXWA 3R5TA 4KWTA 4WLOA 3KLBA 1YQDA 2PSDA 2PYDA 2ZZKA 4FEGA 1E2PA 2O8NA 3X44A 4N6GA 2LTAA 4A8TA 4E15A 4RIEA 2ZRJA 3DE6X 1PP4A 5C8ZA 1RWPA 1X3LA 4PG6A 2J6BA 2HNKA 4Z4FA 1XXLA 2D2IA 2YCBA 4PGMA 4YP0A 5JANA 2C3PA 3VSDA 4OLFA 1WY5A 5FULA 4BNDA 5EE3A 3HSKA 4GOOD 1D9XA 1YU6A 3U19A 1G18A 2X2OA 3S4YA 10MHA 3EEIA 1C3JA 3QWIA 4V0SA 5G0WA 4FQ7A 3VR6H 1MQAA 2GBLA 1EE9A 4MV6A 2Z3WA 3WBFA 3G8YA 3ZDDA 4DDKA 1FMFA 2BGIA 2B4TO 1Z45A 4CF5A 1Q7BA 3O90A 1HG0A 1YGYA 4DR4B 1NA5A 3IUNA 3ONEA 1Q3TA 1UDXA 1MW9X 1QAMA 2XOKD 3KXDA 2FI1A 4J3JA 1G6Q1 2VA8A 3EIQA 2IEDA 4NYJQ 3H5RA 5JLAA 5G1OA 3OLZA 2FOIA 4ZYZA 3VYSB 3FMOB 5IN4A 3NS7A 2NOAA 3JYPA 2HMWA 4P6VF 5AOAA 2X3UA 1TM2A 1DO0A 4JLKA 4LWOA 3L7DA 1C41A 1U2GA 1X9GA 5U4QA 3W3AD 2GUWA 1T2FA 1JXMA 3DFKA 3VSEA 2QMHA 4GBGA 5I7WA 5TQ0A 1QYCA 4JVMA 1ZRHA 3LUAA 4CKBA 3BD6A 1GPAA 1E9RA 1E62A 3UHPA 4Z3OA 4RFSB 3Q3IA 4W7SA 5GWXA 1HYQA 1P4SA 1XRLA 3A3YA 4HDOB 5FWDA 4EHNA 1UAAA 3JASB 4WBNF 1U9ZA 3WK7A 5JROA 1JAIA 1EK6A 2JGJA 1KI6A 3L01A 1CR6A 1GPDG 2QWXA 1VMAA 2JAPA 4BVAA 3QNUA 4NFSA 4ITVA 3MFYA 5JUWA 4WCFB 1NNSA 4C4XA 5EJ4A 3R0ZA 2SCUA 1I3LA 1Y63A 3CEJA 4GXNA 1Z17A 2XNDA 3ZBTA 4GI2A 2OVFA 5E2AA 2Z2YA 4ZYXA 3K1AA 4CU2A 3L49A 4XLTA 4BZXA 4CIXA 2Q29A 1O95C 2ECQA 1SXJE 3AP1A 2ZWIA 3ICVA 3O8RA 2I34A 2XT6A 4IJMA 3FCSB 3L8MA 4F6RA 4C6SA 3GAFA 1SC4A 1SK9A 2HWYA 3QVWA 5IM4A 2A1IA 4N5DA 2DWQA 1AO0A 4UUBA 1Z36A 4W5JA 2HT6A 5AJTA 2A9QA 4LBVA 1E2KA 1VPWA 1N25A 3WHPA 1CQJA 2Z1MA 4L6CA 4WGGA 1J2TA 2JCBA 5LXTB 4QUKA 2ZDQA 4AJIA 5TMPA 4I1OA 1IB6A 3I5XA 1SAYA 1NDHA 4CMKA 1WY7A 1J70A 2OILA 3K4QA 3U3RA 1O9BA 1P1IA 1CY6A 3HGMA 1VE7A 2IYRA 1J33A 1JEQA 1H2FA 1H0SA 1ZSVA 3FGZA 1NF2A 2N3ZA 2N46A 2PVPA 5C80A 1PJ8A 1PT8A 4L4SA 2A4MA 2QN8A 3MAGA 3R3WA 2ZIGA 4OFZA 1RVDA 5LC1A 2FDRA 3FKQA 3ZWOA 2GBIA 3I05A 2FPXA 1UBRS 1ZXBA 2AMYA 2JD2A 2C9OA 1FYFA 1LZLA 3IUPA 3OZFA 3RJ5A 1EIZA 1PWYE 3AEYA 3GBSA 4U7JA 3O94A 1XHEA 3ZGZA 3G6WA 2PUVA 4RC9A 3SHTA 3PUIA 5EY5B 3NT5A 4CMJA 2IP1A 1U9CA 1FXWA 5TNXA 3WC4A 5KJ6A 3AL0C 4PXAA 5I7UA 3OHSX 3M3HA 4C4RA 3THOA 5FF9A 4JLNA 4LVUA 1E2JA 1SBTA 4ER0A 4CF3A 1Y1SA 1R5BA 2YJ5A 1KQGA 3MT0A 4ZYWA 2VDVE 3ZQUA 4QXPA 3N8DA 3OF3A 1YNOA 2BISA 4QHTA 1I0IA 1V4NA 1BQ4A 1QTNA 3EVBA 2GBGA 4ER7A 2RB4A 4RIIA 4E4YA 2XNHA 4TPKA 3K7EA 4BNGA 2XRZA 4JFRA 3N2EA 4YA6A 2X23A 2Z9BA 1Z73A 3GYGA 4W6QA 2I33A 3P96A 2XD9A 2VYND 1GZSA 3KR9A 3X1MA 2JJ8A 4WXRA 4U2GA 2WQ6A 4J16C 4UAUA 2AXEA 1Z35A 3RRYA 1Y4UA 3BMCA 5JS8A 2NX2A 3GJQA 3EPKA 4B33A 2OORC 4B84A 1ZNQO 1XLTA 3H0CA 5FUYA 1AHHA 3NUQA 1FSFA 3H05A 3HGQA 2KB0A 3AU8A 4JODA 3E5NA 3DB1A 3RHSA 1JHVA 3WRYC 2O19A 5A06A 4O8CA 4KQ9A 2VF5X 3BH7A 1F2TB 3RTCA 3ZHRA 3FOAA 4RACA 4BN5A 3SEAA 1Y3AA 3CUWA 4F60A 2WUEA 5J4LA 5CYOA 3JZDA 5DMHA 1QHGA 1MJ5A 1NVKA 5AXDA 1CEEA 2D5AA 1L5QA 2YWJA 4LRYA 2Y92A 1CUVA 3DHEA 5K9ZA 4GDFA 1T3SA 3E35A 4L5AA 4NATA 3I4FA 5DWQA 1KU6A 1G0NA 4KCGA 1IN1A 3NP9A 4G1CA 3EHEA 5EUQB 3SFZA 5B2EA 5IJ0B 4DR6B 2F9MA 2FPPB 1GGFA 3DVAB 3GUZA 4Q9AA 4JA0A 4EEKA 3OCUA 4X1KB 1H9BA 1WCIB 3FLAA 4GFDA 1ZDMA 3L8HA 4J1TC 4B40A 4MZXA 1EDOA 4YUAA 2QN2A 2NU6A 3N0TA 1SM4A 3HYCA 3U31A 1C9EA 2X2EA 2DKFA 2QXYA 1JEQB 3IHKA 2DECA 2VT2A 4XWYA 3V1YA 4CCYA 1QH8A 1CVRA 2WYVA 4G5FA 1C30A 3FOZA 2AL7A 2FZ4A 2PBRA 3C8ZA 4KPYA 2F1IA 3GU3A 1BC5A 4AECA 4AJNA 1MVOA 3LUGA 1IY1A 1CP3A 4OF4A 4LBWA 4OJKA 3SICE 1PD0A 4GZ6A 4PX9A 3C16C 3GGDA 4YDRA 5FPQA 2PWZA 3AQIA 3OD5A 4ENWA 4KO1S 1SCJA 3C3XA 1DEHA 2IH5A 1W36C 3A1NA 4PPYA 1RZVA 2B99A 3EXEA 2UUCB 2DFTA 2ZBQA 3OWHA 3UKOA 4M0CA 1K5GA 4LVOA 2AVNA 4IG9A 3ZY3A 5IFLA 4CM3A 2JBWA 1NRWA 3F6BX 2DB3A 4CCAA 1V43A 4DXAA 4XLLA 4ZQFA 3E9YA 3O7WA 2F1HA 3QELA 3CEAA 5HILA 2FFHA 2PV7A 3NHUA 3UJNA 1D5WA 2IY9A 4MZDA 2OPHA 3JVDA 1V8ZA 5IKXA 1TYDE 4OMDA 4R1OA 4RL6A 4C4OA 4KWEA 2E82A 5CEFA 1L4MA 2P2ZA 1X1CA 3KYBA 4IRMA 3S7ZA 3WLHA 2XYVA 2DH5A 1AUOA 2ZUUA 2CBGA 1OYVA 1L5YA 1JBKA 2HRRA 3RJTA 2XW6A 4OVKA 3IPAA 3D4IA 5LU9A 3BJEA 1PL7A 4BLUA 1A2KC 4IVQA 3IA2A 1KTIA 3PHHA 3A36A 4I1UA 4JBYA 4WBSA 3PNLA 3HCOA 2JJ1D 4XLZA 2EFCB 5SV2A 2CFCA 4XIGS 2ICAA 5IAGA 5JCZA 3GWZA 2WZQA 3ZCVA 3RNOA 5FLXA 5LUBA 2JZCA 1EGHA 1IZ9A 1A76A 4LHXA 1F6DA 1Z2PX 2EG9A 2G07A 1RWQA 4EA6A 4O2BF 3BRCA 4IPTA 1EFAA 3M6WA 3RBXA 2ZRDA 3JXEA 3QUQA 1JR3D 2IODA 3GLIA 2AWNA 2GPAA 2C78A 4YCAA 1PDVA 3AR2A 4YJ2A 1HT0A 3IAFA 3K70C 2SNIE 1LLCA 1ZICA 2FN4A 2HSEA 2OXFA 4G9GA 4OEHA 4OQ4A 3R7LA 4AWXA 4EHLA 3WZLA 1DARA 2X3FA 3E05A 3GOQA 3MNFA 2C20A 5JW6A 4G8DA 4AM8A 1N5DA 1T2AA 1MO4A 1VYTA 2R6AA 3TZBA 1GQYA 2JGKA 1EUCB 5FX2A 1YUBA 4WN9B 4EF4A 4AZWA 4E5VA 3F46A 1GGVA 4HDMB 1TC2A 1CS0B 4UJ5A 3NQ41 3JYLA 4WJZA 4CFSA 1G2IA 5HRCA 2FE4A 4P7FA 3EXHB 2JK1A 4XWGA 4JLOA 5F76A 3WIDA 1IH8A 2QRQA 2A92A 3NVMB 4MPRA 4FYKA 1KFEB 3VZCA 1T0BA 1G7SA 4JT4A 5KCZA 3VSBA 1MW8X 4RS4A 3V8MA 2RKBA 2QL9A 2QVXX 4RKQA 3IBCA 4BO4A 2XWSA 4GP9A 1P2SA 3LLUA 4HAZA 4U9UA 1S2NA 5CVUA 4CN8A 1FUIA 1N2BA 1PQWA 4V03A 2BI4A 5EXSA 1AKQA 1NRJB 1RBQA 2QM0A 1S89A 3ZJ5A 1CUSA 2DSNA 2P6NA 3AIKA 4LK2A 3TSOA 3C3EA 3EFHA 4FNAA 2WDPA 4I55F 3WV5A 3KYCA 2NZVG 2XA9A 4GOXA 1DG9A 1TJ3A 1WXHA 1KI3A 2WM9B 2H18A 4CLOB 4F4FA 2B25A 3HBFA 4NWIA 1OLSA 3OUTA 4DA7A 3NI2A 4WACA 5GINE 5CFZA 2QG9A 2XQVA 1NKVA 5DXAA 1AGPA 3S8YA 1QYVA 5E38A 4GMFA 3FOEC 4G9EA 5H82A 2C5SA 3R8CA 5JI3E 2VS1A 3IQGX 4WNCA 3JYOA 4CYMA 3CSDA 4ALIA 1HNNA 4U2KA 4CTNA 2IHTA 3KKMA 3STHA 1KXJA 3FYSA 1SQSA 3QX9A 2PQ2A 2H1RA 4BBAA 3CV3A 3SCZA 3B60A 2FFQA 1AG9A 3AEUA 1R18A 2CCJA 4GRIA 3LCJA 4AT1A 3QBDA 2LBPA 1P91A 4J90A 3A06A 4EZIA 1SWVA 5ICSA 2QD3A 2XVYA 1SQGA 2CFOA 1VSVA 1XZPA 3D3EA 3QKIA 3CH4B 3F3MA 1V4VA 3QJGA 3R6DA 1KIFA 1EFHA 2WJ3A 2ZFUA 5SYNA 3NHJA 4HGNA 4F3CA 5JD5A 3HUUA 3G3EA 3TTWA 1KEZA 5JCPA 4ZTZB 2AEFA 5DCLA 5JFGA 3AUJB 3OT1A 1BU5A 4GKAA 1XKTA 2QG6A 1TLLA 3PD7A 5B4UA 4HB4A 4L5IA 3EC7A 3SKVA 4DUGA 2D2EA 3QU9A 4AYTA 1BFDA 3ROTA 1HZJA 5B3JA 2PSSA 3DONA 3V8QA 3K16A 2A7XA 1JPVA 2NTYC 1K6JA 3AUKA 3UC9A 2CDCA 1T6BY 5CT5A 3TUJC 3U3DA 4B35A 1NYRA 2W70A 2XXAB 2R6DA 1S9DA 3EBOA 2YRFA 2I4RA 4UTRA 3CR7A 3TIIA 4DR1B 3VO8A 1NFRA 2J85A 5AHWA 4PGAA 1GADO 1P62B 4RDIA 4KWIA 1CDZA 4CL8A 5ENVA 1E94E 3AF1A 4FIDA 1NULA 4JKYA 4KXLA 2VPWA 3ZCQA 1TA9A 2CDRA 1GPJA 1H2HA 1M1XB 2E4VA 3PYMA 3O8DA 3N5CA 1PZHA 3SNKA 2X5KO 3W2IA 2ZTMA 4NICA 4B87A 5HCUA 5K0TA 4XEUA 2ZS8A 3AUYA 5F7ZA 1OI4A 4F2WA 3KCQA 1KYQA 3VJRA 2I2AA 1A3CA 3JRXA 2E1RA 1EP9A 1N3IA 2V3VA 2GR9A 4KODA 5IBPA 3AILA 2V5UA 3PNQA 4CDGA 1VLZA 4DVGA 1JEOA 4C7OA 1DB3A 1QFSA 1GPNA 4JLBA 3W6UA 1X7XB 2QRGA 1DIGA 3R5FA 4HVCA 5AVVA 4GEGA 3HXQA 4O4HF 1TMYA 1VSTA 1T8PA 2RJ3A 4IIUA 3ICEA 4ND6A 3CN9A 4Q6BA 3PXBA 4LHVA 3IP8A 2H8GA 3ADBA 3R9XA 1EWRA 4LW8A 1AD2A 1XO1A 1A9PA 1H85A 3K2BA 1ZHFA 5F9MA 2XRMA 3FWNA 3PKIA 4AFNA 5KPDA 4DIEA 1G8FA 2JD0A 4IIHA 3N2GA 1HYBA 2PX3A 3HBMA 4J0CA 1PWEA 4ZFNA 2OZLA 5JR3A 1PL8A 4UU8A 3THRA 3OCXA 4ZOCA 2J0VA 1I14A 1KDTA 2KLHA 2FWIA 3NC1C 4WX2B 4EFKA 2VRWA 1I7QB 3D1JA 3HWWA 2BDEA 2RBKA 3N0VA 1LPPA 3OD1A 4LQ4A 3DDNA 1DAOA 1KZHA 2PO5A 5DN6A 8MHTA 2G6BA 3ELWA 4BLQA 1VKOA 3ZXIA 2QW1A 3R44A 4QA9A 1UXOA 4P4NA 2IZOA 3VA7A 1P2BA 3BJRA 2H9YA 1UC9A 4G5GA 4QYIA 1P18A 2ISCA 5AW3A 5K0GA 4DHEA 2EV9A 5D51S 1L4NA 3P20A 5EIBC 2E48A 3ZWDA 3ZG6A 3JQ6A 1E0SA 5TDHA 4I36A 4NV0A 2J30A 3FYUA 4UM7A 4DV3B 4NG5A 1HDXA 4DUPA 1JUDA 3OTGA 4XGKA 5E6SA 1NLYA 2FG5A 3DQZA 1RQ7A 4HNGA 2IL1A 4L5YA 5B1HA 4CN9A 1IPFA 3IOEA 4MB6A 4PRLA 4N7JA 1OKKA 2CHUA 1N8SA 2P0EA 1MRSA 2EXXA 3IKLA 1TJ5A 2WP8J 1O9GA 3W2EA 3K09C 1L7EA 3OPYB 4MYDA 1KH2A 2GTIA 1A8UA 3H1AA 1DDIA 2C4MA 3L6DA 4HAIA 1N36B 4DIUA 3OEYA 3HCEA 3VVMA 1H6DA 3GCWA 1GFSA 4AJPA 1QJCA 4MS3B 2O8CA 2OQRA 2YMLA 4Z4GA 5AW7A 4FZ5A 3INTA 2OM2A 2ZLBA 2JASA 2DUNA 4KAXA 3LKBA 4QUDA 3U81A 4E14A 4S1TA 2JI8A 2BFMA 5FUMA 2YX1A 4ZV7A 2FAXA 3SSOA 3R5XA 3C5HA 3I52A 4KIUA 3ZD9A 1FP4A 1DJQA 1L2TA 4N1AA 4G0PA 4QQ8A 1E3EA 3GLTA 4HH3C 5B2ZA 2OM6A 2VIIA 4NLLA 3EOAI 1IRXA 1T6ZA 4NEHB 4Q3BA 4R8RA 4WCFA 4EH1A 2NUTB 4FFMA 3K70D 4JLJA 4MIKA 3ZZ1A 1E1CB 1XN1A 3D4OA 1SPBS 1SR8A 2YFQA 1YS4A 2GM5A 4G37A 3SU8A 4B9EA 3ER8A 3ZHQA 5J4HA 4RIGA 4GECA 2VH5R 1Z6TA 3H04A 3L4KA 3U5TA 1PI3A 1JECA 3THXB 1IATA 5KHLB 4MUBA 1ESDA 3RVQA 1OXSC 2A0YA 4DJJA 4ABTA 1M7HA 1E4EA 2Z4RA 4KQJA 4UBOA 1R5OA 1RIFA 5EJIA 1BRMA 3LHIA 1ETUA 5LIPA 3F1LA 3D43A 3GNQA 4EQZA 1Z0JA 2C2OA 4K5QA 1SG6A 4B74A 1FP6A 3L6CA 2IS4A 4KVFA 3R2JA 4IH1A 4LS3A 4M1OA 4M37A 1H6BA 2WG0A 3NHLA 4ADSG 3U3ZA 1L7BA 3B1FA 4MGYR 1NUUA 1TUGA 4BB9A 4Y6LA 1JYEA 1MOQA 2JFOA 1T91A 4B6PA 1EVQA 2XIJA 3REOA 1VLJA 2OAGA 4XSHA 5ALTA 1FP7A 1V9CA 2QTVB 2FP4A 4FMDF 4OAOA 3JYNA 5CYPA 2O48X 2CF6A 4Q4JA 5KQLA 1A7JA 3AL2A 4GAEA 4IFBA 4X7RA 5JVDF 2WF6A 3H83A 1CWUA 4LVNA 2XRFA 2Q3CA 4JLDA 4UOQA 1XNGA 3STUA 3R6GA 4R6XA 3DA8A 2J9YB 4K0KB 5ELXA 3GLHE 2EOAA 1JKMA 1EBUA 5F7JA 3RV3A 1RWOA 3GXOA 3UT5B 1G55A 4ID3A 3GJYA 4IJUA 3Q8XB 4LZPA 1JHYA 1E9SA 2LUOA 5ALPA 5I7FA 3KAJA 4JP2A 4RM2A 3GEEA 5LUAA 1NU6A 4MGZR 1LF0A 3KFLA 3V4LA 2EZ9A 3AL3A 2ZM5A 3LSYA 5FNZA 4KQ2A 4BNXA 1MC5A 3PE6A 4L95C 4YCLA 3QX7A 1XN4A 3PWSA 4V1CA 4OUKX 4JEHA 2X9LA 1YBVA 1Z75A 2DTEA 2RI1A 2YHAA 4KYUA 4Y1GA 2WMOB 2JVJA 1AA9A 1KYZA 5G3YA 4EF6A 2C5EA 3ND5A 4ABYA 3B13B 3UGKA 2WWFA 4HN9A 5AM4A 2RHDA 7ABPA 1ESZA 1LFDB 5IJXA 3BOSA 4AKEA 3AG6A 4HN2A 3EEQA 5ABPA 1NW7A 2CJPA 2XMBA 3L1HA 1Z0AA 4C7BA 3G8DA 3L8ZA 4HDKB 3M2PA 4BLOA 1F6BA 2Q1YA 3AW8A 4M8KA 4M83A 4O0MA 3K0AB 1XLVA 4LDAA 1WR8A 3ZHSA 5AOBA 1JLMA 1RI3A 4XVHA 4ESOA 1Q44A 3J80A 4FR5A 1W73A 3OBBA 1P6QA 3CRZA 2XF2A 3L3BA 5H0IA 4AJJA 3T4EA 4LXXA 4RJTA 3DH0A 1M8GA 1SXGA 5JECA 1G6HA 3VOSA 2W2PA 2VJCA 2GEUA 4MWSA 3TEMA 4IIXA 1JLLB 3S44A 2ZE5A 1BHQ1 4ZT6A 2QN1A 3CVVA 5T67A 1RYDA 1PHPA 4U8GA 4URWR 1SFRA 4YT4A 3WOVA 3RFFA 3C98A 2OYSA 3OJXA 5HF5A 3W7VA 1AKRA 2WUVA 2P5SA 1X2EA 1SQFA 3E9ZA 1JXAA 2TECE 3HCCA 3WQSB 4WT7A 2GNPA 4AUKA 4QGAA 2JFXA 4XZ3A 3GZJA 3HN6A 4YAFA 2B61A 3RRZA 3BERA 5BPHA 3NU1A 2VJBA 1DQYA 3G2PA 3K2EA 4DZZA 4MGIR 1LSOA 2Z43A 3BEOA 1RKVA 5KHOC 3NAGA 1MNAA 5DM4A 4Y6SA 4KDRA 1AJEA 4FFBB 4KUGA 4BKPA 2HUNA 3QFFA 1LW7A 3INYA 1KJ8A 3TBFA 4C7XA 2G70A 1KZGB 2Q28A 1TUIA 5CURA 4O8ZA 4D9KA 5CXXA 4EOGA 3QYJA 4MUIA 2J31A 4HDSA 3WKAA 5KX5B 1G60A 1I33A 1PNQA 3T15A 1JPNA 4AJ9A 1O96B 1J8FA 4Q4AA 4ROSA 2C94A 3N70A 3GH1A 3T4PA 1PX0A 3TLGA 2PUTA 3I62A 3COVA 1E2BA 1X7GA 1J24A 1FSPA 2CUTA 3GMDA 3ADKA 4AYWA 2B1JA 3QELB 4RQUA 3AYXB 1B2RA 1YZNA 2E4ZA 1PBTA 4AQ7A 2KSQA 1ORDA 1C0LA 3PC8A 4BQSA 3PEVA 1GL3A 3ISJA 1EGMB 1O4VA 2PBLA 3LVBA 3QVMA 5AUQA 4IWYA 3G1TA 2JLWA 1K8QA 1NBME 4V0MA 1QQBA 4ZC8A 1MHTA 4OAPA 4LJYA 2YMQA 1DAKA 5HK8A 2IW1A 1A5ZA 2NVWA 1W19A 1N32B 1PLLA 5ALXA 1DJOA 4MPJA 3OU2A 4EENA 1E79A 2XD4A 1RNLA 1XZKA 1DKOA 1XPJA 2XECA 3IFSA 3NJ4A 1W9HA 4GXTA 4TS9A 5CTJA 3TNLA 4CV0A 3TGPA 4D4KA 1IN4A 1KVTA 1XEXB 2RGDA 1IBRA 2YY6A 3AI3A 3H86A 3NOXA 4M1KA 1ZN9A 1VPTA 3L79A 4X1IB 2NQTA 1DTWA 3H87A 2O8BB 3FDJA 1UP7A 1FSGA 3GAZA 4N5HX 4PU0A 3UJAA 4YRQA 1BMQA 2HXYA 3NBXX 3TIFA 1RKQA 1NUQA 2Q0SA 4BLSA 2NXEA 4GRAA 2XUOA 1IHOA 3JV7A 4RD3A 5CFQA 3QXCA 4H6PA 4IUCS 1DPFA 4NBUA 2BJWA 3U1VA 2YZGA 1EK0A 2Y2VA 1HYHA 4R4JA 5D7BA 2DZDA 3EW9A 2PKWA 2ZANA 3FAZA 2NU9A 2BBTA 4Z4QA 3ILHA 3MK31 1H2XA 2XT0A 3N2KB 1LQ2A 4Z9YA 5HIJA 3T61A 3HB7A 1OH6A 1PS8A 1CZOA 1AN9A 5JD6A 2AZTA 1QX3A 4D5EA 1IZ7A 1QRRA 3ZY2A 2C97A 4QU8A 2QTNA 4YR9A 2W2KA 4OBXA 3PXGA 3LUKA 4PVCA 1BXRA 1WCYA 1SOUA 3DBRA 3HR7A 4GPIB 1IY8A 1Y4DE 3OCWA 1J20A 4TWZA 4M9RA 3FPHA 3CZMA 4DLVA 5CHEA 1QH0A 1KIAA 2OA0A 2OGUA 3RUHA 1ONPA 4JOBA 4X3OA 4LDNA 3MCVA 2HIGA 4GXRA 4KNWA 4PG7A 1QNLA 3TI7A 3TR5A 2I4OA 3SP1A 4JOQA 4OLHA 4U7FA 1WXIA 4AQYB 4HZIA 3GC6A 3WLKX 4ZKEA 5KQSA 3NM4A 2WT4A 2A57A 5IVPA 4PR0A 1KR5A 5HM6A 5LZ7A 3V9AA 5EN4A 3G5UA 1BMFA 3NANA 4AWBA 1JIVA 3CF0A 4FCVA 2IHVA 4OA5A 3QPDA 4EHKA 5LXTA 4JI4B 1RQ2A 3IIMA 3PS9A 4KBYA 3TEFA 1PF7E 4TTJA 5JE8A 4DNQA 1DCKA 1J6UA 2GEKA 1I7PA 1FJHA 3RJMA 1O0BA 1G7RA 5B6JA 4B4WA 3P4XA 1GUAA 2GF0A 4Y2SA 3H1BA 3SSMA 2GEDA 2XOEA 5BYAA 2COUA 2PJRA 1J0DA 3DZGA 3OI7A 2D5LA 4GZMA 1ZK3A 3ICCA 4MLPA 3S29A 5K20A 1W7AA 2NO7A 2ODBA 4RPKA 1GTG1 1FMLA 3OFSA 4YECA 4ZICA 2X9NA 4ZEXA 3VU9B 4Y6GB 1D1QA 3LIPA 1U3UA 7MHTA 1CIVA 3A9SA 1OW3B 4IMRA 4DY6A 5A2GA 3D5QA 1DNPA 3TXAA 3QKUA 2YY5A 3RYTC 1T3GA 2AB0A 4MEAA 3IP3A 2W6NA 2R4QA 4UUMA 4N65A 4HYYA 2QK4A 1JS1X 2HRQA 4M1WA 4YJFA 5KINB 3SI7A 5FPKA 4EYQA 3PPYA 4XTRA 4BFXA 2VHWA 3O0DA 1C3EA 2GN8A 3VOAA 2FWBA 4Y6RA 4F11A 3LMKA 4LE0A 4M1EA 5BY2A 4KXWA 3A6EA 4UDNA 1R7RA 1ZYUA 1DWUA 2DPHA 2MSNA 3AVPA 3SMQA 4D0GA 4H7HA 1XF9A 4O1MA 3EXG1 4F85A 1J8DA 3TOXA 1G21B 2QYSA 1C8LA 3NVAA 4LVCA 4B6FA 4ALMA 1EQAA 1SVIA 2BZ0A 2HV9A 2C4HA 3GEGA 3V4ZA 1T34A 3ZV6A 1J0AA 2FG7C 4ZI3A 3U80A 3KPYA 4HD8A 2RE8A 4IW3B 2B98A 1CUYA 3ZOZA 2AR7A 3ZQKA 1MU0A 7REQA 2B8EA 1JHRA 2Q1XA 1MJGA 5AKKA 1RHKA 1S2LA 4EY8A 4RZHA 3RQIA 8ADHA 1UFOA 3QJYA 5DXFA 5IH3A 1QTIA 5F3DA 1N1EA 2P30A 1OYWA 2X0NA 3D5TA 5GOZA 1Z28A 3KT6A 3UYLA 3TECE 2JG3A 1GZHB 4LPKA 2G3YA 2A58A 2Q9UA 4QBGB 2CZQA 3WWYA 4MV1A 4RY2A 4BYGA 1M54A 2CUZA 3LX4A 4TRRA 3JR7A 8ABPA 4BIMA 1BHJA 3P0IA 5JMWA 3KYIB 5LYJB 1XKQA 1E3IA 3HS3A 3HYNA 4FUTA 5IRCD 4XQGA 2QD2A 3AHEA 4K2AA 4BKUA 3D8UA 5HJEA 1GGKA 2V6GA 4MV0A 4CFYA 5JBIA 4OHUA 4WEQA 2Q9AA 2V6FA 3IXLA 1KPHA 4P4LA 3D6TB 4B6EA 1NSYA 3BXGA 4Q9JA 5AICA 3B70A 2GK4A 1HE4A 3IJRA 4DYDA 2GDZA 3TOVA 4B83A 3UV6A 4LNUA 1NW9B 3QWBA 4CIWA 2IX9A 3HL0A 3PA8A 2P9QA 4KTVE 2C3UA 4ZEMA 2I4IA 5AM3A 3CKYA 2DR2A 1V6CA 3UFBA 3NFYA 4RM3A 3AY0A 3BDAA 3M9LA 2Q3DA 3GNLA 4DS3A 1Y33E 4DDWA 5HZMA 5KTTA 1ISRA 2PKRA 1OAOC 2VQ3A 2WSMA 5AUOB 2EF1A 3DE5X 1JLLA 4LOAA 4PLPA 3H1FA 1NXPA 4DMLA 1EZ1A 5BV1A 3OC0A 5HOQA 3ZLBA 1UPTA 1H8ED 2WMNB 1KBQA 5J2TB 2I6TA 2J6HA 4MKZA 5THXA 5B55A 3L18A 2OR3A 1TZBA 3LGXA 3JQAA 5IARA 2IZ7A 2ZYIA 1OGIA 2H2FA 4JT9A 4WZZA 4LEIA 4Q4HB 4FM9A 5D86A 2E4YA 1QZZA 4IKOA 7YASA 1A8HA 1JDTA 3I5AA 1B0AA 1G4UR 3LUPA 3IHTA 3GGCA 4ND8A 1IDN1 3CSSA 2QJRA 1RYZA 4X90A 5E6SB 1M5RA 2LCIA 3DFMA 7MDHA 4F8YA 1CE8B 2NNWB 1Y1TA 2RD2A 4EPVA 1KMHA 5EJ7A 3MGBA 2FWJA 2X4GA 3DV0A 3LBNA 4E5MA 4F3RA 2XCRB 3ZR4B 1XJQA 1JV2B 3D7RA 5EZYB 3HJRA 1JLSA 4CXMA 1N5MA 2EW1A 5K0EA 3O95A 5AIBA 1Y6FA 1E9DA 2VK8A 1MNQA 4YBZA 1I1HA 2V03A 4MDHA 5FRDA 4PCUA 3RS8A 3ZX5A 3NGMA 5IF3A 1FX0A 3U3OA 2E85A 1PV4A 1FCJA 4XOIA 1GGJA 4UHEA 4KVAA 5BSKA 4W1PA 3K1JA 5JNUA 4AUEA 3NHWA 3FDFA 4EGSA 2RHCA 1RKBA 1S8OA 1WVMA 1K9SA 1LY1A 2ZCUA 1NASA 3NB0A 4E5YA 5BYJA 3MIIA 1P45A 4G0XA 3IE0A 3S5JA 1IPHA 1C4WA 1BVYF 2A1TR 4GP7A 3BWEA 3LLMA 4RLSA 3WK6A 1HTWA 3DOIA 4JDUA 5BT9A 3EXIB 4YRIA 3CNOA 3PF9A 2B83A 3FX2A 4L51A 3U7QA 4DXHA 5JDIA 4YP9A 1ZMRA 1NUSA 1E1LA 1OI2A 2F8MA 5JWRA 1L7VC 3DZFA 5EJGA 5E1DA 4OQXA 2CXOA 5JMTA 2BD0A 2OSBA 1EESA 4MQEB 2BKLA 1UPAA 2EEPA 4TTSA 1UH5A 3GQBB 3Q3CA 5I51A 1Q92A 4DUGD 2R751 1CFZA 4XUGB 4F46A 4AF7A 3NATA 4OOEA 3RM3A 4NCJA 2AEMA 1SC1A 5AMXA 2DFKB 2P2SA 3U7GA 4GKVA 3QYFA 2JVIA 3BREA 2O7QA 4L8GA 4NJEA 4X1YA 1P7YA 4G1FA 3AG5A 3V2HA 2K87A 3G0DA 2DBRA 5TPZA 3V42A 1G8SA 1C4XA 4GSLA 5CFMA 3KYDB 4L4UA 2VUTA 1VPDA 1PIWA 1GUZA 2LWIA 4ZVSA 4BQEA 2GTPA 3PNKA 2CDAA 3PZRA 2ZIWB 4ZYVA 2V0GA 3GUUA 4D44A 2W42A 1P17A 1UP4A 1QGYA 2PT7A 2RGRA 4PLFA 4ARZA 2AG6A 2QU7A 1FC0A 3ONVA 1K4MA 4QBHA 1G8GA 4RK7A 2D8AA 4LBZA 3SEZA 3W90A 1A8IA 3O82A 4JCOA 2B0JA 2HF7A 4N54A 1HFEL 2H00A 3A11A 1E1CA 1EFTA 3A1FA 1VE1A 4WERA 1I1NA 2J7PA 4HTAA 4XYMA 4MARA 2YJNA 2AQKA 5ALKA 2BJHA 3HY3A 2B0CA 1JDBC 3E48A 2FMXA 3FOCA 1QHXA 5BWMA 3DTVA 2WU8A 3KOMA 2V6MA 5JPDA 4JZYA 2ETVA 3MC1A 4UM5A 3P2JA 2QJTA 4Z99A 1KVRA 4MI1A 4WA8A 3C85A 4CT4B 4M36A 2O0JA 2HFJA 3EYAA 2HU8A 2GN6A 2PUWA 3DZ8A 2VKTA 4Y2GA 3I6MA 5FA6A 5FOTA 4D3FA 4DB4A 1MH9A 1B8PA 4UREA 1CJUC 2H07A 2FQYA 4KW7A 1SVNA 1Y8QB 2DPMA 3GVPA 3OTIA 4DV5B 4PG4A 1YZ3A 3DMDA 2AF3C 1NNI1 1R6VA 2IDMA 2DHDA 3BHJA 1MABA 1JHZA 3KPVA 4B8WA 2VNIA 1EIWA 4LA4A 1O58A 2ZPUA 3BWBA 4RLFA 5CT4A 4CIBA 1M6YA 1JHPA 2HO4A 2I3ZA 3FMFA 5ARCA 3SR4A 1L3CA 2ZBPA 5ITVA 4C76A 1A72A 6REQA 4H15A 4D9MA 1AGYA 1CDEA 1HG1A 3DAYA 5EIAA 3QENA 2RBGA 2ONJA 4KSBA 2PX5A 2BGJA 2LZ0A 3OICA 1VIYA 1U2EA 1LBEA 3RH0A 4JT2A 5HG0A 3ZH2A 2C5BA 2QROA 1J2JA 2DBYA 2GRAA 4YYEA 3NMUF 3LYLA 2BHNA 4GM1A 1M75A 1ZCJA 3I9V1 3K32A 1M67A 5EKSA 3KXIA 3AUUA 5KYVA 1KE2A 3SJAA 5M34A 2JLYA 4ME6A 1P1KA 1OV4A 4DB2A 4NRDA 1HE1C 3OCJA 4EKDA 1TF5A 1VCNA 1KC3A 2NMVA 3GG2A 4ZOLA 5LZ9A 2P4QA 1O5IA 3CIOA 5KNBH 3GN1A 4Q93A 4RK4A 2IS2A 2WF7A 5DHSA 2J7PD 3ZCSA 2J6IA 2JGIA 5REQA 3Q40A 5FBRB 4EY6A 5BWCA 2IXTA 2J4CA 3DZJA 3AVOA 3MUEA 5CFLA 1YR3A 3OG9A 1W2HA 2Q0QA 1XMOB 4MQ5A 1QXSA 4CT5A 1Y7IA 2DPGA 5HE9A 4LOLA 3DS8A 4CI9A 1WCV1 3HDQA 2G1AA 3RS7A 3T9EA 1NW6A 3T7AA 1TJNA 2JIBA 1TZKA 1S4MA 2Q9CA 3KOUA 4A7PA 5KVCA 2HTFA 1FLAA 4JB2A 5DU2A 3EC2A 3HU3A 3ZNOA 4EHFA 1AKVA 5K6AC 2FGJA 2GESA 1JJVA 3CM0A 4DMHA 1Y7PA 3KYJB 5IMBA 5LD2B 2XVZA 4S1VA 4N76A 1KRHA 2P40A 2PZLA 1N6HA 1RR6A 1KBZA 1YZQA 2VK2A 3H5AA 4KJXA 3RBVA 5INTA 5TRTA 3KQMA 4E5KA 2P6MA 4ZOAA 1S2IA 3PWKA 4FDTA 4PZEA 5IVIA 4NDNE 4CMGA 3UPTA 1VXRA 1ZAYA 4R1SA 1SXPA 4R2WA 4FW9A 1EA5A 4I7EA 1YCDA 3NETA 5EI5A 2ZUTA 2ZBRA 3UWKA 2OKCA 3WXBA 4YJ3A 5IULC 1GA4A 2I9PA 5JY1A 2PKYX 4GBJA 2QE7A 1CK4A 2UVPA 2B36A 3O1HB 4LRXA 2DBZA 4HWPA 3G0IA 1KERA 4V0ME 1EFCA 1MKYA 2YCLA 2ANCA 2YMPA 3IMKA 4OBBA 1Z2AA 2AYZA 1S3SA 2FVYA 3MUFA 1ZIOA 1H4QA 4BJ5A 2ZWAA 2BEVA 3ACCA 2J9RA 2W4MA 3M83A 4FZ3A 4WW0A 4EX7A 3TOCA 3C7AA 5KSWB 3KT3A 5LMCA 1DKLA 1Z0FA 2RGBA 5FO1A 4BFUA 2PH7A 1XQXA 3A1WA 4OQNA 2OYRA 3T7KA 4QT4A 2FXVA 2Q3MA 2R11A 1DBWA 1R1DA 3L7NA 3NORA 2VDNB 3LA6A 3BS4A 4KLRA 1MAWA 2QOEA 2NUAB 1EM8A 2FLKA 2H06A 3M5WA 5DLQC 3KLNA 4TVBA 5AXCA 3TB6A 5CA0B 2G08A 1A9XB 3PL5A 4PF1A 4DSAA 2WM3A 4Y2JA 3B89A 5AIAA 2WVJA 3D7SA 3LUBA 2FSHA 1KK1A 3OEWA 4WZAB 4TROA 2E4WA 1BSVA 4X71A 3W6NA 1Q0QA 2BR4A 2QR2A 1DC4A 1CX9B 1QRUA 2ODNA 4ZIRB 4PCAA 1QE3A 5FA8A 4C7JA 3OURA 5HIIA 4L6IA 2OGZA 2VPYA 4Q3DA 5EQDA 4RH0A 3HR4A 5D1HA 4NXNB 3FGNA 4UMEA 1FNMA 1K2WA 2I2XB 1XTUA 3R0IA 4GR9A 2JFBA 4L6AA 2CE7A 4US1R<