4QNNA

Crystal structure of phospholipase a 1 from hornet(vespa basalis) venom
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
297
structure length
297
Chain Sequence
b'PCPYSDDTVKMIILTRENKKHDFYTLDTIKKHNEFKKSTIKHQVVFITHGFTSSADTENFLAMAKALSDKGNYLVILIDWRVAACTEEMSGIQLAYYSYAASNTRLVGNYIATVTKMLVQKYNVPMANIRLIGHSLGAHTSGFAGKKVQELGLGKYSEIIGLDPAGPSFKSNDCSERICKTDAHYVQIIHTSNHLGTLVTLGTVDFMNNGYNQPGCGLPLIGETCSHTRAVKYFTECIKHECCLIGVPQSKKPQPVSKCTRNECVCVGLNAKTYPKTGSFYVPVESKAPYCNNKGKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phospholipase A 1 from hornet(Vespa basalis) venom
publication title Crystal Structure of phospholipase A 1 from hornet(Vespa basalis) venom
rcsb
source organism Vespa basalis
molecule tags Hydrolase
total genus 96
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.32: Phospholipase A(1).
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00151 Lipase Lipase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qnnA00
4IH9A 5AM1A 1R4ZA 4UBLA 2Z8ZA 4B0PA 2DQYA 1XLVA 4K6HA 2HRRA 2Z3ZA 1E8DA 5AKHA 3HI4A 5JYCA 3ANTA 3FSGA 1NX9A 3H18A 4UBOA 2R11A 4QZVA 5AK4A 4A16A 4Y2QA 5E2IA 1NU6A 3IBTA 3WL6A 1AGYA 4KJXA 2H7YA 2WJ3A 3DKKA 4HZGA 4PF1A 1E3QA 3WWCA 4P92A 3C87A 2QVBA 3AIOA 1GPNA 2FJ0A 3IVMA 4INZA 4MWTA 3DL7A 4QA9A 2WJ4A 1BCSA 2W22A 4FFVA 3GELA 4OUKX 2JGLA 5AKJA 4B85A 5C7YA 3D2AA 1HLGA 2OLEA 1WB4A 4Y2JA 5AI0A 2OQVA 5KWJA 1DT3A 5CH8A 2XMBA 4DTCA 4YX9A 1B6GA 4J0HA 4ZGBA 2GZRA 5HFAA 1L7RA 1GZ7A 4BCBA 3QPAA 3C45A 4KE9A 3G9TA 4AO6A 1WCYA 2QMQA 3D5EA 4DM7A 4FKBA 1TCCA 2HU5A 1JJIA 1UXOA 1TIBA 3ESBA 4E11A 5FLKA 4KAAA 5JZ9A 2PPLA 3A2NA 5F4ZA 2PUHA 2WU3A 3DDUA 3R40A 3GFFA 2VTVA 3C8DA 1BU8A 1B41A 3EQ8A 2GYVA 5A7HA 1QLWA 1F0PA 3G9XA 3IUJA 2DFPA 5HQ3B 5KREA 1XZGA 4AMZA 5CMLA 1CV2A 2BAGA 2XMQA 4Y7DA 4DNFA 1JU3A 4CIBA 1E8NA 5J3JA 2XQFA 3L1JA 2ZSIA 1F6WA 2ROQA 4MYDA 1EK1A 1QOZA 4BAZA 4UBMA 2PU7A 2QR5A 4OYLA 5IH7A 2XMDA 4OSEA 2W6CX 1SCQA 2Y2UA 5CT8A 1W76A 3IUNA 2RI6A 3T52A 4JYMA 3ED1A 2XMSA 5A2GA 4DMCA 5JAUA 2PL5A 5AKXA 4AO8A 3WK5A 2GYWA 4UHEA 3WKDA 4UHCA 4A5SA 1YS2X 3LIIA 1F0NA 4DNOA 3MUNA 5CT9A 2NW6A 4X90A 1LPSA 5JARA 2C58A 1QIGA 4BE9A 1IVYA 1EB8A 3O4IA 3QBJA 1QIFA 5FP0A 4FHZA 1CIJA 4MYSA 5AM3A 5DYTA 5AIBA 3BXPA 4F21A 4Q3OA 4Q82A 2JGKA 4WFIA 1EVEA 4X94A 3S2ZA 4E14A 4IH1A 4HRYA 1A8QA 3OPMA 3I2FA 4C89A 1VZ2A 4B6GA 3Q0TA 1LPAB 4OCZA 2AJBA 1BEZA 2PU5A 1XZFA 3O9VA 5JZBA 5AM2A 4IHAA 5EHQA 4AN1A 2ES4A 3W9UA 4OB6A 1U8EA 3WK8A 3BE8A 3WLAA 4DLNA 3PUHA 3LS2A 1C7JA 3A70A 3AZPA 5LIPA 4CG3A 4GHWA 4UBJA 1J07A 4W1PA 4PSDA 1ODSA 3RKSA 1I6WA 4BC0A 4B84A 2WTMA 3CN7A 3C6YA 5AOCA 2WFLB 5AI8A 3M81A 4QE3A 2XUFA 2HFKA 4UFPA 3M3DA 4KACA 1XKTA 1N1MA 3JW8A 4I19A 1F8UA 4G5XA 1RP1A 3ZLUA 2B61A 2OCIA 4AZ0A 2HA3A 3IA2A 1USWA 5EI5A 2AJ8A 3MUOA 5E4JA 1TQHA 2HU8A 5K3DA 3SC2A 1DTEA 3DQZA 3OURA 1MAAA 2PSJA 1UZAA 3I6YA 2PM8A 3BF7A 3I1YA 5DNVA 3LLCA 5LZ4A 3R3VA 3AIMA 2WG2A 5T4FA 3IUMA 2H7XA 4G9EA 1DWPA 2O2GA 3I2JA 1GKKA 4MXDA 3C43A 3S8YA 1J06A 1KEZA 3V1NA 3I2HA 3DL4A 4RE6A 4PSCA 1GQSA 1C4XA 1GKLA 4FWBA 3FAKA 4ZV7A 4S0XA 2ACEA 4G4GA 3QZUA 5I9IA 2WFMA 5FKJA 5HFNA 1WHSA 1X2BA 5K3FB 2IITA 1MX5A 1VA5A 4BCDA 5AOBA 3DJYA 4U2BA 2IX9A 3JWEA 5ESRA 4BRZA 4K6KA 2JF0A 3I6MA 5DNWA 4BP8A 1O6FA 1OXMA 4J0DA 3R41A 4X00A 2HA4A 1JI3A 5ALWA 4AB1A 5T4HA 5A7GA 4EY5A 3PDCA 2XUKA 1P0QA 4EY7A 3G9UA 2JGIA 4J03A 1RWQA 2BGRA 4MEBA 3WIOA 2HA7A 4H7HA 3H0CA 5LZ5A 1G42A 4C6HA 1LZKA 3KOOA 5LKRA 2WUGA 2D0DA 1UK8A 5ALFA 1X70A 5K3AA 4B9EA 1LZLA 2WG1A 4K6GA 3FVRA 1E8MA 4CFSA 4FFWA 2WHRA 4LXIA 4P93A 4QDUA 5ALSA 5AI4A 1DWOA 4DSAA 1T4MA 1UKBA 2YASA 2X5XA 2O7RA 5DLPA 1CUIA 4B83A 2JGJA 2WHQA 1SC9A 3O9MA 2DSNA 4I4CA 5CH3A 1ISPA 1K8QA 2QXTA 2FUKA 3VKFA 2QKYA 3VVMA 3I28A 1GPKA 1Q0RA 2Y1KA 4H7IA 2DHEA 4QDTA 5A7FA 4OYYA 4HAIA 1QIMA 4U2FA 4YASA 4M0FA 4J0KA 4P08A 3G8YA 2ZYIA 4Q1VA 4DMHA 1CUWA 4H7KA 3F67A 1XFDA 3CCCA 1MN6A 4ZREA 1QIHA 4AX4A 2X8BA 2QUAA 1D07A 1BRTA 3W2TA 2VT7A 5ALGA 3I6ZA 2QUBA 1LPOA 3B5EA 3E0XA 2QM0A 3FYUC 4X95A 3LCRA 1CQZA 4MQMA 4ZV9A 4NZZA 2YXPX 1ZGCA 4FNMA 1Y7HA 5EHXA 1VOTA 5AK3A 4X6UA 1TK3A 4G1FA 1S8OA 3W05A 3BIXA 1EB9A 3QMWA 5DTIA 3L1IA 2OCKA 3AUKA 2AJCA 2YH2A 4DYHA 3G0IA 5JZSA 3HEAA 5JD4A 4AO7A 5JAHA 3B3QA 4Q3LA 1W75A 2C7BA 4IH4A 2B9VA 5AICA 2XDWA 1DT5A 2O2HA 3F98A 4TPKA 3HXKA 4Y2SA 2LIPA 1UWCA 3D2BA 5E4YA 1G66A 2E3JA 1C7IA 5HF6A 3PFBA 5SYNA 1EDBA 3G0CA 5EIAA 4EUSA 4KRXA 3STXA 1R9MA 4GDMA 4X85A 3WZLA 4J0IA 2RGUA 1VLQA 2PSDA 5ALEA 1R88A 2JEYA 5LZ9A 1YR2A 5CRIA 3LP5A 1CQWA 5I8PA 3H2HA 1CFJA 2CUTA 2PSFA 4EY6A 3WI7A 3D2CA 3WKAA 4QEKA 1ODCA 2G4LA 1LPPA 4GLBA 1A8UA 3DYVA 4ARAA 5LP1A 3FVTA 4WDQA 4C87A 4YK7A 2ZJ7A 2EEPA 1DQYA 3BJRA 3K2IA 2DHCA 4OB7A 1MX9A 1AQLA 4HXGA 1CVLA 5EGNA 3ILSA 3V1MA 1UT6A 4FBLA 3WK9A 1UOOA 5AKGA 1UOPA 4H7FA 4KYVA 5FPPA 3I2IA 5CURA 5KWIA 1EINA 1KU6A 4QWMA 2RAUA 4ETWA 2OXEA 3WYNA 1N8SA 1R1DA 1JU4A 1CUZA 4QLAA 1CUFA 2OAGA 3WA7A 1H2XA 1VXRA 4N5HX 2WUEA 1ZD3A 2J4CA 1CUSA 1Q0ZA 3QVMA 4DGQA 4UBNA 5EIHA 1CEXA 3O0DA 1WPRA 5ALHA 4BDSA 2RONA 4HXEB 3STTA 4G8DA 4L3WA 5HZGA 3YASA 3JYHA 1UK6A 3WKEA 5LKAA 1HL7A 3FSGD 1ZD2P 3FYUB 1QFSA 2XQGA 1QGED 3STUA 2QXUA 5BV7A 4UHFA 3HABA 1BE0A 2XUPA 3K9BA 3QM1A 5CBKA 1IZ8A 1K4YA 5AOAA 1WM1A 4LYEA 3AINA 1XQVA 1WPXA 2XT0A 1WOMA 5CW2A 5ALRA 2PKYX 4WJLA 2RHWA 5JADA 1HPLA 3H2GA 4BCCA 1MAHA 5AO9A 1XZMA 5D7BA 4H0CA 1QJ4A 2XMGA 3G0BA 1GQRA 1JT2A 2ZSHA 5HKBA 1YAHA 2G5PA 5CT5A 2BGNA 4V2IA 1FFEA 1UKCA 2CBGA 4HTAA 1ORWA 2YYSA 3DNMA 4BZWA 3VISA 1W6RA 1Y7IA 1H2YA 1G4HA 5LLSA 3WL8A 5BOVA 5AKIA 2HRQA 5ALMA 3D7RA 2CEKA 2PUJA 5ALVA 1E89A 4C01A 1MTZA 5ALUA 2GYUA 2XUQA 4DIUA 4C4XA 4X91A 3IULA 2WKWA 2EDCA 1GXSA 1R50A 2HHAA 2HL6A 4DMKA 1LPBB 4L9AA 2HA5A 5LZ7A 3IURA 1G5FA 1BN7A 1PFQA 1XQWA 4N8EA 4C4ZA 1XZCA 4C4YA 2PSEA 5AKZA 4BE4A 2OAEA 2Z3WA 1QIIA 4DNQA 2I3DA 3G9ZA 3R3WA 4KR0A 4CCYA 5AM5A 2PBLA 4DSZA 1WB5A 3FLBA 3WWOA 3ANSA 5HCUA 3DD5A 4PO3X 4EZIA 3I2KA 4FOLA 2OQIA 4CG1A 2BKLA 5DNUA 4U2EA 4LXGA 4PV7A 3AZOA 1CUUA 1CUVA 4H7JA 7YASA 3H2JA 5A62A 4QDOA 1DWQA 5KBYA 1YA8A 5AM0A 5ALQA 5HQ3A 5AK6A 3V1KA 4Y2RA 1LBTA 4OU4A 2VQ6A 4XJVA 1THTA 5IKXA 1YA4A 3C6BA 2ZYSA 4BP9A 1H2WA 2GZSA 4OB8A 3WWEA 2R8BA 3OM8A 1U2EA 1ODTC 3WQHA 4XWGA 2XUOA 5D3KA 1VZ3A 1QONA 4JUIA 1OILA 2DR0A 3U1TA 3BL8A 2ECFA 3N2ZB 3HLKA 1CUHA 2QRUA 1H22A 4N8DA 3VVLA 2ZJ6A 1Y37A 3C70A 1JFRA 2WIFA 3O4HA 5EHNA 3DLTA 4Q05A 4AZ3A 4UHHA 1XQXA 4RE5A 4W63A 2HADA 4H77A 2BFNA 3F8SA 4Y9SA 4H18A 3R3UA 2WLSA 2VAVA 4KE6A 3W9BA 2WIDA 1XZAA 5T4BA 2GBGA 4ZI5A 1HQDA 4GWLA 4PSUA 4BVKA 1TCBA 2QZPA 1CPYA 1UFOA 2WUDA 2VJBA 1EH5A 3GBSA 3PUIA 2OGZA 4MWSA 5AI6A 1H23A 2OGTA 3HRHA 2OGSA 2FX5A 2G5TA 3ZLTA 2JBWA 1CR6A 3ICWA 3VJKA 1FFDA 3H2IA 1A7UA 1LLFA 4L72A 4X6YA 4PQEA 4LXHA 5LZ2A 3G7NA 4E46A 2XMRA 3WKCA 3FLAA 4WDRA 3KXPA 3VJMA 5FDFA 2OG1A 1T2NA 3BDVA 1AZWA 1BROA 1CUYA 4KE7A 4EHBA 3D0KA 3TJMA 3FNBA 2WFLA 3UUEA 4OPMA 1ZI9A 1FSSA 5C8XA 3RK4A 3MVEA 3QPDA 5T4EA 3AZQA 1EVQA 4W1QA 4HS9A 2VA9A 1LBSA 4RPCA 1XRLA 1DX6A 4P9NA 1DX4A 4C88A 2WU4A 4X6XA 5JD6A 3V48A 4FLFA 4UHBA 5FUMA 1XZHA 3PE6A 1ACLA 3A2LA 2C5FA 1ZJ4A 2HIHA 4BBZA 5H3HA 2J3QA 5I7UA 1MO2A 3PF8A 3EIOA 4BRSA 2Z5GA 1QO7A 4GW3A 2I3ZA 3KWFA 2BUBA 3CXUA 2XUIA 1YS1X 4EA6A 1CRLA 5ALTA 5FPQA 5K3FA 1TCAA 3WL5A 4B80A 2B20A 4FMPA 4FDMA 1EHYA 2JGFA 5HK9A 4KEAA 4QDZA 3GUUA 1XROA 5YASA 1BN6A 2QS9A 2K2QB 3O95A 1K63A 3HZOA 1W52X 3ESDA 4MQLA 4WY8A 1ZD5A 1QZ3A 3ICVA 5ALJA 2CKMA 1ORVA 3PFCA 4HRXA 2JIDA 5IVKA 1IMJA 4MEAA 2RIPA 3WZMA 4AMYA 3A2MA 3G02A 4GI1A 5IVDA 5AI9A 2Y6UA 4I3FA 2ZYHA 3HACA 3RLIA 4M0EA 2H7CA 1JKMA 1OCEA 1XRNA 3DKRA 2ZYRA 1QIDA 5D3ZA 4BTVA 3STWA 4KE8A 4LIPD 3E1GA 3W06A 3KD2A 4WY5A 4BAUA 1JMYA 4CCWA 1P0PA 1IZ7A 4AXBA 5CXUA 4FNGA 2WHPA 1AURA 3SWWA 1SCKA 4UUQA 3KDAA 5AHXA 5AJHA 4BAGA 1X2EA 1XZKA 2WQZA 1GT6A 4ITVA 1Q84A 5AKLA 4IQ4A 5A6VA 3H17A 4FBMA 1CUJA 3HC7A 1LPNA 5BWBA 1UK7A 3PF9A 4ZXFA 4EY4A 1IUPA 5DTJA 3A6ZA 1AKNA 4J0CA 1IUNA 3ESAA 1FFCA 1QFMA 2V9ZA 3NGMA 2WM2A 2QJRA 2BUAA 1PV1A 3T4UA 4X7BA 4F0JA 3ZLVA 4KAFA 5AI5A 5ISMA 1TAHA 3FBWA 1CUBA 3IDAA 3CCBA 3PI6A 1XKLA 3WL7A 1WHTA 4WFJA 1VXOA 3I1IA 1TKRA 4KRYA 3ZI7A 3ZV7A 1R3DA 2VF2A 2WIGA 3ZPXA 2UZ0A 3C5VA 1W4LA 3TEJA 3RM3A 1A8SA 2HA6A 1A88A 3L1HA 4RGYA 4PNZA 4LKOA 5K3EA 2BCEA 4FTWA 2XQIA 2C0QA 2Y2VA 5DYYA 2IIVA 2V96A 4MJ3A 3ZWQA 1JMKC 3STVA 4XIIA 4M0MA 3D59A 3IUQA 1VKHA 2XE4A 3FLEA 4BZZA 2XMZA 3WK6A 1ZJ5A 5ALYA 2HFJA 2XB6A 4TGLA 1EA5A 2D5LA 3BWXA 2WSLA 5JATA 1ZOIA 4X71A 3ESCA 2J3DA 3KWJA 2WJ6A 3WIBA 2O7VA 4QDXA 4CCYB 4BVLA 1SCIA 2HA2A 4UHDA 5D6OA 2XQKA 3QPCA 3TRDA 2WFZA 5JD5A 3UMJA 1VE7A 1N5MA 2WUFA 2BJHA 1LPMA 1EXWA 3VJLA 2QTBA 1K5PA 4KAJA 4U2DA 2V97A 1XQYA 1BCRA 1QIEA 3C6ZA 2V98A 2X76A 4X93A 2ONCA 2J4FA 5DJ5A 3WKBA 2Y6VA 3PICA 1IUOA 3WJ1A 3U0VA 1CLEA 5EHZA 3RARA 1N5RA 1U4NA 4Y2XA 1XZLA 4X97A 3W04A 5JAOA 4UBIA 1FFAA 1MJ5A 2ORYA 4G8CA 3OOSA 1R9NA 2AJLI 5BWCA 3K6KA 4AN0A 1XLWA 1AC5A 2JEZA 1E66A 2WG0A 4BC1A 3NUZA 4W9RA 3OTQA 1YB6A 4B7ZA 5JIBA 1THGA 4G9GA 1MNAA 1YSCA 1U65A 4H7EA 5CTAA 4TVKA 5JANA 4PW0A 3WWDA 4BTLA 4Y2UA 4HVTA 3TGLA 1TRHA 4J7AA 2VAXA 1DINA 1VA4A 2CZQA 5A71A 4ROTA 5LZ8A 5CT4A 1QTRA 2WILA 4G4JA 4Y2PA 4B82A 1XRPA 3WJ2A 3FWHA 1PJAA 1SOMA 3DCNA 3Q8WA 3STYA 2DHDA 2CMFA 3AJAA 5LYYA 1QIKA 3GZJA 4W1SA 4QNNA 3D3NA 1EDEA 2QOEA 3SK0A 1EX9A 2VATA 3G0DA 5JALA 5CT6A 4B81A 1JJBA 2I03A 2GBFA 4E15A 4OD0A 5AM4A 1W1IA 3BF8A 3FOBA 5JAPA 3H04A 3CN9A 5K5EA 1ACJA 2PX6A 5FRDA 1LGYA 4UPDA 1MNQA 4BATA 3FYUA 2XQJA 5ALPA 4YPVA 3C8HA 4H35A 2P8SA 3GROA 1QE3A 1E5TA 1CUGA 1MPXA 4ZWNA 2FJPA 5AK5A 2CB9A 2HU7A 1DQZA 4Y2TA 1UKAA 3VDXA 1YASA 1M33A 4LHEA 3M83A 5JASA 4W1RA 1NU8A 1GPLA 1HKHA 5HF5A 2AJDA 5ALNA 4EB0A 1GGVA 3AIKA 1MX1A 3OG9A 1ETHA 3QYJA 3DYIA 4U2CA 5IVHA 1RYYA 4JYPA 4ARBA 3SX4A 3R3XA 2QJWA 1CUCA 3EQ7A 3QH4A 2VEOA 5ALXA 1AUOA 3AFIA 2CJPA 1FFBA 5IVIA 4UFOA 4NMWA 5C8VA 3O4GA 3NWOA 4JNCA 3E3AA 1BS9A 4RNCA 2G63A 3FCXA 1JJFA 2HA0A 4DMFA 4DNPA 2GBIA 1XZJA 2C0PA 4CIAA 1K6EA 3HYSA 1ZD4A 5CH5A 5ALDA 3MGAA 3VXKA 4BB0A 1CUXA 4IO0A 5EIEA 4X92A 1QIJA 2XI4A 3NOXA 3IIIA 1YB7A 1HBJA 5DWDA 2OPHA 3DOHA 4XVCA 3H2KA 4GEGA 1CUEA 4QLOA 4N8SA 5EFZA 1XRMA 1XRQA 4EY8A 5K3BA 3BJMA 5AKKA 5C81A 5C8ZA 4WFKA 3QMVA 5AP9A 3O4JA 4K2AA 1LNSA 2XLBA 3DS8A 1XZDA 2VSQA 3H19A 2PSHA 1QTIA 2AXEA 2XUGA 5HF9A 2HDWA 6YASA 1ZICA 1ZI6A 5E4TA 1SFRA 5ALIA 1ZIXA 4CI9A 2ZVDA 1XRRA 4UBKA 3GA7A 2H9YA 5ALOA 4L0CA 4GBGA 3H1AA 3BDIA 1J1IA 1EK2A 2EDAA 3WA6A 3EF3A 1YAJA 3G0GA 2VJDA 4F60A 2H1IA 1KU0A 2XUJA 3WMRA 2WIKA 1QO9A 3E4DA 5SYMA 2PVSA 2WTNA 1EDDA 1FJ2A 4J3JA 1P0MA 4AQDA 2WHPB 5HF8A 4ZRDA 2DCMA 3N0TA 1UOQA 4Q3KA 5FXMA 5DYWA 5HK8A 1Z68A 4Z49A 4BYMA 4H7DA 1XZBA 2VJAA 4GECA 4G8BA 3F97A 1YCDA 3EQ9A 1ZGBA 3IB3A 5AKEA 4JEIA 3FYTA 3KSRA 4B9AA 3HJUA 1L7QA 1WB6A 3UUFA 2B4KA 4GXNA 4J0GA 3WK4A 1XZEA 4U2GA 5AKYA 1CUAA 3V9AA 1VE6A 5AIAA 3LIPA 2VT6A 5CXXA 2XLCA 3R3YA 4FLMA 2XUAA 3FCYA 4Y2VA 3OC0A 1J2EA 2Q0XA 4BVJA 3X3HA 3R3ZA 3H1BA 3B12A 5AH0A 1XLUA 4Y2YA 1P0IA 3D4LA 2XUDA 2XUHA 3C5WP 2GBCA 2I78A 5ALKA 3I2GA 3BIWA 3QMMA 4J0JA 2OCLA 3HSSA 5ALLA 4OU5A 4Q34A 3EBLA 3C6XA 3DOIA 4N5IX 1HDEA 2WIJA 2JGEA 3R0VA 2XMCA 1CUDA 2JGMA 2DQZA 3AILA 3F96A 4BDTA 3M82A 1L7AA 1AMNA 2C5GA 4CG2A 4XX1A 5ALZA 4QWWA 4D9JA 2ZJFA 3DEAA 1O6GA 3WWPA 3WK7A 3WYDA 1ZIYA 1EI9A 2RHTA 4HXFB 1DU4A 1UK9A 2OCGA 2O2IA 3QITA 2HM7A 3P2MA 2C4HA 3V1LA 4UFNA 4LYDA 2QT9A 4K5QA 5FV4A 4B0OA 1MT3A 1ZI8A 1VJ5A 5HKAA 4FLEA 1MU0A 4G4IA 2ACKA 2VJCA 5K3CA 1XZIA 2BUCA 1BEEA 3F9CA 4JH0A 4NVRA 4O08A 1Q83A 5FOQA 4A23A 1AX9A 4F5ZA 4WCVA 1H2ZA 4X3CA 4EBBA 2Z8XA 4NS4A
chains in the Genus database with same CATH superfamily
1GFIA 2F9LA 3HCFA 4M0UA 1G1AA 3AY6A 2H1LA 3TOZA 2O05A 4UBLA 1CWUA 2R44A 2B1JA 3N2KB 4B0PA 1TQ2A 4L8WB 2DQYA 1TLLA 3WIDA 1W87A 2D5AA 4EF5A 2HRRA 3TVDA 2J6CA 4YC7A 2EZUA 1ZX1A 3AUXA 3IV6A 2QEQA 2FK8A 1OXSC 2AR7A 3QKUA 3E9EA 4BNYA 4EUKA 2JI8A 3IJRA 2BH2A 4S1VA 4KX3A 5KNDH 4AUKA 1E7MA 2G28A 1DFGA 1P45A 5IUKC 1NX9A 1R6DA 1R4NA 1RHMA 1LSSA 2HSZA 5AW2A 1A7AA 3KJNA 1W4ZA 3A1NA 4L4XA 2Q4TA 4LRTB 4QPPA 1UMKA 1WDKA 3JVDA 1Z13A 4GZMA 3U3DA 3NYRA 3V4PB 1MAUA 1U6JA 3VYVA 3PRHA 1AS2A 1L6RA 4R0NA 5IYZB 1K06A 4YUAA 3BCSA 3OPQA 2EF0A 4BMVA 1Q92A 4BNDB 4QJBA 4RADA 2CXPA 2KLBA 3GGJA 1E3QA 3TBHA 3GLTA 1KS2A 2WM3A 3FTDA 4OA8A 1NATA 1OSNA 5JBNA 2QVBA 2GEUA 1IEXA 4RZIA 2FJ0A 1ZJWA 1EGHA 1NP7A 2WNHA 3MD0A 3L0SA 4TVOA 3PV0A 3F6BX 2D7DA 3CA8A 1T0UA 3F6EX 3U9TA 4QA9A 2QRHA 3DFIA 1P6XA 3PHGA 5BSKA 1LNZA 2BFPA 2ONYA 3VVCA 2QL5A 2ZIAA 2EYQA 4II7A 2JFOA 1RLJA 3GLRA 1C7FA 2BHTA 4CLRB 2ORIA 3GWGA 3HYCA 1CZHA 2N1BA 3UBTA 1CEEA 1GXSB 2I71A 2W11A 3P9KA 1M76A 4MR7A 5T8KC 2YHAA 3QMPA 4CKBA 7MDHA 3A4IA 2I66A 2IVZA 3R0JA 2IF2A 1G5RA 1VIAA 1HLGA 1VG8A 2WE7A 1U7WA 3SZGA 2NSLA 2P0YA 1KK2A 3WP1B 4ZK6A 1WB4A 1L5FA 2AOUB 4PQYA 2OQVA 5KWJA 1DT3A 3GZNA 1Y7TA 1V39A 3JWHA 1R0SA 1NN1A 4G0OA 1C0KA 4H6VA 3WE7A 5FULA 4DTCA 2ETVA 2WDZA 5AHKA 3W2FA 3ADBA 1LBQA 1SBYA 1IQ0A 4LOHA 4E2WA 3AR2A 4IJKA 4AX8A 4JKIA 1OXTA 4L4SA 4CKCB 1YFLA 1BZYA 4QO8A 3KSUA 2X0FA 1UBCA 4AMVA 2GPYA 4D92A 1B4DA 3IEIA 4DQUA 3RK1A 1NW4A 3FYDA 2F3TA 4MV7A 4BCBA 1IQRA 1NVTA 4F4DA 1Q1AA 3B38A 2SCUB 3DLIA 4JC5A 3ZV3A 1NG9A 2I9KA 4S1OA 4CQNA 2GN1A 3HVHA 1HNXB 3DW3X 1A9XA 3T7KA 3KEOA 3G68A 3G9TA 5LQKA 4RDIA 1WCYA 5BSTA 4BVAA 2XJ9A 2QMQA 2AA3A 3D5EA 5F5NA 4DM7A 4CEJA 4XVHA 2VF7A 2HU5A 1E2BA 2XGMA 3NHPA 4HKTA 1UXOA 4RTMA 5EJAA 1YDWA 4J49A 2PUTA 3AGQA 2DBRA 4EMSA 2IHKA 4BFUA 1EFCA 4IHJA 2H0AA 3I05A 2X2EA 3KPVA 2EHDA 3MTQA 4P36A 4QSMA 5FLKA 4KAAA 3TCNA 3UAGA 1E3SA 1YK0A 1ZQ9A 2KS6A 5JHHB 1WXIA 2A86A 1USKA 1XNHA 2ZIGA 1S1MA 5F4ZA 4G5OA 3KTAA 3DDUA 4S2EA 1NMYA 2QROA 2DFVA 4GS5A 2P2CA 3GFFA 2VTVA 3V8BA 1CR4A 2HXYA 3I52A 5K2MA 2FE1A 1GN9A 3ZUPA 1RVDA 3DC2A 4WBNF 3DEHA 2GYVA 3F6RA 4LDZA 4LJSA 5A7HA 5HP4A 3G9XA 2DFPA 3Q2KA 2WTBA 3DE5X 1KY2A 3MF4A 1IHUA 1O97C 4N6NA 4GIBA 5HQ3B 1AA6A 2GXAA 4AMZA 4M53A 1RD4A 2WHYA 4FD2A 3BB4A 1XO1A 5LP6F 3GUCA 5G2OA 1JU3A 4JGBA 5CNKA 1EVLA 1PWHA 1M6EX 1E8NA 5DO9A 3QLVC 4MI9A 3QWIA 1SQGA 4NYMQ 1GCAA 3OKCA 3EE6A 5C37A 1F6WA 1JRLA 4LJ8A 4CLRA 1QGAA 1W88B 1E77A 2PU7A 3W3AD 3TW8B 1P9NA 3UHOA 4K9SA 3R8XA 3JPYA 4ETNA 3FD8A 4LHVA 4OYLA 5IH7A 1ZRHA 3TGWA 5C18A 1EUDA 2OUIA 4NCXA 1N2XA 1GRQA 3DB2A 1T3TA 3PGVA 4CMHA 2PEZA 10MHA 3NHFA 3C5HA 4KR6A 1O9HA 2SKCA 4IEIA 3IUNA 3SOPA 3OY2A 1OD6A 3GG2A 1U1EA 4OFBA 4XR9A 5DEIA 1H9BA 1XDWA 2PL5A 3ZD8A 4XYLA 1V3UA 3LO8A 4FMBB 4CEIB 3GNSA 3WK5A 4JKOA 5A4DA 3AKEA 3KZVA 1T9GR 1P5HA 1KQPA 3C16C 4M6WA 4UHCA 4Y0VA 4CVNA 1EQAA 4EA9A 4YCBA 2W6QA 3EC2A 1XN4A 1KMCA 1X1DA 3MCZA 3BXHA 3LIIA 5I4BA 1F0NA 1ID1A 2ONZA 2OV6A 3TD2A 2DFKB 4B71A 1NN5A 3B1ZA 3MUNA 1JKJB 3G0HA 4CMAA 3ZV6A 1LW6E 4RMJA 3A28A 1ENOA 4OO3A 2C4MA 5EJ7A 4I4LA 1CF9A 1JX6A 1J5EB 4AZ3B 1HV8A 2AQIA 3JQ7A 3EXFA 2IXEA 1KE1A 5KTKA 2ZPTX 2HCRA 3OECA 1H4SA 3ABIA 3OTHA 1Q6ZA 1K98A 4JKYA 5JARA 2C58A 2P6UA 3TWOA 4UUOA 2VP9A 4Q7QA 1G3IA 2Z30A 2NADA 2FQ1A 1OQAA 1LFAA 4DYVA 1I3OA 4BE9A 2GCOB 1KMNA 5BSRA 5IZ4A 3DTYA 3O4IA 1E2EA 2ZI4A 4EATA 2ZU0C 2GAFA 3B53X 1E1CB 2BP7A 3JARB 3X44A 3H5VA 1J8QA 1XVTA 2OM2A 3IAM1 4MI1A 2JH9A 3A1SA 2XUZA 4MULA 1R3UA 2BVNA 3RDPA 3S7ZA 1EFKA 3PQ4A 4WK6A 3TTSA 1Y6JA 1MC4A 1OYOA 3U40A 1QHIA 3UJ6A 3NVKI 1X80A 1RCFA 4GD3Q 4Q3OA 1NXVA 2IY8A 4RSHA 5I7EA 4XPIA 5LMCA 3DMDA 2FRVA 3G2KA 4R8KA 4PNEA 3VNVA 2W2OA 3OT5A 1Z0SA 4X8MA 3S2ZA 1EQUA 1SVKA 4FYKA 4RACA 4OQMA 3QBEA 2QA5A 1XCJA 4E5KA 5B2FA 2F8SA 2C4TA 1GA6A 3BGOS 3DZHA 4DQLA 3LD9A 1V8FA 1NUTA 1QFXA 2ANCA 2H0QA 4Q1CA 6LDHA 3FLMA 1Z4QA 3LFHA 3VR2A 2XAAA 3Q0TA 4TMXA 2IHJA 4BVFA 1K3TA 3U4CA 1EWVA 3GVHA 3OX4A 4OCZA 4ZT3A 4BFLA 1Y8ZA 2QM7A 1PUXA 4X7MA 1WL8A 4RQBA 4WESA 3KWMA 3FGPA 3FMIA 4XJXA 2Y9MB 3GFOA 1BEZA 4D3SA 1EDZA 2PU5A 2FPPA 4YDSA 3TDKA 2ZZNA 3WY9A 1YQWA 1J9ZA 4RCVA 2CFTA 2XWQA 3LU1A 5HSGA 4F56A 2IYAA 2NUPA 2PIDA 4KJZA 2XCQA 4BQPA 1W0KD 5EHQA 3U80A 4AN1A 1T3SA 4J6FA 6GPBA 1QLHA 4YDHB 1U3DA 4OB6A 3TM5A 3ZQUA 1U8EA 4AIIA 2BPOA 2ETXA 1TT5A 4HMQA 3WK8A 1D1SA 2A5YB 3MGBA 2F43A 3TQQA 2GJAA 2ZROA 3DUWA 3RIEA 3WAGA 1T10A 4V0MA 3JSXA 2EQ5A 2FHSA 2MR5A 1LDGA 2PKQP 3WLIA 1QHFA 5EE5B 1Z36A 1YS6A 3DV0A 3KT6A 3SOZA 5LIPA 1M2EA 1NWHA 3ZU3A 4BMSA 2XW6A 3FHLA 2G1JA 3G2HA 3O26A 3ZD6A 3EEOA 2YIVX 2XCLA 1J07A 3D7SA 3IT3A 4LZOA 5KSWB 3ONEA 1RQLA 4M99A 1P4AA 1DKMA 4F1KA 1E9FA 1I6WA 4GVPA 1SHUX 4AJNA 1V3VA 4BP3A 4BQEA 4XIYA 5JECA 4J0QA 1TPYA 4KKVA 1OWOA 2Y05A 3HP4A 2QSYA 2WFLB 4WZZA 1TQ4A 1LDNA 1PU2A 4QE3A 4JJKA 1R6XA 1R0XA 3K16A 1ETUA 2FZEA 3WYGA 4RK5A 5KYXA 3PTAA 1GVHA 4TYMA 4EEXA 1HQKA 4KACA 3R6WA 4KWIA 4ED9A 1BE8A 3RS4A 3TSYA 1SRRA 3P9IA 7REQB 5A4MS 2IS6A 1RP1A 2V59A 2C88A 2W9XA 4UMFA 2EVWX 3ZLUA 3D4IA 3AETA 2WVGA 3O31A 3T06B 2RJOA 1SJ9A 4AZ0A 1DVRA 3IA2A 2BGTA 3K6SB 2BMAA 1ARZA 2Q5IA 4NXNB 2VRCA 4EO7A 3SJUA 4Q1FA 1JMVA 1OV4A 1JHAA 2RD2A 4RBNA 2NZUG 3KZMA 1TQHA 4WOCA 5U9CA 3MAGA 4YGXB 1AS3A 1GNRA 1I2MA 1MAAA 1RACA 3FTPA 3P9RA 1OIVA 2ZRKA 1VIDA 3LZCA 5AK0A 3TTTA 3IP7A 4D8WA 4N3GA 2ZTMA 3G9QA 3I6YA 3OUTA 1RQ7A 4FEEA 3RWOA 4RW0A 2PM8A 5DNVA 4IXNA 1GPDG 1Z38A 3R5KA 5GZ6A 3R3VA 5JH7B 1FMJA 2WG2A 3ONDA 3USZA 4DHEA 4C3UA 1FYEA 1HDXA 4MS1B 3IUMA 1XQ9A 1MORA 1JIVA 3RIMA 4A36A 2SKEA 4G0VA 4G9EA 4PXAA 3NHUA 3RSGA 1TA0A 3QWFA 2PLAA 4N01A 5CK5A 4HFJA 3I2JA 2K6GA 3UAWA 4MXDA 3VUEA 3S8YA 1VMKA 3AEUA 3I2HA 3RC1A 5C8YF 5CK4A 4WKCA 1GQSA 4I6GA 5LQSA 1JDTA 2UV8A 4O1IA 4D5GA 4UVEA 1X7HA 2ACVA 1LQTA 2JFWA 4FMCB 1QWSA 3AESA 4LE2A 1TDJA 3DOEA 2FLWA 4D9BA 2EWVA 4KXWA 1MZPA 1OBFO 4OJTA 1IN6A 3H9GA 5A4IS 4Z4QA 3WNCA 3LPNA 5HTOA 5BWNA 3FF1A 4ZEOA 5K9ZA 4WNIA 8ATCA 5ELMA 3NBAA 5JV5A 1Y48E 1TU4A 2O8VA 3QG5A 4KN8A 3BH0A 4EMBA 3LLMA 3OJEA 1C30B 3Q15C 3HV2A 3FPFA 3SYRA 1H0RA 3M6UA 4O4JA 1C3EA 3ZE2B 1XYVA 3CPJB 2Q1YA 2QY6A 1GRNA 1Z2AA 4PVDA 3TE7A 2CV0A 1XE3A 2QDKA 2BF4A 1Z33A 3NAGA 1RFLA 1LSUA 2WMOB 1VIVA 2AOTA 4IDPA 5C4MA 3TX2A 1FW8A 2G0TA 1PS9A 4G81A 3JAMA 5AW9A 3HYRA 1YRBA 3U3KA 4K40A 3U81A 1JI3A 4Z0NA 4MK4A 1L5WA 3V2IA 3S70A 5T4HA 3AUJB 3E5HA 2XKKA 1BDIA 2V7EA 1GFSA 3DZBA 1DG9A 3LGXA 1OH7A 2EW1A 2PR7A 3CY6A 1TUIA 3HI6A 3HDJA 4YAOA 1DCMA 1US8B 1V1RB 1QMGA 5EIBD 3RIHA 3AM1A 1OWPA 4FFLA 5AVUA 1Z45A 1GITA 3LYUA 4KAXA 4MYHA 1HFEL 1OX5A 2R7LA 2BGRA 1NJGA 1NY5A 4UKDA 2JGNA 1XDZA 2JEOA 4MEBA 5F3RA 3PC8A 4B3SB 1ZN2A 4M1YA 4NBTA 3WX0A 4AMGA 1GR1A 1ZNZA 2VRWA 4B3GA 4H7HA 3VKHA 3FHCB 3Q6IA 3GVPA 4RGQA 4O4HF 4MQ4A 5EPUA 3WLEA 4BLTA 1CIPA 4C6HA 2W00A 4N76A 1DX9A 1COZA 2WP0A 2XECA 2NTEA 2OE2A 4KLZA 2H17A 3L7IA 5L7YA 2D0DA 3U56A 1F38A 2C3YA 3EY9A 2UUOA 3HDTA 3F6SA 3P45A 1UK8A 4OGLA 4RJLA 4TZ0A 3VTFA 5ALFA 4HQFA 3VYUB 4NDNE 4D57A 1M10A 3PYMA 4B3CA 4B9EA 7ABPA 4AYWA 1L5LA 5CUQA 5IWCA 1SXJA 2NTNA 4OHCA 2Z2ZA 4JUCA 1EFRA 2PV7A 4YJ2B 4F6RA 3TB6A 4ZHQA 5BYJA 1ZN8A 2GAJA 2VJKA 3BHJA 4ZQBA 3KQUA 1ZRMA 2VP3A 3JVVA 2ONJA 5BORA 3RS0A 2JCXA 1M0TA 3L0DA 4L7QA 5IM5A 2E4XA 1E59A 4IRUB 3HA3A 2CFRA 2FP3A 3H4VA 4X8LA 1CBUA 3PQFA 1ZJ6A 4OQEA 2ZR7A 8ADHA 1NQUA 2AZ4A 1U7XA 2BGJA 2JIMA 4F71A 4FGWA 4P93A 2PL9A 4QBFA 1ZMRA 4YLEA 5FJJA 1NQVA 4PAMA 5IMSA 1DWOA 3OEWA 4BUZA 1T4MA 1HG0A 1UKBA 3GGPA 2QGFA 5G4KA 2R1TB 2X5XA 3FUVA 1B93A 1XKQA 5JS8A 3FCEA 2YWBA 4V02A 5DLPA 1LKZA 3LWBA 5IDXA 2I87A 3ZE0B 2WHQA 3TQCA 5HS6A 2Q4DA 1SC9A 2O57A 4WX2B 1L7BA 3G5TA 1NVUQ 3O9MA 3I30X 3ZU6A 2Q3LA 4TYPA 3ORSA 1LTKA 1NTRA 1G7CA 4L4RA 4LXYA 5ECYA 3SHOA 3T7EA 3BHNA 2GVNA 1OWMA 2IY9A 2AQKA 2QXTA 1XZ8A 2FUKA 5C5CA 4G24A 2IH2A 3ZGXA 4K9RA 3DBOB 3SBDA 2W4IA 5A4FS 2QKYA 1TCVA 3C3YA 3HGTA 3VVMA 4TN5A 2QR2A 1BO6A 1MC5A 1GLNA 1Q0RA 4ZQIA 4KV7A 3FYSA 1YB2A 1Z17A 2VN8A 5K1ZA 1V7CA 2AZTA 3DD1A 2X86A 4OYYA 2IWRA 4HAIA 3KQMA 1A9YA 1U90A 3SYLA 3C3BA 1MB3A 1WCIA 4M0FA 4P2BA 3MHTA 5JWOA 2GPNA 4HWKA 4ZT2A 3KHTA 3NIBA 3B2EA 4J0KA 1OLUB 1YI1A 4YAKA 2ZRNA 4ONEA 5EXTA 2HDOA 3G8YA 4UPEA 5JDCC 5JPCA 3MCAA 3RRJA 1N0UA 2EFDB 2Q3MA 3GPBA 2OFFA 4DR1B 4IXMA 4IG9A 4GAEA 3VH1A 1MN6A 3IDZA 3N74A 5L3RA 1KZ1A 2ZRIA 1A9XB 1QIHA 2CCJA 4HWGA 3ROZA 5E9JA 2GN4A 3F9RA 1HDZA 2B21A 2QUAA 3T54A 3TR5A 1QRTA 4NCKA 4HMOA 1D07A 3QY9A 4AZWA 1QO0D 1AV6A 3MA0A 2VYQA 2VK4A 2VT7A 4JX8A 4Q1AA 1KPIA 3ISVA 4HAZA 3W1EA 1C9NA 3TQOA 4LVCA 4N0MA 2VJMB 2ZRQA 4WNAA 1N4AA 3RUCA 1NW7A 2QTGA 1RJGA 4Q3BA 1JLRA 2QM0A 2NNWB 3L8FA 3JQEA 4HNAA 4JIMA 3EOAI 4R2WA 1KQFA 4ZPXA 5C3UA 2FOIA 3R9IA 2JA1A 4W8OA 4EI7A 3BCRA 1BCSB 1M6NA 1TLFA 2C8KA 2QT0A 2YNMD 3E15A 4NZZA 4IRXA 1GQ2A 3CU5A 5C7IO 3Q10A 1T2EA 4WLFA 4RXMA 3GJQA 1HURA 1PEDA 1Y3IA 3Q6MA 4E13A 5KTRA 1H5NA 1Y7HA 3FNEA 5EHXA 4ZMRA 5KYYB 2ENUA 5HBRA 5AK3A 3RVSA 4C06A 3B1KA 1ZVKA 1TK3A 3OU7A 4Q4HB 2CL6X 2PRZA 5EZYF 3TCKA 1S8OA 1Z0AA 2JIPA 3W05A 3WLTA 2VOEA 2BR4A 2ZWAA 3RWMB 4Z5XA 5KCZA 2CFSA 3BQMB 3Q7QA 3EVAA 1MA3A 4OJKA 3E5MA 1L5SA 4U8GA 3AM3A 2OCKA 1XAHA 2AWOA 3FSEA 3IP1A 3SHVA 4RTSA 4B73A 4HUQB 4PZDA 3SEAA 1R37A 4PRLA 1OFVA 4DCGA 1PJ2A 5BPFA 2BM8A 4EDFA 3WLLA 4B8WA 1P2GA 3HEAA 2P67A 3L6RA 4HQ0A 5JD4A 5AJVB 4AJHA 4DUPA 1EFVA 4N7RA 2CHVA 3R6LA 5H4GA 3IDFA 2ZRCA 3UC9A 5FAKA 3M0EA 2VPPA 2NSYA 4KQJA 5AMXA 5GPBA 2Q5OA 1HGXA 1IVNA 3GEMA 2WWIA 4IUYA 1UZNA 2O9JA 4IIFA 4LDJA 4NS1A 5EVJA 3U4HA 2O1XA 2ZB8A 1QFYA 2XZTA 3NM5A 4IH4A 3QBVA 3B36A 1EIWA 3SIXA 3DL0A 4N49A 5E2AA 1NQXA 5J1TB 2HWXA 1PZXA 2RARA 1TF7A 1R0ZA 4U0KA 2R47A 4O59O 4URXR 1PSZA 5K0BA 3UG6A 2O2HA 2ZDQA 3BMNA 3CPEA 3CZQA 4DCUA 3OP4A 4CGYA 4A91A 4KCGA 3HXKA 4BO4A 2LIPA 4V0ME 2VSYA 1F4LA 3DAGA 5CB4A 1P4SA 2NV6A 5HOQA 1G2OA 2E3JA 2P1RA 2NGRA 4O1MA 1QG2A 1UP6A 3PCXA 2V7UA 4U5XA 1CZUA 5LB2A 2FUG1 1G5PA 3E53A 4FS3A 5HF6A 1MGPA 5LJIA 3L7NA 1JWLA 3ETDA 1P61B 4KO1S 5E8JA 1QB7A 1RVV1 2AE2A 5K8IA 3FB4A 3G0CA 4U9HS 5TS2A 5ADWA 2DPMA 2ZZKA 3SS8A 1GPWB 4X85A 3DKVA 2RGUA 3GFGA 4N3CA 4F2PA 1KVTA 4TTSA 3MB5A 5ALEA 1TK2A 3VR5D 4RK1A 2A57A 1L8OA 4LY6A 5LYJB 1EQ2A 3QSYA 1CJSA 4UM9B 4QVIA 2K4MA 1EEXB 4IIYA 4IL5A 4L51A 1L5VA 2B7LA 2ZTSA 1LW7A 2C9CA 3EY4A 4ZOLA 5EPOA 4B2LA 5I8PA 1FXUA 2NTJA 2O14A 3TI7A 4QYSA 3UUGA 5CA1F 1NIPA 9MHTA 4FFBA 2WM9B 4RMNA 2CXSA 4L0QA 3Q8XB 3SE0A 3V8PA 1W29A 2Q5FA 3D2CA 3PHBE 2CF5A 2JD1A 5C5EA 1J0DA 1D4ZA 3WKAA 2OCAA 3HQ4O 4ZQGA 5IULC 2XYRA 2KJQA 1TB4A 3ZXYA 1A0OA 4YUXA 1B2RA 3AB3A 2AXPA 4PZAA 3K8ZA 3CUWA 4ZVRA 3IBYA 1O5OA 2V8OA 4HNGA 1KDTA 3EVFA 4YK7A 5TJ9A 4BB9A 4ENWA 3CC8A 2FW8A 3H4IA 1U63A 4C0WA 2NTVA 2IOQA 2OENG 1GYRA 2FEXA 3K8QA 1O94A 2YC2C 3CONA 3EG9A 3D43A 2QX4A 1G60A 1YFKA 3H2SA 3DE0X 2RGGA 5I3CA 2VQDA 1UDRA 5DTMA 1HEUA 2FN7A 1Z15A 2DQSA 3IMFA 5L3SA 3I04A 5DHFA 1SCAA 1CVLA 5EGNA 4BEJA 1HFKA 1KY4A 5ESWA 4D9MA 5L4LA 3U7GA 1HDOA 1G291 2PZLA 5LQAA 4C7OA 4CR7A 2VCYA 2ZBVA 1KFJB 3NTRA 4MJXA 4WMLA 5JMPA 1FE8A 4OH1A 1FDTA 3UA3A 1U9JA 3T4EA 4MIKA 4HBGA 2CC2A 3CVVA 4IKOA 4H7FA 2I7TA 1OU4A 3COYA 4TMZA 5DM2A 3GT4A 1HWYA 3ZIAA 2X6QA 5KNBH 4OI0A 4KXNA 4MUMA 1GNQA 1WQ3A 3EZ2A 1JPUA 2ZIXB 3OHPA 3IIMA 4XOIA 3MMZA 1JR4A 5BW4A 2QTRA 5CURA 5KWIA 2Y4NA 3IOYA 2OHFA 3KHSA 1MW9X 3O84A 2BBSA 4F2HA 4QWMA 2X6TA 5M7EA 2OK7A 1OAKA 5EYPA 5ICSA 5FUQA 4KXQA 5LUAA 4ETWA 5AJUA 2XIQA 3JWIA 4MVJG 4UQPA 4DLRA 2R7AA 3FCAA 4DG8A 3E0QA 4IO1A 4MRNA 1I7LA 3HZHA 4ERXA 3DV9A 4QLAA 1LLUA 4IDHA 3GJ5A 3FHOA 4YRZA 3R24A 2W37A 2ZUBA 2D7JA 3G5LA 1CFZA 1Q0HA 3UPTA 2B4YA 1WEHA 4NCBA 4GEKA 4Z8XA 3IXLA 4ND3A 1ZD3A 4ZCPA 5CFMA 3D8TA 4DJ5X 1Q0ZA 2G36A 3QVMA 3WRWA 2JHPA 2ASVA 3CKMA 2J7KA 4A03A 4DE5A 2IYYA 3K2QA 1MJFA 2A0UA 1M8FA 2V45A 4QOSA 4UBNA 2XVZA 4YLGA 1O58A 5EIHA 1KEKA 2Z6AA 2XAUA 4MB2A 1XHFA 2C5AA 4H9GA 3KC2A 3UOAB 1MIOA 4D45A 5BR4A 1AK9A 2LRHA 3W5VA 2RONA 3IVCA 1D8TA 2VAWA 4U8HA 2GJ9A 3RBZA 4R1SA 3YASA 1SU4A 3DQPA 3R7LA 2ZJAA 1XJQA 5IAGA 5ANRB 1BE1A 4AP6A 4K8RB 2PJRA 4EW2A 4AXXA 3GVIA 2G9QA 1E2PA 2J0VA 1WU8A 5ENDA 5REQB 2XQGA 4DIDA 5I7AA 1TKCA 5EEHA 2QN7A 4P53A 1LF0A 2HEIA 4G0PA 3HKBA 1JHVA 1M8GA 1RDFA 2JKZA 4G07A 3DPSA 1FZQA 2RGNA 4UHFA 5D1NA 4RULA 1SOWA 2QMUA 1K27A 3OE5A 3QU9A 1J2JA 4EJ2A 1XXHA 3D6HA 2CK3A 2R8EA 3LUDA 4LNUB 1C7QA 2FV8A 2P6PA 3Q3VA 1P9RA 1RC0A 5IM4F 2BKAA 2R1ZA 2QLLA 3L46A 3QM1A 4ZVLA 3IRVA 2IEGA 1NLMA 1X9GA 4CI0B 3V6LA 1M5UA 1U7DA 3V7NA 1WUTA 1JQLB 3DBHB 1SXJE 3KS9A 3K5PA 1E3LA 1TA9A 1W8DA 3WIEA 2CHGA 3EGCA 1E7QA 4ND6A 3BWDD 2DF8A 1FX0A 2J6HA 2XHZA 4OGGA 5CW2A 4C6RA 1N2CE 1HDYA 1MCZA 2GQ0A 2JLRA 2ZUVA 3C7AA 4MQFA 1I3LA 5HCIA 1ZOOA 3KL4A 2G0AA 2IV2X 3MUFA 1CULC 1T0IA 4H1VA 3UK0A 3C2QA 1DBPA 1V11A 2OMKA 3A4LA 4FXPA 1QPZA 1YJ8A 2NV0A 4A0HA 1K7SN 3IVRA 3EGOA 3I5XA 5EHGA 2EL9A 2P4UA 4H0CA 1Y1RA 3SF8B 3WBBA 3LFTA 5JAUA 1JG1A 3G0BA 1CNEA 5KOYA 4HUJA 4REQB 4YDQA 3TZ6A 1P7WA 4KQMA 3GV0A 3BIJA 3GRKA 3FGOA 2ZPAA 3PEVA 4Z2AA 3PR2B 5HRUA 3JX9A 1M8PA 3O7WA 1PFUA 4PCAA 2QN1A 1CQIB 3D6VA 4WUTA 1POXA 4U7JA 4YRNA 3U13A 2I7DA 3HN7A 2BGNA 4LOAA 4FQ7A 1U9IA 4V2IA 5DM1A 4MVJM 1WTCA 1SKUA 3SC2B 1DKPA 4HTAA 2Q6TA 1ORWA 3K31A 4DRYA 2NO4A 1W6RA 1R0WA 3EF0A 4HWRA 4DABA 5A5GA 1B74A 3R44A 2PNJA 4IQGA 1G4HA 3K32A 3OOWA 4B6EA 3KNZA 1JPNA 3VKVA 1U3CA 1DMSA 3HCEA 5A3VA 3KYCA 4N40A 2OZKA 5AKIA 2R7KA 5H5JA 1G63A 4YB8A 2Q07A 2DHQA 2PRJA 3D7RA 5ALMA 4BMDA 4CUZA 1REQB 2QTNA 3VAZA 2JC3A 1WUIS 2W70A 2EP5A 1ADYA 1Z75A 3ON5A 4CFZA 4XWKA 2O0JA 4IP0A 4DUZB 5I9SA 1CY1A 3CF0A 1K9SA 4B17A 4F6LA 5ALUA 1YE8A 1H2EA 1C7RA 2GBLC 4Y30A 1V4BA 1UBMS 4ZARA 5DHUA 3VHXA 3MLAA 2XUQA 2JASA 3O38A 4Q6BA 4DIUA 4C4XA 4YMTA 1HRDA 1FB5A 2IE8A 3FWKA 3QEMB 4W5JA 1AV7A 2WKWA 3F4BA 5EL0A 3NMUF 3W5AA 1K6MA 4U5QA 4TKMA 2HUNA 3RHSA 1R50A 2NO0A 3UMSA 3WL4A 1FYVA 3C6KA 5AHWA 4DOMA 5AVJA 2HDHA 5GTDA 2HL6A 1RAHA 3O93A 1I2DA 2ZSFA 3GEDA 5I4KA 4AS1A 1T34A 1WHSB 2VIIA 2YY6A 2W48A 3ZX4A 2ZBRA 1LJ8A 5FWXB 5LZ7A 2IZ1A 1QAQA 3FNIA 3SEFA 4EPYA 5K6RA 1WBJB 1XQWA 2FSVA 3CF2A 4KLNA 5I48A 4F9TA 3M6IA 1D04A 3UG7A 1HRKA 5FR1A 1BWPA 4MNTA 1DC5A 3V42A 5BXQC 1QH1A 3RYTC 4DV6B 4OGKA 2WY2D 1JW9B 2DJ5A 4H6WA 4TXJA 5A5DA 3GRFA 1K6JA 2WJJA 4XDHA 4HY3A 4RL6A 4AY6A 4Q9IA 3PQ5A 5AKZA 2ODEA 2HEGA 1UFVA 1GNPA 4JWKA 3IAAA 3FOFC 1DCKA 4D26A 5IKPA 4MW5A 1W5BA 1E60A 4U4AA 4CU5A 3R3WA 1RKBA 1TNDA 3FZYA 4Y6OA 3SZMA 1KBZA 1V3TA 1SOUA 4PG5A 4Z0TA 1TTPB 3N0RA 1ECBA 3UHPA 3ZD9A 4A8JB 4D5EA 2PBLA 5JSZB 1DIOB 1IY2A 4AC9A 3QA9A 4DANA 2DX7A 2V4UA 3K1YA 4CKYA 4ZCMA 1NKSA 3PLRA 4PWYA 4E12A 1NA5A 1E9VA 4ZMBA 5JMOA 2XXAA 4LX0A 1MB9A 1U5CA 2GHIA 3CTPA 4RD2A 4PO3X 3MQ4A 3EWAA 4AICA 1A82A 3NBUA 3GRYA 5KAPA 3QLUA 2BLLA 5DASA 1K8YB 2B1RA 4FSHA 2W2LA 4J91A 2I7XA 2ZYVX 2BKLA 1NZFA 3IIJA 3QX8A 1PTJC 2YVLA 4HPXB 5DNUA 3UJBA 4HYQA 1VLZA 1WW8A 5CXQA 1U02A 3H7AA 2BGMA 5CVTA 1ZOSA 4C5AA 3P0JA 1K5DA 1CUUA 1XD8A 2R68A 1S9DA 1CUVA 3PVSA 4UDYX 4BLUA 7YASA 2R1VB 1PT9A 3K0FB 1BXKA 1WPGA 2GAIA 4UU0A 5DTRA 4ZT6A 2BM0A 3H2JA 4MWGA 3FKQA 2NU7A 4X8OA 1OI3A 3U7JA 1QP7A 5KBYA 1VHLA 1YA8A 2VP2A 3L7LA 2WIBA 1Z4KA 4YR7A 1KDPA 1ZCZA 3IPLA 1JDPA 3MMXA 5KQRA 3PHHA 4D6XA 3BD9A 3T9FA 1Y9ZA 1KKMA 1LRLA 3IP5A 4IIJA 1QTNA 1N6HA 1NT4A 3GUVA 3MCWA 3WR5A 2VTBB 1DEOA 4JHLA 1EFPB 5BY2A 1ZAYA 4YAWA 1CC1S 2IOFK 4KN5A 2TYSB 4UUNA 2YVQA 2ZXUA 1THTA 3IPAA 1YA4A 3C6BA 4MUIA 3T5CA 2I2DA 4FCCA 4BN0A 2XZDA 3LTNC 3DAYA 1L5YA 4MP6A 5K4AA 2FWNA 4YTEA 4D4KA 4YQFA 3TZEA 1V1MB 1XU9A 3Q1LA 4XLLA 1SQ5A 1JLSA 5EINA 1E1QA 2YCLA 2B0JA 1K5GA 1OWNA 1TM7E 2XUOA 3BXXA 3QVXA 1FP1D 3W5UA 3ND8A 1UBUS 2VUUA 1U7ZA 3CLTD 4HGOA 4AWBA 5MDHA 1K6IA 1NBIA 4ILKA 3WHLA 4LXTA 1ZH4A 1FP4A 1WXXA 3ACCA 3GUZA 3B51X 5ILQA 3ZXUB 1A3CA 3C15C 2ZP1A 1WWKA 4FQ8A 3U1TA 4M9QA 2V74B 4UREA 4F38A 3KETA 1QYXA 4TL9A 1AU9A 4ENUA 3UV7A 1MQ9A 1TD9A 2A0XA 3CPHA 3GQBA 2G80A 1ORRA 1JIKA 1SBQA 2WJPA 4IINA 4MWEA 3I9V6 5IXJA 1B1CA 1KERA 3R7BA 3LXMA 1HG1A 1BXRB 4X60A 3VR2D 1UKEA 4EKDA 5J4VA 2I2XB 3K53A 1PS0A 2OV3A 4Q02A 2FZKA 1JFRA 1QVWA 2WAAA 2WIFA 3ADOA 3CPSA 3LUJA 1N6RA 3HHPA 2Q0QA 3O4HA 3GJRA 3QENA 3QXGA 5EHNA 4PHCA 1Y33E 1Z5ZA 4B48A 4E03A 1ES9A 5E3IA 3ND6A 4LBWA 4KSYA 1H9CA 1H85A 1XQXA 4RE5A 1NT2A 4FZ5A 4HNHA 1ZMOA 3ZKWA 4H77A 1I2BA 4P82A 4MDYA 3IUBA 3JYPA 4AUNA 1E0SA 4L76A 4KE6A 5D1HA 1GAJA 3VR5H 2LDBA 1M8KA 1JDVA 3U7FB 3DGEC 1M1NA 2WZCA 3ZJVA 5BWMA 3E5NA 5T4BA 1J21A 5AWFC 2GBGA 1MXHA 2OILA 4LA4A 1UBEA 2WJGA 1NSFA 3C8UA 4HX5A 1EGQA 1HQDA 4GWLA 4QATA 1FY2A 5BN3A 4HD8A 1J7KA 1AKMA 1UFOA 5KI6A 3T12A 4F72A 1JUDA 2G8LA 4LRSB 3OX1A 2WSIA 2XA2A 2O2EA 3GBSA 4POAA 3AONB 1B76A 3AP3A 1U99A 2JLQA 4JI3B 2ZRHA 1UZLA 5EJ4A 1HDCA 1ONOA 3AHEA 2OGTA 4J6EA 3CLUC 3V00A 3GJ0A 4HLQB 4RTRA 3HRHA 4TTRA 4AROA 1X77A 2OGSA 4UHKA 2H52A 3OIVA 3PXGA 3U16A 1H8HA 1OGYA 4WXHA 2NX2A 1CR6A 1DBQA 3QXJA 3R0XA 3LWZA 1HE5A 3K1AA 3OJFA 2V7XA 3PJFA 3PQ6A 5F2OA 2AI2A 3TRKA 5JZVA 3CLRD 4OM8A 2F4VB 5ILGA 1GTJ1 2C2GA 2IHBA 3LA6A 4L72A 3RHZA 4PIPA 1X92A 2VRCD 4AY4A 4BB5A 3THXB 1TEZA 2NPFA 1NXXA 4I50F 3ZGOA 3ES9A 1IOWA 3THSA 2HK9A 5TJHA 3E4CA 5U4QA 1RWBA 1VJ0A 2OP1A 2K7FA 1JGTA 1LVHA 3AF2A 4E46A 1TO2E 1UR5A 1YRQA 5FAXA 3UJ3X 3WKCA 4DEVA 4D41A 1KS9A 2ISSD 1C9JA 5HRCA 1NMSA 2OT3B 3B3AA 3HBJA 1ISGA 3ICOA 4KG7A 4WDRA 4I81A 2I1VB 4OSOA 1VLMA 2DY0A 2ZUTA 3D4PA 1OUMA 3GLIE 3ZD7A 1HE2A 1VHJA 1B3RA 4RY9A 2E37A 4CV3A 1J8VA 2NVOA 2QZJA 3OMWA 1T2NA 2GO7A 1ONBA 2C2ZA 3UXYA 2FOXA 3TINA 1VTKA 4L74A 3BOSA 1BROA 1CUYA 1LK0A 4XGKA 1HLFA 2LUOA 3FH0A 4YWJA 4KIUA 3RFUA 2XQVA 4BVEA 1SB8A 5HZMA 1J20A 2Q21A 4MGKR 3W4IA 4FP9A 2WC1A 2UYYA 3L0PA 4JSYA 1CEYA 2FZGA 4ZVNA 3FRJA 4W99A 4GQAA 1L1FA 4BLOA 1PWEA 1EFLA 3DZGA 2BCGY 4KBYA 3RK4A 5CJ2A 4YP7A 3TR0A 3IESA 4NE9A 3QPDA 3RHTA 4RAQA 4BKUA 1V6AA 1Q11A 421PA 1XNQB 4DLKA 1P1JA 4AKEA 1ZMBA 2J5XA 3BXEA 4BGVA 1FQWA 3BVPA 2I6GA 2AMFA 2ZUFA 5NULA 3BD8A 4HS9A 4QRDA 1KBOA 3PQ7A 4J3FA 1JPVA 3RT1A 4YUWA 2R96A 3EPKA 2GVZC 4LMPA 1WDLA 2YYZA 4GKVA 2VAMA 3E1KA 4NJEA 4WZBE 3NT5A 4YDRA 1WR8A 4Z4CA 4C88A 1SXQA 1UBHS 4F5YA 1VPLA 1AUXA 1EFTA 4L4ZA 4CV1A 5JD6A 1ADJA 4MUJA 3FKSA 4UVIA 4L5YA 4FLFA 3Q7PA 1WZIA 1UM8A 2PS1A 4U6SA 5FUMA 2RAVA 4AN4A 2VQ3A 2ODNA 2QUIA 2G7MC 1ACLA 1OFUX 2HI0A 3A2LA 4K9QA 4R01A 5CDSA 1PF7E 5KYTA 4NXMB 4YALA 4MKIA 2HIHA 3A6LA 4M1KA 4MVJF 3GNLA 5DW0A 4BBZA 5H3HA 2GZ2A 3FHTA 2CVOA 2ZYTX 4LHYA 5FHRA 1EVIA 4XIFA 4GPEA 5AVYA 1WW3A 4DLSA 5A3SA 3M4JA 4M8NE 1LH0A 1MO2A 3FNRA 3N1UA 1PLKA 3C74A 1O89A 1NYRA 3Q5GA 3EIOA 4HMPA 3GVXA 4IDCA 4MR8A 1N8TA 2A35A 5G53C 4F5WA 2C7RA 4GW3A 1D2AA 1OXBB 1R64A 3WBKA 1UWVA 3OM0A 5KWSA 2G9NA 5GIPE 1N33B 3R5JA 1IL0A 1HT1E 4P5DA 2NU8B 4TWZA 2NACA 2Z5VA 3CXUA 3LQQA 1EA7A 1EWQA 2XEXA 1GAXA 1T4BA 2OR3A 3QA3E 5TQ0A 3VGJA 3LWNA 1JEYA 2GD2A 1PSDA 4JVOA 3AF3A 5K3FA 4ZKEA 4B80A 1NBEA 4KO3S 4ER6A 3KT3A 2PZKA 1HTBA 4YLYA 4MTLA 2GTIA 1EHYA 3NB0A 1Z6PA 3AU9A 4PO9A 3V7WA 1OJ7A 2PGLA 3B89A 3GRPA 3GUUA 4XUDA 4LTMA 4OY3A 2C2OA 2LNDA 1XD9A 3C97A 1A8IA 4CIWA 5KINB 3P0EA 3GBVA 1EFRD 1K63A 1P0FA 2OVBA 2CNOA 1ZC3A 3BJZA 2C8VA 4JDUA 3EIXA 4J3NA 3ESDA 2VHYA 5EY5B 1SG9A 1DUVG 1SUSA 2CLHB 1ZD5A 1QZ3A 2ZUDA 2FVXA 3ICVA 1K68A 4CKBB 2XDAA 3KZNA 1GL3A 1YXMA 3G6KA 2GEBA 4KNVA 3WIVA 1PFGA 5C8DA 2OYCA 1FU4A 1PFVA 2FF5A 4LBZA 2ZE8A 3N2IA 5HIIA 4IZHA 2QR3A 4EI9A 4BKMA 2JIDA 4LZLA 1YRHA 3VPDA 1F9AA 3GZNB 3WWYA 4D46A 2BFBB 4CT4B 4QNMA 2E4AA 4LE1A 3LLSA 4KHZA 1G9TA 3OZFA 1O5TA 3A2MA 3C1UA 3OZXA 4NV1A 3UB4A 4R7TA 5IVDA 3G1TA 5AI9A 2PAAA 5IYZF 1L8XA 1ZH0A 3DZJA 2EJVA 3PL5A 4PRKA 4B1FA 2EJWA 1FXWF 3PJDA 4K6MA 2LGJA 4M0EA 4UNIA 5GV8A 1THMA 4OA5A 1L8AA 1P3JA 2Y66A 1JKMA 3FBGA 4MH0R 1XRNA 4ALNA 1IRIA 1JQEA 1ZN9A 1HX7A 3TRHA 4MAAA 5GINE 2X5KO 2IPLA 1QIDA 3C3EA 4DW8A 2AJTA 4KE8A 2XWJI 3BK1A 4TLDA 4F3NA 3RS9A 5JCXA 4ZVPA 2X58A 2PN1A 5KEIA 2BFDA 4CCWA 4RK0A 1IQPA 1E5XA 4O3FA 1BIFA 3S5UA 4CIVA 4XUEA 1AM4D 1PJ3A 3VNBA 1N9ZA 1TLTA 5L9AA 5DX1A 4CEJB 1GV1A 3C3MA 4FNGA 2HNAA 2XD4A 4FT2A 4U0JA 3RSZA 3SWWA 4DUYB 4UUQA 1G9XA 4OHXA 3WO1A 1KI6A 3KDAA 5C7LO 2KHZA 2NXJA 5CYFA 3UW1A 1J70A 2GA8A 3DBRB 3KV3O 3EZGA 1XOIA 2UZAA 4FNAA 4RV9A 3TOSA 3V4LA 1YF3A 1U8YA 4YO7A 3EHEA 5JE8A 1GUFA 3KTAB 1E2UA 2WJAA 3GB9A 3T1QA 1MDFA 5C51B 1ULUA 5AKLA 3OZUA 2YIDA 4IQ4A 3N5KA 5CM8B 1IN4A 1VMDA 4YV0A 1EPUA 2G72A 3PTLA 4X1YA 1FDVA 1UWKA 4BGUA 4QRHA 4R71A 3BBLA 5B3JC 1HF3A 1CTQA 1U8XX 4XJTA 5EIFA 4D0GA 3QNWA 1XF9A 4ZT7A 5G3YA 2I7VA 4K46A 1S2GA 3A3YA 1CUJA 1LPNA 4LWQA 3AEXA 4JL6A 3GPIA 3DF7A 2XGGA 2NU9B 4D9IA 3WGKA 4UATA 4YV7A 1TW3A 3OCUA 3S2FA 1ZLXA 1ST3A 4RFSB 1VL8A 5EKSA 1FFCA 1N1EA 1J97A 4Y1EA 1OTYA 2V9ZA 3HB1A 1P2VA 1P1RA 3NGMA 3OZBA 4QPJC 2WM2A 3IQDB 3JQ8A 3V8RA 4MKGA 3EXEB 1GAQA 4AY3A 5JFOA 2ZANA 1DGQA 1WMDA 2BUAA 1PV1A 1FSPA 4BY9E 3NTXA 5FWYA 2FX2A 2X5JO 5T6BA 3KQNA 3KXDA 3DYBA 1SGWA 1BKDR 5H0IA 1M34E 5I9BA 1T1GA 3RQSA 4F0JA 5KHAA 5AI5A 5ISMA 4MIEA 3HKDA 4YMHA 4B6JA 1LTHR 3F7NA 1BGVA 5EP1A 3QVTA 4EH1A 1CUBA 4K8OA 4ZMSA 1GFZA 3KB8A 5DLDA 2G9ZA 3CCBA 3IMKA 4HX9A 2I3GA 1J56A 1Q1BA 3WHPA 2W98A 4TWAA 1QQTA 1WHTA 3ZOZA 3NJRA 5FPKA 1ND6A 2VQFB 2JG3A 5CXSA 2B25A 3PGKA 4BLWA 3GAZA 4F12A 5JCPA 2E5LB 1I4WA 2G8NA 3G2JA 3AR5A 4P6VF 1PWYE 3ZI7A 1X42A 1KQOA 3IKTA 1DADA 2YRXA 3AR3A 2NXCA 4EGSA 3EXAA 5E9AA 3TQRA 1G21A 2C42A 2I8CA 3GD5A 4MHOA 3Q8MA 5FADA 2X40A 2UZ0A 4MZDA 4EW6A 3CR3C 3JQ7B 3EXFB 3MINA 3TEJA 3UC5A 3LI2A 5C53B 4BTEA 3R4VA 1VJTA 2IHTA 3DG9A 4NBWA 4WECA 3CEAA 5FEMA 1Z4MA 3F4KA 3RT7A 3LBHA 4BO8A 3REFA 4QUHA 4WWHA 3M1IA 1SWWA 1FNNA 4MAFA 4AF7A 3FETA 4LKOA 4OGWA 4CEHA 1GIAA 4ZZ0A 2XQIA 1R8JA 2F8MA 2W8ZA 3NS7A 4BRUA 5I7FA 2CLEB 3LZ6A 1DCFA 4XH9B 1P77A 2HLHA 4ND8B 1VP3A 3D3WA 3KZOA 5DBEX 3SAJA 4AI6A 3VHRA 4J1SA 1B8VA 2NQ2C 2P9QA 1U2DC 3ZWCA 1OH5A 2Z2XA 4F6CA 5JMTA 2D1YA 2QRVA 3CFYA 4M0MA 3IUQA 3DC7A 3ORYA 2FETA 1VKHA 4HNTA 4QBIA 4NOLA 2FOLA 1KGDA 3K94A 1SXJC 1Z47A 1BSVA 3DOOA 2DPHA 3JXEA 2XE4A 3PUWA 4XPIB 2QD5A 3HZRA 4N0PA 2X14A 2BEVA 3LGAA 4QQ8A 1H1LA 4AQ7A 3AL0C 1DAOA 1SZCA 3MK31 1D6NA 4NY1A 3M4XA 2WK1A 3PC7A 1WMEA 4S1TA 1RBZA 2XB6A 4HATA 1B43A 2HPVA 4OLFA 1CVIA 2OD9A 5DSXA 2OFPA 2YC4C 4Q4LA 3BWXA 1EVYA 2WSLA 3OP1A 3P2KA 3EC1A 1R18A 4MGZR 3WRXA 1ZOIA 1VSVA 3LY9A 3NVDA 1TADA 3FMOB 5GV7A 2GHRA 2J3DA 3FPCA 3GMIA 4WESB 1F6BA 1YACA 1R8YA 5D86A 2PGDA 5AOVA 3SHQA 3WV5A 3RGWS 4DMUB 4EG3A 4E7OA 4ALLA 3U9LA 2AHRA 3BKWA 4J16C 2RFLA 5K0JA 4UHDA 2NUPB 4R0VA 3H5AA 1HYGA 1G20E 2PWPA 1Q77A 3NH6A 5D6OA 4KR9A 5JS2A 1AKTA 3TRDA 2F90A 2WFZA 4PZUA 1FIUA 4IICA 1M2VA 3FJOA 3NEAA 4OEHA 4ZYWA 1OLSB 3VAYA 4JOBA 1GRVA 5KS2A 3UCEA 2DR3A 2FFAA 4UMEA 4D82A 1IIRA 3UJPA 5LA6A 2QZ4A 4FVTA 1C3OB 3DV0B 3NHJA 4LJ6A 1CRQA 2JH8A 2UKDA 3FPSA 3PNQA 2YR0A 2OUKA 4Y1RB 5ADVA 1VPDA 4W9MC 4U2DA 4UMVA 3PHLA 3HO6A 2FN9A 5KVQA 4QD3A 1E3MA 1KYIA 2V98A 1Q22A 3IKLA 1LBHA 1Q19A 3AMVA 3IP9A 1Q3HA 3JAWB 3AKZA 2ONCA 5ITVA 4D4GA 1AUVA 2AS0A 3GI1A 1Z2CA 5K01A 3TUZC 1R8QA 1XXLA 2QG9A 4GI2A 3WKBA 3ZIAD 4ESHA 3NXKA 1SEPA 2BTQA 1RYZA 2QTVA 4V0OA 3CZAA 4KDEA 1DJQA 1L7NA 3Q6NA 3W5DA 4RTQA 3AO0B 3EDQA 2V6IA 3LDAA 4TL7A 5EHZA 4O2AA 1BTOA 4X97A 2HK6A 3D1VA 3JQ6A 2DBZA 5JW6A 4W5NA 4M8IA 1VCMA 2IXAA 5CVUA 4MV9A 3IP3A 4UBIA 5JAOA 2Z57A 1FFAA 3SFTA 3M7IA 2MHCA 3DZCA 4RKEA 3VMFA 3H11A 4G8CA 1U2RA 2XNCA 3KYBA 4M87A 4M1MA 4UC0A 2IU6A 2VK8A 4UJ5A 2C2BA 5CLIA 4AN0A 3F5QA 1QGOA 1X7YB 3QELA 4A8HA 1Q16A 2QPTA 1VI2A 2JEZA 3CT4A 2WG0A 4PFJA 3TKLA 1N3IA 1ULSA 3PIRA 3UEOA 3NTUA 4W9RA 1XEFA 4F11A 3OTQA 4B7ZA 3A6DA 4G9GA 5MGBA 3WWDA 1MRSA 2NSDA 4KXLA 4NNJA 4TLLB 3E84A 2FSIA 4HVTA 5DWQA 5LMZA 3TGLA 1CHNA 1I0IA 4TKUB 1QLJA 3SC3A 5DF1A 4E51A 1RZRA 4J7AA 1GGNA 1T5IA 1X74A 3DUFA 4BX9A 4MDFA 3AEUB 5A5EA 2CLDX 3CKLA 2HQRA 3I9MA 3AVPA 3S44A 2WILA 1AQ6A 3HS3A 3LW7A 3U3MA 4IMPA 3AESB 1J8YF 2NU6B 4F3RA 3WJ2A 2CDBA 1Y9EA 2QU8A 4W7IA 3SI7A 4P7GA 1PJAA 3M1AA 2I55A 2QAGA 4RIGA 1N2ZA 1Y8QB 2IZZA 3V9PA 1MG0A 4AWAA 1E4OA 3L6UA 3OT1B 4ZDWA 2PXXA 2L0XA 5F98A 3QXSA 2CMFA 2G82A 4L95C 2V7QA 3AJAA 4RELA 1IHOA 4W4TA 5LYYA 1S02A 4L5JA 3ZVKA 4EZEA 2ZREA 4KH0A 3VR6H 2CK3D 3GZJA 4G0NA 2J85A 3IAEA 3K7EA 4O4JB 2VA8A 4UEOA 4ICIA 4Q5IA 3GLFE 1FCJA 4TRNA 3D3NA 3FBTA 4DCMA 4HLCA 3AW8A 3CSDA 4FDTA 3FB1A 1EDEA 4DWJA 3WV4A 1LJUA 3ADPA 4ZI7B 2H1FA 3FFBA 2JLZA 4MUHA 1EX9A 3KE9A 4Q47A 1OZGA 3G0DA 5J59A 3HCOA 2H54A 5CT6A 3C1OA 4GI3A 4MO9A 2HOQA 1ZXXA 4QFMA 4XB6B 1U5AA 1JJBA 2AOTB 5EJ2A 3KUKA 4DRXA 8MHTA 3UGQA 1YS9A 3EH1A 1YK1A 2Q28A 4CDNA 5AQ1A 2VDPB 1PT5A 3TZHA 2I0FA 5FA6A 2IKSA 1H05A 1IXZA 2BGKA 4INOA 1Z5UA 3SLRA 1WABA 3HL0A 4R0MA 3ZNPA 4UEJA 2I8LA 4DEXA 5FFNA 1THZA 3ZCRA 5IU6A 3QQPA 5LOVB 3L2OB 4UPDA 3QVUA 4RESA 4XYGA 4YYEA 4NNOA 2C1EA 1TU3A 2JLBA 3L40A 4IBOA 4N0DA 1UODA 2XQJA 4PYKA 5ALPA 3UK6A 5IRCD 1RHKA 3RTAA 1OGJA 2P8SA 3GROA 4Q7JB 4MW4A 1RQNA 1VFNA 3K09C 2YINC 1RI2A 1V3QE 1X39A 2FKAA 2Z83A 2FMFA 5AK5A 2QRJA 4TV8A 4TMYA 1XDDA 2CB9A 3FZGA 3ROKA 4UU1A 2FB9A 1F3OA 2HU7A 4KWHA 4DT1A 1Z37A 4JLSA 1S2NA 1UKAA 3OZCA 4Q37A 3ZYZA 4GKKB 3N76A 4GNKA 1E96A 4LHEA 1PGQA 2CHFA 4WQMA 4W1RA 5K51A 1DNPA 1NU8A 2W8BA 1XZQA 1SXJB 4CM9A 1Z4IA 1YOVA 1SHKA 3GX1A 1HKHA 2WSSA 1NW9B 2LP4Y 4OXNA 5ALNA 5BN4A 5KKCA 2ERYA 2HMYB 4WKNA 1WULS 3JQFA 2CZGA 1K2WA 2O5EA 4EVQA 3PD0A 4UDNA 2RHOA 1A9TA 2O4UX 3GJ3A 3DYIA 4U2CA 4YP1A 1O94C 4JYPA 4KRFA 2UAGA 3HU2A 1ILEA 4XUCA 5KHOC 1U8UA 3OKAA 4MX8A 3E03A 2J5RA 3NKVA 3F4LA 5CM2Z 5EA2A 3RRYA 4KITB 3U44A 1EM8A 3CSSA 3CTMA 2WWYA 1PJZA 1NGSA 3N7UA 1A5AB 2VEOA 3EDMA 2R8YA 5G4KB 3RW9A 3WLSA 5CJJA 4ZJZA 5GZ1A 3J81k 3HE3A 4NPCA 2VCHA 3TJZA 2CJPA 4ZRMA 1OBHA 4IUDS 2V54A 4BO3A 3UMYA 3ACBA 3UJ9A 2RBEA 4DUGA 4HDMA 4S1WA 2OECA 3OPNA 1U3TA 3WADA 4A6DA 3AY7A 3QUSA 5EWJB 3C4JA 3RWBA 3JQBA 1WDTA 1OC2A 4D3YA 1QPGA 3NWOA 5FEUA 4HLNA 1R0RE 4TUYA 1CY7A 3WGQA 1JJFA 2YWFA 3PPYA 2PT9A 3LP8A 2WYHA 2HA0A 4BWFB 4M9CA 1SUBA 5HCNA 2C0PA 2Z04A 3OIWA 2HF8A 2FMIA 5LBTA 1I6LA 1GNTA 1N5LA 1T3LA 4KR3A 2O54A 2O3QA 3DR5A 1NXPA 3KU1A 4BVBA 4X24A 4WXYB 5DPMA 5KDDA 4YMUA 2PUAA 1VM6A 4HDAA 4MYUA 2HJRA 2QD4A 3DHNA 4TXMA 1N77A 4GSKA 2OYSA 4BB0A 2PUFA 1IOVA 5GAJA 4YCCA 1QIJA 2ZLBA 2P79A 2AYYA 3AEKB 4JENA 1HFJA 4KZKA 4FC6A 3K1ZA 5IUNC 1ENYA 1P80A 4L07A 4Y9TA 4OQXA 1XPOA 1HYBA 1EX7A 3ZDZB 1Y3HA 2QP3A 3HY3A 1HBJA 2W2LD 4NDAA 5DWDA 1T9BA 1SVSA 3R5HA 4UNRA 3KEFA 2CZCA 1QANA 2VZLA 3F46A 2O2XA 1WU7A 1V16A 3G59A 3LUFA 4GEGA 4KDCA 4EYQA 2O48X 3Q3JB 1I5EA 5EFZA 2HXSA 5DFAA 3FJYA 4WHMA 5C32A 1YDFA 2QU7A 5IAJA 2V0CA 5D3MA 1XTTA 3LCJA 4RZ3A 5L3QA 1E3DA 4HH0A 4LZNA 5HW0A 1DBIA 5IX8A 5AR1A 1SG0A 1ONPA 3N0WA 4GX0A 1IAQA 2Z2KA 1L5OA 1HTTA 3PR3A 4U7FA 3UM9A 1OB2A 2XLBA 3DS8A 5G0UA 1CNMA 3RRNA 4OOFA 1J90A 4MJLA 2LE0A 5DMHA 3W9YA 2PSHA 5DP2A 1O0SA 3ANLA 2ZETA 3U4AA 3VKUA 2GWHA 3IV9A 2O07A 2ZRFA 1K0UA 5BSVA 1Z26A 2VHVA 1M3SA 5E4TA 2F1KA 2V7WA 3OJOA 3MT7A 3FVQA 3GT0A 4KOAA 3R7WA 1ZIXA 4CI9A 1X0XA 1IOZA 4HWTA 3CT6A 1E1QD 1CZOA 1GUDA 1S8NA 1XRRA 3DOCA 4FOTA 3INGA 4KUEA 2OXCA 3GA7A 5F5XA 2H9YA 1E2QA 3LQ1A 5ALOA 4WZAE 4GBGA 4IJMA 2VK1A 2BEKA 1D2CA 3SICE 4KH1A 1OX4A 4PS0A 3IP8A 4OHPA 2GWRA 1PQUA 1FDUA 3BFJA 3WA6A 2Y0BA 4CGZA 4A2QA 1IOLA 5CTJA 4NEHB 3JATB 3E1SA 3NONA 1DWUA 1KU0A 2GILA 3DMGA 3SDSA 3D6MA 3V4FA 5HZKA 3I42A 4FFNA 4FSXA 2B36A 2FFHA 3GEHA 4JQCA 1I5OA 3H5IA 1Y63A 2W6ZA 3E4DA 4JVNA 5MFPA 2WTNA 3PQ8A 1EDDA 4D44A 4ER5A 4D6YA 2ATXA 1QB8A 3G2OA 3PXDA 1PR0A 2ZSBA 4LKRA 1PJLA 4RK4A 2QW1A 3BMNB 1GAEO 3I76A 2BBWA 3HUTA 5JSHA 1X87A 1TZMA 1E2FA 1SBHA 2HO4A 4HC4A 3D8RA 1WCWA 2GFQA 4ZA2A 2WWHA 2Z1MA 1JSXA 1OAOC 5DCWA 3VZRA 1IBSA 1P31A 5KSYA 4DRZA 3D3JA 3O21A 4NH0A 4EHJA 1XZBA 4MA4A 1KIMA 1Z16A 2ACWA 2Q6KA 3CX4A 2FUEA 3F97A 1A8PA 2AN4A 2YDXA 5FBZA 5C31A 2XEDA 3T0FA 4B75A 4QBTA 4XB2A 1JP7A 2CDCA 4PHFA 1T8TA 2GHQA 2VPZA 2JJ8A 2QTMA 3KSRA 5FHQA 5AFSA 3TLGB 1Z0KA 1ZGGA 4B9AA 4BNHA 3NXSA 1QZXA 4YVFA 2ORWA 2QG6A 2C7GA 5U4XA 1WB6A 1G8AA 3U31A 2HBRA 3PIIA 2PVPA 4I5GA 2ZRPA 3L8GA 3PYLA 3E9MA 4L4YA 2W58A 2WF7A 1UEXC 1XZEA 1TECE 4U2GA 4EJSA 2AN1A 5I5EA 2WNSA 3LCUA 4ARAA 2AFVA 4ZOLB 5FUYA 5AIAA 2OYRA 2JZNA 3I0ZA 3N2EA 3VDRA 1Y8RB 4B33A 4TV9F 3NC0C 4FFBB 4B3FX 1YDEA 4IMRA 5BRNA 4LOKA 2CXXA 1JQ3A 1CDEA 3FCYA 1PW5A 1T1SA 2B83A 3IJEB 4PGGA 5TGTA 2XCIA 4Y2VA 5JJKA 3OC0A 1UEJA 1F2VA 1P17A 5C2JB 2UXDB 4IEFB 5JQGF 1J2EA 1G6OA 4PG4A 1CJCA 4R9SA 1QS0B 2IXDA 4NCAA 3QNMA 4ND2A 4FGJA 1F2TB 1F8YA 2Q0XA 3IUSA 4ZAVA 3X3HA 3R3ZA 2HZBA 2XRYA 1XMSA 1U6KA 2FQYA 3GP5A 1ZY2A 3H1BA 5AXBA 3R7DA 3ZY6A 2B1QA 2PXAA 1FU8A 1XLUA 4FIZA 1MW8X 5K8JB 5F7JA 5G1OA 1ISFA 4FKZA 5LDHA 1VB3A 3D4LA 2VHQA 3C5WP 2GBCA 2D5BA 1L1RA 4I5DA 4V0KA 4BUCA 1WMSA 4QUKA 1CT9A 4FHEA 3QMMA 1EESA 3MMNA 4PXSA 4DY4A 1FJHA 3L5OA 1QGZA 1YD7A 1Y80A 1DL5A 3GN2A 4M0PA 3EBLA 3S29A 3UK1A 4DV7B 1T8SA 3C6XA 4ZC8A 1JNXX 3OQNA 1GDTA 2IYRA 2WW8A 3R3SA 1HDEA 4CUKA 4KPYA 1ADGA 1T5BA 2F48A 4HDSA 5FPTA 1OHHA 2JGEA 2R8XA 5LYJF 4I55A 1KRWA 3R0VA 2D13A 4GPZA 4C3VA 1CUDA 4URHA 4M7WA 2Y68A 4O4LA 2JGMA 1IEQA 2PZEA 3NLLA 4EG6A 2GK6A 3BKXA 1DKQA 2LD4A 3MC1A 3UT6A 4BIMA 2G3YA 4C0JA 4DF3A 3EQ2A 3ZVMA 1L1QA 3QLUC 1P9WA 3BE5A 5IK2D 4IVNA 4UM7A 1TM1E 5JO9A 3F9IA 1P9OA 4RMHA 4EFMA 1G3UA 4JSTA 2P6RA 3A3KA 4QPZA 4X7PA 4MQEB 2VNJA 4YQYA 1FLAA 1RIFA 3TKAA 3Q7SA 1ZIPA 4EYOA 4RSRA 4CG2A 3LRXA 3BTUA 3N3BC 4WV3A 3SMQA 3SQWA 4JXJA 3CVXA 3H65A 2CVHA 4PZ9A 1KO5A 4BX8A 3GHHA 1Y1QA 4AVYA 1AZTA 3DEAA 3KVOA 4E5VA 4GRIA 3HSYA 1TYAE 4K9LA 3K2BA 5H16A 1JZSA 4FDAA 1A96A 4PC3A 3WWPA 3B9RA 1K7YA 3WYDA 3KR2A 4EKYA 1MV8A 2OY0A 2PRKA 3S1LA 4A2CA 5CB0A 1JFSA 3TRFA 4OH7A 1RWMA 4QM6A 2G71A 3JD0A 1X7WA 2RHTA 3LT2A 2UYCA 4XWAA 2A1IA 4PY2A 4HXFB 4HLUA 1I3KA 4HXYA 1UIRA 3GL9A 4JEMA 1R5OA 1UK9A 1QH9A 2ZBQA 1R6TA 3FKSD 1PR9A 2O59A 2YQZA 2CNNA 3TCXB 4DQVA 2ZWOA 1JWBB 2C4HA 3PU6A 3GLIB 3W4JA 1YDMA 2HLDA 2OESA 3V1LA 1XLTA 5CDFE 1T2AA 4LYDA 3E61A 2QT9A 2ZAGA 3KJXA 5ULLA 2PT5A 3I3SR 3ZCTA 4K5QA 4ENVA 1I9GA 1MT3A 1N9GA 1GJRA 3N7TA 1E7RA 1NV9A 3WQSB 1K4MA 2YXEA 1MO6A 2PXHA 1RXSA 2H08A 3GOQA 3P2JA