4QNNA

Crystal structure of phospholipase a 1 from hornet(vespa basalis) venom
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
297
structure length
297
Chain Sequence
PCPYSDDTVKMIILTRENKKHDFYTLDTIKKHNEFKKSTIKHQVVFITHGFTSSADTENFLAMAKALSDKGNYLVILIDWRVAACTEEMSGIQLAYYSYAASNTRLVGNYIATVTKMLVQKYNVPMANIRLIGHSLGAHTSGFAGKKVQELGLGKYSEIIGLDPAGPSFKSNDCSERICKTDAHYVQIIHTSNHLGTLVTLGTVDFMNNGYNQPGCGLPLIGETCSHTRAVKYFTECIKHECCLIGVPQSKKPQPVSKCTRNECVCVGLNAKTYPKTGSFYVPVESKAPYCNNKGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of phospholipase A 1 from hornet(Vespa basalis) venom
rcsb
source organism Vespa basalis
molecule tags Hydrolase
molecule keywords Phospholipase A 1 from hornet(Vespa basalis) venom
total genus 96
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.32: Phospholipase A(1).
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00151 Lipase Lipase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qnnA00
4EUSA 1EK1A 1EDDA 3IUJA 4BDTA 3WYDA 3MVEA 2VATA 5ALSA 5JD4A 1F0PA 2X5XA 3DOHA 3SX4A 1XRQA 4U2BA 5LKRA 1WB6A 3MUOA 1XZLA 4OU5A 5JATA 5HF6A 2I3DA 4FWBA 4W1QA 3KWFA 1U2EA 4IO0A 4EA6A 1LPMA 1QO9A 2QR5A 3BIWA 3OG9A 4MEAA 4N8SA 1IUPA 4KAFA 1CR6A 2B4KA 3WIOA 4DSZA 3WLAA 1W52X 3W04A 5HKBA 2WSLA 4IH9A 1CLEA 3AZPA 2JF0A 2GBGA 3LS2A 3WKEA 4GWLA 2BGRA 3YASA 4FFVA 4GXNA 4KYVA 3WWEA 4JUIA 1LBSA 1DQZA 5AOCA 4WFIA 3ZPXA 3QPAA 2VEOA 2C7BA 1YB6A 1KU6A 4BAGA 2AJDA 4BTVA 5ALGA 5AI0A 2Y2UA 1SCKA 1WCYA 3WWPA 3C5VA 3H2KA 1P0IA 3ZV7A 1H2WA 3RLIA 5LLSA 2ES4A 5ALHA 5ALTA 4DM7A 1CUCA 2CUTA 1XZEA 1JU4A 1XZIA 2X8BA 4OCZA 3WQHA 2ZYHA 1TCCA 4H7IA 3WKCA 2CEKA 4QLAA 4DYHA 4BVJA 5T4EA 1Q84A 7YASA 2WHPA 5FUMA 1GZ7A 3I6ZA 2XUHA 4BE9A 1WB5A 3OM8A 2HA2A 3FLBA 3BJRA 5AK3A 3PDCA 1QIKA 2BGNA 5LZ7A 2QXTA 3ESDA 3F97A 5LP1A 4UBLA 5C8XA 4KE6A 3QPCA 4C88A 2G63A 1T2NA 2BAGA 2VJAA 1QIIA 3W9UA 2CB9A 3GZJA 3QMWA 1E8NA 1TCBA 2XMDA 1R4ZA 1JJIA 4N5HX 1LZLA 3WK4A 2AJLI 1A8QA 4B85A 4WJLA 4FMPA 4KRYA 4EY4A 1JMKC 4ZRDA 3G9ZA 1MAHA 1R1DA 5BWCA 2XMQA 4LIPD 5JAOA 1EI9A 3QMVA 1H2XA 2JGFA 5LZ2A 1YB7A 1O6FA 4Q05A 4PSUA 1X2EA 4UBOA 1VXOA 2XUAA 4BVLA 4EHBA 4W63A 2OAGA 4L3WA 5JD6A 2JGIA 4INZA 5EIEA 1WHTA 3CXUA 2DQZA 3V48A 2QT9A 2GZRA 3KOOA 3FBWA 3BDVA 1JI3A 3A70A 1CUHA 2Y2VA 2O7RA 3C87A 3R3WA 3C45A 2DHDA 1IVYA 1JKMA 4AB1A 2EDAA 4G4JA 5ALNA 3B12A 4P93A 4G9GA 4DNOA 1CUJA 3IURA 1LBTA 1ACJA 4QWMA 2YASA 1CRLA 1QO7A 3H17A 3H2IA 3WK7A 4AXBA 4WY5A 1F0NA 1XQVA 4G4GA 4LXHA 2QVBA 5ALUA 2RAUA 5AOBA 3B3QA 5JZSA 3D5EA 1AMNA 2D5LA 1S8OA 4U2EA 4Y2TA 2OQIA 5H3HA 4UFPA 4BC0A 4PSCA 4Y2UA 1MX9A 4PSDA 1ZD5A 3FCYA 1DX4A 3IA2A 1QOZA 3WI7A 3PICA 5AKLA 1QZ3A 5AI5A 3FWHA 3CCBA 4M0FA 2XQKA 4FNGA 3I1YA 1YA4A 1QIMA 2AXEA 3ICWA 2Z5GA 5T4HA 3BL8A 2WU4A 5AKXA 2ZJ6A 4U2CA 5DYYA 3V1LA 5JAUA 4H7FA 5HFAA 2VTVA 1UK9A 2WG0A 3ZI7A 3HZOA 2HA3A 1BN6A 4CG2A 3GA7A 5A7FA 1MJ5A 4FHZA 5ALEA 5EHXA 2O2IA 4KRXA 3ZLVA 2J3DA 1SFRA 3AZQA 3A2MA 2I03A 4CFSA 1XQYA 3M82A 5A7GA 4UFOA 2HADA 3I2FA 3EQ7A 2Z3WA 3L1IA 2XMGA 1FFDA 4EB0A 2JGJA 1UKBA 2XUQA 2ZVDA 2HU8A 5EHNA 3IUQA 1AX9A 1GQRA 3QBJA 4H35A 1CUFA 5IVIA 2G4LA 4DMHA 1CUEA 3FLAA 1GKLA 3E3AA 3G9UA 4WFKA 4G8DA 3O4GA 5CT5A 1R88A 1HPLA 2PX6A 1CEXA 2OCLA 4MJ3A 4OYYA 3WMRA 1QIGA 1UK7A 2J4FA 2H1IA 1CUXA 3I6MA 4IH4A 2Y1KA 1QONA 4K2AA 2HHAA 3TRDA 2XMZA 4N8DA 3D7RA 5ALZA 2ACEA 1XROA 1E8DA 2HL6A 2Y6UA 2FJ0A 4K6GA 2C5GA 4DNFA 1XKLA 5EIAA 4XWGA 1ORWA 5K3EA 5SYMA 1Y37A 4GHWA 4JH0A 2CMFA 1ZGCA 2R8BA 1MPXA 2PSEA 3BDIA 1EDBA 4J0IA 5ISMA 2H7XA 5EHQA 3M3DA 2WUFA 2WJ3A 2GZSA 1LNSA 5CURA 1MAAA 3I2HA 3WWDA 3C43A 2QUBA 4K6HA 1YR2A 2XUKA 1XLWA 3D2BA 5AK4A 1SC9A 3DCNA 3PFBA 1K8QA 4BB0A 3TGLA 2WIFA 3I2KA 2HA4A 2Y6VA 4C87A 3PUHA 4X3CA 4HXEB 1QFMA 3RARA 2OAEA 4KEAA 1ETHA 3IIIA 4C4XA 3G8YA 1CUYA 1BEZA 3RM3A 2XB6A 1FFBA 3HEAA 2QOEA 3H2JA 5D7BA 4I4CA 5KBYA 3WIBA 2HIHA 5HF8A 1ZD4A 3E0XA 1C4XA 1EX9A 3O9VA 3DQZA 4WFJA 1QIFA 2VQ6A 1GGVA 3WK8A 3O4HA 3A2NA 4G1FA 2WILA 5BOVA 2WG1A 2VJBA 1DWQA 3HYSA 3OC0A 4UUQA 1UOOA 5K3CA 2QRUA 6YASA 1DWPA 1TCAA 5AM0A 3O9MA 1TQHA 3D2AA 2BUAA 1HDEA 4ARAA 1EA5A 1USWA 3ICVA 1QIDA 4Q3LA 3G0GA 1XRPA 1ZICA 1UOQA 3KWJA 4IH1A 5HK8A 1R9MA 3C8HA 5E2IA 3VKFA 3BF8A 1N5MA 3BWXA 4EZIA 3ANSA 5KWIA 2DR0A 1DINA 1RWQA 1WPRA 1EXWA 5J3JA 3FOBA 1XRLA 4G9EA 3AILA 3ESBA 2GBIA 2XUDA 1E3QA 3AIOA 3WK5A 2PVSA 1ZIXA 1J1IA 2W22A 3KSRA 2WKWA 4ZI5A 3JW8A 4FDMA 1SCQA 3GELA 4X7BA 5AKHA 3WA6A 3UMJA 3WJ1A 1SOMA 2VT7A 4TGLA 1XRMA 4OPMA 3ANTA 1MT3A 3C70A 1K6EA 2AJCA 5ALYA 1NU8A 3KXPA 1XLUA 3C6BA 3PF8A 3HLKA 3QVMA 4H18A 3I2GA 4GECA 1MN6A 4PNZA 5LZ5A 3S2ZA 5CT6A 2XUIA 3QMMA 2PSJA 3FLEA 3OOSA 3CCCA 2OXEA 1XZDA 3H2HA 2BCEA 2RHWA 2PM8A 1N8SA 1UXOA 2RHTA 2WIDA 2OG1A 1CUBA 4GEGA 3GBSA 1OXMA 2P8SA 2PL5A 5FXMA 2AJ8A 2WIGA 3Q8WA 5AHXA 2NW6A 4MEBA 4X94A 2XUOA 1VXRA 3FSGA 5AKEA 2QS9A 3HI4A 3AIKA 1BROA 3PE6A 4BTLA 1NX9A 4X6XA 4QEKA 2E3JA 1UWCA 2IIVA 3O4JA 1Y7HA 1U4NA 3V9AA 3KD2A 2XE4A 5DTIA 1K4YA 5FDFA 5A7HA 4OB6A 4KACA 2C0QA 1TAHA 3R41A 1MX1A 4B83A 3STYA 4CCYB 1R9NA 2OGTA 2WUEA 1QIJA 3DL7A 3DS8A 4FTWA 1DTEA 5LYYA 4BC1A 2PSHA 3E1GA 1ZJ4A 1DX6A 3DDUA 2QJRA 1PJAA 1ZOIA 3FVRA 3I2IA 3L1JA 5F4ZA 4P08A 3WL6A 1MNAA 4X92A 1VA4A 4A16A 3UUEA 4UHDA 3D4LA 3NUZA 2C4HA 1IUNA 4MYSA 2JIDA 4GW3A 4X00A 2V9ZA 1A88A 3QITA 2BKLA 1Q0ZA 3FAKA 1PFQA 3FVTA 4GDMA 5AKYA 2XQGA 3NGMA 3NOXA 2PUHA 4Y2SA 3A2LA 5CH5A 4AO8A 4X71A 1ZI9A 2PUJA 3QPDA 4IHAA 4KE9A 4Y2QA 1FSSA 1CUWA 4BZWA 4J3JA 4DTCA 4TPKA 4AMYA 1FFAA 1QTRA 2XMSA 5C7YA 5ALLA 4JYPA 4G8BA 4BBZA 3EQ9A 2JGLA 4Q82A 4ETWA 3R3XA 1CVLA 3IVMA 1JU3A 1AURA 1OCEA 5DYWA 4XVCA 3QYJA 5LZ4A 1CUIA 4O08A 3BF7A 1I6WA 5AP9A 1CUGA 5T4BA 4ARBA 3ZWQA 2XMBA 2V98A 2FJPA 1TKRA 4K6KA 3C6YA 4YK7A 3OTQA 4BCDA 5BWBA 2BUCA 1B6GA 4DLNA 3G9XA 2W6CX 5SYNA 1WOMA 5FPQA 2ECFA 2G5PA 4X91A 4RE5A 3LIIA 3H2GA 2OCKA 4PQEA 4LKOA 2H7CA 1HKHA 1CUDA 3B5EA 4H7JA 5EHZA 3WK9A 5IVDA 4Y7DA 2WFLA 1MTZA 4EY7A 3SK0A 3SWWA 3G9TA 3W06A 3JWEA 1XRRA 1AC5A 2WJ4A 4X90A 3MGAA 2WFZA 5K3BA 1CUZA 4H7DA 5EIHA 1LPSA 4B80A 4V2IA 2CKMA 4S0XA 4DNPA 1J06A 4OUKX 3W9BA 2XQIA 1W75A 1VZ3A 5D6OA 3DJYA 1LPAB 4X95A 2XUFA 5JADA 3WYNA 2WTMA 1DU4A 4KJXA 1L7QA 2Z8ZA 1EB9A 3VVMA 1H2YA 4B6GA 3LLCA 3STXA 4UPDA 2GYVA 1TIBA 2OCGA 3I28A 1R50A 4J0KA 2WFLB 1XZAA 1K5PA 2XI4A 4TVKA 4HVTA 4QNNA 4BAZA 1BEEA 3EF3A 5FPPA 2WIJA 5HK9A 2H9YA 1ZI8A 4Y2RA 3G0BA 2EEPA 3M83A 3DLTA 5AKKA 4H7EA 1A8UA 1FFEA 4CCWA 1MO2A 5HF5A 3FYUB 5FRDA 2WG2A 2YXPX 4WCVA 1XZMA 3ED1A 4F0JA 1XLVA 1KU0A 2OLEA 3AUKA 4OYLA 3E4DA 3K6KA 3V1NA 2JBWA 1JJBA 2PSFA 2VAVA 4UBIA 2XLBA 2HFKA 1UKCA 2BUBA 1EVEA 4ZWNA 4MYDA 1AZWA 1E66A 1X70A 1WM1A 1P0QA 4MQLA 2RGUA 5DLPA 4ZXFA 5ALWA 2CJPA 4HRYA 1G5FA 5HZGA 4JEIA 2XUJA 2QTBA 4W1PA 2ONCA 3RK4A 1FFCA 1A8SA 2C58A 2I78A 2K2QB 2Z3ZA 4FLMA 3S8YA 2B61A 2Q0XA 4QDZA 4EY5A 2WHQA 3BIXA 2EDCA 5ESRA 4OB8A 2HA0A 1A7UA 1T4MA 1LGYA 3FCXA 5AKJA 3EIOA 4G5XA 1RP1A 3V1MA 1MU0A 1QFSA 2ZYRA 5I8PA 3DYIA 2WM2A 3IUNA 5ALKA 1WB4A 4AO7A 4B0OA 2I3ZA 3C6XA 5ALQA 2RONA 5IVKA 4KE7A 3AZOA 3H04A 1LLFA 4H77A 5ALPA 1TRHA 1RYYA 2VSQA 1B41A 4UBJA 3W2TA 5AM4A 3WJ2A 5KWJA 1YS1X 4X85A 1XKTA 1GXSA 4UFNA 1P0PA 1W4LA 5AM1A 1E8MA 1UOPA 5E4JA 3DEAA 1ZJ5A 5I7UA 1XZCA 2V96A 5AK6A 3AJAA 1JJFA 2DSNA 1UKAA 4LXIA 4AO6A 4NMWA 5JZBA 2BFNA 5ALDA 3X3HA 3DL4A 3C6ZA 4ZV7A 1ZIYA 2PPLA 4FNMA 5EGNA 1BE0A 4MQMA 2ZYSA 2WU3A 4E14A 4F60A 4Z49A 3F96A 2PU5A 1UFOA 3WL8A 4UBNA 1HLGA 5JANA 4AN1A 1XQXA 4BRSA 2DCMA 4G8CA 5AKZA 2XDWA 4RPCA 3H18A 1U8EA 2JEYA 4J03A 3HC7A 5K3DA 4JNCA 3G0CA 3L1HA 3VISA 1CFJA 2UZ0A 3ZLUA 3D3NA 3HXKA 3AINA 1Q0RA 3VJLA 1DT5A 1BN7A 3IB3A 4P92A 4DMCA 1HL7A 4U2FA 3VDXA 4UHCA 2OPHA 5CXUA 3WKDA 4J0JA 1UZAA 5AICA 5CH3A 5E4TA 1YAJA 2WJ6A 5JASA 1XZGA 5AIAA 3G02A 1C7JA 2O7VA 4H7KA 4ZV9A 1Y7IA 1H23A 4P9NA 2JGKA 1FJ2A 3K9BA 5CT8A 4OSEA 2XUGA 4QLOA 2JGEA 1H22A 1EDEA 1ODTC 1AKNA 3O0DA 5DNWA 3V1KA 4H0CA 3O4IA 3H0CA 4UHBA 4PO3X 1THGA 5BV7A 2R11A 1CUVA 2OQVA 4EBBA 5FKJA 1IZ7A 3QZUA 4M0MA 2VJDA 3FYTA 5FOQA 4WDQA 1M33A 1UT6A 3LP5A 1GQSA 3WWCA 3WKBA 4A23A 1THTA 2HA7A 3LCRA 3WWOA 4N5IX 3T52A 3CN9A 1C7IA 4FBMA 1KEZA 5HF9A 3N0TA 4GBGA 4QA9A 1VOTA 4DIUA 5DYTA 5A71A 2FX5A 4HXGA 1ZD3A 4UHHA 2HU5A 2GBFA 3C8DA 3I2JA 1WPXA 5HQ3B 4E15A 5LIPA 4C89A 2XT0A 1XZKA 4E46A 1Z68A 3WA7A 1VA5A 1QTIA 4Y2VA 4NS4A 5AIBA 4QDOA 5ALIA 2ROQA 4CCYA 3O95A 5AM3A 1QGED 4Y2XA 3R40A 1ODSA 1JFRA 4U2GA 4M0EA 2VJCA 4PW0A 1GKKA 1LPPA 4D9JA 1VE7A 1UK6A 2IX9A 4KE8A 4F21A 4HAIA 5ALMA 2WUDA 1E89A 5DNVA 1AQLA 3CN7A 5C8ZA 5D3KA 3F9CA 4PF1A 5EFZA 1ORVA 1BU8A 4DMKA 5K3FB 3DOIA 4B7ZA 5C81A 4DNQA 5JALA 4LYDA 1SCIA 1JT2A 5CRIA 1P0MA 3HSSA 4AZ3A 1DWOA 2YH2A 1R3DA 1J2EA 2DFPA 2WLSA 4GI1A 3WL5A 1ZGBA 1K63A 5LZ8A 3U0VA 5HCUA 1YCDA 3R3VA 1TK3A 2PSDA 5K3AA 4C6HA 3H1BA 2HA5A 1EINA 1YASA 1YAHA 1XQWA 2XMCA 2WUGA 3H1AA 3DNMA 4NVRA 1X2BA 4AZ0A 5K5EA 2ZSIA 2GYWA 4DGQA 1HQDA 2PU7A 5A2GA 2H7YA 4B9EA 2PBLA 1CUSA 1MX5A 4B0PA 4Y2YA 3HACA 3KDAA 4MXDA 5AKGA 5EI5A 4Y2JA 4ZGBA 2ACKA 1ZD2P 2WHPB 1J07A 5LZ9A 4IQ4A 3R3YA 1ISPA 5AOAA 5YASA 3WKAA 4B81A 5DWDA 4DSAA 3ILSA 2YYSA 3R3UA 3F8SA 4RE6A 1QE3A 3K2IA 5FV4A 5LKAA 4CG1A 5JARA 1XRNA 5AKIA 4PV7A 2O2HA 4X97A 4LYEA 2HA6A 3FYUC 4X93A 3QM1A 4BP8A 1JMYA 3UUFA 2DHEA 5AI4A 5T4FA 2PKYX 5CT9A 3D59A 1OILA 1BCRA 4MWSA 4OD0A 2FUKA 3F67A 3STWA 2X76A 4Y9SA 4BATA 3PF9A 4XX1A 2WIKA 2C5FA 1VZ2A 2JEZA 1CIJA 3STVA 3HRHA 4QE3A 1GPLA 5AI9A 1W6RA 4QDTA 1EH5A 1BCSA 3C5WP 5FP0A 4HRXA 2VF2A 1QIHA 3ZLTA 1EHYA 3P2MA 2XQJA 3BXPA 5AI8A 3OURA 2J3QA 4FBLA 4J0HA 2AJBA 2G5TA 4K5QA 4XJVA 5ALFA 2QM0A 1NU6A 3RKSA 4ZREA 1PV1A 4KAJA 3FNBA 1LZKA 3ESAA 4C4ZA 5AH0A 4YASA 5IKXA 2B20A 3MUNA 3STUA 4L0CA 3WK6A 2J4CA 5I9IA 4BRZA 4BVKA 3EBLA 2HU7A 3VJKA 4DMFA 4E11A 2HM7A 4MWTA 3I1IA 3DD5A 1XZFA 5JZ9A 3DYVA 5ALOA 1XZHA 3WL7A 4Y2PA 3IDAA 1IMJA 2HRQA 5A6VA 1W76A 2XLCA 3G0DA 3WZLA 4C01A 4CIAA 4ROTA 2GYUA 2VT6A 1EB8A 1D07A 1GT6A 1O6GA 5A62A 1N5RA 1EVQA 2QJWA 1YS2X 4UHFA 4CG3A 4BE4A 2XMRA 3PUIA 3SC2A 2HDWA 1QIEA 2O2GA 4H7HA 3VJMA 2HFJA 5E4YA 3A6ZA 4L72A 4BCBA 3TJMA 5JAPA 4HXFB 5JAHA 4UHEA 3EQ8A 4QDUA 2XUPA 1CQWA 1F8UA 3IUMA 1QLWA 5AK5A 1VE6A 4Q3OA 3ESCA 2OGSA 5ALRA 3QH4A 5JYCA 5HQ3A 2ZJ7A 4BP9A 5CMLA 4YX9A 4BCCA 4XIIA 2V97A 2QMQA 1N1MA 4BDSA 5C8VA 4FLFA 4FFWA 4N8EA 4LXGA 4NZZA 3I6YA 4WDRA 2WHRA 4B82A 5ALVA 4EY6A 5DNUA 1L7RA 2IITA 3T4UA 4KR0A 1GPNA 4J0DA 4AMZA 4F5ZA 3PI6A 4KAAA 4HZGA 3HABA 4B9AA 1VLQA 2WTNA 2QKYA 2RIPA 5CT4A 4BAUA 1VKHA 3G7NA 4EY8A 1G42A 1BRTA 1G4HA 5FLKA 1EK2A 2OCIA 1H2ZA 2JGMA 4RNCA 4BYMA 2ORYA 3TEJA 1U65A 3Q0TA 5ALXA 2QUAA 5CXXA 3JYHA 3N2ZB 3PFCA 5HKAA 4YPVA 3FYUA 5IH7A 3M81A 4X6UA 4LHEA 3H19A 1QJ4A 4Q3KA 1G66A 1WHSA 2DQYA 2QXUA 3D2CA 4FKBA 4W9RA 4A5SA 1F6WA 3W05A 4W1SA 2GBCA 4W1RA 2BJHA 4BZZA 1Q83A 1AGYA 2QZPA 4L9AA 4UBMA 5IVHA 5ALJA 1LPBB 2CBGA 2VAXA 3AIMA 2ZJFA 4I3FA 3VVLA 2CZQA 2HRRA 1YSCA 1HBJA 5KREA 5CH8A 3FSGD 2LIPA 4WY8A 3D0KA 1GPKA 4J0CA 1ACLA 2XQFA 4GLBA 1LPNA 3LIPA 3GUUA 5CW2A 3GFFA 3BE8A 1ZI6A 4B84A 2VA9A 4Q34A 5JIBA 1CUAA 3VXKA 4FLEA 5AO9A 4J7AA 4JYMA 1ODCA 1LPOA 1DQYA 5HFNA 1AUOA 1E5TA 3WZMA 1CV2A 3DKRA 4HS9A 4ITVA 4QDXA 5AJHA 3HJUA 5K3FA 4FOLA 4AN0A 4J0GA 3G0IA 2WQZA 1L7AA 3F98A 2WFMA 2Z8XA 2C0PA 3GROA 3U1TA 4HTAA 2D0DA 1CUUA 3AFIA 4X6YA 1UK8A 1BS9A 5D3ZA 4RGYA 4CI9A 1IUOA 1CQZA 4UBKA 4OB7A 3R3ZA 4QZVA 4AQDA 5AI6A 1CPYA 1W1IA 2ZSHA 2OGZA 3NWOA 1XZBA 5JD5A 1VJ5A 3R0VA 5DTJA 2RI6A 2DHCA 2ZYIA 1DT3A 1YA8A 4OU4A 5DJ5A 3STTA 2B9VA 4AX4A 1MNQA 4I19A 4C4YA 3IULA 5CTAA 4U2DA 1XZJA 1XFDA 3BJMA 4CIBA 5AM2A 4QWWA 3DKKA 5AM5A 4Q1VA 1IZ8A 3OPMA 3IBTA 4G4IA 5CBKA
chains in the Genus database with same CATH superfamily
1X1CA 2P6UA 2XKBA 2JIPA 1IG3A 2W6MA 3CEAA 4COKA 1PQYA 1EK1A 3RYFA 1LV7A 4DGSA 4IIFA 3VZDA 2LIVA 4E2WA 3IUJA 3AUAA 1U7TA 4RTKA 4JFRA 3BRSA 4LHYA 3Q3CA 3G49A 3IQWA 4B43A 4D4HA 5MFZA 3WYDA 2B8TA 1T8WA 3A28A 1J0CA 2HX1A 2CVFA 3AUSA 4NXMB 1KMMA 3ABZA 5JD4A 1WF3A 4R1NA 2BFOA 4C6RA 2WF7A 1B2LA 3G79A 5KHAA 2QT1A 1QPGA 3LBHA 1X1EA 4JJKA 5JATA 2VT3A 1NUQA 1K66A 4W1QA 4JBHA 3HL4A 3KWFA 1U2EA 5F5NA 3LGAA 2BLLA 4DSUA 4BGVA 4EA6A 2ON6A 2Q46A 1QO9A 3ZU6A 1OB5A 2G88A 1U1DA 2ERCA 1OTHA 3BIWA 3NHYA 3KU4A 2PRSA 2QE7A 2BFDB 3A9CA 4GR4A 4INJA 4KAFA 4G36A 3RU2A 3Q15C 1CR6A 3S1AB 5FEMA 1YZ3A 1QB7A 4WV3A 1KKLA 1GRNA 5H68A 3O84A 3Q0IA 4ZN6A 3H9EO 2QE6A 4U7WA 2GN6A 4OOEA 2C3YA 4IGKA 2GETA 3TAXA 1RRFA 1YQDA 3GAAA 4ZAVA 3GFTA 4C6TB 3ZHZA 1MA3A 4UATA 3I61A 2BEVA 2XJ9A 4IH9A 4QOIA 4CWAA 4JROA 3ZS8A 2A5FA 4AZSA 4TZ6A 2I80A 3BK2A 4C3OB 2D2FA 2H1FA 2HBZA 2X2EA 3V4SA 2WLTA 4WKNA 4K9LA 4AKTA 4QM7A 1ZHFA 1SJ9A 3PHBE 3U7RA 3BERA 3LS2A 2GJ4A 3WKEA 2C95A 1PGNA 1N6IA 3JATA 4XDZA 1TE2A 4F6RB 1V4VA 2NG1A 4LXTA 4ID9A 3V6MA 2B30A 4JQYA 3GLHA 4KYVA 3RK1A 1E7QA 5MN4A 3OIGA 1JEDA 4L2IB 3QVOA 3WIEA 4JJZA 1JWLA 1MFZA 3VPCA 3WGGA 5DM70 2XADA 5AW5A 3KE9A 4IV8A 4ZYWA 1DQZA 5D3MA 2BYTA 2FG5A 2PX0A 2O5EA 2CVQA 1RJGA 4NFYA 4YP6A 4FI3F 1SC1A 1NN1A 3W4JA 1B93A 2VEOA 3U3MA 1YB6A 4BAGA 2ZANA 1YQGA 2IELA 3H05A 2GBLA 4HX9A 3VI4B 2HJ9A 2Q3DA 1ZM3A 1XELA 3W2FA 3ZHVA 5BSUA 4NFHA 5ALGA 4BTVA 5BQ3A 3FB4A 5KOJB 3RHZA 3VC3A 1GHTA 1YHYA 3WBBA 1E0DA 1GCGA 1WCYA 2Y8EA 1JSLA 4TM7A 1K8XB 2C83A 3ZXYA 4AZVA 2O1XA 1X42A 5LIRA 5DM4A 1TKBA 4XX0A 4ACAA 2TSYB 4L6IA 1ACMA 3OF2A 1XXHA 5LLSA 2ES4A 5ALHA 4Z9AA 1I7SB 4J0QA 1PYDA 4NCAA 3SZ3A 2IKQA 3QVXA 1F1JA 3TFWA 2C0CA 2BY4A 2NSHA 3TG8A 2H5EA 2WVJA 1N92A 2I1LA 2X8BA 3EZ2A 1DAIA 4ERXA 1HF3A 5P8WA 2GNOA 1H94A 4XVRA 2ZYHA 4HL6A 1PBTA 2ISQA 2ZR7A 2XYVA 3ZI0A 3NOQA 4QBFA 3VKHA 3DZDA 3K1AA 4H7IA 1NJ2A 3WKCA 3TNDA 4BN0A 2G5CA 3L8EA 4QLAA 2SHKA 4DYHA 5EKSA 1R18A 1WUHS 1DAHA 1L3BA 1QPBA 1N4DA 2HMWA 1G1MA 2WHPA 1RAEA 2CK3D 2XUHA 4PIVA 4IWXA 4YJ3F 2LZ0A 1WB5A 4MGZR 4OA8A 4RL4A 3EIWA 1QF7A 4N3GA 3OM8A 1JBQA 1D9XA 3CH7A 2ZZMA 1N1GA 4DM3A 5GIPE 1JDPA 2PLFA 3BJRA 3JWGA 2DPGA 4HF7A 1R4NA 1QIKA 3KBBA 2ZBUA 3ILHA 5CNMA 4MINA 3MTEA 4B6OA 4AY2A 2QLTA 2Q9BA 3VZRA 2HHHB 1CY8A 1NBEA 2Y9MB 3RRNA 5DF1A 4OQEA 3SFZA 5TMEA 4KQ1A 2GPJA 3DEYX 3JSXA 2BBTA 3TL3A 4MS1B 1S2DA 1E4OA 2G63A 2A67A 2Q1YA 2BAGA 3ZE2B 3OZXA 4HVLA 4IDGA 4LDJA 5EWLB 4MCIA 5BR8B 5BSTA 2Y99A 3GA5A 4LSZA 3Q8MA 2Q5FA 3A9WA 4I9NA 4DLPA 4URWR 1KI4A 2KS6A 4E5MA 2OM2A 1OY1A 2ZVJA 1E1CB 4TT3A 1TCBA 3UFBA 2RHLA 1JJIA 3K15A 4N5HX 4DNXA 4DSNA 4F1KA 1PFYA 2UZ1A 1R4MB 2XOXA 1E69A 2AJLI 2XODA 1MC4A 2RHCA 3C5EA 3QIVA 3R23A 1O94C 5JMPA 4B85A 4YAGA 1KR5A 1CS4C 2W37A 1Z4PX 3HJNA 1M6VA 3P9QA 4KRYA 4CM9A 4WJLA 1ZS9A 3U3OA 4BBJA 4TM8A 1JHVA 1KEWA 3B8HA 1J25A 1Z4LA 4LJSA 4KVFA 1EE9A 1JMKC 2W93A 1EPUA 3HCFA 2PDAA 2XTNA 4FEGA 1OA1A 1MAHA 3N8HA 2X0DA 3IVGA 3DSRA 3V6LA 1N2IA 3IEVA 1L3CA 1U0RA 3FI0A 3JS5A 4BKRA 4BO6A 4ZFNA 4PC7A 5JAOA 2NUTB 2P69A 2ETVA 3H9GA 4OJNA 1QH9A 1V3QE 2VWQA 5HQJA 4QGGA 4YRJA 3R7LA 2PX2A 4ZYXA 1DEXA 2ZRJA 4YHBA 2NOAA 1NTOA 3X1ZA 2O59A 5KTPA 1WD7A 3QMVA 3AVVA 1SA0A 4JI2B 2JGFA 3D7LA 1JIJA 2IDMA 2B9EA 4KYUA 1FPMA 1XL1A 4TL6A 2IT1A 2VPQA 4H3HB 4JLPA 3S7TA 5JQWA 1Y42X 2BTQA 4TTTS 1T25A 1QHHB 3ZU5A 2YWDA 1FP4B 2GRUA 1BJKA 1IU9A 3MTIA 4EQ6B 4CIYA 1P45A 4B4OA 2WJZB 2BGIA 4BFWA 1XB2A 2ZJZA 1P5FA 3OU6A 2I87A 2JGIA 4OAOA 5E6SB 5NULA 3X0DA 4Z8YA 2LWIA 5DBOA 4FR5A 4PLFA 1QOQB 4UNQA 3SJ7A 4AF6A 2FI1A 4IZ6A 2I7DA 1IBCA 2AG6A 4FMDB 3GFQA 3LCCA 2RGWA 1DRVA 1KSHA 3FBWA 3GIWA 1JI3A 1RJ9B 1JMVA 4RAQA 4X24A 2N46A 2OKCA 4MCJA 2IZ5A 1P73A 3R3WA 1HOTA 2ISCA 2Z9DA 3QJGA 2AZ4A 1S7GA 2QTLA 1PS9A 1D4ZA 1GV1A 2DHDA 5E3JA 5CB4B 2P2ZA 4GOKA 1WDMA 1I3LA 3KVNA 4IHJB 4LCJA 2ATIA 2WPNA 1PNRA 3WHIA 3AW9A 3PENA 3T5BA 4AB1A 4KBYA 1NVGA 4G4JA 2AN5A 2Q9UA 5JZVA 1UDXA 1J6UA 3B12A 4FNAA 4BP1A 1ANKA 3W5JA 1RPZA 4B7AA 3OQHA 1ZMTA 2WWVD 1C7RA 4HGPA 2B2CA 3W4IA 4DMMA 3E9DA 1CUJA 3K9LA 2WOOA 4EJSA 4QIHA 1CQJB 1LBTA 2H2FA 1KEPA 1ACJA 1T5DX 1LTKA 5BURA 2WICA 3MT9A 2ORIA 1RWXA 4QWMA 3B6JA 4B3RB 3DE2X 5JCJA 5K8UA 3MD0A 1MAWA 3CB2A 5B2ZA 1QFYA 1CJBA 4UNNA 2I5PO 3VHRA 4ZHQA 5F9HA 4M8NE 1K7CA 3A6LA 4K9KA 5DN6A 1A50B 3SQOA 4B76A 1D4OA 2GEBA 2IXBA 1WA5A 1Y34E 1XQVA 3N7AA 621PA 2P90A 4GLOA 2WWYA 4A6XA 1KNXA 1UAYA 5LP6B 4PLTA 1IXKA 4Y6QA 4KOEC 1GAJA 3GJTA 4Z1MA 2A9OA 3L8HA 3B3QA 3I58A 4LNHA 3H11A 1U2DC 4R0MA 2H0RA 1ZGJA 3ZI4A 1RWNA 2A0FA 1NVUQ 2FX2A 2OBXA 3CUVA 1ORHA 5C1BA 5HBRA 2D7JA 3HB1A 3N9IA 1JWBB 4Y2TA 1EFAA 3Q3EA 1NOJA 1UKVY 1NW8A 3CY6A 1QVRA 2K7ZA 3COYA 4GQIA 1XRSB 4PSCA 1MX9A 4MV8A 4ZAXA 4L4YA 1DX4A 3KJEA 5F64A 3WQQA 3KK0A 3O82A 2H5LA 4RTOA 1QOZA 2ZB3A 4L5CA 2EW8A 1ABFA 2FFBA 2GM9A 3A3PA 3K3PA 4HEJA 4OXQA 4TV8F 2FPKA 3LTEA 4MW9A 1TM2A 3KS9A 2G0TA 4PGMA 4TMVA 5KKAA 3WYFA 2AEEA 3F6RA 1I80A 3NVAA 2PMDA 1U99A 3CCBA 4B79A 4B3GA 1XWIA 4XXHA 3W6NA 3QYAA 3VTAA 1HO3A 4RGVA 3TLEA 1BQEA 3BOSA 3ICWA 4GIBA 1RXSA 1XXHB 2O6HA 1PN3A 4KI0A 5ULLA 2DKFA 1Z39A 1WKVA 4ALMA 5CDHA 4PRZA 1KK2A 3NETA 3GCDA 2ZSEA 5AKXA 3WB1A 3GEBA 4QOGA 4D9FA 2ZJ6A 5C34B 4EPXA 2Q3HA 1DPGA 4GOOD 3FPCA 2A94A 1EP9A 1Z0FA 2FWPA 1AS0A 1N1EA 3UWDA 1I3KA 2UV8A 2FTKE 2V3WA 5F78A 4GUAA 4B4WA 1JEEA 4S3MA 2VDLB 1Q3HA 3OICA 3Q72A 2PANA 3IDFA 2GN9A 3DEKA 3LX5A 3PS9A 3UENA 2HA3A 1BN6A 3HU1A 1SCAA 2ATEA 3GA7A 4ITRC 3TTTA 2EL9A 1JHRA 5IX8A 1EU1A 3B3FA 4JSYA 2MYPA 4FYXA 1C30A 1K7SN 1U94A 1W5FA 2XF8A 1U6IA 4JA2A 1PT7A 4ALJA 4ZCTA 5DX8A 1R66A 2XWPA 3Q88A 4PWYA 4WLOA 3C4QA 3K2EA 1FC0A 3OOHA 3ZLVA 2J3DA 2CC2A 3U61B 4XGRA 2B3DA 2WSYB 3EFHA 1A5ZA 1A71A 3RHFA 2C4NA 1SFRA 1C3XA 1PAUA 4ARSA 5H59A 3HB7A 4EJMA 1ZN2A 1BDBA 1NMZA 1B8NA 2ZTVA 1GU0A 1ZVQA 1NW9B 2IWHA 4UFOA 4QNRA 5FA8A 1DPFA 1GLGA 2IOYA 2Z3WA 1EQAA 4IHQA 4JP8A 2Z8YM 4XR4A 1FFDA 1X1SA 3NO4A 5AJWA 2VI5A 4EB0A 3M4YA 2JGJA 4KL8S 5BRNA 3W5HA 1C9KA 1VYHA 1X1TA 1AY0A 4EHIA 3ZQJA 3CMMA 2YJTD 5FQOA 1TX4B 3B9BA 5EJGA 4X64B 3P5BA 5J4LA 2QU7A 4K8OA 1LDMA 4G1VA 4QBTA 3S6JA 4H35A 1CUFA 1C7FA 4DMHA 5I51A 3ED5A 1YR9A 3FLAA 3GZTB 5ENDA 1J97A 3EUWA 1A9XB 2MYTA 3KHTA 1S3GA 3BXOA 4WFKA 4ERNA 2PX8A 1QGYA 3A6JA 3D3WA 4D44A 4QT0A 4Q1AA 4XD7A 5AOVA 2EKZA 3DTVA 2KI5A 2V45A 3O4GA 1NC3A 3F78A 1GYRA 2ZIVB 3CV3A 4I4IA 2WT4A 4Y2GA 4F5DA 2PX6A 4EA9A 3KQPA 4MJ3A 2FQ1A 2GN8A 2OGWA 3WBJA 4AG3A 2CL5A 3MELA 4D5GA 1UZMA 1W4CA 4OYYA 4W5TA 2GXAA 1ZUNB 1GZ6A 1QG0A 1QIGA 2Q0QA 5ED0A 3N0VA 5BV0A 1NDHA 1V41E 3EF0A 1XTKA 3UK1A 3RAEC 4RZXA 4CDMA 1N78A 4IH4A 4UMDA 1XAGA 1QONA 1XPJA 2QMHA 3IS3A 4K2AA 3TSZA 1NBOA 4DQVA 1KWGA 2OTCA 1GTG1 4DSTA 3DT9A 4DXHA 1ND6A 4JLAA 4DCNA 2HHJA 3CT6A 2A5GA 1K7XB 1ZCAA 4FKZA 1L5WA 3AEYA 3KFVA 3PR1A 4AW9A 3GUZA 4KLRA 3DEIA 2XMZA 4N8DA 1O97C 1Y4DE 4MR7B 3G0OA 1FFYA 1Y3CE 3L6RA 4G01B 1XROA 2HSEA 3Q9NA 1LS6A 3OIWA 1T15A 2HL6A 5DNDA 5T8KA 1FDTA 4N82A 3PLRA 4QXQA 4NOJA 5A5DA 5CM9C 4ND8B 2ZRHA 4K6GA 2MHCA 3WSWA 2C5GA 2FUEA 3N2NA 4P6VF 4Y9TA 1KC1A 1NT2A 2D5AA 3JQGA 5KTOA 2VCHA 1G7CA 5EIAA 3HJFA 5K3EA 5IWAB 1Y37A 4A15A 3OJLA 4XH9B 3ABIA 3N76A 3O4RA 1TZCA 4IHJA 4RM2A 1C9YA 1GTZA 5CUQA 5TJHA 3TECE 1Y82A 4KV9A 3GGSA 1AHIA 4J0IA 5TGTA 1LF0A 3BHIA 4GYJA 4LJ8A 4TLAA 2OFFA 4M9SA 3NBXX 1TLLA 1Z06A 1UFQA 5JRDS 1WX1A 1DUIA 4XOIA 3ZK8A 1JIKA 4FFBA 5E95A 3IELA 4LAFA 2QIOA 3GEDA 3IO5A 4ZVOA 3SZOA 1UPFA 2ZP1A 1QAOA 4HQ0A 1XMQB 4F8YA 1NI4A 2UYGA 3UYKA 3D8UA 3I6IA 5CURA 3T6KA 1BSVA 1RWMA 1V3TA 2Z04A 3ONEA 4JEMA 5GZ1A 2B5OA 1TZMA 4XRGA 1DAMA 4IS3A 1J21A 2VF4X 3WWDA 5LYJF 4WOBA 1Z4JA 1PD1A 4JK3A 2NX2A 3D64A 1YR2A 3EQ2A 3HN7A 2XXAA 3MGKA 3TOVA 1XLWA 4Q4HB 5AK4A 4BO5A 1U0TA 3DCNA 4DQLA 4EITA 1KJNA 2C7PA 2HQSA 2QRGA 4R31A 3R0ZA 5F7JA 3BWMA 4HQNA 4NE9A 5LA6F 1KEEA 2ZRAA 4OHCA 2GVDC 2LXNA 1GYQA 3K1ZA 2VH2A 3DOFA 1AG9A 2TMDA 1F2TA 2IZ0A 1CJUC 2LV8A 1JR3E 3GV0A 3ZHRA 3GGDA 4RKEA 5JAQA 1P2FA 5E2BA 3PUHA 1JEAA 3BWEA 4X3CA 3P94A 1N75A 3B9PA 5JPIA 4E21A 4LV8B 1DG9A 4RD1A 2OAEA 4KEAA 5CAEA 4YJ2B 4JB8A 3I76A 1JDBB 1QQBA 4ZARA 1M34E 4KO8A 3ZVRA 1ORTA 2HTEA 1MB0A 2GOYA 3RM3A 4DKXA 4URVR 3W8DA 1RMYA 2CUNA 2GK7A 2OUKA 3UUWA 3U48A 3EGVA 3EN0A 4GQBA 3ROTA 3C3WA 4RK0A 1C0KA 3D6AA 5H16A 4UCXA 5KBYA 5JXHA 4DRXA 1YV9A 4PAMA 1TDJA 2NV6A 3D6VA 4QQRA 3FCOA 1P61B 1V0JA 5CLIA 1SQGA 2OK7A 4KQJA 3HCBA 4UVGA 4G23A 4BMPB 1EX9A 1XAHA 2GSWA 4J91A 2F9MA 1Z73A 3OPYB 4Q1DA 2KMLA 2YQZA 1QIFA 3EFOB 4WFJA 1IFXA 1J90A 2AC7A 3LA8A 4WACA 2YWJA 1DAKA 1C3VA 1GGVA 5IJZA 4YRDA 3HXTA 3PEFA 3A2NA 3HJBA 5KX5A 4BX2A 1UQUA 3AR8A 1NP7A 4IVRA 3UOAB 4GM1A 4PGFA 3AESB 3CC8A 3KFLA 3OM9A 1R0XA 2TS1A 2P11A 1P6XA 3JY6A 3JD1A 1WUYA 5BOVA 2V5AA 4G0UA 4TLBA 1DKUA 3FCEA 4R8KA 4XQEA 1HRKA 2RKWA 2VJBA 1L7XA 1NASA 1E63A 3D4PA 1DWQA 4PLYA 2JI4A 4UUQA 4GX1A 6YASA 2IZ6A 4NMMA 4FMDF 1TCAA 5T6BA 1GFZA 2J0UA 3CZCA 1DCFA 4TWZA 1ECGA 5PNTA 4YRMA 4LZZA 1H8HA 4QL3A 1XEWX 1LDBA 1HDEA 4ARAA 3WV4A 1T5HX 4W9NC 1RYDA 4RIHA 1Z0DA 2LR0A 1USWA 1D0SA 4YONB 3WVNA 3W7BA 2I1VB 2W71A 3MBKA 1TA9A 2OCBA 1T5TA 1Z7GA 2ZRDA 3DUFA 4LTDA 3UAOA 4ESHA 5C1PA 1MA0A 3CLSD 3QUCA 4P54A 1GRCA 2VIIA 4B74A 4B6RA 3PRJA 5ECWA 4IVPA 1HG1A 1OWNA 3SIWA 1VMDA 3KQUA 1OOEA 1YC5A 2D54A 5E2IA 4TQ9A 4YRPA 3VKFA 3F5MA 3EIXA 2JH8A 3KEFA 1U28A 2TRSB 4CEJA 2MSNA 3EOBI 1JALA 4J94A 4BASA 1HDXA 1NG9A 1M6NA 3B85A 3HP1A 3CQ9A 2I8AA 4ZALA 1TCUA 1OZFA 2OB1A 3PNLA 5KWIA 1EFPB 1SQ5A 2AFIB 1HC7A 2XSZD 3HCOA 5JCOA 1GZDA 3KFXA 1JLLB 5BW6B 4EENA 3AILA 3MMXA 5AUNB 2VHJA 2GBIA 2F48A 3SJUA 5KO2A 1W59A 2L69A 4G5YA 1DUVG 2SICE 4MV1A 4QYIB 4EPWA 2IOQA 3QWFA 1ZIXA 2BN4A 2IKSA 1DLJA 4KQ9A 4K6FA 1JXMA 4KWTA 5A3SA 1OJ7A 5JCZA 3IX7A 4UOQA 3LP6A 2ZCJA 4XCQA 3DFFA 1EZZA 3ENNA 2I67A 3JW8A 2GFHA 3D6TB 3GELA 3O94A 2W2OA 4JJEA 3GDWA 3GVXA 4QXPA 4DLLA 5CA1A 1H2AS 5KJEA 1AS2A 4AL4A 1IONA 1JAHA 1YXMA 2X41A 2BR3A 1R8SA 1RRKA 3U81A 1SOMA 1AUQA 3DV0B 1UPCA 3HS3A 4JXZA 5JG7A 4LISA 4XDHA 5IULC 1UEIA 3ANTA 3C70A 1K6EA 3VTZA 4GPAA 3TNFA 1DJOA 3BFVA 4LRTB 1XGKA 1UMBA 1NU8A 2W2PA 1XLUA 1ZU4A 2R1ZA 3OPYI 4U6SA 1UJ6A 1RYBA 2A30A 3RS7A 4Q1BA 5LQJA 1FBTA 1KI7A 2CLLB 1WETA 4TYYA 2G07A 2RBKA 4QOHA 3CNEA 1JLRA 4HQRA 3WIVA 3QVMA 1AO3A 3FYSA 1QCCA 2FMIA 1CJCA 3I2GA 5TE9A 3F5DA 4CM5A 1NGSA 1MN6A 1SUIA 2J7KA 3B82A 4RA6B 4PEVA 1FNSA 4PNZA 1YR7A 1XQ1A 2VDWB 5ED4A 2N1MA 2PSJA 3QMMA 2PUCA 4DA4A 1NNI1 1PQWA 5E1MA 4AX8A 3HWSA 3H2HA 4IQ0A 2RHWA 1B16A 1ETUA 2QG4A 1N8SA 1UXOA 3ORHA 3TINA 1K5DA 2XVZA 3T7SA 4IIBA 3CO0S 1GR0A 4OMCA 2OG1A 4WCFA 1P4JA 1CUBA 1E3IA 1ZRNA 1OXMA 3ONFA 4OV6B 4KWHA 2AJ8A 3FZEA 5ER9A 1DV1A 3B36A 4KQHA 2I9KA 2IYQA 3PXCX 1LC3A 5E8JA 3ZX4A 3EOZA 4EA7A 3AG5A 4TKZA 1A4IA 5JJBA 3LKZA 2AI3A 3H1PA 4RUKA 3REGA 2G9QA 1UM8A 3AIKA 2Q5CA 3KJHA 4HQFA 3MCAA 4MA0A 1X7XA 3FKSA 2X0RA 3CZ5A 3GJSA 4XIYA 3QW4B 5B1EA 1IPFA 2E4YA 2ZIGA 3I3OA 4LXUA 5EPOA 2C7QA 4BTLA 1IJEA 2XDYA 3MS7A 1WQ3A 1YF3A 4N0PA 1YFKA 3HRIA 4K7JA 4NFLA 1DKLA 1G5QA 1CY7A 2QMYA 1FK8A 3FPEA 4CQNA 3OX4A 2IIVA 3U1BA 4XB2A 3PQFA 4OKIA 1F6DA 1C0PA 1ZGZA 3D4IA 2IIBA 3O4JA 3PFNA 1Y7HA 4JC0A 4MMZB 4QBKA 4H6XA 4V02A 3RW9A 3ZCQA 1TEZA 1QPZA 1U4NA 4PXAA 2MMGA 2IUEA 2PGLA 1C7ZA 3KQTA 2V55B 4LE2A 2XE4A 3U3XA 3ZU4A 4ZHQF 3B3GA 2YCBA 3EG5A 1JKJA 2GHRA 3TLMA 3DDOA 1RZRD 3BGIA 4EB3A 5FL7D 4CCAA 3GJ5A 4D9BA 1DIAA 3L4JA 4KACA 2QU8A 2FWBA 3Q5EA 1YL7A 4ECAA 5G0WA 1JR6A 3ZCVA 3JQ8B 1MX1A 1L4LA 2B4RO 4B83A 3STYA 4DJDC 3QLEA 5A4AA 1TYZA 1OWMA 2VYQA 1VBMA 4RMJA 4MRRA 4D74A 3BJEA 2CXQA 4Y9DA 3SPXA 4BNXA 4X1YA 4Y1EA 3DL7A 3TZEA 4I4TB 4FTWA 3UB3A 4QULA 2H1CA 3ST7A 1DTEA 1XU4A 5B1HA 3QNWA 3VPDA 1MTOA 2P2YA 5LYYA 4EARA 3MSCA 1YDFA 3O1IC 2QSUA 1ZJ4A 1MV8A 4I5GA 2H1WA 5DRTA 5C5EA 3DDUA 4I55B 2QJRA 4BNDB 3G0HA 3ORRA 2OCYC 3N6RA 3T1HB 3FVRA 2ZEJA 3M33A 4R98A 4NCBA 1BWQA 3L1JA 1Q7GA 2F3UA 1PDVA 3LXUX 5AT1A 3WL6A 5ARDA 4XLZA 4EF6A 3ZY6A 1EFCA 2OCAA 2ID9A 4JELA 3V2HA 1ULZA 3M6FA 4N9QA 3V8EA 5L6LB 4A16A 3V4RA 3SQLA 2WSMA 2N42A 1EDZA 1YKSA 1KRXA 2DJ5A 1S3IA 1SUDA 2G0AA 5I7FA 2PN1A 1T5LA 1Y5NA 3OBBA 1YKFA 1POWA 3TZCA 4BN5A 2HAEA 3MXTA 5FNZA 4C2AA 3OEED 3T3NA 2C4HA 2J0UB 4TTPA 4GP9A 1JQKA 4MYSA 5AWFC 3L8DA 5JVDB 2B7CA 5FLYA 1G21E 4ISBA 3RU7A 1RI1A 2ZJ4A 3PUXA 4PWZA 1GUDA 2H29A 2VSFA 1C8LA 4TXMA 3O4VA 4X00A 3DJFA 2EKQA 2V9ZA 2AI1A 4RH3A 4FIDA 5IBPA 5EUBA 4NBRA 5ELLA 4Z7NB 3AY6A 3QITA 2BKLA 1K7FB 2RGBA 1LD3A 3EY4A 5IXJA 3FVTA 1EUCA 3V8RA 3HN2A 3C3MA 4ZOQI 2BR4A 5I9BA 2C20A 5AKYA 1G20E 2XQGA 2P6OA 2ZRNA 3NGMA 3CX3A 3NOXA 1W0KA 1O6ZA 3NBFA 4ZVQA 4DMLA 3L18A 1SRQA 3NGXA 5EUQB 1JPUA 1XHFA 1F4VA 1V3UA 4PYQA 4R2JA 4YS6A 5BNWA 1ZVMA 2O2YA 3OA2A 4X71A 1WVMA 1ZM4A 2QRJA 1FEZA 4Z7QB 4RDXA 3A3YA 3QPDA 5FADA 5GQSA 1L1FA 5JZSA 1TIKA 1E3WA 5FTNA 4EAAA 4RYDA 4QJIA 5M04A 1XCJA 3DLCA 3HE3A 5E9AA 1FSSA 2AOUA 3WNCA 4ZIRB 1CUWA 3A6EA 4IICA 3IV9A 5HE9A 5I01A 2FRDA 4B3MB 4TMXA 5L4SA 3ZHSA 2WMOB 1IEWA 1Y3FE 4YXFA 1FL9A 4WKBA 1L4MA 1KGDA 2I0FA 3B1KA 3DTTA 2J5XA 3AKCA 3OE7A 3BD9A 4ESVA 4O63O 3JQBC 1MOZA 1AF7A 1ADGA 2VBGA 3OH8A 1AT1A 1Z37A 3VU9B 4EPTA 1M5RA 2JGLA 3SQXA 4KODA 4L51A 3TX2A 3CE6A 5IXSA 4NHEA 5AVUA 3KKEA 3I8OA 1YJXA 4NIMA 4CNBA 2G40A 5KOIA 3THYB 1VL5A 2Q1UA 4RLFA 4DW8A 1N5JA 2D4AA 4E5YA 1OCEA 3HBJA 3EVNA 5AMXA 3RAJA 5FOXA 2WWTA 3E9ZA 1Q14A 3NX4A 4HSGA 1TU0A 3IC5A 2H0QA 3JD0A 3KPJA 2OVBA 3K9CA 1GA4A 4I2NA 4BNTA 4C7OB 3HO8A 2HT6A 3PXEA 3QYJA 4CDRA 4BS9A 4UC0A 2RGXA 2X86A 3I32A 1CUIA 4MAFA 4DA7A 2OHFA 3EXHB 5A0VA 1RRGA 1XQ9A 1SCBA 4DABA 2ZKLA 3LGXA 3C48A 1TW2A 4IFBA 8ABPA 1RQ7A 3ILVA 4ZKEA 2H00A 4TSKA 2C7VA 1TEVA 2ZSKA 1GNLA 4HNGA 5F1KA 4M6WA 3VH4A 1R15A 1S2IA 3LHIA 2I7XA 2BSQA 2JGAA 3ZWQA 4REOA 1L5FA 2NNLD 2ZXUA 1MUUA 2COUA 4X65B 1PUJA 1IJKA 3ZH9B 4BIIA 4L57A 3ZW7A 1KH1A 5CBPA 5KYXB 2J3EA 4N5DA 4C4PA 5LQMA 2E21A 5B3KA 3QSGA 5BWBA 4GNRA 1JQAA 4FYKA 2VSNA 3TWOA 3S8EA 3IIJA 2YQ5A 3L8GA 4DLNA 3WNZA 5CITA 4ZRMA 2RGNC 4DR3B 4U4AA 4D3DA 2GILA 1SHLA 4NU8X 2W6CX 1E4YA 4U7PB 2FPMA 3JWPA 5TARA 2C82A 4AZWA 4AS1A 3ACDA 2BWJA 3BSYA 1CZNA 2AOTA 2GS9A 3DMRA 4E7OA 3P7MA 4GM0A 4HCJA 4GZMA 3WQSB 2CUKA 4NULA 4TX1A 1QGZA 2YINC 4X91A 1RXUA 3TZ6A 3KB2A 4YLEA 5GP1A 3SDZA 3KZNA 2BM9A 2OCKA 1NXVA 2RG1A 4PQEA 5CG1A 5AW0A 2R9VA 2W6JA 1G8AA 2G9ZA 3CIOA 4RESA 5K8JB 2JD0A 1M73E 3HVRA 2FN9A 3CPEA 3MT0A 4DJAA 5J2TB 3PPVA 4DCCA 1YZQA 1AKTA 1JEYB 5MGNA 1RVDA 1IHUA 4JXKA 4B32A 2XNJA 2J4DA 2OCDA 3DBRB 1Y9EA 3GUHA 5DVZA 3RUCA 1EX7A 2OC9A 4YJHA 4X90A 1IIRA 1EEHA 1GADO 1JPNA 2BZ0A 2WJ4A 3CXRA 3AR4A 3L1VA 3L7YA 4PLCA 3WLRA 4D96A 5K3BA 4RZSA 1E6WA 1ZPDA 4B80A 3RUFA 1VI5A 1MJFA 1AHHA 4S0XA 4F96A 1FW6A 3LSTA 4Z9FA 4WNCA 5KTRA 1E1CA 3DQPA 1G3QA 3I12A 2XQIA 3P96A 1OH7A 4NCHA 1HYBA 1VZ3A 3K1TA 1M7BA 2IW1A 2JFVA 5D6OA 4MVJI 3DJYA 2PIAA 3ICCA 3LT0A 3L7AA 4NQZA 4UZFA 4ZZ1A 4I2VA 4KYIB 2O8NA 2DT8A 5DFAA 2H18A 3ABSB 4MJLA 5CYOA 3KVOA 5TEVA 2XUFA 1IWBB 3LBIA 5DIFA 1CR1A 2QNIA 4OJTA 5ADVA 4I8IA 1VPLA 5JADA 1U0FA 3PC8C 3GAMA 4GMHA 1DU4A 1R0LA 2YHSA 3IMFA 5FIUA 3TD2A 2JLVA 2D1SA 4WWHA 5PGMA 2REOA 2E37A 1SD5A 5FULA 2Z8ZA 4ZPJA 1GG2A 2BOVA 1KH3A 1ONNA 1T4CB 2XKAA 4G1UC 4MWBA 3ZWMA 5JY1A 1XMIA 2Z43A 3EEYA 3VBCA 3VVMA 5BN1A 3J81k 5T6MA 5SICE 3WGZA 1YI1A 3WADA 6ADHA 3B7PA 4P98A 3BIFA 1IY2A 1C9MA 2YNMA 5IARA 3P0HA 1JV2B 4LVCA 5LQDA 4JBLA 4JBYA 2QMZA 1XZAA 1K5PA 2QTZA 3ADOA 1D2MA 3GVPA 4GGPA 3PL1A 3FCSB 4TVKA 1ZH6A 3SZGA 3L6DA 4N12A 5ITVA 5JCPA 4MRAA 4ZEOA 1D04A 3KL4A 3SXUB 3TR0A 5E7JA 3VR1A 3TW8A 3F5SA 2AMFA 2X58A 3V9PA 3OD5A 4JDPA 4F45A 3OPVA 4OM8A 2PD6A 3WDKA 3MAJA 3NBMA 3WYGA 2DQ4A 3L05A 1DZ3A 1DO2A 1T91A 1DKMA 3FRIA 3K0CA 4ML3A 2PS0A 4JT8A 3DLTA 3VC1A 4WXPA 1A8UA 5EKTA 2RK3A 4FJ1A 2G7ZA 3B9RA 5C7LO 5JWHA 5IXYA 3FYUB 1WQ1R 2FWIA 1KDPA 4KO2S 4UNIA 1XD9A 2RGYA 3NCTA 3P26A 2ONJA 1NOIA 3RUAA 4MITA 3RFTA 2RB4A 1KDYA 1KU0A 1G8KA 1N6LA 1KS2A 1VIYA 1W30A 1Y1LA 2LDBA 2OLEA 3CNBA 3BBPA 3E4DA 4HWPA 4N0EA 4OYLA 3ZD7A 1KQPA 5J1SB 2PWPA 1U7UA 4CGYA 3LD9A 4DR6B 5G41A 3BWBA 4C4SA 2PSFA 1TQ8A 4ER7A 4HAYA 4UBIA 1B6RA 5JRZA 1XA3A 2ZS8A 1S3FA 3CF4A 4R9SA 4BTEA 1E3DA 2GA8A 4X3OA 1WU8A 1WMEA 1GL6A 4JUDX 1YJAA 1GUAA 1LBEA 4KGZA 1MENA 4NL4H 2ENWA 1AZWA 1CQJA 1HZJA 1KJ8A 3MTAA 2P9QA 1RLTA 1JLHA 4QUDA 5DEIA 1RWPA 4BLTA 4E70A 1T34A 1BXZA 1QHSA 4DG9A 3MHTA 1H2BA 3NZEA 4ND3A 1CJMA 2Y1DA 4M8IA 4ZP1A 4YYZA 4HDCA 1B8OA 2BGUA 2QP9X 2O14A 2HSWA 2FSVA 1VGRA 3PX7A 1OBVA 1PL7A 1VCOA 2WVHA 2RGUA 4KPGA 1T8UA 5DLPA 1KTVA 4ZXFA 4IINA 5TT0A 5L7TA 4JLSA 5CGQB 3H87A 2NV2B 5SY6A 1Z22A 3CIFA 1FFCA 1FXWF 1HL3A 4XIJA 1MXFA 2XUZA 2ZPAA 1A8SA 1G7TA 2XVYA 3VU1A 5EJ6A 5JY6A 4C1BA 3WB0A 1TJ4A 4UUMA 4ASUD 1CE8A 4U6NA 3TTUA 3R8CA 3GVCA 1II9A 5TQVA 3L7CA 3MTGA 3S8YA 3TX6A 2EYUA 3QUTA 3PK0A 3Q11A 1XDUA 3O74A 4F9EA 4XDYA 3TAHA 3TTVA 1I4WA 2Q0XA 3WLOA 4OQYA 13PKA 1KFCB 1T1EA 2IY7A 1EVZA 3PHJA 4C76A 3EDRA 1UZLA 2EDCA 4LZLA 4EZEA 2OV8A 1A7UA 2IY8A 2HCJB 5CA0F 2QM3A 2DWPA 3R44A 3ZJUA 1T4MA 3QOFA 3A4YA 3ZDDA 1MV5A 3FCXA 2B4YA 2PZLA 2FW1A 1KJZA 2JLQA 1Y8AA 1KXZA 1YQUA 4PCVA 2QZ4A 1MIOA 3V00A 1RP1A 2PO7A 3AR9A 4O0MA 3ERCA 3HXOA 3NVDA 3QBEA 5B30A 5DTEA 1Y8CA 4ZVKA 2RH9B 2XOKA 2ZYRA 3VZSA 2PZJA 1UR5A 1ZP6A 4NQRA 1KFJB 2P9CA 3CUTA 1KP3A 2NVUB 1W29A 1KL7A 1KO1A 2XITA 3I52A 1CR0A 1JQ5A 3JQ7A 3KKMA 5ALQA 3LC1O 1H6CA 3WLPA 4D41A 3WAJA 1I36A 1NMEA 4CR6A 4IIJF 5I48A 3KWMA 4O8ZA 1JEQB 1RQLA 3AJ8A 3A1DA 4H77A 4QM6A 3UGQA 2A1UA 4D3SA 1KDRA 5ITZB 1TJNA 3A10A 3JQDA 4UBJA 4EAQA 1U90A 2C7GA 2PUAA 3THSA 5J5CA 1SIUA 2DECA 1ORDA 1PR4A 2LNDA 4FM9A 4BNGA 1HORA 5FO1A 1BVYF 3SGLA 3COWA 4MRMB 1JG6A 1PWYE 4I6JA 5FL7A 4DLZA 1OB2A 1P0PA 1BXRA 4P4SA 2Z2IA 3AQIA 1RQRA 1E8MA 1XALA 3RS9A 5DTQA 3NEPX 2IYAA 2EU8A 2NQTA 2AX3A 3GNQA 2GN2A 4E51A 5DCYA 3HO1A 3W9SA 1NQWA 2Y1EA 3AJAA 1JJFA 2GZHA 3JD2A 5FNVB 1R74A 3DMNA 2I4IA 2X14A 1V1RB 3OLXA 1J2YA 4AO6A 3LBFA 5MFPA 4XLLA 1DMRA 4IGFA 3DLHA 1CWUA 2CXXA 2X8AA 3GPBA 2H54A 2JZNA 2RC6A 3PXAA 1VRWA 4BU1A 5JI3E 4YCNA 3QX3A 1KYYA 3PVCA 1TM7E 2P3QA 4LBVA 4R54A 2FZ4A 3C6ZA 2IYSA 4D6XA 5EGNA 4HLQB 4KU4A 3BMCB 5KYKA 3PSHA 4KQKA 3FWYA 3AHHA 4MQMA 3GGGA 4RA9B 4RFSB 3WOHA 3I1JA 2F62A 1D03A 1XYGA 3NHFA 4F60A 2NZUG 4MICA 5BMVB 3UJ6A 5A1TA 3S1SA 3F96A 3BCHA 5CYGA 2DPLA 2RIRA 1D0IA 2PH1A 3SC6A 3WL8A 3ZJ5A 5HKKD 4DDWA 1H05A 1SEVA 3G88A 5LQNA 5I9LA 2Q5JA 1HLGA 1K6MA 3KR9A 4PINA 1BMFA 4L08A 5E6RB 3VYRB 5EJ4A 5KSZA 1XQXA 1ZD1A 2QE7D 1DP4A 3PCTA 3NH9A 4E5SA 1U5BB 3KT6A 1YS6A 2HBRA 3M5CA 2EKDA 1KMNA 4GC9A 5EAIA 2ALJA 1T9DA 3T5MA 1HETA 2R8EA 1WF6A 4NESA 1ULTA 2NYVA 3FFXA 3L0IB 4XGKA 2XDWA 4BLQA 2ZFUA 3EXEA 1YUBA 4FJ0A 4V0OA 1ZBDA 1IK4A 3KETA 4X3PA 5EJ9A 5TX7A 4TXLA 1E0JA 1PFGA 3QOWA 1S02A 1B43A 2IEAA 4BX9A 1YZVA 2PFKA 4OMUA 4ZO7A 3VVCA 4YQFA 1H8EA 2PEYA 4NEGA 2BLNA 1CFJA 5EMNA 3SKYA 1GP2A 3IP8A 3K09C 3PNKA 3I4FA 3QWBA 5FI5A 2WTXA 1Q0RA 4L8FA 4JR2A 4B87A 5KVSA 3W5DA 1SBHA 1WDLA 2Y0BA 4DDHA 2AQ8A 1DT5A 3EH2A 3DM5A 2XRZA 2BTEA 3SM3A 3GP8A 1V8FA 1ZN9A 1BN7A 2WINI 3LCJA 2YYYA 4XYGA 3W7AA 1OV6A 4YJDA 3RT9A 4I5IA 1IXSB 4IY1A 1QRUA 1JPJA 1WPQA 3FX2A 3H4TA 1HL7A 1A04A 2BEUA 3JR3A 3P2EA 3SLRA 4U2FA 3GMSA 4CMEA 3VDXA 2D5CA 4TV9A 1HH4A 5DMHA 3ZD8A 3PL5A 5DBGA 2JJMA 2JJYA 3P0EA 2YOHA 2OPHA 3ZWKA 1L4KA 3WKDA 3H7IA 4KUEA 5CTJA 3MT8A 7REQB 5AW4A 3GBVA 2HSJA 4TL9A 4U1RA 2DKOA 2HRBA 2QVLA 4GX0A 1NY6A 4EMTA 4J4BA 2DG2A 3GLVA 3RIMA 1XPRA 4H15A 1OWOA 3L6OO 3J81A 5F9MA 5AIAA 2HMTA 1SXJE 2UXDB 3G02A 3CTMA 5DN6D 2PBZA 2AXNA 5EZSA 2Y68A 2O7VA 4LQDA 4PANA 3KZCA 1Y63A 3QUAA 2P5UA 3O31A 4MW0A 4ZV9A 1JA9A 2OXIA 5M7EA 4Y9UA 3EOAI 5J47A 5AHOA 4YGXB 3KQMA 2HNAA 1ODFA 4NU0A 2OHIA 3S28A 4BFUA 2ZIAA 3PUZA 4DJ5X 2YZMA 4EL0A 1C0LA 2XE7A 1EFVB 5EEGA 3T9FA 2AFVA 4LEIA 2XR1A 4QLOA 1AV6A 3EVCA 1BMTA 1WKCA 4GYWA 2YV5A 2NNWB 1EDEA 3BL6A 3K6JA 3LNCA 1Q0LA 4K40A 2QMEA 4QGFA 4W8GA 1KHTA 3DO8A 5DNWA 1DUSA 4Z86A 4H0CA 1XEFA 3O4IA 5ILQA 3V1KA 1WWKA 4C4TA 4E88A 1B1CA 2YVKA 3FBTA 3H0CA 3AXTA 3FHLA 4X54A 2WV9A 3O93A 3TVDA 2P7IA 5BUCA 3HZHA 1QH1A 2X3UA 2YWCA 4NCJA 3DFZA 1THGA 4PX2A 4QVKA 2WTEA 2ZBQA 2ZB4A 1PNOA 1CUVA 3KOXA 4GPTA 3EVFA 3WLMA 1HNZB 3EG9A 2PZFA 2XYGA 1CY0A 3ET5A 4J6FA 3QFRA 3NKFA 3O83A 3I39X 2JIQA 3EISA 4Q9JA 4ZVTA 2H6EA 2YW2A 2C9OA 2H17A 2ADMA 3GU3A 2O2EA 1CR2A 2OESA 2OM6A 1WRBA 3P9KA 4OFZA 4U7FA 3ZCSA 3FYTA 5FOQA 1P75A 3BYZA 1UT6A 3SMVA 3LP5A 1KZ9A 2R6DA 3BREA 3GN2A 1FX0A 1HT3A 4ZZIA 4FEEA 4QPCA 2GM3A 5IANA 3T3OA 1N9GA 4BRWA 1SUFA 3U26A 4NS1A 1V4NA 1PR3A 4FBMA 3CE9A 1I30A 4Q1FA 3N0TA 1AM4D 4UOEA 4A0SA 4D9GA 1VOTA 3CFYA 1EK0A 2O2JA 2Q3EA 2A0XA 3EZXA 1Z7YA 3FHJA 1QLHA 4HFRA 4HXGA 4WKGA 5DYTA 5B4VA 1P81A 2J7PA 3AL3A 3BGWA 4J2HA 1LVUA 4UHHA 4CTOA 3JALB 2PQ6A 4Q12A 4RJ2A 1P77A 5K1ZA 3RS8A 2W6JD 3BHJA 4M9CA 1SQSA 2NP6A 3WLQA 1T6YA 1YO6A 2XWSA 1Y6FA 3C4JA 1GFSA 3HKBB 5LYJA 1UMDB 4RIGA 1QBKC 2PT6A 2RI0A 2VWPA 3RYHA 4E15A 1M6YA 3K94A 1XZKA 4E46A 4PQFA 1OU0A 4P3NA 4EO9A 1L7DA 2WY2D 1FVHA 2QJFA 4LYYA 4O4IA 1OX4B 3LXXA 4EL5A 1VA5A 1QTIA 2AZMA 2FR0A 4RJTA 4JV5B 3K4HA 2O8CA 3NDBB 1DCMA 4TXJA 1N2BA 2YN4A 2G6TA 3IUEA 4LRYA 2P40A 2CNWA 4RF3A 1YVEI 5ALIA 2AYZA 3KUUA 1NI3A 2R7KA 2YWXA 4JLOA 3DL0A 3KZVA 4Y2XA 4CMAA 2KPOA 1ODSA 1WS6A 4D3YA 3IQHX 3MC1A 3PC4A 3N2EA 4FDAA 4MUGA 4BE7B 4TLDA 1GYPA 1X0VA 4K9OA 2FPRA 1RHUA 1MB9A 1GKKA 3LV8A 4D9JA 1VE7A 4P2GA 3FY4A 3EGXA 2G5GX 4TUYB 4ZXPA 3PKJA 3LK6A 4KE8A 3ZBTA 1L4EA 3UGJA 3CH5A 5JJCA 4HAIA 3NANA 4LMBA 2I2BA 2R48A 3QGMA 1PGQA 4HAUA 2WAXA 2DFDA 3PRYA 4IYRA 1PG5A 1YC2A 1ULAA 3RFVA 5D3KA 4RGQA 2JA2A 3ROPA 3T9EA 5L8VA 3ELDA 2MWMA 1AOXA 3CURA 5C32A 1ORVA 2B78A 3DHNA 4P7GA 4UUOA 2CVPA 5HX7A 1W1WA 4UAGA 2W2MA 2XBLA 3X44A 4D79A 3ELUA 4RQTA 4CN8A 4DMKA 4ZC8A 1D7OA 3PR2B 5JXJA 4BWFB 4IIJA 2P79A 4FI3C 3G13A 5C81A 2HWXA 2JAPA 4DNQA 3REOA 2LCQA 4Q16A 1J2RA 1SCIA 3E1SA 1M1YB 4ESOA 5JAMA 1WSAA 5ERYA 1J8QA 2J6HA 4OI2A 3VH3A 1XYYA 1AF4A 2Y0EA 3I09A 4GL4A 1Z7WA 4AJJA 2IEZA 2ZB8A 4LRSB 2H2IA 3VAZA 1QX3A 4K28A 1XTUA 1I7LA 4LXXA 1BHO1 2YH2A 2EOAA 3H3JA 3AY0A 1CLUA 2J5QA 3MPOA 4L9WA 1J2EA 2H11A 3IT2A 4MVCA 3WO0A 5CFOA 5IPFA 5K0TA 2DLCX 2V7EA 1B74A 1EAMA 4E2XA 1VE3A 1X0XA 4KOAA 4BFZA 1GTVA 4M36A 4S1PA 4RZ2A 4LYJA 1OUMA 3OZUA 4MPDA 1E2PA 2W2KA 5HCUA 1KVQA 1PBNA 3DE3X 3R3VA 2CB0A 1TK3A 3NC4A 4XWYA 5HG0A 4HT3B 3DQQA 3RGWS 2HA5A 3USCS 4FNOA 3RC9A 1II8A 1O95C 2RAFA 4UTZA 3CA8A 3A9VA 1NATA 2AFRA 2XMCA 4M55A 1G3UA 2BFBA 4RHCA 1C3JA 5FBLB 1YU6A 3DNMA 4CBVA 4HUQA 4IJQA 1FFSA 1J9ZA 1X2BA 3PX3A 5DLEA 5K5EA 2OBMA 1NHWA 1R0YA 4EFNA 3AGPA 2GYWA 3CLUC 3EDOA 3L7MA 4TRNA 1VBFA 2NTJA 1NXXA 4OG2A 4DGQA 5K4HA 2G70A 2W8BB 6AT1A 2ZU6A 4MO2A 2FR1A 3W79A 2EQ5A 3DVAA 4RTMA 3QPUA 4S0ZA 3A9SA 1YKGA 3U19A 3JWIA 2SKEA 5A2GA 5KNCA 4Q01A 2I62A 1A2BA 4YRIA 6ABPA 2WDZA 1ATIA 4B9EA 2ZTHA 4M86A 1YH3A 4JGIA 5JDIC 4P7JA 3UMGA 1X1QA 4QUJA 1XCBA 3QF7A 1E58A 2Z9BA 1MX5A 1NMSA 3H5LA 3QFHA 2H7VA 4GX2A 4JOQA 3CGGA 3SEQA 3EVEA 3RYCA 5GY7A 3ESRA 4DILA 4LJ9A 4FFMA 2QD2A 2ZOSA 2R85A 1LFAA 2Q2NA 3BICA 5EI5A 3OJCA 3M4NA 4QPJC 2GN4A 4WZZA 4PQYA 3RT7A 1NQ5A 3T12A 2ZBPA 4PC2A 4PGHA 4DIMA 4AMUA 1ZD2P 3FNEA 3KOWA 1XA4A 4UD2A 1E5LA 3UCXA 4DXAA 2ZYWX 3BG5A 5LZ9A 2PKEA 1Z4QA 3AESA 3PVZA 4IQ4A 3JQ9A 1OIXA 1UH5A 3PC7A 2YHIA 3JASB 3K1YA 2PUFA 5JNTA 5I9NA 4L0QA 1CRZA 1SO8A 1K9SA 5F3RA 3R75A 2YYSA 5A3JA 3R3UA 1BGWA 3F8SA 3WYEA 4QQNA 5KVQA 3JQRA 3FGOA 2QG9A 1FDSA 4YPFA 1KZGB 2DFLA 2G3YA 3DZBA 3KLOA 2IZ7A 4LCEA 4LJYA 5I8ZA 3BFJA 4X1YB 4QBHA 2O07A 3OOJA 4AICA 2ZRIA 3VPAA 1U2TA 3TNYA 4FYVA 3CUYA 1FRQA 1IWPB 3B13B 4X1OA 4N01A 1LWOA 4I8DA 1DZIA 2JIZD 3AWIA 1MMFB 3GZNB 5CT9A 3P9SA 3THXA 4GZ5A 1I1OA 5HIKA 3SVLA 2X4LA 3K8QA 3KSAC 4Q4AB 1XKQA 1UL1X 3COJA 3JXEA 2FUKA 3B1YA 4OD0A 1H4VB 4NZMA 4MV3A 3RRFA 3TMYA 4BLRA 5L95A 1BKYA 1RD4A 4ARZB 3AV3A 3I30X 5EGSA 4MROA 4BATA 3QPWA 3C3JA 4FQ5A 4LV5B 1HK7A 2YS7A 3P9NA 4OBEA 1S2OA 2C5FA 4INAA 1QDEA 4IW3B 3DV2A 2ZAIA 4BMSA 3TL6A 1WIWA 4TKUB 5JJKA 5JBNA 1Q6YA 1EM8A 3EBOA 4QYIA 4QE3A 1N2CB 1GPLA 2W6QA 3RRJA 2CMDA 2PKXA 1SIBE 5ESWA 2EAUA 3CRQA 4MWCA 5AI9A 5HTKA 4IDFA 1W6RA 1ZCZA 4FB5A 3C5WP 2P9TA 5FP0A 1OX4A 1RKBA 4HRXA 2VF2A 3KPUA 3TJZA 2P0YA 3JTMA 1GTJ1 1NYTA 4MV5A 1L5OA 1O97D 3HEMA 3HO6A 2CBZA 3MN1A 1DMSA 3ZKAA 1S6YA 2XQJA 2OV3A 3E7WA 2PL3A 4RVUA 3S1LA 2GX6A 5KX5F 1E4EA 4XASA 4OREX 2YL2A 3H9UA 1O9GA 3OURA 3PHCA 4FBLA 4OBBA 4UTVA 2FE4A 3D1JA 4ILKA 1SHZA 1H93A 1U3WA 2G5TA 4NPHA 4XJVA 2MSDB 3TAUA 1EWYA 4BP3A 1K75A 1U1GA 1RAHA 3WLFA 1ZGHA 4CNQA 1EFUA 1T2CA 4C0KA 2VK8A 3OTGA 1G6OA 1ZU5A 2CNBA 2O06A 2E5FA 1K92A 1IVSA 3DA8A 1DKPA 3L5OA 4FYWA 2IXAA 3TPCA 1LZKA 1A9PA 1QH8A 3ESAA 4IM7A 5LLDA 5IKXA 2ZI4A 2XZOA 1FA9A 4F5EA 3ZTWA 3K5PA 4UTNA 4CKYA 1EUYA 3MUNA 2IBMA 3KEGA 4XGNA 3QEOA 3L8FA 1M34A 2R8YA 4Q9HA 3STUA 2OFXA 3IAUA 5H8WA 4ZJZA 2NUAA 3O8CA 1K4KA 2DZDA 3BQNB 5LU8A 2FPWA 1E7MA 4QDJA 3GRAA 1ZAKA 1G8PA 2EP7A 4E30A 1TAQA 2QL7A 4IS2A 1DEAA 4IDOA 2Z95A 4BRZA 2P9ZA 2X2FA 1FU7A 2HCTA 3EBLA 3ZBQA 5DHTA 5U1PA 2XCIA 3S2UA 2NU6A 3UOWA 5K2OA 4WW0A 4K1LA 4WQMA 2DUUA 1EP3B 4MWTA 3I1IA 4CMIA 1RLIA 2O57A 4RBNA 1XZFA 2OZPA 5FO0A 4CM4B 1JA1A 5KNDD 1BCSB 4CMCA 3FHCB 3WGLA 2ODNA 1A5SB 1YT5A 4J0FA 3ANXA 4YUXA 1Z5OA 1V96A 2N1BA 4Y2PA 3T5DA 5C1DA 3JSAA 3IDAA 4L8LA 5HBGA 1T3GA 3CX6A 3QX8A 1TA4A 2UXBB 1DKOA 2V4UA 3G0DA 1YI0A 3QYFA 4BVFA 3RCBA 1EHCA 1Z5WA 2VPXA 3DKVA 4WA8A 2YWEA 5EWLA 4CIAA 2O3TA 4J1NA 1PQUA 4EEKA 2WQ6A 3QE9Y 3M2TA 4R3NA 1OFHA 1PYGA 3HVIA 2QW8A 2J31A 2VT6A 4GP7A 2QRKA 1JB1A 3IDZA 1VJ1A 1O6GA 3DZIA 3PE4A 2R66A 3ZZ0A 4RZHA 1ISIA 3JZIA 3OCXA 3A32A 4AY4A 4GS5A 2W2KB 1YMQA 3DWFA 4MUJA 2BHLA 2YN2A 4PZ0A 2YV2A 4W5OA 4KCGA 3IRVA 3EC7A 2CF6A 5LXTB 2D74A 1X8KA 2HI0A 1DQNA 4QBIA 2XMRA 4HGOA 2YTZA 4PTLA 3DO5A 2NXEA 2QMUA 4FE3A 4L28A 3TSWA 5E7MA 2NV0A 3RRXA 1KYVA 4DLSA 2FOIA 3C6MA 5EQTA 2DF8A 2G9UA 2HR1A 4H7HA 4JNKA 4URHA 1WCWA 5FTKA 5DZSA 3ULKA 4DIBA 3QLJA 3CKLA 4N76A 1FJGB 3H1EA 5DYNA 2GVNA 4YC7A 4WMLA 4A27A 4MP6A 5EZQA 3JQAD 1D9ZA 1AN9A 3NHPA 1NX6A 1NF3A 1H2RS 4EW6A 5CD9A 1O58A 3AIIA 4BCBA 1GSIA 2P9YA 2FWNA 3OC6A 4OFXA 2A9RA 5JAPA 2E1RA 3AH8A 5C80A 4CF6A 5D5PA 4DWVA 3HM9A 3OZ7A 1G7SA 1M6VB 1T13A 3NBZC 4QSHA 5DGIA 3S7ZA 2ZPUA 4AY3A 4ABYA 3OKAA 4IEFB 4AY5A 1FXWA 1G8MA 3V7YA 1C8BA 5HOEA 5FPKA 2XNCA 4NDAA 4ZT3A 4A7PA 4B8WA 3D3KA 5HA5A 1OKKD 3PQ7A 2VJQA 4M4SA 4P31A 2O0HA 3A14A 4GPBA 3PGMA 1X80B 4P34A 3WR5A 5JYCA 2KE5A 1UMDA 4B75A 2VYNA 4K9DA 2P1DA 1KZHA 1V2HE 4JB2A 2DB3A 5CMLA 2Q9CA 1G291 2NUBA 3MRSA 2JHPA 4L95C 4BCCA 1Q1ZA 4ND1A 3EZGA 1DIHA 1VHTA 5FYDA 3AEQB 5JYBA 2GEDA 1KYZA 1SCJA 2V97A 1V4BA 4YAOA 4ZGWA 3CNQS 5B36A 1KQFA 4XJSA 1QHHA 2G9RA 3BX1A 1U02A 1Q2XA 1J2TA 2PGIA 4N8EA 2D5IA 4EQ6A 4ESEA 4ISCA 3DLBA 2I4OA 1Z3CA 5C4GB 4WDRA 1FDIA 4Q00A 3CKYA 5A4IS 1Z15A 4IWYA 1MQ9A 2FK8A 3HSKA 4TYMA 3P9PA 3VHQA 1XNGA 1VCNA 4F2HA 1ADYA 4DV7B 4E3WA 2WQ7A 1A98A 3AHDA 4UEWA 2IITA 4PZCA 4KQIA 1Z8HA 2PTHA 4YB8A 1EUDA 4YRAA 5DBIA 4U9HS 3AOEC 1KEUA 2JH9A 3BSWA 3MGBA 1X7ZB 2H1HA 3AC0A 5F1OA 3UK0A 2BKXA 3HWX1 4D3XA 2JI8A 2FEPA 3F8TA 2IUYA 1IULA 3H2ZA 1SOWA 3I9FA 2BPOA 4I46A 5K8VA 4QO8A 5FUYA 4RTPA 5KU7A 1ZGAA 1ZK3A 2X3FA 3DTVB 2FGJA 4OO3A 2KLBA 4GXQA 4JUBA 2V7BA 1MJHA 1FDRA 1TO2E 3UKJA 2I9PA 4CEHB 3HL0A 2AMYA 2IZ1A 1O0SA 2ZJOA 4TVOA 2GKGA 1HEYA 4G8JA 1BA3A 2D0IA 1G42A 2B21A 1OYYA 3P52A 4ZOLF 2M98A 3OOYA 3UNXA 1QFZA 1E3LA 1ZCJA 2I66A 3L82B 3PNMA 4OYRA 2OCIA 2NO9A 3T7RA 2GUGA 3P9ZA 4NV0A 3RPEA 1VSBA 1OIVA 3ZWBA 1M74A 5JSFA 1FP1D 2ORYA 4X7RA 3F49S 4HPXB 2LTAA 2QUAA 1P7ZA 2B25A 4HLDA 5B58T 3DP9A 2ESRA 4YIKA 1ADFA 2JPDA 2GTIA 3B1VA 4FCVA 5CXXA 3R9IA 4U3JB 1NC1A 4N18A 2CT8A 4KDCA 2GASA 5HKAA 5TPWA 3HCNA 6REQB 2EWVA 5EE9A 4ZDJA 4TWBA 3FYUA 4F3NA 2IP4A 3H42B 4X6UA 4TT3D 1OU4A 1XYVA 3TQRA 2DRIA 5CK5A 1QJ4A 3GJ0A 1OAAA 1R10A 5G3ZA 2J6IA 1G66A 1T6ZA 2QXUA 4J3FA 4LW8A 3HZRA 4MDHA 4MVJF 5HZKA 5U9CA 4AJLA 4BO0A 3DXFA 4BB6A 1PUXA 4TTRA 5IG2A 4HUQB 4A5SA 3LQRA 3LP8A 3ZX5A 3M5PA 4YQZA 4DREA 5LNK1 2FFRA 4GBED 2L19A 2D2VA 4O4JF 1RBYA 2GBCA 3TJRA 1ZNYA 5M29A 2E89A 1H85A 1MEOA 2Z2JA 3CH6A 2JHAA 2BJHA 1OGYA 3T61A 1AKQA 3IVRA 3LCUA 1N0HA 3T7TA 3ZNNA 4BY9E 4TRJA 1K6XA 2R751 3DVAB 3QG1A 4AJEA 3CYFA 1JG3A 1Q83A 3KPWA 5JS6A 1EP2B 3G82C 5DGCA 1XRJA 3NVMB 4V39A 3F90A 4KWIA 1N5OX 1P29A 2GEVA 2JASA 4TV9F 3QFFA 3MFQA 2FW8A 1SGWA 5CFNA 5LD2B 4WLVA 2FE1A 2GHQA 2CBGA 4KPEC 5EEHA 1GN8A 1DCKA 3GG9A 4JLKA 1G2QA 2XHZA 3W5UA 2HRRA 1C1XB 1YSCA 2GDZA 4ZAZA 1MCZA 3U9SA 4C08A 4CM7A 4ZI2A 4CXMA 3AF3A 3R7SA 3ZIUA 4MRVA 1EGMB 2GKOA 3OCUA 4RK5A 3EF1A 4P1ZA 2JKVA 1JGTA 4RU1A 2XQFA 3SZLA 5D84A 5C52B 3O2SB 3E61A 2C5EA 3D3EA 3GUUA 4A03A 1C30B 4XPZA 4YWHA 4RYLA 3DW1X 4WCDA 2IV2X 4MVJA 2VA9A 1L9KA 1LUAA 3A4MA 4CKBA 3L43A 4ZEVA 1XNRB 2X1LA 3HCCA 1WUKS 1Y6RA 3U13A 5GOTA 1CUAA 2CK3A 5K20A 4P0PB 4C7XA 4JYMA 5HJEA 2OFOA 2OR3A 5IC6A 3UAZA 5G1OA 4YJHB 4MP3A 3RG8A 2H57A 3W6OA 1C9DB 4JCOA 4WXHA 1E5TA 2J0SA 4HS9A 4ITVA 5DHSA 4FU0A 4QDXA 3KSMA 1T2AA 2YUIA 3A26A 4RF5A 4JR1A 4IFTA 1GFIA 4F85A 5EP4A 5K3FA 4FMCB 4MUMA 4J0GA 1QRTA 3G0IA 1DDGA 1YB1A 2HO5A 3R6WA 5J2UA 1L7AA 1B0UA 1F60A 2CE7A 3GWZA 3LM8A 4FUTA 4DCUA 2R1UA 2GZ3A 3U1TA 4NYMR 3F3SA 1L7NA 1NXOA 2D0DA 4EKEA 1Q22A 1SHUX 1NVWQ 2IBTA 3WRXC 1GPBA 1KMCA 1N7HA 3VYWA 3QVJA 4IQFA 4BNWA 1GQQA 1L8OA 1Z6QA 4LOLA 4WL0A 5JZOA 1UK8A 4QG7A 4ENUA 4RVDA 2BGWA 1S3SA 4V2UA 3B48A 2OL4A 2OV1A 2EW1A 4CI9A 2B1RA 4R2WA 1IUOA 4DOMA 1BH2A 2F9FA 2PZEA 3ZV3A 2NPFA 5IT9A 2JBAA 4RWZA 1RYHA 2CFTA 1P4GA 2W2NA 3CF4G 3KYDB 3R3ZA 1CP2A 4AQDA 4Z1MD 4L7QA 3LW7A 1OAOA 1LQTA 4IJ5A 3KEOA 4YCMA 1AUVA 1KMQA 2HLDA 1YCGA 3IPLA 4KKXB 4BQPA 4PO1A 2ZYUX 1UQRA 1P60A 1USUA 1ZVKA 1U1FA 3KVRA 2ZPTX 1N9ZA 1XZBA 4XQ0A 4RTNA 1YCHA 1VJ5A 3NXSA 2XEXA 4N54A 4F8JA 2OD7A 4BNNA 2F00A 1VL8A 1QNLA 4KVZA 5COAA 1KZ4A 1LI4A 4NE2A 1NFQA 4RGBA 1ULSA 2M6SA 1VSVA 2ZYIA 3PU6A 2F1IA 4L74A 4LDRA 4LYHA 5MF6A 1YA8A 3L3BA 3FCAA 2QPLA 2QUJA 1JQBA 4GEKA 2QRPA 3U5ZB 5B57C 3LDHA 3FGZA 1N0IA 4GPIB 2YY5A 3MBOA 3I34X 4EZBA 1XTBA 5KSOA 3P9XA 4GDFA 1Y3DE 2MINA<