4QNYA

Crystal structure of mapk from leishmania donovani, ldbpk_331470
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
347
structure length
333
Chain Sequence
TKSLAELQAEVCRLDDRYLLERIIGAGSYGVVIRARDTKSDNRLVAMKRVNKEIFEEVILAKRILREIKLLAHFNDDNIIGLRNILTPEDPENFDHFYIVMDIMETDLKQVLRSGQELTEAHIQFFIYQALRALHIIHSAGVIHRDITPANILVNTNCDLKICDFGLAKEEGEYMTDYVTMRWYRAPELVMEDKDYSAQIDVWGIGCILGELLGSRPLFQGKDRVNQLDKIVDVIGTPSEEDINSVGSSAAQKYLKKKSHRPQADWRQRYPTASPEALDLLRHMLVFNPKRRITVLQAMRHPFLEQLHDDYALFRFDTIVDVKRAIYEESVKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MapK from Leishmania donovani, LDBPK_331470
rcsb
molecule keywords Mitogen activated protein kinase, putative
molecule tags Transferase
source organism Leishmania donovani
total genus 102
structure length 333
sequence length 347
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qnyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qnyA01
2OZOA 2QOHA 4MNEB 3FKNA 4FMQA 4GYIA 2ITWA 2XMYA 3LXPA 1DS5A 3RZFA 5CY3A 3QX2A 4IFGA 3P1AA 1O6KA 3QGYA 2GNLA 3LXNA 4UZHA 3WF8A 3DAJA 5AEPA 2VO7A 4E5BA 5BUEA 4WT6A 4ERKA 2XKFA 4FVQA 4ANSA 4ASDA 3NW7A 4IX6A 4LRJA 4DFLA 4WSYA 4N6YA 1E9HA 2B1PA 4M8TA 3QD4A 4QTEA 4C34A 3BWFA 5H8EA 1UA2A 2Y4IB 4QMOA 3MS9A 4RZWA 2EXEA 3D7TA 1FGKA 2CCIA 3ORKA 4ACHA 1JBPE 4FT9A 3S2PA 4EYMA 2BCJA 5AIRA 4IIRA 5E8ZA 4RIXB 2J5FA 3H10A 3RHXA 3ANRA 2O63A 2Z8CA 3UGCA 3W1FA 2X6DA 3BKBA 3OXTA 2Y6OA 3Q4UA 4ZOGA 4EOMA 3A4PA 2VTMA 2W7XA 4IZAA 3I6WA 4JDIA 5KZ0A 4OTDA 4EQUA 1JWHA 5EI2A 3WBLA 2GTNA 2JKKA 4JIKA 5HG8A 4EC8A 2BRHA 2J0LA 5FGKA 3C5IA 4WRGA 3HV3A 4GH2A 5AV2A 4BCPA 2WIPA 3E62A 5KHXA 3F2RA 4YHTA 4X3JA 5CAQA 3M1SA 4I6HA 4FYOA 3FXZA 3PIYA 4DT8A 3MYGA 3ZZEA 4ACDA 3THBA 5HNGA 4EOLA 2CHLA 5EI6A 5FDXA 3HLLA 4IAZA 3FMJA 1H28A 4JXFA 5FEQA 3VULA 2FO0A 3EQBA 4FSYA 3C0GA 4J71A 4MKCA 3NLBA 3ZU7A 3SAYA 5J9ZA 4BTKA 5DMZA 3ZUTA 1JAMA 2VTQA 1KE8A 2BFXA 3DTCA 3F9NA 3VBYA 4DG0E 4GK4A 4TNDA 4FSWA 3MJ2A 4PP7A 3E7OA 4HNFA 3OCSA 4X3FC 5EM7A 3R0TA 1M17A 2GFSA 2ITOA 4FSUA 4PWNA 3HVCA 3R8PA 2W1GA 1P4OA 3NUSA 4QTBA 2WTKB 2XJ0A 3FMMA 2UV2A 5I3OA 3RP9A 3P9JA 1MUOA 2WEVA 3LQ5A 4ANLA 3DBDA 1M2RA 2XVDA 3MH0A 5EI8A 3R8UA 4CQGA 2XIXA 3DNDA 4F99A 4CG8A 2W4JA 2HWPA 4J98A 5CEIA 2EXMA 2R3HA 1GZOA 4A07A 2VGPA 3EFKA 4XV9A 4IZ7A 5DBXA 3UQGA 4NM5A 3ZFXA 3EZRA 3FI8A 3BE9A 4IVCA 4FEWA 3FSFA 3LQ3A 1APME 5BYYA 2F9GA 2OG8A 3FHIA 4W4XA 3F7ZA 4BDKA 5J9LA 3QU0A 3ODZX 2C0TA 4BDAA 4E6QA 5AUTA 3BGQA 3R01A 3BEAA 3PXFA 3Q9YA 4XV2A 2XIYA 4AX8A 5L2SA 3QAME 5A4CA 1A48A 4X2FA 3FXWA 3FZOA 2OIBA 5DT3A 1UNHA 2QCSA 3QZGA 4G5PA 3D83A 1XR1A 2WMRA 3AGMA 3MESA 3ORZA 2VTRA 2X39A 3P0MA 4I23A 2V7OA 4DA5A 4AN9A 3AT4A 4K77A 3PP1A 5JFSA 1I09A 3R8VA 5BX0A 4E3CA 4S34A 3BE2A 5FD2A 3NW6A 5H3QA 3FLNC 2XH5A 5IG1A 2R3QA 3OZ6A 2IO6A 3P7CA 4FIHA 4FV2A 4JL9A 4YZ9A 5J1VA 3ZO2A 3UG1A 4QMWA 5AR5A 4EJ7A 3F6XA 4FKSA 4APCA 3A61A 1IASA 1OUYA 4X3FA 4D2TA 3D5XA 4FTJA 3I79A 1UNLA 4FL1A 2JDOA 2OFVA 3QCQA 3T3VA 4ALVA 4I0RA 3DZQA 4O0TA 3FAAA 3QTXA 4O7VA 3MIAA 3VNTA 3MTLA 4RLKA 1Q4LA 4I0SA 5LOHA 2R7IA 4XRJA 1Y8GA 4KAOA 5DT4A 2CGVA 3PXKA 4U6RA 5CWZA 4UMPA 3R28A 3T8OA 4G6OA 1GZ8A 2XP2A 3CD3A 3E92A 3JVRA 2YABA 5HO6A 3ANQA 3DAKA 3FPQA 5KCVA 3PY0A 1MQ4A 5AV3A 4FV7A 2ETKA 3DAEA 2XCKA 3GCUA 2X9FA 2IVTA 4HCTA 3KVXA 3LFSA 4I0TA 2B54A 1ZYJA 1SVEA 4QYYA 4XV1A 4YJTA 1R39A 3RPSA 3WOWA 3HX4A 4RPVA 4EYJA 4ZTNA 1OBGA 4XCUA 1U4DA 4FIGA 4XH6A 4BCJA 1FGIA 2W5BA 3ENHA 1SNXA 4FNXA 3PE1A 4Y83A 3JUHA 4G3DA 2HY81 4O2PA 2X4FA 3BQRA 4E4XA 2PSQA 2C6LA 3PSDA 5GIPE 3PPJA 2RG6A 4X6RA 2YEXA 4DEEA 3BCEA 2O0UA 3EN9A 3KGAA 4MEDA 2VX0A 3TZ8A 5AP0A 3WZEA 1XWSA 4NW6A 4DBXA 3FHRA 2GS7A 5JEBA 3Q5ZA 5FM2A 3P79A 4ANNA 5KBRA 2H9VA 4NCTC 2AC5A 4XP0A 3VUGA 1LEZA 4BI2A 4USDA 2FA2A 2WMVA 3IQ7A 5DFPA 4G16A 5FWKK 5KMOA 1UV5A 2W5HA 3O50A 2QU5A 4OAUC 1WBSA 4GFMA 4C58A 2XA4A 1G5SA 4FT3A 2VWBA 3Q9XA 3C0IA 4RX5A 2VTHA 4O0YA 4UZDA 5CI7A 5LJJA 1PKGA 3R21A 5GJFA 4YURA 1M14A 3TXOA 2VO3A 5LARA 5CU0A 4QP7A 1YI3A 4OBOA 4YJVA 5TF9A 2YWVA 4FZ7A 2WTJA 5DWRA 3R7YA 3H30A 1ZYCA 4R77A 4I24A 1BYGA 5CEPA 5M44A 4JR3A 4GSBA 4CMUA 4H3PA 4Y73A 4F6SA 3QHRA 4ZJVA 5IQFA 4PL5A 3FYJX 2C3JA 5M56A 4BCFA 3TIZA 4D9UA 4E7WA 4FTAA 4DGLC 3Q53A 4ZY4A 5AAEA 2CNVA 4FSTA 3TV4A 2UZLA 3E93A 3GU7A 2Y9QA 4GG5A 5BNJA 2PU8A 2VX1A 4FV9A 3CKWA 1PY5A 4QMPA 4G9RA 3ERKA 1ZY5A 3FMLA 3ZHPC 4ASXA 4BFMA 4BIDA 4BZDA 3EL8A 1NT2A 5AR8A 3Q4ZA 4NCTA 2W1IA 2X0GA 4JG6A 4QNAA 5H8GA 2BKKA 2YZLA 2QLUA 2Z2WA 5FRIA 5F95A 4FKQA 3FSKA 2F7XE 3M2WA 4XLIA 2KTYA 1B38A 2WAJA 5HX8A 2CLQA 3POZA 4H3BA 4M13A 4B7TA 5EHYA 4ZXTA 3ZONA 4O82A 4EJNA 2YIYA 1J7UA 3C9WA 1REKA 2XNNA 3KK9A 2HELA 4FUXA 2XB7A 4QYGA 4HPUE 4KBKA 3A7FA 5LWMA 3B8RA 2PUPA 1XJDA 2XYNA 2VAGA 3DKGA 3HA8A 4ZSEA 2OSCA 4KA3A 5KBQA 3RZBA 2F57A 4WRSA 4KKHA 5HBHA 3VW6A 1QPCA 2W17A 2PULA 4CXAA 3ET7A 4CRLA 3SGCA 5CTPA 3C4ZA 5CZHA 3H4JA 4E4LA 3DJ5A 3TJDA 4NIFA 3PA5A 3P86A 4Q2AA 1TQIA 2OK1A 3GC0A 3UYTA 2YM3A 1OPLA 2I0HA 3GC8A 4V0GA 4DFNA 4EK6A 4DGNA 4YLLA 3UNZA 4XNEA 2HZ0A 3OWKA 3R9NA 4L01A 4FEXA 4BTJA 3R1SA 5ANJA 4E93A 2G15A 4R8QA 3E8EA 3JS2A 2EUFB 4YO4A 4A9TA 2W4OA 1BX6A 3VBQA 3G33A 2J0IA 5EDPA 3E3BX 4FG9A 3R8ZA 4NZWB 3GBZA 1Z9XA 5IA2A 2VWIA 5HVYA 2IW6A 3FI4A 5CASA 2B53A 2FVDA 2ZMDA 4TWOA 5AR7A 1U54B 2VU3A 1RE8A 4WIHA 2VNYA 1HCLA 3R1NA 4K18A 4QP3A 3QBNA 4C59A 4I5HA 4LOQA 2NRUA 4QP4A 3ALNA 3Q2MA 4UB7A 3UZTA 4XG7A 4AW1A 4AU8A 5BVKA 4FUYA 2E9PA 4W4YA 2GNFA 4WOVA 3HECA 5BMSA 4J8MA 4Z55A 2UZVA 2RFEA 3F3VA 4AW0A 4DCEA 1YVJA 3HZTA 3PRIA 2XJ1A 3UNJA 5CAPA 4PRJA 5A3XA 4C36A 3KC3A 4PMSA 1CKIA 1U5RA 3D2IA 5T6KA 3VHEA 4D5KA 4O96A 3OXZA 4MNEA 1H4LA 4G6LA 4IZYA 4B8MA 3UOHA 4L8MA 4CFMA 1ND4A 3HP5A 2CKEA 3QZIA 3QYWA 3ZSIA 5HEZA 2XK9A 1AGWA 4JAJA 5EK7A 4FT5A 3VO3A 2NRYA 4RX7A 4IAIA 2YIXA 2PVRA 4NKAA 2WTKC 3EFWA 2C3KA 3NUNA 3I60A 4RWIA 3REPA 5C4LA 4BICA 2NNWB 5AR3A 2X4ZA 5KKRC 1XH6A 2VZ6A 4IAFA 5CX9A 4L53A 5CAVA 2QHNA 3ZLXA 3OOMA 3W8QA 1EH4A 3GCVA 3UO6A 3U4WA 3JXWA 1WBTA 4RIXA 4EH9A 2PMLX 5CT7A 3FBVA 1J91A 5HU3A 4ZSGA 3QQHA 4RX9A 4AOJA 3QQKA 4RWJA 5I9ZA 2JDSA 2P33A 5HO8A 5L8JA 2C5OA 4J53A 1WCCA 3F61A 4PV0A 4MCVA 1T45A 4LMUA 3O7LD 4RA4A 5HNIX 4FOCA 5IH4A 2CPKE 5JGAA 4MYGA 4MX9A 2WMWA 3FZRA 3O23A 5EQEA 2B55A 1PXNA 5A54A 3KN6A 4QPMA 4ENXA 4DE4A 1YI4A 4EOPA 5GJGA 2R3IA 3BV2A 3G6HA 3L9LA 2OH4A 5AUWA 1R1WA 2XM8A 5AP2A 3MB6A 1RDQE 5HD7A 2Z7RA 3PFQA 4IB1A 3TWJA 3KB7A 3QTIA 3TKIA 5HLNA 5L2IA 2BDJA 4HGEA 4YO6A 3ZUUA 5AWMA 4AT3A 4P90A 4C8BA 4X7QA 5JZJA 5K4IA 4LV5A 2J51A 4XG6A 2BVAA 2BHHA 4M69B 4FKRA 1TVOA 4QMLA 5AUXA 2VTNA 1IA8A 3DDPA 4Y95A 4EHZA 5BUIA 4NH1A 3F3TA 4L44A 5DPVA 4KINA 4L7SA 1NY3A 4ZTSA 3WF6A 4Z7HA 3Q4TA 3IDCA 3D5UA 3HDMA 4LGGA 3LFQA 4H05A 3I0OA 1SZMA 4NL0A 3OCBA 4IEBA 4K33A 5JFVA 1GNGA 1ATPE 4I1ZA 3TUBA 4RFZA 1YW2A 5AP3A 2XBJA 3D5VA 1FMOE 3FC1X 2HW7A 2VWZA 4FKPA 4YP8A 4KSPA 4L45A 4U44A 4Z3VA 3I6UA 1PHKA 5CU6A 4YHFA 2OIQA 3FZTA 3QF9A 3NUYA 2GU8A 4C35A 1KSWA 2ACXA 4CT2A 5HQ0A 3GQLA 3AC4A 1Q24A 4RC4A 2PMIA 2WB8A 4ACGA 4XG9A 4AP7A 5EH0A 1SNUA 4BCHA 3WI6A 2Z7QA 4JOAA 4BZOA 4DLJA 2JITA 4ASZA 3QZHA 2OBJA 2C3LA 4AZWA 4BGQA 3LJ2A 5M55A 3NUXA 3FLYA 4D2VA 1CKJA 2RG5A 4ZSLA 3ULIA 4EUUA 4A4LA 4PQNA 3DKOA 2ITUA 2UW5A 3RK5A 4EHEA 5M06A 3ENMA 3A4OX 4I4EA 3QQFA 4GEOA 2B7AA 3BWJA 2UVYA 5J7BA 3ELJA 5M08A 2YCSA 3O17A 3PY1A 2ERKA 5LVPA 5ETCA 4TWPA 4O0WA 3DK7A 2QOKA 3C4FA 5BVOA 4CT1A 3JR1A 2QHMA 4G31A 3QLFA 4ZEGA 4BR3A 5HIDA 4P5QA 3RCDA 4TNBA 4UYNA 2ITNA 3LJ1A 4IB0A 5I0BA 5FP6A 2CNQA 5CQUA 4NM3A 2BZJA 3BI6A 4FNZA 1H24A 4BIBA 1PMUA 3COMA 3F3ZA 4BGHA 4JG8A 5K5NA 4QQCA 1KE7A 3CJGA 2HOGA 3BQCA 3KCKA 4WNMA 4D4VA 1OL1A 4KIOA 5L3AA 3PJCA 2YLFA 3BZ3A 3P5KA 3V5PA 3CPCA 4QMTA 4K1BA 4O1PA 2AC3A 3ORLA 2YJSA 4JJRA 5CZIA 3UE4A 4F09A 4EEVA 2QQ7A 2XNMA 4DG2E 2YM6A 4XG3A 3Q52A 3QQJA 3LCTA 3POOA 1UKHA 4N4SA 3ZUVA 1QPEA 2J7TA 1J1BA 2E9VA 5KUPA 2QOIA 4XG8A 5LWNA 2YLEA 2ZYBA 4QMSA 1SVHA 4IVAA 5FM3A 5LMAA 3NMUF 1M2PA 2OXDA 4FKIA 3FMDA 4IDVA 4YZBA 4BIEA 5CEOA 3EQIA 3COKA 3GOPA 4I6BA 1PXMA 3F88A 4YNOA 2BRMA 2A4LA 1OKYA 2HY0A 1WVXA 4EK8A 4EK4A 2EB2A 2PMOX 2QOQA 4LYNA 1Z57A 3RKBA 4BBMA 3LIJA 5G1XA 4BYJA 3FLWA 4NM0A 4UN0C 3EKNA 4O6EA 4YTCA 5IU2A 3MBLA 5CVHA 1L3RE 3UYSA 2ITVA 5IISA 4WSQA 5IMEA 4XEYA 3EN6A 4QRCA 2C6EA 4AZTA 4O0UA 3L8SA 1KE9A 4TTHB 5ANIA 2X1NA 2J0JA 3TT0A 2R3KA 3RALA 5TT7A 1RW8A 3AMYA 4XMOA 5A6NA 1OL7A 4BN1A 1P2AA 2YM4A 3UPXA 4CMOA 3UODA 2W1FA 4KWPA 2IN6A 2O5KA 3DU8A 3QTWA 4MWIA 3UP2A 4C3FA 1QPJA 3OWLA 4UY9A 4FA2A 2BILB 5FXSA 1W98A 1UU8A 4AUAA 4G5JA 3OW4A 4IWQA 1GZKA 1WBPA 2XBAA 4KSQA 5HG7A 3DK6A 3NAXA 3C4XA 4M67A 4IC8A 4RVMA 3ITZA 3NUAA 3GU8A 4KNBA 5EYDA 2CLXA 2GS6A 2BDWA 5BYZA 1P4FA 5DE2A 3G0FA 3C0HA 3O8PA 1V0OA 2UW8A 5DVRA 4O7YA 4ZJIA 3HNGA 1Q3WA 4G2FA 4XG4A 4H58A 4BCQA 4F1TA 4O7WA 1UKIA 2C5XA 2ZMCA 3EB0A 4X2KA 1YDSE 2PE0A 2YDKA 4B0GA 4B6LA 2R0UA 4RGJA 1ZARA 3F69A 3DV3A 3TTIA 2VV9A 5C8KA 2J90A 3OEZA 4FV5A 1UU7A 5AP4A 2QOLA 3VJOA 3ZTXA 4ZZNA 2VRXA 2OXYA 5CU4A 3JVSA 3BV3A 4AW2A 5AP6A 2G9XA 4ALWA 5HIBA 4XRLA 4FKWA 4TL0A 5TKDA 3RBWA 2OLCA 3QRUA 3HAMA 5DOSA 5CNOA 3VS2A 3CKXA 2VTJA 1YQJA 3IS5A 4MXZA 4AZSA 4ZIMA 4O81A 4DLIA 1P5EA 4FIFA 4YPDA 3ZBFA 1CDKA 3MN3A 4IX3A 3W33A 4TYEA 4CLJA 3FDNA 4QMVA 2XNPA 4KBCA 4BTMA 5GZ8A 4F7SA 5I9YA 4NWMA 4TYIA 3EN7A 1TQPA 2OFUA 2GQGA 3E87A 3LM0A 4WNOA 5H8BA 3UMWA 4USEA 5AA8A 3FV8A 3N4VA 2JDVA 4RWKA 5HD4A 3KQ7A 5JFWA 5AM7A 3KRRA 4IM2A 2OJIA 4XOYA 3V5TA 2B0QA 4GYGA 3EFJA 1NVQA 1Q8TA 3O8UA 3MVHA 3UO4A 2ESMA 3IW7A 3CSVA 5IQCA 4ORKA 3MPAA 2VWUA 4B99A 5HTIA 2Y6MA 2JIUA 2EU9A 3HL7A 3VBXA 4ITIA 3QTZA 1HCKA 4BI0A 4YJUA 5AAFA 3FL4A 3LAUA 3SDJA 4V04A 3MH1A 3LMGA 4OTIA 1JNKA 2XJ2A 3PDTA 4C4GA 4FTUA 4RIYB 1O6YA 3F5UA 1IR3A 1VR2A 3QC9A 4JR7A 3TZ9A 4CTCA 2WKMA 4DGGA 1U54A 4HGLA 1YI6A 2R3LA 2WMXA 1PXKA 2WPAA 2R7BA 4FE2A 2Y7JA 4FKOA 5KHWA 5EG3A 3B2WA 4FKJA 4N70A 3ZEWA 4C4JA 3UQCA 5EYCA 1UWJA 3AT2A 5BVFA 5E9EA 3I5ZA 3UVPA 1JPAA 3D4QA 1ZYSA 1BI8A 4C4HA 3MTFA 4HZSA 4CSVA 3MSSA 4G17A 5LQFA 3IW6A 3PJ1A 3E7VA 3BELA 3TKUA 3BIZA 1WFCA 2WHBA 3AG9A 1OL5A 4WG4A 3Q6UA 1Q41A 2GQSA 3ZDIA 5HBJA 3SXSA 4CRSA 2FGIA 3LXLA 4CFXA 1ZY4A 1K2PA 4UYAA 4YZDA 3QKLA 1WAKA 4JDJA 3DFCB 5CYIA 3V04A 3RM7A 2XNOA 3KXMA 3IW8A 4D0XA 1M7NA 4M15A 3IOKA 3HP2A 3OFMA 4QMYA 2QG5A 1IRKA 4U8ZA 3DOGA 2BZIB 4LGHA 2HW6A 3BU5A 3C4CA 3UOJA 2REIA 5A4LA 4FTCA 4JBPA 2PZRA 4WG3A 4KB8A 5FEEA 4S33A 4U81A 1R0PA 4GFOA 3PXRA 1SVGA 3VS1A 3QD2B 2G1TA 4KIKB 3FE3A 4R3RA 3ZFMA 4BDJA 4FR4A 1H0VA 2ZDUA 5AP1A 1YXTA 2J6MA 3G2FA 4I5MA 5C8MA 2ITTA 3IECA 2P2HA 1H0WA 4TYHB 3W10A 4F9WA 5A9UA 1FINA 3CXWA 4O7NA 2WTVA 1KV1A 3DXQA 3DKCA 2YM5A 5EFQA 3K3JA 2P0CA 3R1YA 2H96A 4UMRA 2IVSA 4H39A 1T46A 2OI4X 2VTPA 1E1VA 2RIOA 5C9CA 3D7ZA 4ONAA 4EK5A 3DA6A 3NYNA 3QTSA 2C68A 5L4QA 2W0JA 4D2WA 4YR8A 4GK3A 4NFMA 2VTIA 4ZS0A 3W55A 2X8DA 4EBWA 1OL6A 3GNIB 3W2PA 3LLAA 1FVVA 2BRGA 2VTTA 3RK9A 4QQ5A 5KMJA 3MFTA 4KIQA 3DXNA 2UVXA 1PJKA 1URWA 4A9UA 4V01A 4OTGA 2YIRA 3TZMA 3U6JA 3QC4A 5CU3A 3O8TA 2OZAB 2WOUA 4H36A 3QKMA 4BGGA 3GFWA 1V1KA 3LCKA 3QRTA 2VTLA 4F9BA 4LUDA 3R73A 2UUEA 5JH6A 4YGAA 4RFMA 4S31A 2R4BA 1X8BA 4I93A 3L9MA 4M69A 1UWHA 4XUFA 3BHVA 1ZMUA 3KMWA 5HCZA 3D2KA 3TCPA 3R7IA 4F7LA 3IW4A 2I1MA 4I21A 3V8TA 4XP3A 4AE6A 3WZJA 4U3YA 4Z16A 2XKCA 4YJQA 5L2QA 3UIXA 5LVMA 2FSMX 2FSOX 4S32A 2QU6A 4C57A 3R9OA 5CXZA 1U46A 5ETFA 3AD6A 2W1HA 3IPHA 3O96A 2QNJA 2ZB1A 2AUHA 3ALOA 4F9YA 2X7GA 1YOLA 4IHPA 5K9IA 4E5WA 2QKRA 5E8SA 1ZZ2A 4MBIA 3L8XA 4R7HA 5AX9A 2H34A 3VS7A 5JQ5A 3AMAA 3DGKA 2BFYA 4NK9A 2CCHA 5D7AA 5CENA 5T68A 5KMKA 3N51A 4QPAA 1JVPP 4C7TA 1JSVA 4GMYA 3ZC6A 2OJ9A 4F63A 4FIEA 1YHWA 5ANKA 4CYJA 5M53A 2WQBA 2FYSA 4P5ZA 4HVDA 1F3MC 5E1SA 2WQMA 4NTTA 4ZTRA 2XM9A 2O64A 4FTRA 2WMQA 5BVEA 5IEVA 2ZV9A 4OTPA 5DI1A 3ZSGA 4FKVA 4G6NA 1YKRA 4YTIA 1ZXEA 5F94A 1I44A 5KMNA 5IQHA 4YZMA 5DGZA 3W2CA 2DQ7X 3EFLA 4R78A 4G9CA 3FZ1A 2OXXA 3TG1A 1Q62A 2BRNA 4GG7A 4EZ5A 2V5QA 4FSZA 3V5WA 4RC3A 1ZMVA 3MA6A 3KREA 4J1RA 4A9YA 5JGDA 1BL6A 3NPCA 2QOOA 3MPMA 1OIUA 3DT1A 3RINA 4RSSA 3TNWA 4KS8A 1G8SA 2KULA 4O21A 4UWBA 4F1OA 4QMZA 3LPBA 3TZ7A 2X8IA 4R6VA 3NRMA 5KZIA 4EBVA 4BDGA 4ZMEA 3AC1A 3V01A 1UU9A 2PVHA 3F2AA 4CZYB 3EYGA 5IQEA 2OW3A 4A9RA 4F1MA 2C0IA 3OCGA 4XP2A 3SQQA 1XH5A 2W96B 3LFNA 4QPSA 3ZS5A 3HUBA 2FSTX 5IQBA 4IC7A 4HVGA 4O7ZA 5HNBA 4EHVA 2IW8A 3SC1A 3VRZA 4CCBA 1FVTA 2VWVA 4O6LA 1R3CA 3OG7A 3WZKA 4DEAA 3CBLA 1XBAA 2YAAA 3A99A 2DYLA 3LFAA 3U6HA 3S3IA 3Q32A 3TIYA 4L43A 3GGFA 5EQPA 4WNPA 4O0RA 5EW3A 3FPMA 5GJDA 4EWHA 5CVFA 4USFA 2F2CB 4QMUA 4UALA 4IACA 1PMEA 5EM8A 4JX3A 4ASEA 4BYIA 1DAWA 3R2YA 3OROA 3UIUA 4GIHA 2R2PA 2OJJA 4WKQA 4AS0A 1Y57A 5HVJA 4AWIA 4C3PA 3MI9A 4I92A 4LOPA 5L6WL 4OR5A 5E90A 3FKOA 4P2KA 2BAKA 2V55A 4PDYA 3EWHA 4YBKA 1OM1A 4IXPA 4LI5A 4TXCA 5GNKA 3LE6A 4ARKA 4DGOA 2GDOA 1MRVA 2WD1A 5DNRA 5T3QA 5DH3A 1L8TA 2RF9A 3K3IA 3NW5A 3CY2A 4UXLA 3WIKA 3RPOA 4CYIA 3DKFA 1FOTA 2RKUA 3RAKA 1GOLA 4IADA 4BCGA 2UW3A 4OLIA 4AAAA 2PZIA 1XH4A 1BMKA 2XF0A 3DBFA 3QHWA 2BZKB 4J96A 4U7ZA 3LFFA 2YDIA 3MH2A 4PNIA 5E91A 4IW0A 5AMNA 5IEYA 2P3GX 5LXMA 4W8DA 1WVWA 3BYSA 3R7OA 3C5UA 1CTPE 4IWOA 4CFUA 4DGMA 1W8CA 1ERKA 3ACKA 3QTUA 2YERA 4NUSA 5HBEA 3IKAA 4O38A 2WIHA 4HGSA 5M4UA 3BYMA 4WUNA 1MRYA 4BL1A 4NEUA 4R3CA 5J9YA 2B52A 1Q8YA 5CNNA 4WD5A 5M51A 3ZRKA 2GNGA 3SVVA 2VX3A 2ETRA 5A46A 3G90X 5DR2A 3RAHA 4L3JA 4AW5A 2W06A 4M7IA 4NT4A 2VWXA 2RFDA 4M3QA 4I4FA 4RA5A 4YZCA 3SW7A 4DFUA 2YJRA 4CG9A 2YZAA 4OTHA 3QX4A 3V6RA 3VN9A 2A27A 3BYOA 3HA6A 2CGXA 2OIDA 5FG8A 2J0KA 3UZRA 1H1QA 5M4IA 3D15A 5CU2A 2R3MA 4YJRA 3PVBA 1Y91A 3IGGA 4L67A 2Z7SA 4WG5A 3BHHA 4IFCA 2WELA 5H2UA 3BEGA 4GUEA 4BDDA 1PYXA 5HG9A 5IKWA 2CGUA 3PWDA 2V7AA 3HRFA 3NR9A 3PPKA 2PZPA 1XHAA 3I4BA 1LPUA 1BI7A 4FNYA 4W4VA 1JKTA 1Q61A 4GVAA 3F5XA 5ITAA 1WZYA 1MQBA 5HE2A 4PP9A 3ZEPA 2I0VA 5HKMA 2C4GA 5EDRA 2WQOA 3EKKA 2R3FA 4FK6A 1KE5A 2YCFA 4IBMA 5DYJA 3DJ6A 4BWKA 4AA4A 4FGRA 4RJ3A 5CI6A 4EZ7A 2XK3A 4PUZA 4ZMFA 3ID6C 4BKJA 3ZOSA 4UWCA 3R83A 2QKWB 2AYPA 3BYUA 5ACKA 2JFLA 3AD5A 5I9XA 4XS2A 5LVNA 4F7JA 5D1JA 5DA3A 1S9IA 2YM7A 2Y4IC 2F7EE 4MXAA 3QXOA 2WTDA 4FSNA 2I7QA 2E9NA 4ALUA 4I5PA 4F70A 3A7HA 2QR8A 4IZ5A 2ONLA 3OVVA 2GHGA 2C5NA 4LV8A 4RRVA 4R1YA 4OBPA 4ZK5A 3T9IA 3DZOA 3NS9A 4I6FA 4IVDA 5AADA 5BVDA 2JKOA 4RIOA 4LG4A 3HRBA 1JKSA 4YNEA 3ZDUA 5CF6A 2RFSA 4ERWA 3BLQA 3P23A 5GZ9A 1PMNA 3BLRA 4G34A 1NVSA 4L68A 4U97A 4F0FA 1SM2A 3G6GA 3F7WA 5CSWA 2SRCA 3NNXA 3CQEA 4X6QC 4D4SA 3EQFA 4NU1A 5F20A 4YC8A 4DITA 2Q0NA 3OT3A 4IAAA 3UIBA 3K54A 3V8SA 5IF1A 5KX8A 2QOCA 3QCYA 3EQDA 5FDPA 5ANOA 4IWDA 3GC9A 4B8LA 5ACBC 2YCQA 1B39A 5J79A 3G0EA 3WIGA 2FH9A 3OEFX 3GCPA 4D9TA 2ZM3A 4HVIA 3DS6A 4HYUA 3O71A 2DUVA 3ZRLA 4W9XA 2UZUE 3DBCA 4N6ZA 4PX6A 5I9VA 3ORPA 2IVVA 2OJGA 2P4IA 2C30A 4XHKB 3R2BA 4ZJJA 4MAOA 3H0YA 5TO8A 5GHVA 4E1ZA 3S00A 4FYNA 3NYXA 4LL5A 5IA1A 2PUNA 4R7IA 4FG8A 3SA0A 3ZSHA 4OT6A 2QO9A 4RMZA 4AZEA 5HE3A 4M68A 2C6IA 4L52A 4D1ZA 1WBWA 1Q8UA 4FC0A 3V5JA 5A14A 3ZLWA 5K5XA 5DN3A 3C4EA 4FEUA 4F65A 5HZNA 3MW1A 4FNWA 4XOZA 4C62A 5F4NA 4NJDA 3R7GA 3FY0A 5IQIA 1S9JA 3R00A 2W99B 3A8WA 3CTQA 4EH8A 3QXPA 3A62A 5B7VA 4EUTA 3U4UA 4EZ3A 3QL8A 4OTRA 4YSMA 5DEWA 2UW0A 4BWPA 3G51A 2QURA 5FEDA 3MGYA 1FQ1B 3OTVA 4AZVA 3WZDA 1JSTA 2VUWA 3GU4A 1ZYLA 5DEYA 4EOJA 4ZLOA 4JQ8A 4PMMA 4EH3A 4RIWB 1GZNA 3SD0A 5B2LA 3D9VA 1OIRA 3NNVA 3SLSA 3L9NA 3VQHA 4EK3A 4M97A 3Q96A 4NJ3A 3KKVA 4QOXA 3OCTA 4DF3A 3KRWA 5K3YA 1GIJA 3K5UA 5HIEA 3NGAA 5J95A 4BRXA 3DNEA 2BTSA 3UTOA 3M42A 1RJBA 2B9FA 3HGKA 5EDQA 3DLZA 3RWQA 3BHUA 5CAUA 3FZPA 5CSPA 4DEHA 1CSNA 2UZNA 3GCSA 4KIKA 5CSVA 1KOAA 3QRIA 3PZEA 3H9FA 2CN8A 2IZTA 2XK7A 2BDFA 5DRDA 4L42A 4PMPA 4FIJA 4IVBA 4C0TA 4D1XA 5HTCA 3TV7A 5L8LA 5LMKA 1NW1A 3MVJA 1FVRA 5E7RA 3KMUA 3RTPA 3ZXZA 4G3EA 3VS0A 5HTBA 3TV6A 4A06A 3MJ1A 1ZWSA 3HMNA 4TY1A 4BF2A 2UW6A 4QP8A 2WFYA 3EQGA 3VUKA 2PVKA 3QWJA 4EOKA 3NZ0A 3RMFA 1U5QA 4QO9A 5M4CA 3EQRA 4CLIA 2PMNX 2P2IA 1XH7A 3EIDA 1Q5KA 1E1XA 3OT8A 4GRBA 4HVSA 2CKOA 4F0IA 4R5SA 5IDPA 1Q8ZA 2J5EA 2BAQA 1G3NA 1K9AA 3N4TA 5EKOA 2ZVAA 1LP4A 2Y8OA 4FZAB 4EHGA 2XK4A 4EKLA 2RSVA 4DEDA 3OF0A 3OWJA 2HIWA 4ZTQA 1M2QA 4OT5A 2CDZA 4JNWA 2CKQA 4YSJA 2OZAA 3GB2A 3VUHA 3S0OA 4U40A 2ZV7A 4HCVA 3NYVA 2IZUA 5H9BA 4BCIA 4A7CA 5AUVA 2FUMA 2C5YA 2UZEA 1IAJA 5M07A 4FX3A 1XQZA 4X3FB 2ZV2A 5C4KA 4RVTA 5EHOA 4EH4A 3LM5A 4AA0A 3GOKA 3OMVA 4FK3A 2C1BA 1PF8A 3DBEA 4IQ6A 3SOCA 4D4RA 2WTIA 4GV1A 3FL5A 3FQHA 3BU3A 3GFEA 2YISA 4FV0A 3AC2A 5HESA 4TYJA 3A2CA 3C51A 4EKKA 3KXXA 3ZO3A 4MHAA 5C26A 3QYZA 4BY9E 4FODA 2GNIA 4X21A 2HAKA 3L8PA 3BBTB 3EMGA 3OUKA 4FTQA 3FLSA 3DB8A 3DK3A 4FVPA 3CTJA 1OI9A 3GT8A 3VUTA 4BHZA 5D10A 5C1QB 2H8HA 4E4MA 1YXUA 3SG9A 4Y8DA 3RGFA 3TM0A 4FKTA 3W2SA 4ANMA 4MVFA 1OUKA 5IQDA 2OJFE 4JRVA 3W18A 1TKIA 2NP8A 3PXZA 4Y5QA 2ERZE 2WGJA 2HWOA 4QTDA 5JRSA 1A06A 2CGWA 4O91A 2HZIA 4EOOA 5EOBA 4S2ZA 2JAMA 2W9FB 4FTNA 5CVGA 3WYXA 4E5AX 5IQAA 3U8WA 2JIIA 3SW4A 4H1MA 4FL2A 1W82A 3PVWA 2ZB0A 4Q5HA 3BLHA 4KIPA 5HORA 4FSMA 4C4FA 4W4WA 2PUIA 4IAKA 4YJNA 4L00A 3L1SA 1F5QA 3VF8A 3PSBA 2PVFA 1Z5MA 1UU3A 1QL6A 3O51A 4FV4A 4IE9A 4XYFA 4ANBA 3W32A 3WE8A 4OTQA 3HV5A 2C6KA 1YWRA 2XNGA 3ORXA 3VS6A 4B9DA 4C2VA 4FTMA 2W1ZA 5BPYA 4M14A 1QPDA 2WQNA 4U43A 4UMUA 3EL7A 1REJA 5F1ZA 1M52A 1OKWA 3COHA 3E8DA 4MXXA 4PDPA 4RLLA 4RJ8A 2Z7LA 1LUFA 5AP5A 5EHLA 1VJYA 1H1WA 2JAVA 3DLSA 3GI3A 5IA5A 4O83A 2ITZA 2XIKA 4JX7A 4C2WA 5A4QA 3UOKA 3KFAA 2Q0BA 4S30A 2BTRA 2WZJA 2QVSE 2UW4A 2HXLA 4AZFA 3TKHA 3UNKA 4J95A 2PTKA 2ZM1A 4RQVA 5CXHA 2GNHA 3UOLA 3PE2A 5BVWA 2PVNA 1CMKE 2ZAZA 4UBAA 4ACMA 3VRYA 2QG7A 3KCFA 5CT0A 5CS6A 2X2LA 3C1XA 4C4IA 3IK3A 1RQQA 5J5TA 3R04A 4HCUA 2JC6A 3GUBA 3OW3A 4LQMA 2ZDTA 3N4UA 4FZDB 2I40A 1ZOEA 4FEVA 2OH0E 3W2RA 2WO6A 3GU5A 4J8NA 4EI4A 3U54A 4ZSJA 3E3PA 4Y46A 3I7CA 4ZP5A 1GJOA 1M7QA 4XJ0A 1FMKA 4PPCA 3QA8A 2NO3A 3QD3A 2A0CX 3TDWA 2XEYA 4PL3A 5I9UA 3PPZA 4HYIA 5IUHA 3ZXTA 5AUUA 3LZBA 3UO5A 5HICA 1ZRZA 4Y85A 5ICPA 4YMJA 3UVRA 3QUPA 4EOIA 2G2HA 5DHJA 3Q04A 3DJ7A 5C27A 3F5PA 3ORNA 3NX8A 3P08A 2PVMA 4YC3A 3VBWA 3HMOA 3LFDA 1OPJA 3LMIA 4UX9A 4DINA 3AOXA 5FP5A 4EH7A 3AC5A 5BUJA 2OF2A 5ANDA 5AIKA 4QNYA 2BUJA 1OIYA 4CKJA 3CC6A 3QFVA 3GQIA 3M11A 3ZMMA 4PL4A 4AXAA 1Q97A 1J7LA 4IWPA 5JKGA 3PLSA 3FI3A 4PPBA 4NTSA 5IA3A 5ANGA 4NIFB 4DHFA 1PRYA 3TTJA 2UZWE 4FV8A 5L8KA 5IPJA 5LVLA 1H00A 3PG1A 3UVQA 3WF5A 3KXNA 4AGWA 4G1WA 4D55A 1GY3A 4A9SA 5JQ8A 1G8AA 3CCNA 4QMXA 2X7FA 5E4HA 3R71A 3RNYA 5FLFA 2WMTA 1PMVA 3NDMA 1QMZA 2F2UA 4EL9A 5IDNA 5AAGA 2ITPA 3ZCLA 3AT3A 3KF7A 3KVWA 1YOJA 3E64A 3W8LA 2VTSA 1NA7A 3PJ8A 3OBGA 3KA0A 3I81A 3RWPA 4O7LA 2QOFA 2F49A 2YCRA 4F9AA 3KY2A 3RPVA 1U59A 2GTMA 1V0PA 3PXQA 3V5LA 2OO8X 3R63A 4DYMA 4BBEA 3PZHA 4CV8A 2O65A 5DIAA 5AV1A 2XEZA 2JBPA 4XX9A 5B0XA 1GIIA 4DH1A 5GIOE 5JZNA 3QTQA 4M12A 4R3PA 4J97A 2YHVA 5CEMA 3TNQB 2QLQA 3R22A 4GS6A 3GU6A 4ID7A 3ROYA 1B6CB 2R3RA 5KE0A 5EW8A 3A7JA 5GINE 5IH6A 1YRPA 2PK9A 4KKGA 2GHMA 1UVRA 2YIWA 2UVZA 3FLQA 4M0ZA 2VWYA 3KULB 4MNFA 3ZRMA 2XK8A 4OW8A 3E8NA 5IEXA 2VN9A 1R0EA 4LL0A 5D9HA 3HMIA 3FKLA 3WZUA 2WTWA 3JY9A 3I0QA 3C13A 4AFJA 5HHWA 4O1OA 4CEGA 2FB8A 4WBOA 4K2RA 3NUPA 5I3RA 2UZOA 2PWLA 3TNIA 3UMXA 3D14A 3MIYA 2PUUA 3VAPA 4OGRA 4XLVA 4J52A 2V22A 5JFXA 2PE2A 4EH5A 4Z7GA 4BHNA 5CEKA 3RJCA 4H3QA 2VNWA 4RBLA 5AR4A 4AFEA 4UV0A 4AACA 3AMBA 4GCJA 3MFUA 3PA4A 4O0VA 3HEGA 3PXYA 2WNTA 5AM6A 2PPQA 4IB3A 2CN5A 5BVNA 3F2NA 4BCKA 4U3ZA 2ZOQA 2JDRA 3SOAA 3P7AA 4DH7A 5TR6A 5BQ0A 4YJOA 4FBXA 2J9MA 2YAKA 4GJ2A 3FJQE 4KS7A 1FBNA 1KUTA 3EOCA 3EYHA 5DLSA 3CLYA 4YLJA 1BKXA 3CGOA 3G9LX 4OTFA 5C8NA 1W0XC 4F4PA 3WARA 1STCE 4J99A 2J2IB 2OWBA 1XH8A 3FZSA 2GHLA 4MF0A 3GCQA 4PDOA 5LCKA 1W84A 2GSFA 1JOWB 3ORTA 3CPBA 3OUNB 2GCDA 3FMEA 2PVLA 2UW7A 4RIWA 4O7RA 3RM6A 4CZTA 4ZLYA 1PKDA 4BTFA 4O84A 1ZLTA 2E2BA 4LM5A 3VUMA 4IJPA 1CKPA 2Z60A 3P78A 3A60A 3V5QA 3OP5A 3R9HA 3TACA 3GEQA 4E4NA 1J7IA 4RVKA 4UXQA 3BHTA 2JGZA 5K0XA 2UZTA 3I7BA 3MY5A 3TUDA 3SRVB 2JDTA 1MP8A 1O6LA 4XBUA 5AV0A 3GXLA 4O22A 2W5AA 5JSMA 3ULZA 5HO7A 3OY3A 4MWHA 4APPA 3PIZA 2HXQA 3VBVA 4M66A 4XG2A 2PZ5A 2VD5A 3PUPA 2F4JA 3WYYA 5KKRB 4V05A 3EN5A 3H9RA 2GS2A 4LGDA 2WMSA 4AG8A 3FUPA 3PWYA 4PMTA 4ITJA 3VHKA 4N57A 3FMNA 2VO0A 1URCA 3VQUA 1Q3DA 2RL5A 3ROCA 5IMXA 2G2IA 1H1SA 5E8TA 3RPYA 4I6QA 5HOAA 2XRWA 3OXIA 2R9SA 4K8AA 4D5HA 4LFIA 4IJ9A 1OECA 4H1JA 4QP2A 1W7HA 4IDTA 4FGBA 3HUCA 4F7NA 4GT4A 3RAWA 1JKKA 1XO2B 3WE4A 1OMWA 3BGZA 4FKUA 3RAIA 3FQEA 2YFXA 3OTUA 2VWWA 2LGCA 3SHEA 1YDTE 2HYYA 4C61A 4TN6A 4R7BA 2BR1A 3GENA 5A4EA 1IAHA 3ORMA 4E6CA 3MDYA 3OBJA 3N9XA 1YWVA 2XYUA 3FY2A 2P55A 4PNKA 4FEQA 2W1EA 2E9UA 3BBWA 3BGPA 3U9CA 1TQMA 5D12A 3UJGA 1IEPA 2W4KA 5CAOA 5IA4A 4QYHA 1YDRE 3EHAA 3KEXA 3NSZA 2GQRA 4A4XA 4B4LA 3CIKA 4FOBA 3U87A 3VIDA 5E1EA 3HV7A 4HYSA 2XCHA 3ZC5A 4CFWA 4MD8E 3G9NA 4CMTA 3MFSA 4C02A 2JEDA 3PVGA 3CEKA 4EC9A 3IG7A 3F5GA 3MVMA 4MQ1A 1OKVA 4MK0A 2RFNA 4BCOA 4CGAA 4BDHA 4U45A 3LCOA 1YWNA 1H25A 2OU7A 4L7FA 3QALE 4JG7A 4CFNA 4RJ4A 4TPTA 4MF1A 3ZM9A 4BC6A 4FKGA 2WMBA 3FXXA 2B9HA 3Q5IA 3R7EA 4ACCA 5HGIA 3C4WA 3DXPA 2WU6A 3W2OA 5JK3A 4CKRA 4ZS4A 4JIAA 5D41A 5EM5A 4FT7A 4BDBA 4I22A 2Q83A 4MXCA 3QUEA 4FKLA 1OVEA 2BROA 5IZFA 1OKZA 4JLCA 3TDVA 3GC7A 5HI2A 3IO7A 4FL3A 2QI8A 4L9IA 4RVLA 1H1RA 5D7VA 3CQUA 1OBDA 4GKIA 5AUZA 5HLWA 3KU2A 3TEIA 4K11A 4FI1A 3UDBA 4RC2A 4EOSA 4HPTE 2YN8A 2YM8A 3OWPA 4O0SA 4X2JA 4DH5A 4CVAA 3AGLA 5FXRA 5LVOA 2JBOA 1H07A 3QRJA 4MBLA 3KXGA 4DTKA 5FTGA 3E8CA 3IGOA 4JAIA 4BDFA 1DAYA 4BBFA 2X7OA 3KRXA 2X8EA 4F9CA 2XS0A 4G3CA 3SV0A 4AOTA 4C4EA 4KBAA 1UNGA 2Y4PA 3KRJA 4E6DA 3FQSA 3MY1A 3R02A 4EH6A 4D28A 2X2MA 2VTAA 4FTLA 4QD6A 3R9RA 1IA9A 1YXXA 3FEGA 1VEBA 4YC6A 4O86A 2ETMA 4KD1A 3VS5A 3VUIA 1NXKA 3GVUA 4QMMA 4YTFA 4E26A 1ZZLA 3OY1A 4FG7A 4JT3A 4D2RA 3R8MA 4E8AA 3VBTA 2HCKA 2JKMA 1V0BA 4FSRA 5K4JA 3S4QA 4ZSAA 3TL8A 3VWAA 3AC8A 3BYVA 4MTAA 5IUGA 5HLPA 3PY3A 5BMMA 4JI9A 1DI8A 2ITYA 4U41A 3DFAA 2XNEA 2OICA 5HCXA 2ONLC 3SX9A 1OITA 4BB4A 5IQGA 1JKLA 4RT7A 2QONA 3JY0A 3PTGA 3UC4A 2J4ZA 2CSNA 3KL8A 2B9IA 4RJ7A 4DG3E 5AV4A 5EM6A 4O7TA 4DTAA 4D2PA 4EOQA 2CNUA 4L46A 2YDJA 4QP6A 2C1AA 3PYYA 3FYKX 1PXOA 4MD9E 4HW7A 3SG8A 3EH9A 2IVUA 2JLDA 4QQJA 4AF3A 3QKKA 2R3JA 3BPRA 4FSQA 1FPUA 1ZYDA 3JYAA 3RHKA 4QQTA 5LCJA 1A9UA 4NM7A 3NVMB 3BRBA 5ANEA 4N0SA 4DCAA 5A6OA 1WBNA 2A1AB 2IZSA 4FF8A 3QQGA 1YXVA 4JRNA 2O2UA 4P4CA 3RPRA 2UZBA 4E6AA 3NIZA 3QCXA 4KUJA 3RCJA 4XBRA 4DH8A 1H08A 3PA3A 1GIHA 2XRUA 4F08A 4WUAA 3LKMA 3CJFA 4I20A 5EKNA 4MXYA 1WMKA 3NNWA 3T3UA 2IG7A 1K3AA 3QTRA 1DM2A 4DFYA 4O27B 4BVUA 1WBOA 3UQFA 3LW0A 1WVYA 3F3WA 2W05A 3V51A 4Q9ZA 5CEQA 3BU6A 3NCZA 2YACA 3G5DA 4CFFA 3LMHA 3FI2A 2GFCA 2IW9A 3ATTA 4JBQA 3IONA 3NYOA 4YLKA 2C6MA 3DCVA 2O3PA 3WILA 5DR6A 5L2WA 4ANOA 2ITXA 3Q2JA 4GFGA 1XKKA 2X2KA 3CY3A 4NKSA 2IPXA 3EJ1A 4K6ZA 3U55A 3UPZA 3FMHA 2X81A 1F0QA 1JSUA 4YHJA 4YU2A 5CSXA 5IUIA 4GKHA 2BIYA 3A7GA 4M0YA 2XIRA 2Y0AA 1XBCA 3DPKA 4J7BA 4TRLA 5DT0A 5EOLA 4ANQA 1IG1A 4CQEA 4DEGA 5CSHA 3EN4A 2G2FA 4HNIA 4U80A 5CF5A 3CGFA 3U6IA 3HV4A 3LFCA 5E8XA 5JGBA 4CKIA 3LOKA 3CS9A 4G3FA 4RJ5A 3SXRA 4W8EA 2DS1A 2W1CA 1H26A 1JQHA 1H01A 1KE6A 4NSTA 1H27A 2VO6A 5E8VA 5G6VA 4YJPA 4I5CA 1PXIA 3R8LA 3W2QA 1YHSA 2PL0A 1W83A 5AUYA 3D7TB 2CKPA 5BYLA 2EWAA 3RI1A 3MA3A 1PXLA 2A19B 5J8IA 5LMKC 1KV2A 3I5NA 4ENYA 2C6OA 3C7QA 3NAYA 3LFEA 4RIYA 3RK7A 4KRCA 1J1CA 3VC4A 4YUQA 3AC3A 3MPTA 4DEBA 3Q9ZA 1YHVA 1DI9A 5A4TA 5JN2A 3KULA 4UMTA 3EZVA 4LMNA 4EQMA 1JLUE 2I6LA 3LHJA 2G01A 1LEWA 4K0YA 1OZ1A 4JBOA 2C6DA 2EVAA 5FQDC 4U42A 2QR7A 4TT7A 5HE1A 4Q5EA 3E5AA 4RG0A 4ZZMA 3ZO1A 1O9UA 5HG5A 5B2MA 5FUTA 3HMPA 3HMMA 4CCUA 4FTKA 3TN8A 5I9WA 2X6EA 3Q4CA 1LR4A 2QOBA 2XK6A 3AXWA 3CQWA 2IJMA 1Y8YA 3E63A 3EQPA 1R78A 3H3CA 1HOWA 4KKEA 1PYEA 4CZUA 5LMBA 5KMLA 4AE9A 3ATSA 4HGTA 3ZLYA 4O7SA 1AD5A 4DFZE 1XH9A 4CNHA 4BKYA 4GK2A 1OL2A 3A8XA 4GVJA 3H0ZA 4D0WA 2IWIA 3AD4A 2JKQA 3PLAE 4MD7E 5E8YA 5AX3A 4HYHA 3NCGA 3NUUA 4YPSA 3KXHA 4KRDA 3KK8A 2CMWA 4ZTMA 2CJMA 2PZYA 3NWWA 3T9TA 3MWUA 2XNBA 4HOKA 4GIIA 3R30A 3MH3A 1ZOGA 5CF8A 4BI1A 3OD6X 3HDNA 4JVGA 4DBNA 5DRBA 3PG3A 3LFBA 4TYHA 4Z9LA 1OPKA 1VYWA 3UBDA 2GPHA 5J5SA 4I3ZA 4FV3A 4DAWA 4PY1A 3CR0A 2DWBA 2JFMA 2XKDA 4YZNA 4ZLZA 1J3HA 2B9JA 2WU7A 4CTBA 2HZ4A 2OKRA 2WMAA 4HVHA 4NW5A 1P14A 3VVHA 2PYWA 5L2TA 1Y6AA 4FV1A 3FWQA 4D1SA 3ZFYA 3ORIA 3VF9A 5FTQA 4C3RA 3MFRA 4FTIA 4OUCA 1VYZA 4EQCA 4BZNA 3G15A 4OTWA 2J50A 2EXCX 4QTCA 4GW8A 2VGOA 2GNJA 4U9AA 5AJQA 4GT5A 4AGUA 5CF4A 3IDPA 3PRFA 3SRVA 3QLGA 4PF4A 5K0KA 4DC2A 2BAJA 3WF9A 2QODA 5E92A 4DFXE 3R7VA 3R1QA 4AT4A 5L6PA 4RQKA 4ZTLA 5AR2A 3LCSA 2C0OA 4NYEA 3FLZA 4EONA 3NVKI 2WXVA 3TUCA 4AOIA 1H1PA 3QGWA 3Q60A 3Q6WA 3VW8A 3EQCA 5KO1A 3IOPA 4YTHA 3R6XA 4FZ6A 2WOTA 4Y72A 3UIMA 4QYFA 1QCFA 2JIVA 4PTGA 4UMQA 1MRUA 2HZNA 3QUDA 1ZMWA 4U79A 4GUBA 5J1WA 2ZV8A 4EORA 4U0IA 4JDKA 2XZSA 4WHZA 3LQ8A 3ZLSA 4ZTHA 2HENA 4RZVA 2YA9A 3TI1A 4C33A 3UG2A 4IB5A 2HK5A 2H6DA 3O0GA 3ZM4A 3HAVA 4P7EA 1KWPA 2R3GA 3KN5A 3HRCA 4QT1A 2R0IA 2YIQA 4YBJA 3LXKA 3BHYA 4OBQA 1SMHA 3MB7A 4TWCA 3S95A 2OGVA 4GU6A 5E8UA 3D94A 5AA9A 3L9PA 3UC3A 5HCYA 4DTBA 3FC2A 2YITA 2EB3A 4PTEA 4IAYA 4IH8A 2I0EA 4TYGA 2BIKB 3KMMA 3MV5A 4FV6A 3P4KA 3DBQA 3B2TA 3RNIA 4ZZOA 5J87A 3KRLA 4F0GA 5J7HA 5L6OA 4RWLA 2RGPA 2WQEA 3SXFA 3OOGA 3QQUA 5I5ZA 4I94A 1NVRA 4DH3A 4X0MA 3O2MA 5B2KA 3VJNA 3B8QA 4IX4A 2R64A 2XUUA 3H9OA 2WMUA 3DY7A 4DT9A 2PE1A 4BCNA 3ACJA 4U5JA 3DB6A 3Q9WA 5JRQA 3ZO4A 4AA5A 3L8VA 1ZOHA 4AGDA 1ZAOA 4IM0A 4LOOA 4PTCA 2C69A 3VS4A 3E88A 2V0DA 1XBBA 3IW5A 3C50A 4II5A 4IX5A 1SYKA 5CQWA 5C01A 4F6UA 4D2SA 4RJ6A 2Z02A 3BX5A 4FTOA 4AN3A 1OGUA 1YXSA 4ZY6A 2LAVA 3EQHA 2PY3A 2IZRA 3F82A 3ZH8A 3DTWA 3QD0A 3OS3A 4GU9A 5FBNC 2QO2A 5D11A 3OHTA 2ITQA 4F64A 3HYHA 4DN5A 2A2AA 3LCDA 4E20A 4X2GA 4TKSA 5FXQA 4AT5A 4UWYA 4PPAA 3COIA 3PSCA 5CANA 3DDQA 2C5VA 2C6TA 5KNJA 4WO5A 4RFYA 5FTOA 3PJ3A 5GZAA 2VTOA 3R7UA 4BDEA 1H8FA 3AQVA 4YJSA 4A4OA 4DEIA 4FT0A 3HV6A 4BDIA 2R5TA 5HX6A 5I4NA 5EQYA 3MY0A 2BMCA 2WTCA 4BDCA 3F3UA 3D0EA 3ODYX 4O2ZA 1PW2A 2X9EA 2JD5A 3LJ0A 4TZRA 5IA0A 2I0YA 2QC6A 3UZPA 5M09A 4CFVA 4L3LA 3TNPC 4AN2A 4QTAA 3U51A 4NFNA 3HKOA 3QZFA 2PHKA 4WBBB 2R3OA 2BZHB 4XV3A 1BUHA 2OF4A 4QYEA 4FVRA 2XKEA 4C37A 4D4YA 1GAGA 4JQ7A 3NNUA 4E73A 2O8YA 5C03A 5DR9A 3W16A 4K9YA 4ZY5A 2R3PA 3QRKA 2WEIA 3FMKA 4GL9A 4ITHA 3ZBXA 2ZM4A 5AP7A 3CE3A 5EYMA 2C3IB 3ZYAA 3DQXA 2W9ZB 3S1HA 2E9OA 2W1DA 3KF4A 1VZOA 3V3VA 3V8WA 4JS8A 3PJ2A 4EWQA 4L3PA 4CV9A 5HVKA 3PP0A 4R5YA 1PXPA 3NIEA 4D58A 2C47A 3GP0A 3UP7A 5FBOA 5HU9A 3OC1A 4FZFB 2V62A 3Q3BA 4IMYA 4ZAUA 5TE0A 3PVUA 2F7ZE 4JBVA 4WNKA 4Y5HA 5E8WA 2QD9A 4O0XA 2YWPA 3P7BA 1Y6BA 4L6QA 4DFBA 5CLPA 1AQ1A 3D5WA 4M84A 4V0GB 3LVPA 3NEWA 4JDHA 3VS3A 4OAVB 5F9EA 3V6SA 4MH7A 5M57A 4AGCA 3SKCA 3QWKA 2UZDA 5KMMA 1Q8WA 5HE0A 4JQEA 2BRBA 4CD0A 1YOMA 4Q9SA 4QMNA 2ZJWA 5ETIA 3K5VA 4BKZA 4C38A 3O7LB 3II5A 2PVYA 3JPVA 4I41A 4W9WA 1Q99A 3WF7A 3U9NA 1BLXA 3CTHA 3ZZWA 5JMSA 4EH2A 5EYKA 2J0MB 4GT3A 4PDSA 3RVGA 4QP9A 4MBJA 1BL7A 2BHEA 4HZRA 5JT2A 3A7IA 4LRMA 4BCMA 4X2NA 1OB3A 4IANA 3I1AA 3CP9A 2BALA 4LUEA 3VUDA 4UEUA 1CM8A 3PIXA 4MQ2A 4WA9A 2XIZA 3QCSA 4RX8A 4LRKA 3DQWA 3F66A 1WBVA 3KXZA 3MVLA 4TW9A 4QMQA 1OIQA 3LLTA 1KOBA 3TNHA 4TWNA 5TOZA 4G3GA 2B4SB 4QP1A 3QQLA 4GJ3A 3CD8A 5EW9A 4FTTA 5DG5A 4BWXA 5IH5A 3QA0A 2GMXA 5ETAA 5CALA 4KABA 1PXJA 3K2LA 4FIIA 4MXOA 2FSLX 5M4FA 3IDBA 4IM3A 2QO7A 5AFVA 4FICA 5KMIA 4HJOA 3R9DA 2UW9A 4F6WA 4AQCA 3TJCA 2R3NA 2PVJA 2NPQA 4R1VA 2BPMA 2BKZA 3ETAA
chains in the Genus database with same CATH superfamily
2OZOA 2QOHA 4MNEB 3FKNA 4FMQA 4GYIA 2ITWA 2XMYA 3LXPA 1DS5A 3RZFA 5CY3A 3QX2A 4IFGA 3P1AA 1O6KA 3QGYA 2GNLA 3LXNA 4UZHA 3WF8A 3DAJA 5AEPA 2VO7A 4E5BA 5BUEA 4WT6A 4ERKA 2XKFA 4FVQA 4ANSA 4ASDA 3NW7A 3NFGB 4IX6A 4LRJA 4DFLA 4WSYA 4N6YA 1E9HA 2B1PA 4M8TA 3QD4A 2XALA 4QTEA 4C34A 3BWFA 5H8EA 1UA2A 2Y4IB 4QMOA 3MS9A 4RZWA 2EXEA 3D7TA 1FGKA 2CCIA 3ORKA 4ACHA 1JBPE 4FT9A 3S2PA 4EYMA 2BCJA 5AIRA 4IIRA 5E8ZA 4RIXB 2J5FA 3H10A 3RHXA 3ANRA 2O63A 2Z8CA 3UGCA 3W1FA 2X6DA 3BKBA 3OXTA 2Y6OA 3Q4UA 4ZOGA 4EOMA 3A4PA 2VTMA 2W7XA 4IZAA 3I6WA 4JDIA 5KZ0A 4OTDA 4EQUA 1JWHA 5EI2A 3WBLA 2GTNA 2JKKA 4JIKA 5HG8A 4EC8A 2BRHA 2J0LA 5FGKA 3C5IA 4WRGA 3HV3A 4GH2A 5AV2A 4BCPA 2WIPA 3E62A 5KHXA 3F2RA 4YHTA 4X3JA 5CAQA 3M1SA 4I6HA 4FYOA 3FXZA 3PIYA 4DT8A 3MYGA 3ZZEA 4ACDA 3THBA 5HNGA 4EOLA 2CHLA 5EI6A 5FDXA 4LV7A 3HLLA 4IAZA 3FMJA 1H28A 4JXFA 5FEQA 3VULA 2FO0A 3EQBA 4FSYA 3C0GA 4J71A 4MKCA 3NLBA 3ZU7A 3SAYA 5J9ZA 4BTKA 5DMZA 3ZUTA 1JAMA 2VTQA 1KE8A 2BFXA 3DTCA 3F9NA 3VBYA 4DG0E 4GK4A 4TNDA 4FSWA 3MJ2A 4PP7A 3E7OA 4HNFA 3OCSA 4X3FC 5EM7A 3R0TA 1M17A 2GFSA 2ITOA 4FSUA 4PWNA 3HVCA 3R8PA 2W1GA 1P4OA 3NUSA 4QTBA 2WTKB 2XJ0A 3FMMA 2UV2A 5I3OA 3RP9A 3P9JA 1MUOA 2WEVA 3LQ5A 4ANLA 3DBDA 1M2RA 2XVDA 3MH0A 5EI8A 3R8UA 4CQGA 2XIXA 3DNDA 4F99A 4CG8A 2W4JA 2HWPA 4J98A 5CEIA 2EXMA 2R3HA 1GZOA 4A07A 2VGPA 3EFKA 4XV9A 4IZ7A 5DBXA 3UQGA 4NM5A 3ZFXA 3EZRA 3FI8A 3BE9A 4IVCA 4FEWA 3FSFA 3LQ3A 1APME 5BYYA 2F9GA 2OG8A 3FHIA 4W4XA 3F7ZA 4BDKA 5J9LA 3QU0A 3ODZX 2C0TA 4BDAA 4E6QA 5AUTA 3BGQA 3R01A 4O4FA 3BEAA 3PXFA 3Q9YA 4XV2A 2XIYA 4AX8A 5L2SA 3QAME 5A4CA 2XARA 1A48A 4X2FA 3FXWA 4FJVA 3FZOA 2OIBA 5DT3A 1UNHA 2QCSA 3QZGA 4G5PA 3D83A 1XR1A 2WMRA 3AGMA 3MESA 3ORZA 2VTRA 2X39A 3P0MA 4I23A 2V7OA 4DA5A 4AN9A 3AT4A 4K77A 3PP1A 5JFSA 1I09A 3R8VA 5BX0A 4E3CA 4S34A 3BE2A 5FD2A 3NW6A 5H3QA 3FLNC 2XH5A 5IG1A 2R3QA 3OZ6A 2IO6A 3P7CA 4FIHA 4FV2A 4JL9A 4YZ9A 5J1VA 3ZO2A 3UG1A 4QMWA 5AR5A 4EJ7A 3F6XA 4FKSA 4APCA 3A61A 1IASA 1OUYA 4X3FA 4D2TA 3D5XA 4FTJA 3I79A 1UNLA 4FL1A 2JDOA 2OFVA 3QCQA 3T3VA 4ALVA 4I0RA 3DZQA 4O0TA 3FAAA 3QTXA 4O7VA 3MIAA 3VNTA 3MTLA 4RLKA 1Q4LA 4I0SA 5LOHA 2R7IA 4XRJA 1Y8GA 4KAOA 5DT4A 2CGVA 3PXKA 4U6RA 5CWZA 4UMPA 4AXCA 3R28A 3T8OA 4G6OA 1GZ8A 2XP2A 3CD3A 3E92A 3JVRA 2YABA 5HO6A 3ANQA 3DAKA 3FPQA 5KCVA 3PY0A 1MQ4A 5AV3A 4FV7A 2ETKA 4JMQA 3DAEA 2XCKA 3GCUA 2X9FA 2IVTA 4HCTA 3KVXA 3LFSA 4I0TA 2B54A 1ZYJA 1SVEA 4QYYA 4XV1A 4YJTA 1R39A 3RPSA 3WOWA 3HX4A 4RPVA 4EYJA 4ZTNA 1OBGA 4XCUA 1U4DA 4FIGA 4XH6A 4BCJA 1FGIA 2W5BA 3ENHA 1SNXA 4FNXA 3PE1A 4Y83A 3JUHA 4G3DA 2HY81 4O2PA 2X4FA 3BQRA 4E4XA 2PSQA 2C6LA 3PSDA 5GIPE 3PPJA 2RG6A 4X6RA 2YEXA 4DEEA 3BCEA 2O0UA 3EN9A 3KGAA 4MEDA 2VX0A 3TZ8A 5AP0A 3WZEA 1XWSA 4NW6A 4DBXA 3FHRA 2GS7A 5JEBA 3Q5ZA 5FM2A 3P79A 4ANNA 5KBRA 2H9VA 4NCTC 1XMMA 2AC5A 4XP0A 3VUGA 1LEZA 4BI2A 4DDGA 4USDA 2FA2A 2WMVA 3IQ7A 5DFPA 4G16A 5FWKK 5KMOA 1UV5A 2W5HA 3O50A 2QU5A 4OAUC 1WBSA 4GFMA 4C58A 2XA4A 1G5SA 4FT3A 2VWBA 3Q9XA 3C0IA 4RX5A 2VTHA 4O0YA 4UZDA 5CI7A 5LJJA 1PKGA 3R21A 5GJFA 4YURA 1M14A 3TXOA 2VO3A 5LARA 5CU0A 4QP7A 1YI3A 4OBOA 4YJVA 5TF9A 2YWVA 4FZ7A 2WTJA 5DWRA 3R7YA 3H30A 1ZYCA 4R77A 4I24A 1BYGA 5CEPA 5M44A 4JR3A 4GSBA 4CMUA 4H3PA 4Y73A 4F6SA 3QHRA 4ZJVA 5IQFA 4PL5A 3FYJX 2C3JA 5M56A 4BCFA 3TIZA 4D9UA 4E7WA 4FTAA 4DGLC 3Q53A 4ZY4A 5AAEA 2X0PA 2CNVA 4FSTA 3TV4A 2UZLA 3E93A 3GU7A 2Y9QA 4GG5A 5BNJA 2PU8A 2VX1A 4FV9A 3CKWA 1PY5A 4QMPA 4G9RA 3ERKA 1ZY5A 3FMLA 3ZHPC 4ASXA 4BFMA 4BIDA 4BZDA 3EL8A 1NT2A 5AR8A 3Q4ZA 4NCTA 2W1IA 2X0GA 4JG6A 4QNAA 5H8GA 2BKKA 2YZLA 2QLUA 2Z2WA 5FRIA 5F95A 4FKQA 3FSKA 2F7XE 3M2WA 4XLIA 2KTYA 1B38A 2WAJA 5HX8A 2CLQA 3POZA 4H3BA 4M13A 4B7TA 5EHYA 4ZXTA 3ZONA 4O82A 4EJNA 2YIYA 1J7UA 3C9WA 1REKA 2XNNA 3KK9A 2HELA 4FUXA 2XB7A 4QYGA 4HPUE 4KBKA 3A7FA 5LWMA 3B8RA 2PUPA 1XJDA 2XYNA 2VAGA 3DKGA 3HA8A 4ZSEA 2OSCA 4KA3A 5KBQA 3RZBA 2F57A 4WRSA 4KKHA 5HBHA 3VW6A 1QPCA 2W17A 2PULA 4CXAA 3ET7A 4CRLA 3SGCA 5CTPA 3C4ZA 5CZHA 3H4JA 4E4LA 3DJ5A 3TJDA 4LDTA 4NIFA 3PA5A 3P86A 4Q2AA 1TQIA 2OK1A 4QEBA 3GC0A 3UYTA 2YM3A 1OPLA 2I0HA 3GC8A 4V0GA 4DFNA 4EK6A 4DGNA 4YLLA 3UNZA 3AKKA 4XNEA 2HZ0A 3OWKA 3R9NA 4L01A 4FEXA 4BTJA 3R1SA 5ANJA 4E93A 2G15A 4R8QA 3E8EA 3JS2A 2EUFB 4YO4A 4A9TA 2W4OA 1BX6A 3VBQA 3G33A 2J0IA 5EDPA 3E3BX 4FG9A 3R8ZA 4NZWB 3GBZA 1Z9XA 5IA2A 2VWIA 5HVYA 2IW6A 3FI4A 5CASA 2B53A 2FVDA 2ZMDA 4TWOA 5AR7A 1U54B 2VU3A 1RE8A 4WIHA 2VNYA 3O5AA 1HCLA 3R1NA 4K18A 4QP3A 3QBNA 4C59A 4I5HA 4LOQA 2NRUA 4QP4A 3ALNA 3Q2MA 4UB7A 3UZTA 4XG7A 4AW1A 4AU8A 5BVKA 4FUYA 2E9PA 4W4YA 2GNFA 4WOVA 3HECA 5BMSA 4J8MA 4Z55A 2UZVA 2RFEA 3F3VA 4AW0A 4DCEA 1YVJA 3HZTA 3PRIA 2XJ1A 3UNJA 5CAPA 4PRJA 5A3XA 4C36A 3VONA 3KC3A 4PMSA 1CKIA 1U5RA 3D2IA 5T6KA 3VHEA 4D5KA 4O96A 3OXZA 4MNEA 1H4LA 4G6LA 4IZYA 4B8MA 3UOHA 4L8MA 4CFMA 1ND4A 3HP5A 2CKEA 3QZIA 3QYWA 3ZSIA 5HEZA 2XK9A 1AGWA 4JAJA 5EK7A 4FT5A 3VO3A 2NRYA 4RX7A 4IAIA 2YIXA 2PVRA 4NKAA 2WTKC 3EFWA 2C3KA 3NUNA 3I60A 4RWIA 3REPA 5C4LA 4BICA 2NNWB 5AR3A 2X4ZA 5KKRC 1XH6A 2VZ6A 4IAFA 5CX9A 4L53A 5CAVA 2QHNA 3ZLXA 3OOMA 3W8QA 1EH4A 3GCVA 3UO6A 3U4WA 3JXWA 1WBTA 4O4CA 4RIXA 4EH9A 2PMLX 5CT7A 3FBVA 1J91A 5HU3A 4DHZA 4ZSGA 3QQHA 4RX9A 2X0QA 4AOJA 3QQKA 4RWJA 5I9ZA 2JDSA 2P33A 5HO8A 5L8JA 2C5OA 4J53A 1WCCA 3F61A 4PV0A 4MCVA 1T45A 4LMUA 3O7LD 4RA4A 5HNIX 4FOCA 5IH4A 2CPKE 5JGAA 4MYGA 4MX9A 2WMWA 3FZRA 3O23A 5EQEA 2B55A 1PXNA 5A54A 3KN6A 4QPMA 4ENXA 4DE4A 1YI4A 4F78A 4EOPA 5GJGA 2R3IA 3BV2A 3G6HA 3L9LA 2OH4A 5AUWA 1R1WA 2XM8A 5AP2A 3MB6A 1RDQE 5HD7A 2Z7RA 3PFQA 4IB1A 3TWJA 3KB7A 3QTIA 3TKIA 5HLNA 5L2IA 5BV3A 2BDJA 4HGEA 4YO6A 3ZUUA 5AWMA 4AT3A 4P90A 4C8BA 4X7QA 5JZJA 5K4IA 4LV5A 2J51A 4XG6A 2BVAA 2BHHA 4M69B 4DDIA 4FKRA 1TVOA 4QMLA 5AUXA 2VTNA 1IA8A 3DDPA 4Y95A 4EHZA 5BUIA 4NH1A 3F3TA 4L44A 5DPVA 4KINA 4L7SA 1NY3A 4ZTSA 3WF6A 4Z7HA 3Q4TA 3IDCA 3D5UA 3HDMA 4LGGA 3LFQA 4H05A 3I0OA 1SZMA 4NL0A 3OCBA 4IEBA 4K33A 5JFVA 1GNGA 1ATPE 4I1ZA 3TUBA 4RFZA 1YW2A 4QDVA 5AP3A 4O4EA 2XBJA 3D5VA 1FMOE 3FC1X 2HW7A 2VWZA 4FKPA 4YP8A 4KSPA 4L45A 4U44A 4Z3VA 3I6UA 1PHKA 5CU6A 4YHFA 1ST4A 2OIQA 3FZTA 3QF9A 3NUYA 2GU8A 4C35A 1KSWA 2ACXA 4CT2A 5HQ0A 3GQLA 3AC4A 1Q24A 4RC4A 2PMIA 2WB8A 4ACGA 4XG9A 4AP7A 5EH0A 1SNUA 4BCHA 3WI6A 2Z7QA 4JOAA 4BZOA 4DLJA 2JITA 4ASZA 3QZHA 2OBJA 2C3LA 4AZWA 4BGQA 3LJ2A 5M55A 3NUXA 3FLYA 4D2VA 1CKJA 2RG5A 4ZSLA 3ULIA 4EUUA 4A4LA 4PQNA 3DKOA 2ITUA 2UW5A 3RK5A 4EHEA 5M06A 3ENMA 3A4OX 4I4EA 3QQFA 4GEOA 2B7AA 3BWJA 2UVYA 5J7BA 3ELJA 2XANA 2YCSA 5M08A 3O17A 3PY1A 2ERKA 5LVPA 5ETCA 4TWPA 4O0WA 3DK7A 2QOKA 3C4FA 5BVOA 4CT1A 3JR1A 2QHMA 4G31A 3QLFA 4ZEGA 4BR3A 5HIDA 3PUFC 4P5QA 3RCDA 4TNBA 4UYNA 2ITNA 4BJJB 3LJ1A 4IB0A 5I0BA 5FP6A 2CNQA 5CQUA 4NM3A 2BZJA 3BI6A 4FNZA 1H24A 4BIBA 1PMUA 3COMA 3F3ZA 4BGHA 4JG8A 5K5NA 4QQCA 1KE7A 3CJGA 2HOGA 3BQCA 3KCKA 4WNMA 4D4VA 1OL1A 4KIOA 5L3AA 3PJCA 2YLFA 3BZ3A 3P5KA 3V5PA 3CPCA 4QMTA 4K1BA 4O1PA 2AC3A 3ORLA 2YJSA 4JJRA 5CZIA 3UE4A 4F09A 4EEVA 2QQ7A 2XNMA 4DG2E 2YM6A 4XG3A 3Q52A 3QQJA 3LCTA 3POOA 1UKHA 4N4SA 3ZUVA 1QPEA 2J7TA 1J1BA 2E9VA 5KUPA 2QOIA 4XG8A 5LWNA 2YLEA 2ZYBA 4QMSA 1SVHA 4IVAA 5FM3A 5LMAA 3NMUF 1M2PA 2OXDA 4FKIA 3FMDA 4IDVA 4YZBA 4BIEA 5CEOA 3EQIA 3COKA 3GOPA 4I6BA 1PXMA 3F88A 4YNOA 2BRMA 2A4LA 1OKYA 2HY0A 1WVXA 4EK8A 4EK4A 2EB2A 2PMOX 2QOQA 4LYNA 1Z57A 3RKBA 4BBMA 3LIJA 5G1XA 4BYJA 4O4DA 3FLWA 4NM0A 4UN0C 3EKNA 4O6EA 4YTCA 5IU2A 3MBLA 5CVHA 1L3RE 3UYSA 2ITVA 5IISA 4WSQA 5IMEA 4XEYA 3EN6A 4QRCA 2C6EA 4AZTA 4O0UA 3L8SA 1KE9A 4TTHB 5ANIA 2X1NA 2J0JA 3TT0A 2R3KA 3RALA 5TT7A 1RW8A 3AMYA 4XMOA 5A6NA 1OL7A 4BN1A 1P2AA 2YM4A 3UPXA 4CMOA 3UODA 2W1FA 4KWPA 2IN6A 2O5KA 3DU8A 3QTWA 4MWIA 3UP2A 4C3FA 1QPJA 3OWLA 4UY9A 4FA2A 2BILB 5FXSA 1W98A 1UU8A 4AUAA 4G5JA 3OW4A 4IWQA 1GZKA 1WBPA 2XBAA 4KSQA 5HG7A 3DK6A 3NAXA 3C4XA 4M67A 4IC8A 4RVMA 3ITZA 3NUAA 3GU8A 4KNBA 5EYDA 1TZDA 2CLXA 2GS6A 2BDWA 5BYZA 1P4FA 5DE2A 3G0FA 3C0HA 3O8PA 1V0OA 2UW8A 5DVRA 4O7YA 4ZJIA 3HNGA 1Q3WA 4G2FA 4XG4A 4H58A 4BCQA 4F1TA 4O7WA 1UKIA 2C5XA 2ZMCA 3EB0A 4X2KA 1YDSE 2PE0A 2YDKA 4B0GA 4B6LA 2XAOA 2R0UA 4RGJA 1ZARA 3F69A 3DV3A 3TTIA 2VV9A 5C8KA 2J90A 3OEZA 4FV5A 1UU7A 5AP4A 2QOLA 3VJOA 3ZTXA 4ZZNA 2VRXA 2OXYA 5CU4A 3JVSA 3BV3A 4AW2A 5AP6A 2G9XA 4ALWA 5HIBA 4XRLA 4FKWA 4TL0A 5TKDA 3RBWA 2OLCA 3QRUA 3HAMA 5DOSA 5CNOA 3VS2A 3CKXA 2VTJA 1YQJA 3IS5A 4MXZA 4AZSA 4ZIMA 4O81A 4DLIA 1P5EA 4FIFA 4YPDA 3ZBFA 3P5JC 1CDKA 3MN3A 4IX3A 3W33A 4TYEA 4DHJA 4CLJA 3FDNA 4QMVA 2XNPA 4KBCA 4BTMA 5GZ8A 4F7SA 2AQXA 5I9YA 4NWMA 4TYIA 3EN7A 1TQPA 2OFUA 2GQGA 3E87A 3LM0A 4WNOA 5H8BA 3UMWA 4USEA 5AA8A 3FV8A 3N4VA 2JDVA 4RWKA 5HD4A 3KQ7A 5JFWA 5AM7A 3KRRA 4IM2A 2OJIA 4XOYA 3V5TA 2B0QA 4GYGA 3EFJA 1NVQA 1Q8TA 3O8UA 3MVHA 3UO4A 2ESMA 3IW7A 3CSVA 5IQCA 4ORKA 3MPAA 2VWUA 4B99A 5HTIA 2Y6MA 2JIUA 2EU9A 3HL7A 3VBXA 4ITIA 3QTZA 1HCKA 4BI0A 4YJUA 5AAFA 3FL4A 3LAUA 3SDJA 4V04A 3MH1A 3LMGA 4OTIA 1JNKA 2XJ2A 3PDTA 4C4GA 4FTUA 4RIYB 1O6YA 3F5UA 1IR3A 1VR2A 3QC9A 4JR7A 3TZ9A 4CTCA 2WKMA 4DGGA 1U54A 4HGLA 1YI6A 2R3LA 2WMXA 1PXKA 2WPAA 2R7BA 4FE2A 2Y7JA 4FKOA 5KHWA 5EG3A 3B2WA 4FKJA 4N70A 3ZEWA 4C4JA 3UQCA 5EYCA 1UWJA 3AT2A 5BVFA 5E9EA 3I5ZA 3UVPA 1JPAA 3D4QA 1ZYSA 1BI8A 4C4HA 3MTFA 4HZSA 4CSVA 3MSSA 4G17A 5LQFA 3IW6A 3PJ1A 3E7VA 3BELA 3TKUA 3BIZA 1WFCA 2WHBA 3AG9A 1OL5A 4WG4A 3Q6UA 1Q41A 2GQSA 3ZDIA 5HBJA 3SXSA 4CRSA 2FGIA 3LXLA 4CFXA 1ZY4A 1K2PA 4UYAA 4YZDA 3QKLA 1WAKA 4JDJA 3DFCB 5CYIA 3V04A 3RM7A 2XNOA 3KXMA 3IW8A 4D0XA 1M7NA 4M15A 3IOKA 3HP2A 3OFMA 4QMYA 2QG5A 1IRKA 4U8ZA 3DOGA 2BZIB 4LGHA 2HW6A 3BU5A 3C4CA 3UOJA 2REIA 5A4LA 4FTCA 4JBPA 2PZRA 4WG3A 4KB8A 5FEEA 4S33A 4U81A 1R0PA 4GFOA 3PXRA 1SVGA 3VS1A 3QD2B 2G1TA 4KIKB 3FE3A 4R3RA 3ZFMA 4BDJA 4FR4A 2XAMA 1H0VA 2ZDUA 5AP1A 1YXTA 2J6MA 3G2FA 4I5MA 5C8MA 2ITTA 3IECA 2P2HA 1H0WA 4TYHB 3W10A 4F9WA 5A9UA 1FINA 3CXWA 4O7NA 2WTVA 1KV1A 3DXQA 3DKCA 2YM5A 5EFQA 3K3JA 2P0CA 3R1YA 2H96A 4UMRA 2IVSA 4H39A 1T46A 2OI4X 2VTPA 1E1VA 2RIOA 5C9CA 3D7ZA 4ONAA 4EK5A 1ST0A 3DA6A 3NYNA 3QTSA 2C68A 5L4QA 1VLRA 2W0JA 4D2WA 4YR8A 4GK3A 4NFMA 1OGYA 2VTIA 4ZS0A 3W55A 2X8DA 4EBWA 1OL6A 3GNIB 3W2PA 3LLAA 1FVVA 2BRGA 1G8JA 2VTTA 3RK9A 4QQ5A 5KMJA 3MFTA 4KIQA 3DXNA 2UVXA 1PJKA 1URWA 4A9UA 4V01A 4OTGA 2YIRA 3TZMA 3U6JA 3QC4A 5CU3A 3O8TA 2OZAB 2WOUA 4H36A 3QKMA 4BGGA 3GFWA 1V1KA 3LCKA 3QRTA 2VTLA 4F9BA 4LUDA 3R73A 2UUEA 5JH6A 4YGAA 4RFMA 4S31A 2R4BA 1X8BA 4I93A 3L9MA 4M69A 1UWHA 4XUFA 3BHVA 1ZMUA 3BLAA 3KMWA 5HCZA 3D2KA 3TCPA 3R7IA 4F7LA 3IW4A 2I1MA 4I21A 3V8TA 4XP3A 4AE6A 3WZJA 4U3YA 4Z16A 2XKCA 4YJQA 5L2QA 3UIXA 5LVMA 2FSMX 2FSOX 4S32A 2QU6A 4C57A 3R9OA 5CXZA 1U46A 5ETFA 3AD6A 2W1HA 3IPHA 3O96A 2QNJA 2ZB1A 2AUHA 3ALOA 4F9YA 2X7GA 1YOLA 4IHPA 5K9IA 3W0PA 4E5WA 2QKRA 5E8SA 1ZZ2A 4MBIA 3L8XA 4R7HA 5AX9A 2H34A 3VS7A 5JQ5A 3AMAA 3DGKA 2BFYA 4NK9A 2CCHA 5D7AA 5CENA 5T68A 5KMKA 3N51A 4QPAA 1JVPP 4C7TA 1JSVA 4GMYA 3ZC6A 2OJ9A 4F63A 4FIEA 1YHWA 5ANKA 4CYJA 5M53A 2WQBA 2FYSA 4P5ZA 4HVDA 1F3MC 5E1SA 2WQMA 4NTTA 4ZTRA 2XM9A 2O64A 4FTRA 2WMQA 5BVEA 5IEVA 2ZV9A 4OTPA 5DI1A 3ZSGA 4FKVA 4G6NA 3KIOC 1YKRA 4YTIA 1ZXEA 5F94A 1I44A 5KMNA 5IQHA 4YZMA 5DGZA 3W2CA 2DQ7X 3EFLA 4R78A 4G9CA 3FZ1A 2OXXA 3TG1A 1Q62A 2BRNA 4GG7A 4EZ5A 2V5QA 4FSZA 3V5WA 4RC3A 1ZMVA 3MA6A 3KREA 4J1RA 4A9YA 5JGDA 1BL6A 3NPCA 2QOOA 3MPMA 1OIUA 3DT1A 3RINA 4RSSA 3TNWA 4KS8A 1G8SA 2KULA 4O21A 4UWBA 4F1OA 4QMZA 3LPBA 3TZ7A 2X8IA 4R6VA 3NRMA 5KZIA 4EBVA 4BDGA 4ZMEA 3AC1A 3V01A 1UU9A 2PVHA 3F2AA 4CZYB 3EYGA 5IQEA 2OW3A 4A9RA 4F1MA 2C0IA 3OCGA 4XP2A 3SQQA 1XH5A 2W96B 3LFNA 4QPSA 3ZS5A 3HUBA 4BJJA 2FSTX 5IQBA 4IC7A 4HVGA 4O7ZA 4FRFA 5HNBA 4EHVA 2IW8A 3SC1A 3VRZA 4CCBA 1FVTA 2VWVA 4O6LA 1R3CA 3OG7A 3WZKA 4DEAA 3CBLA 1XBAA 2YAAA 3A99A 2DYLA 3LFAA 3U6HA 3S3IA 3Q32A 3TIYA 4L43A 3GGFA 5EQPA 4WNPA 4O0RA 5EW3A 3FPMA 5GJDA 4EWHA 5CVFA 4USFA 3BL9A 2F2CB 4QMUA 4UALA 4IACA 1PMEA 5EM8A 4JX3A 4ASEA 4BYIA 1DAWA 3R2YA 3OROA 3UIUA 4GIHA 2R2PA 2OJJA 4WKQA 4AS0A 1Y57A 5HVJA 4AWIA 4C3PA 3MI9A 4I92A 4LOPA 5L6WL 4OR5A 5E90A 3FKOA 4P2KA 2BAKA 2V55A 4PDYA 3EWHA 4YBKA 1OM1A 4IXPA 4LI5A 4TXCA 5GNKA 3LE6A 4ARKA 4DGOA 2GDOA 1MRVA 2WD1A 5DNRA 5T3QA 5DH3A 1L8TA 2RF9A 3K3IA 3NW5A 3CY2A 4UXLA 3WIKA 3RPOA 4CYIA 3DKFA 1FOTA 2RKUA 3RAKA 1GOLA 4IADA 4BCGA 2UW3A 4OLIA 4AAAA 2PZIA 1XH4A 1BMKA 2XF0A 3DBFA 3QHWA 2BZKB 4J96A 4U7ZA 3LFFA 2YDIA 3MH2A 4PNIA 5E91A 4IW0A 5AMNA 5IEYA 2P3GX 3TYKA 5LXMA 4W8DA 1WVWA 3BYSA 3R7OA 3C5UA 1CTPE 4IWOA 4CFUA 4DGMA 1W8CA 1ERKA 3ACKA 3QTUA 2YERA 4NUSA 5HBEA 3IKAA 4O38A 2WIHA 4HGSA 5M4UA 3BYMA 4WUNA 1MRYA 4BL1A 4NEUA 4R3CA 5J9YA 2B52A 1Q8YA 5CNNA 4WD5A 5M51A 3ZRKA 2GNGA 3SVVA 2VX3A 2ETRA 5A46A 3G90X 5DR2A 3RAHA 4L3JA 4AW5A 2W06A 4M7IA 4NT4A 2VWXA 2RFDA 4M3QA 4I4FA 4RA5A 4YZCA 3SW7A 4DFUA 2YJRA 4CG9A 2YZAA 4OTHA 3QX4A 3V6RA 3VN9A 2A27A 3BYOA 3HA6A 2CGXA 2OIDA 5FG8A 2J0KA 3UZRA 1H1QA 5M4IA 3D15A 5CU2A 2R3MA 4YJRA 3PVBA 1Y91A 3IGGA 4L67A 2Z7SA 4WG5A 3BHHA 4IFCA 2WELA 5H2UA 3BEGA 4GUEA 4BDDA 1PYXA 5HG9A 5IKWA 2CGUA 3PWDA 2V7AA 3HRFA 3NR9A 4O4BB 3PPKA 2PZPA 1XHAA 3I4BA 1LPUA 1BI7A 4FNYA 4W4VA 1JKTA 1Q61A 4GVAA 3F5XA 5ITAA 1WZYA 1MQBA 5HE2A 4PP9A 3ZEPA 2I0VA 5HKMA 2C4GA 5EDRA 2WQOA 3EKKA 2R3FA 4FK6A 1KE5A 2YCFA 4IBMA 5DYJA 3DJ6A 4BWKA 4AA4A 4FGRA 4RJ3A 5CI6A 4EZ7A 2XK3A 4PUZA 4ZMFA 3ID6C 4BKJA 3ZOSA 4UWCA 3R83A 5IQGA 2QKWB 2AYPA 3BYUA 5ACKA 2JFLA 3AD5A 5I9XA 4XS2A 5LVNA 4F7JA 5D1JA 5DA3A 1S9IA 2YM7A 2Y4IC 2F7EE 4MXAA 3QXOA 2WTDA 4FSNA 2I7QA 2E9NA 4ALUA 4I5PA 4F70A 3A7HA 2QR8A 4IZ5A 2ONLA 3OVVA 2GHGA 2C5NA 4LV8A 4RRVA 4R1YA 4OBPA 4ZK5A 3T9IA 3DZOA 3NS9A 4I6FA 4IVDA 5AADA 5BVDA 2JKOA 4RIOA 4LG4A 3HRBA 1JKSA 4YNEA 3ZDUA 5CF6A 3W0SA 2RFSA 4ERWA 3BLQA 3P23A 5GZ9A 1PMNA 3BLRA 4G34A 1NVSA 4L68A 4U97A 4F0FA 1SM2A 3G6GA 3F7WA 5CSWA