4QO1A

P53 dna binding domain in complex with nb139
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
127
structure length
127
Chain Sequence
VQLQESGGGLVQAGGSLRLSCAASERTFSTYAMGWFRQAPGREREFLAQINWSGTTTYYAESVKDRTTISRDNAKNTVYLEMNNLNADDTGIYFCAAHPQRGWGSTLGWTYWGQGTQVTVSSGGGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nb139 Nanobody against the DNA-binding domain of p53
publication title A nanobody modulates the p53 transcriptional program without perturbing its functional architecture.
pubmed doi rcsb
source organism Lama glama
molecule tags Apoptosis, transcription
total genus 30
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qo1A00
2XQBH 3VJ6B 4WY7L 5CMAA 4CU8A 5MEND 3TVMC 1JPGA 2CRZA 1HZHL 4EUPA 4NKIL 4P5TA 1S7VB 4MA7H 5I76A 3BN3B 4MSWB 3MV7B 4LCCA 1NBYB 4HKZB 2GAZA 2C4FT 4D0CA 2AEQL 1FDLL 5IQ7H 4QCIA 5C6TH 1X5ZA 3D25B 1CFQA 1FNLA 1E6JL 5CEZE 1P6AB 1CICA 1QLEH 3LN9A 1D5BB 5J6GA 4PJHA 4IDLA 4FZ8H 4BKLA 5I75B 3KPSB 4R4BA 3O9WD 4LCIL 4TRPL 3B6SB 4JZJA 5BZWA 2FWOA 2B4CL 3WN5A 1B6DA 4M6ML 4PRPA 4A2MA 4KDVA 5GSRB 4NUGH 3SOBL 5ID1B 1XF4B 1AH1A 3Q6FB 4M1DL 1CU4L 1S5IL 5CD3A 4QNPE 1A4JB 3SDXA 1ZV5A 4K8RD 1G7IA 1AHWC 3Q48A 2CRMA 5LCVL 3QFJB 4AH2A 4HT1H 5HVGB 3CAFA 1L4IA 3DGCR 4QWWD 2LTQC 4K3HA 4F7TB 3O2WH 4KUCF 3O8XD 4BSJA 3S4SA 3L5XL 3IU4H 4TSCH 2YD8A 1F4XL 1XF3A 3MV7D 1A0QH 4YEFA 1EHXA 3CVHA 4XCCL 3KYAA 2XPGA 1UM5H 4PP1D 4XP5L 2H2PD 4WU7A 2LAGB 2WUCL 4ZDHB 3HCVA 1XF2A 1VEPA 4I48B 3KPSD 4PFEA 3LKOB 4ODHH 3EYSH 3C08L 1HOCA 1OF2B 2D7OA 1I9IL 3LIZH 3VH8B 1MJUH 2B1AH 3PF2A 3TC9A 2HTKC 1UXWA 4UB0L 5DUPH 3CDFA 4GBXA 3HZYB 4LHJB 5DRWA 3C09C 3QUMA 4TOYL 5DHYA 5GS0D 5I8OL 2BHUA 5FF6B 2Z92A 2LE9A 2Y07L 3QFJD 1A9EB 1MQKL 4YBLB 1WZ1H 3OF6A 5FOJA 3D0LA 4DFHA 1JNLL 1IAKA 5DRXB 3QBTB 1ZLSH 1VKXB 4XPFL 3QUXB 4JRYE 5GQBA 2BVPA 2NNAB 3IF1A 5BV7H 4M48L 1WEJL 4TULH 3SN6N 1GC1L 4S1QH 1T21B 3LSOB 4RAHA 1UVQB 2AK4A 1D6EB 5GGRB 3L6FB 1KT2A 3H7LA 1DVFB 4PV9A 1CGXA 3TESA 1GOHA 5CJOL 1Q0YL 2X1WL 3HMWL 5EORL 4ZYKB 4XB8A 2IBZY 3VGHA 4JG1H 4KVNH 4FQXB 3HRPA 4Q2ZA 1JF1B 1KN2L 3KYMB 4X6BA 5J8OA 5LQBL 1J8KA 3TBVB 4F15B 3KVQA 1IZJA 5JMOC 5H94B 5IM7B 3B8YA 5I6XB 1ONQA 1N4XL 4GRMB 1HCVA 3U9UA 5I1KH 3GJFB 1CF8L 2R15A 3M1BB 3ARZA 4MVBC 4WV1C 4U49A 1G7HA 2XQBL 2NW2A 5I2IB 4ETQA 3QUXD 5HGDA 4C58B 1W8NA 1G6RB 5EUKB 1YPZE 4MA7L 4JQIL 2QQKH 3KLAB 4MXVE 4LMQE 5IQ7L 5C6TL 4KJYA 2J3SA 4RQQA 3R1GL 4J7RA 1DVFD 1QLEL 1PZ5B 3PV6A 4PYHA 4FZ8L 1GCFA 1CT8B 1EK3A 2AQ1A 3ROLB 1T2JA 1J1OH 1AGBB 1MPAH 2W38A 4XVSH 4FQXD 1KLUB 1FYHB 2VOTA 4NUGL 4YHIB 4O5LH 1P5UA 4Y1AA 3TN0C 5F7YC 2LV4A 2PYEE 1ND0A 3D3VA 1II4E 1C08A 5J56B 5ADPH 2JF1A 2EDBA 2GKIA 4HT1L 1HINH 4QHLB 5GSVB 2AERT 1XGTA 1BBJB 3QO1B 1BVLB 4OI8A 2V2WA 2XA3A 3O2WL 3O41A 1HH6B 4TUKL 4OCLC 2P4AB 1BZ7B 1C1EH 3IU4L 3S98A 5DS8A 5DMKB 4TSCL 3AY4C 1EEZB 2BOBB 4MNQE 3VFWB 5BVPH 1JV5B 3UTSB 5D1XC 1A0QL 5DD3H 3FAXA 3PDOA 4WFFD 4WEMB 1QRNE 3MREB 2V2TA 4I0PB 2VLJE 5K9OA 1UM5L 3AS0A 5AEAA 2LVCA 4PGZA 1CDJA 2P5WD 3FFCA 4NRXA 4D0DB 4GAJH 4XTRC 3P4NB 5L8KB 5EU3B 1BX2B 5ACLA 5C0IA 4ODHL 3EYSL 1FRGH 3MR9B 4PLJC 3RTQC 2EYSA 1KIPB 1MJUL 4HBQA 2B1AL 4RBPH 1RK0B 3TJHC 5DUPL 5HI3D 4PRDB 1QR1A 3MRKB 1OSPH 3MLVH 4OKVB 3IJYB 5BCAA 3KPQB 3MO1B 5JO5B 4OFIA 3BPCA 1WZ1L 1X6LA 3N9GH 4K07A 1TXKA 1HSBB 5F6HJ 1ZLSL 4TSAH 4NO2B 3MNVB 1Z9MA 4QHMA 3GI8H 4U6YA 5BV7L 3D18B 4QF1B 1LILA 4TULL 4S1QL 1DSFH 3UTSD 5FDYA 1ZT7B 4ZSOE 1S8DB 4X4ZA 3UJTH 4NN7C 1PKQB 4I0PD 4OZ4A 5K59E 4JPIA 2DTSA 4P2RB 1TCMA 1MEXH 2HLFD 3OKEA 4U1MB 1A9BB 4K7PH 4XVTH 3UZVB 4ZOAA 5LGKA 4OGXH 4OF8A 3HUJA 1V3LA 3EFFA 2I25N 1GZQA 4JG1L 4KVNL 4HGMA 2BY0A 1WWAX 3B9KC 1JZ5A 4J1UB 5ICXB 1KC5H 3X14B 4HPYH 1D5IH 4HIEA 1I3RA 3BPNC 5FYKE 4LF3A 4OZGF 3RVUD 3D2UA 5KAQF 4F9PC 4WHYH 4LVOB 3GSWA 5I1KL 3IB4A 4MQXC 5E7BA 2P5EE 2X40A 1BIIB 3AXLB 4XP4H 2HFGH 4TUJB 2ORBH 5IB5B 1D9KA 4FABH 1O7VA 3ARQA 4XH2A 1AO7E 1GJIA 1UZ6F 1B88A 4K9EC 3CCHB 5FA3A 5ANME 4UOW1 5C71A 5IF0B 1KJMA 2QQKL 2PR4H 5F9OH 1PQZB 2X4QB 2A74A 2EDKA 2AJUH 3OKLB 3Q2CA 1RZGB 1O5DT 4EUPH 3VWKB 3P9MB 3WNMA 4MJIA 3L3OA 2CIKB 5DF0A 3PGFH 4P2RD 5T3ZH 4YWGL 3P9LA 4JR9H 4PG2C 1R3LA 4UU9A 4RGNB 1AGFA 3TVMA 4ZFFB 4MDIA 4LFHD 4H1LA 2BFVH 2OR8A 4XVSL 1OB1B 3BEWA 4JANB 4P46B 3IKCB 4CBPA 4PRAA 4ZS7H 5J6HA 3PABA 2BY3A 4O5LL 3W11C 4OI9A 4G6AD 1SYSB 5F9WB 1MLBA 2BVUA 2Y5EA 5ADPL 3ARGB 5I1DB 1HINL 3MJ7B 3U7AA 2CIIA 3PNWB 3ZE1E 3IS0X 3LS4H 2QADC 1KGCE 4I2XE 2B20A 5DR5H 2DBJA 1I1CA 1C1EL 5CKGA 1XFPA 4RX4D 5BVPL 2JJWA 1ZHBA 1AHWA 1RZKH 4JO1H 2CGRH 2EKSB 4GW1A 1KTDB 5C07E 1G6VK 2ZG3A 2JIXA 4ZODA 3W5NA 3VWKD 3VDBA 1TQCB 2J8UF 4LSUH 4GAJL 4WUKH 4CGTA 4NO3A 3CVHH 4NKQB 3N1GC 5B38B 4RGND 1LNUA 2FH8A 3EYVA 3V4UH 3LKQB 1FRGL 3P3YA 1J5OH 2NY5H 4K23H 5JOPD 4L4VA 1I1AC 3VD7A 5GISH 5D2LF 4P46D 1NCNA 2QSVA 4Z7VF 3JV4A 1OSPL 3MLVL 5J9PB 1A6WH 3ZDYF 4RMSA 4JKWA 3A0OA 1MJ7H 4XP9H 2VLKA 3QUMH 3ARGD 4UOW0 5DGRA 2YS4A 5HHQB 3N9GL 4L3CA 4WU5B 2XTJB 1E0OB 4TSAL 3IFOA 2EDYA 3PWPA 2VDMH 3MLZH 4KI5F 3GI8L 1M7IA 1Q0XH 1JGEA 1RZIA 4Z77B 4W6XB 5EC2A 1DSFL 2CUIA 2VZOA 1I8LC 4C83A 3B8SA 4L3EB 3UJTL 1FFOA 1LQSR 1OLZA 5KSAC 5JIHA 3FZUD 4MCZA 5MEOB 1MEXL 3PQYE 4K7PL 4XVTL 2VQTA 2WNGA 1IC7H 4OGXL 2NZ9D 7CGTA 4H26B 1HN1A 1MCDA 2GJJA 2F54A 5D2NB 1KSRA 3EHBC 4JY4B 2CXGA 1KC5L 4HPYL 1D5IL 4L4TB 3QUKB 3CFDA 1YY9D 5KG9B 3MRNA 5E8PB 1G0DA 2DTMH 4XWOD 3UTPE 4XP4L 5F3HA 2HFGL 3GMQA 2ORBL 3QQNA 3PV7A 4FABL 3MJ9A 1V3MA 2XTJD 4JPVH 3CH8A 2ESVE 1HQRA 1U8NA 3CK0H 5C09E 4DK6A 1FIGH 3KPMB 3QFDB 3SJVB 1T0MA 1H3VA 2PR4L 5F9OL 2FRGP 3PJSB 2AJUL 4L3ED 3EYQD 3F7VB 4PRHB 4WV1A 5C0BA 5FYLD 3PGFL 5T3ZL 4JR9L 4Z7NE 4DN4H 3M17A 2OYPA 4L5FH 1EX0A 2BFVL 1F4WH 2YRPA 2WMPA 1QQDA 4X9HA 2EIEA 5E24E 4ZS7L 5JQHC 3TNMA 3JXAA 3EO1B 4KK9D 4L4TD 2NXZC 1WIPA 1GGTA 5F1OB 4GRWB 1TTFA 5ITFA 3EYFB 2CR3A 1J0KA 1KPRA 3CXDH 5BRZB 1I1YA 4AMKH 1EGJH 3QH3B 3LS4L 1T04B 2DJSA 5DR5L 1QBBA 4N0UB 4UNTA 1KEMH 2QQNH 3K4DA 3SJVD 3TN0A 5EZOH 4FQLL 4FXKB 1RZKL 3KS0J 2CGRL 1VFAB 1X5JA 3CDGA 4NHUB 4AZ8A 2A73B 3FQNA 1BJMA 2R0KH 1UYWH 2J5LC 4RBPK 1I7ZA 4QHNA 5I30H 4RA3A 2VLRA 4PRHD 1L7IH 4LSUL 1M05A 1I9EA 4WUKL 3CVHL 2DM7A 1JPFB 1UB5A 2IG2H 4CVXA 1Y18B 4KJQC 3AY4A 4LRNH 2BVQA 3V4UL 3FKUS 5D1XA 5DJ0B 5JZ7D 2NY5L 4MHHI 4K23L 1NGZA 5GISL 3I6GA 3QSKB 4OZIA 4KKAD 4FN0A 3NAAH 3ALXA 1LEKB 4P48A 1A6WL 5JXED 3IVKA 3U6RA 3VD9A 1MJ7L 4XP9L 1J86A 2W91A 1AD9A 3GMPA 3QUML 4JAMA 4YDLC 5BRZD 1MCRA 1M6OB 3BO8A 3RTQA 5KSVB 3E1F1 1RULH 3QXTA 5GGSY 2XQYG 5E4EB 3RIAF 1PX4A 2EEAA 5TFSH 2VDML 3MLZL 5L2KB 1Q0XL 1RPQA 2ARWA 1CLOH 1W72B 2IQAB 1WFOA 2O93L 1TQBB 4NN5C 3VI3E 3OAZH 3GKZA 3KDMB 2R0LH 5JPNB 4R6UA 4J4PD 5F7FA 3DIFB 4IM8A 3IFPA 2O26U 2P45B 3JTSA 4L29B 1SVZA 25C8H 5F7LB 1IC7L 4JFXA 5CZXC 4L8DA 5I8CB 1R3KB 4Y4FB 3D39A 3EKCA 5CGYD 2ZUVA 1I3GH 4KKCD 1VHPA 1FC1A 1T5XB 2HT4D 4X98B 1BMGA 1KPVB 1JPSH 1X7QB 1OY3B 2ATPA 3I3DA 2DTML 2VDOH 5HD8D 2BERA 1A6TB 2ZSVA 3CFIC 2CKBB 1BQLH 2VDPH 5IFAH 3B9KA 4JPVL 2APXA 4HUMB 5H37G 4E42A 3CK0L 3FQXA 2BSTA 3UYOD 1YMMB 4G9DA 5L2KD 1FIGL 3O3AA 2KQMA 1QO3A 1J05A 3RKDC 3RIFF 5DQJB 4F9PA 2VZVA 3FHAA 2EDHA 4NSKB 4ELKB 4LK4A 5IBLC 4JVWA 4DN4L 1FVEA 4L5FL 4N1EA 3SDCB 3KWWA 1LWRA 2FJHA 4H0IA 5HGAA 5H35A 4K7FA 1F4WL 1MF2L 3CSYB 4Y4FD 4H1LH 5BS0E 1JGDA 1FNEA 4K3EH 2V9QA 4O00A 1N3NB 2P1YA 2QSQA 5F1IA 2YR3A 3VG9B 3WFHB 3RPIB 3QEUA 4PG2A 1MHEA 3L3HA 4R2GB 3CXDL 2ENSA 1I7TB 3H9SB 4AMKL 1A1MB 4CDHA 1U92A 1EGJL 4OUOA 2L7JA 3SE4C 5KN5B 6FABH 5E5UB 2DIBA 3QULA 2D4FA 4PLOB 1YMMD 3VXMB 3ESUF 1KEML 2AJYH 2QQNL 5EZOL 4MA1B 3HI6H 5F6HI 4ACPA 3K7UA 3U1SH 1CBVH 1S78C 2R0KL 1UYWL 2R4RH 5I30L 3EGSA 1L7IL 5D4QA 3CLFH 2GJZB 4MX7B 5EA0H 5F44A 4NOFA 2IG2L 1C5BH 4LRNL 3T0EE 2LU7A 3SDCD 3VFPB 1GOGA 2C9AA 3H6JA 1BQHB 5I1CH 4Z7WA 2HFEA 1WWCA 3AREC 3NAAL 4PBXA 2ZCHH 3LH2H 4U7MA 1JPTL 4XNMB 5E94A 4MQ7B 3GB7B 3MQIA 4R2GD 3RA7H 2DF3A 4GLRH 3H9SD 5D5ME 1K8IB 1RULL 5DK2B 4JHAH 3WNLA 3X13B 2W9EH 1I1AA 1A7NH 2IH1B 3IJHB 3MRBB 1QG3A 1G7JA 4HIIB 5TFSL 5F8QC 2Z4QB 4WEBH 1CGTA 4POZD 4WRLA 1CLOL 5IUSA 3VXMD 2YA2A 1FAKT 1K9TA 4EI5B 2EDDA 1ORQA 2G75B 4CVZB 2R0LL 4P0DA 3RZWA 5C9KA 2P43B 2RBLA 4DZ8A 4QY8B 3VFMA 1UJTA 4HFWB 5GS1B 3WCYA 1RVFH 2P24A 5DJYB 1BECA 25C8L 2A77H 3DRQA 4JVPA 5BJTA 3EJYD 1NKOA 2Q3ZA 1U3HB 4YHYC 3C2SA 1I8LA 3RWFB 1TTGA 2IBBA 2WBJC 4HUWB 1MLCA 1S7WA 1I3GL 5KSAA 3OWEA 2KZ1B 1HHHA 1YECL 4P2QE 2ADJA 1JPSL 4YFEA 4P4KC 1BPVA 2OS7A 3ARBB 5DLMH 1MH5A 4Y2DC 3G6JE 3SDAC 3V0AC 2VDOL 4PJAE 5IFAL 1BQLL 2OI9C 2VDPL 5B39B 5D7IA 4YQXH 5KANG 1ZVSA 4EVNA 4JQVC 4FFWC 3SKMA 1G7MA 4NCC1 4XMKH 3TYFB 4ZXBC 4EI5D 2BNRA 3DUUB 3GJEA 3OAYH 2J8HA 3VXRE 1MI5B 4RAVA 4UMGA 3UTZB 4Z78B 4GKZA 1B4RA 4TTGA 3EZJB 4CADA 1FLRH 2FIRT 2HVJB 3WSQH 2DYPB 1NFIB 5T1MB 5E8OB 3H8NA 1FJ1B 3UZQA 1U3HD 4PJ7E 2PO6C 2R1WA 2EH8H 1OAQH 5DHVA 3CC5A 2R23A 4F9LC 4KRPC 5C6PB 4K3EL 3GGWA 1G7QB 1DEEB 5E2UH 4BUHA 3BH9A 4X7TB 1RY7B 5KS9A 3ARBD 4AG4H 4N68A 1WCQA 2X70A 1ZA6A 2ZNWA 3FRPA 4NBXB 6FABL 3C9NB 2HRLA 1C7SA 4J3TA 3HE6B 4J3OC 2AJYL 1ZMYA 3HI6L 2DLTA 2FBOJ 1NCCH 4XXDA 4PJGB 3NBNA 5GIRA 3U1SL 1GRWA 1CBVL 3IAGC 1JTTA 5L88H 2R4RL 1RIHH 1K5NB 1MI5D 4JPKH 4ZUWB 5DMGC 5HYJB 5D7LA 1XGUA 3CLFL 4PGEA 5IMLA 1PLGL 5EA0L 5C8JB 5IW1A 1C5BL 2DYPD 4O51B 1MWAB 5LWYH 5AZEL 3X12A 5IEHA 1DQMH 1RIUH 4Y8DC 1AP2B 4HKJA 3ARPA 1QSZA 2JCCE 4ZUUB 2KUTA 1KBGH 3ZT6A 4K71C 2ZCHL 3LH2L 1FNAA 4PJEA 2JB6A 3QEGH 2AJ3B 1MCKA 3OAZK 1X5LA 4G9FB 3RA7L 1YDPA 3W39A 4PG9B 2GJ6A 1IGYB 3SY0A 4I3GA 3MV8A 5HYEA 1U8PA 2X4PA 3LD8B 3QWRD 4JHAL 2W9EL 4QLRA 4XWGH 4HWEH 1ZHKA 3FN0H 4WEBL 4MD5A 4EI6B 4PTTA 3HE6D 5DDHA 5FUOH 1A4KB 4NHCH 4HMCA 5D2LE 3LQAH 3GFUA 2OJZH 1X5FA 3WKMH 5J11B 3L9RB 4U6XA 3C5ZC 3BUYA 4FQ1H 2C3VB 1IGMH 4DTGH 1T1WA 2PW1A 1RVFL 2VDNH 2FJFA 5HYJD 4OGAD 4XX1G 1XH3B 2DBLL 2A77L 4QXGH 1YNTA 2I27N 3D9AH 1M7XA 4YGVB 3C6SA 1LE5B 4R7NA 4FNLH 3UTQA 2XN9E 5IVOA 4FTVE 3RWIB 2NX5A 5HHOD 3CZJA 4KI5E 1WAAA 1NUNB 5I73B 1IQWH 3MTRA 4D0BA 3STZB 5T5NF 4DW2H 4Q9RH 1JWMA 2OL3B 2QSCH 2Y6SD 3O4LA 5DLML 2GT9B 2JB5H 1OP9A 4QRPA 2A0LD 2QHRH 4LIQH 4AEEA 2F74B 4YQXL 1BD2A 5C9JA 5AUMB 5TE4H 3DX7B 3F6IA 5ECJE 1N7MH 4BZ1H 2R2EB 5E4IA 2PCPB 4R4NC 3ULSA 3Q1SH 4XMKL 3LKSB 4PP2B 3AS2A 4PRIB 3VRIA 3UDWC 5FDWB 4JRXE 3P73B 4OI7A 1EEQA 2FDBP 3QPQD 5C0DA 4LAJH 4N8VG 4EIZC 3W0WB 1J8HA 5J3HC 1FLRL 3WSQL 4WI5A 3QIUB 3FQRB 3RWHA 3T0BA 3KPNB 1XF1A 5ENWB 4AT6B 4XCNA 4K9EH 1OGTB 2APBA 1FL3A 4TVSa 2EH8L 1OAQL 4ZFGH 1ZGLB 5I74C 3KHQA 4HS6A 5IEKB 5J89A 4IEFB 4YBQC 3IDNA 1ED3A 2A1WH 2O5YH 3MRIA 5E2UL 3VFUA 3L3JA 3T65B 5D7JB 4XCEB 2X89A 4AG4L 3LKPA 1BQUA 4FQIH 1X5XA 3NN8A 1IQDB 2ZG2A 3CUPA 1B0RB 1AXSA 4WI4A 5I1JH 4LLYB 4X5WA 5EC1A 2AXFA 3ZTNH 4PRID 1JK8B 1LDPH 3OGCB 1NCCL 3K1KC 4PJDE 1T5WB 3C8KB 5L88L 4PB9H 1WFNA 1EAPB 1BVKB 3SE4A 1RIHL 4F7MB 4JPKL 4I18B 1NAKH 3W0WD 4LKXB 1WZKA 5ACMA 2B2XH 2WQRA 5DRZB 3U4BH 1CFNA 3QIUD 3D6GA 1FVCB 4FQHB 1PYWA 1QLFA 1EHAA 2GK0B 1DQML 3B9AA 4UDUA 4CU6A 1RIUL 4WGWB 4I5BA 3F12A 1KPUA 3G5ZA 3LS5H 43C9B 1T1ZA 5HVHC 1KBGL 2B7DT 5DJZB 3SGDH 1P4LB 4LGPB 1J87A 3E2HC 1XZ0B 2Y4SA 1F4HA 4NQXA 3QEGL 5DC0A 3I3EA 4DVBA 5F7DB 4FMKA 3ECBB 2CJUH 5D7JD 1ZGLM 2OTUB 3R0MA 2HFFB 5FKAA 2BCKB 5J57B 4XWGL 4HWEL 2VABA 4ZFZA 2IJ0C 2FL5A 3AREA 3FN0L 3BD4A 5FUOL 1QFWH 4NHCL 2VXQH 3T8XB 3LQAL 1J0IA 2GEEA 3BSZH 4KJWD 3ZKSD 2OJZL 2YEZA 3A6OA 3WKML 5I16B 5HHMD 3V7MA 5ID0A 4FQ1L 1IGML 4DTGL 3MODH 2VDNL 2XG5A 5F1KC 1NQBA 2X4OA 5IFJA 2I26N 3RPKA 4KK6C 4QXGL 5FYJH 3FMGH 1JZ2A 4Z7OE 2HJKA 1B0WA 5E6ZA 1HH9A 4MJ5A 4LP5A 3O3EA 4NKDB 4B53A 3O45B 5E9DE 4D9QE 1EFXA 5DJAA 3ARTA 1FN4A 1IQWL 1QUNA 1GGUA 4DW2L 2RJMA 3EJZD 4Q9RL 2QSCL 4M7LT 1D7FA 3J8F7 1IARB 4U1NB 3PUCA 4HC1A 2NY6B 1FGNH 2JB5L 4F3FB 4MD4A 1U8IA 4GRLB 4LIQL 2QHRL 3OAYK 1F97A 4HX1B 1UJ3C 4Y4KC 2WBJA 1LO0H 2R4SH 5TE4L 2K1MA 4TUOA 2HN7B 4BZ1L 1N7ML 1W0WA 1LK3H 4JFPA 3S37H 3F5WA 4WTWA 4HWBA 3Q1SL 1CFSB 2IALB 1UB6A 2D7MA 4MXQD 4P4KA 4Y2DA 3QZWB 3SDAA 4WJ5A 3O2DA 3ROOB 1D5MA 3FB6A 4JQVA 4OGYH 3ULVC 3TJEH 3BP6B 2BVOA 3EO0B 3UPRA 4ZXBA 2EDFA 4K9EL 1XGRA 4Q6YA 4KJPC 4ZFGL 2CD0A 3UPAA 2VZUA 1XIWC 4X6EA 4B7IA 4G5ZH 2A1WL 2O5YL 5MERB 3F7RA 5DHVH 1OTUD 3PGDB 4NQCA 5BOZG 4BH8B 1S7SB 4PJ8B 2NY6D 4HFUH 1IC4H 1T22A 4AIZA 5I1HH 4GRLD 4FQIL 2MQ3A 2PO6A 1G1YA 4H25A 2YPKB 4LDLB 4F9LA 1VESA 3HB3D 3OG4B 4HF5H 4P2YA 5I1JL 1IKNC 4LNRA 1N2RA 3UAJC 3ZTNL 2YK1H 1KXQE 1LDPL 1AXTH 1IEBB 2J88H 4QEGA 2CSPA 3DVNA 4OUUB 2NTFB 4PB9L 2BHZA 3QPXH 2N7BA 1RZ8A 1NAKL 4LSTH 1NANI 1NLDH 4JRYA 4KZDH 2B2XL 3QG7H 4M3JA 2IC2A 3U4BL 2G2RB 5GGUB 3MLUH 3MCKA 1V7MH 3HG1B 4S1SH 1SM3H 5IB3B 1WTGT 3LS5L 4QXUH 5TDPA 1C16B 5ESAB 1JN6B 3WEXB 5LBSH 5IVNA 3OXRB 5IVXE 3GM8A 1R5IA 7FABH 5HI5C 2CR6A 2MCG1 1HHIA 4IMLB 3NACH 3BWUC 4PJ8D 2CJUL 3TCLA 3I2CH 3ULUE 3L3DB 5HJ3B 2ZP0T 1L0YA 5F96H 1IGTA 4HJGA 3TBYA 1QFWL 3UPCA 2B5IB 2VXQL 4NP4H 3BSZL 2EIBA 3OKNA 5A40E 3LDBB 4U6HA 2Z8VC 5CLTA 2CPCA 3MODL 3MYJB 1D5XA 2WINA 3BWAB 3BEVB 4AY0A 1OP5H 5BV7B 1QEWB 5DJ6A 1YPZA 3FMGL 1U8KB 4OCXH 5EUOB 3HG1D 3U30B 1RUPH 1AGEA 2XXCB 5E2TH 2DDQH 1J10A 3C5ZA 3RJQB 5C0CB 3VFTB 1LVEA 3LKRA 5SX4H 2FJGA 2Y72A 3S36H 5J12B 3RVVD 2ZOKA 4R0LC 3G04A 1FGNL 1WTLA 3T4AA 3SKUD 2RFXB 3BIKA 5IT2H 1LD9B 1LO0L 2R4SL 4U05A 3LHPH 1CTNA 3PXJA 1BZ9B 1LK3L 4LGRB 4QKXB 2PYEA 3S37L 3C5SB 4PJBE 5FO9B 1UH3A 2E7CA 4RMTA 1DUZB 2XNAA 4U1LA 1BF2A 5IVZB 1QBAA 1YC8A 3DI2B 2OBGA 5ISZA 4YK4C 1RSFA 4OGYL 5F9AC 4MNQA 3TJEL 4JFHD 2HT2D 4GKSB 4HS3B 2ITDA 1TZHB 5E8NA 3S34H 5HY9A 1QRNA 3UDWA 2VLJA 4DK3A 3MFFA 2X2YA 1WBYB 4R4FH 1YN6A 3T2PA 4M6AA 4ZNCD 3MV9B 3BGFB 1JTPA 4OF7A 2HLAA 5E6IC 5C0CD 2HAZA 4I3RH 3ZYIA 5KSBB 1XR9A 1NKRA 1YA5A 1H3GA 4P9HH 2W0FB 4DCQA 2X4UA 5JHDB 4HFUL 4XCYA 1IC4L 5EO9A 1GZPB 5I1HL 3FO1B 5I17B 1FG9C 4D9LH 5F88A 2IANA 4AEFA 1T3FB 4X6DB 2ICWA 4HF5L 2IPUK 3VXQB 2QR0B 1SVCP 3NA4A 3QDGB 1IM3B 2AXGB 2YK1L 4IHOA 3KAAA 2J88L 5CGTA 2VISB 3S3JA 3GSQB 4U2ZA 3MROA 4V2CB 5F9JA 3MPCA 3QPXL 3WE6B 1IGIH 2V7NB 4LSTL 1NLDL 1JE6A 4KZDL 2OZ4A 2P8MB 1WC7A 3QG7L 1SHMA 3MLUL 4MWFB 3HZKB 1S7XA 4ZSOA 1TLKA 3G5VA 2XY2A 1V7ML 5E1AA 1SM3L 3MOAL 1M7DA 4Y5YB 4GXUN 4QXUL 4M8QB 1CGSH 1N5AB 3IDMA 4KK8C 1SY6H 1ZLVK 3KPRE 7FABL 1CDYA 5EZJA 2KL6A 2DM2A 5DUBA 4ZUVB 3LEVH 5J13C 4FXLA 1FFNA 3I2CL 4W4NA 1NBZA 1KCLA 3U79A 3S3SA 5A2KH 4PJFA 4LKCA 5F96L 1FFQA 5E1HB 4NZRH 3GMMB 5D6CA 5EIQA 2IAMC 4ZTOH 5IMOA 2SEBA 2DWDB 1ZSDB 3QDGD 4NP4L 4GAFB 1W0VA 2X7LB 3EOAB 2MKLC 1AO7A 2KPNA 5ANMA 1O0VA 2BNQE 2GW5A 4UT9H 3NFNA 4PJGF 1VACA 4OCXL 3MLRH 5FEBA 3FOLA 1RUPL 1ITCA 1SBSH 2YA0A 1CDCA 4FFVD 5E2TL 2ICES 3VRLF 2DDQL 43CAB 2F53B 3BVNA 4MDJB 1FAIH 1CFBA 2VN7A 3L3IB 4N9GA 2VIRB 4HUUB 1LEGA 3S36L 4A2LA 5CEZH 2BNUB 1QVOA 4ODUA 5IB2B 1M71A 2EEBA 3VDCA 1KV3A 2CDEB 2R1XB 5IR1A 8FABA 4LEXH 4YDJA 5IT2L 4HC1H 4MNHA 1IL1B 3LHPL 3OXSB 4K3DH 2W9DH 5B21A 3TPUA 3CXHK 4NQSA 2J6EA 2YOCA 4YZFF 3T4YA 1HI6A 3GZKA 1WGOA 4KK5C 3DTXA 4IS6B 3WDHA 5DURD 1T1XB 5TDOA 3N1PC 3FOMA 1UJ3A 3QDJE 4G43B 4Y4KA 3GUTA 3DETD 4WO4B 1P1ZB 4APQC 3T0EC 1MSPA 4F57H 3VGAB 4J23A 2ILLA 2R2BB 3N50A 3WFBH 2B1HH 5C07A 4X5LA 3S34L 4KUZH 1JPGB 3BIBX 4EUPB 3GIZH 5I76B 4R4FL 5EO0A 4PJXA 5LJYH 3L3GA 2F53D 2GAZB 4D0CB 4I3RL 4R97C 4QCIB 4ZOBA 1CFQB 4P9HL 5HSFA 5GZOD 1J88A 4B0MM 1P2CA 1KF9B 1EXUA 5J6GB 4PJHB 3W2DH 2ZUSA 4G6MH 5DEFB 4BKLB 4R4BB 1A3LH 5CSZB 4LFHG 1H3PH 1FGVL 4D9LL 3QXVA 2FWOB 3GSOA 1NFDE 1XIWA 5F97E 1CS6A 2YSSB 1F8TH 4PRPB 5C08E 1IM9A 5CD3B 4NIKB 4JLRB 3SDXB 4UUJB 3I6LD 1G7IB 1AR2A 4GW4B 2W65B 4C56E 3MA7A 1VB9A 3CXHJ 5DFTA 5T1DH 1KN4H 4FHBD 1IGIL 4ZD3H 4MYWB 3UYPA 4WO4D 2M26A 3PWJA 1IKNA 3WUWG 3MBXH 4XBGB 2AJVH 4EXKA 4JY6B 1K2DA 2NTSP 3WFZA 4CKVX 1EEYA 3DBXA 1CGSL 3S3PA 1E28A 4JFFE 3QJFB 1NGPH 1SY6L 3CFJA 3PQYA 3CVHB 5T3ZD 1MCCA 2XPGB 4KVCH 4JZNB 4YLQT 5I1AA 4GJTB 3LEVL 4QGYA 1R3JA 1T83C 2EH7H 4U0RB 1HOCB 3AROA 3C6LB 1I1RA 3KXFE 1X5HA 1TPXB 4NZRL 3F7YA 1OP5K 1ZVYA 3TA3C 4EN3C 4PRPD 1UXWB 5J06A 1CLYH 4GBXB 5D96B 5DRWB 4ZTOL 4TTDC 3QUMB 3SKOA 4U1SA 2HT3D 2YUZA 4P23B 3HC4H 4JO4H 1FZOA 5C92A 2Z92B 1K4DA 1KJ3H 1JWSA 2ESVA 4UV4H 3VFOA 5E99H 4YO0A 4M8VA 3S35X 5FO8A 2WIIA 3HNTH 4UT9L 1U91A 4FQ2H 4OLWH 3TIDA 2H1PH 4I9WE 3MLRL 3NIFE 3QXAA 3DSNA 1MAKA 3TNNB 2BVPB 3IF1B 5H8DA 1SBSL 1TJGH 4G42A 3BN9C 1FAIL 1CDIA 3AGVA 1ZT1A 4WNQA 1KT2B 4M1CD 4EOWH 1NEZB 5CEZL 1FFPA 3Q5OA 5KW9H 4PV9B 1LP9A 4PTUA 1U95A 4H5SA 1UQSB 5T5NG 3IXAA 4LEXL 4F2MA 3C6LD 4HC1L 4XAKE 5GGRY 4EKXA 4K3DL 2W9DL 2YC1A 5DYOB 3ZE0F 3IDYC 3KLHC 4NKOA 5F7NC 4GBXD 1FPTH 3WIFA 5FCUH 4R0LA 2MFNA 2VDQH 3RDTC 5TH2A 1ONQB 4P23D 3EFDH 3U9UB 2H8PB 1C12B 4AK1A 3OF6D 3MJ6A 1J18A 3MRQA 5SWQA 2AK4E 2M1KA 1Z5LA 4F57L 4KV5E 1G7HB 2B1HL 2EDRA 2NW2B 2AQ2A 4QRQA 1NGWB 5IB1A 4KUZL 5HGDB 3N85H 3PE9A 1F11A 1U0QA 2FHBA 1IGJA 2ADFH 4KJYB 3NGBC 4RQQB 5EFIA 3IU3B 4MAUH 3OBAA 4KROC 4JFQB 3W2DL 4OLEA 5JNYA 1OVZA 1MCWM 1A3LL 5F1SA 1H3PL 3Q3GA 3S96A 3MMEA 2CLVA 1WIOA 2MOVA 4P5KA 1T1YB 1T6VN 2W9LA 4WFGE 4AM0B 5E6IA 1RJYA 1F8TL 4ZOCA 1WIUA 4N9OB 1XF5B 3T0DA 5JLZA 4A6YA 4Y1AB 4EXPX 3GSRA 1QLRA 4ZTPH 3AM8C 3D3VB 1C08B 5T1DL 1KN4L 3BRGC 1XGTB 4ZD3L 2V2WB 2XZCH 4KQ4H 4Z5RA 3V2AR 3QDME 4DAGH 1SJHA 5C6WH 3THML 3MBXL 5IHZA 2AJVL 3ZDXF 3ZYZA 1QACA 4KI5C 4BJLA 5DS8B 3U0TA 3PIQA 2OZ4H 1QTYT 5BQ7A 5IQ9A 3DURA 4K3GA 3RNQB 1NGPL 2DQEH 4NZDA 3PDOB 4ESKA 1HYSC 2E9BA 2V2TB 5DD6A 2BXYA 4X9IA 3FFCB 4KVCL 4NRXB 3NIGF 2H26A 5C0IB 2EH7L 5TJWK 1S7RA 1RAMA 3SE9H 5F89A 3ZO0A 2V5SA 5DZNA 3DYMA 4LRIC 2BVYA 1QNZH 4YBHA 3REWB 1CVSC 1CLYL 5CEXA 1DQJB 3ZE2F 5FYKH 3JV6A 4KHXH 4Y1AD 4WI3A 4BQ6A 2DS4A 3RX8A 4JO4L 2BJMH 3D3VD 1KJ3L 1OTSD 2E9IA 4UV4L 3BPCB 4DN3H 3ZL4H 1KIUA 2QJDA 3L5WA 5E99L 3UMTA 4HV8B 3HNTL 5JA9A 4FQ2L 2Q86A 4OLWL 2H1PL 4Z0XA 2IAMA 5HYIA 4QHMB 4HAFA 1A6VH 5ETUA 1D5ZA 5EWIH 1TJGL 4M3KB 4NQEE 4RZCB 1KJVA 5D71H 2FB4H 1MHCA 2WLZA 5IB4A 1QFUH 4AYFA 5KW9L 4OZ4B 5CINL 2A6JA 4JPIB 5DK0A 3OKEB 1YEJH 3LN4B 4LPTA 3HUJB 5AWNH 5BS0A 5IG7A 3EFFB 1GZQB 3WHXA 4LLVA 1J1XH 5HDBF 4MZ2A 2VLME 4ODTH 4YR6A 5D7KE 3CDYA 1RHHA 1FPTL 3O9WC 1I3RB 3P30H 4U7SA 4PRBA 5FCUL 4P3CH 4N0RA 3DOSA 2VDQL 1JHKH 3D2UB 4RRPG 1GIGH 3EFDL 3GSWB 2W60A 1CD9B 1MCLA 2VB5A 4PREA 5D7SH 2J4WH 4WUUA 3NIDE 3U36A 4NRZA 1D9KB 2DL9A 2OSLB 2UZXB 2RHEA 4OF6A 3OKMA 1R0AH 1NCTA 2EE6A 4U1GB 4K8RC 5HI4C 5FA3B 3RIAK 5J1TC 2A6DA 3N85L 1TETH 1KJMB 2APFA 4QWWC 2A74B 3P9WB 3WDJA 4HIJA 2ADFL 3MRHB 3O8XC 4APQA 3UROR 2DMBA 3T0EA 4MJIB 1U2HA 4KRNA 4MAUL 5EUOF 3DO7A 4HUKB 2IH3B 3P9LB 1R3LB 4UU9B 4MS8C 1AGFB 3TVMB 5HYSG 4MDIB 3V0VA 4H1LB 1YEKH 3T3PF 3VG0L 3TBWB 4P3DA 2F5AH 4HIHB 3B3IB 4PRAB 5J6HB 3PABB 1CXEA 1RUKL 2F15A 1YUHB 3F6LA 1F3RB 3D2UD 4ZTPL 3S7GA 1P7QA 2DMKA 4O2EA 2JJVA 4NC1C 4PGBA 4WHTA 2XZCL 4KQ4L 1D9KD 2GSIB 4DAGL 1S9YB 4NBYB 5GS0C 4Q9BA 2A6KA 1HXMB 2ZWLT 4ONHA 2FBJH 1IAMA 5KBNC 5DA0B 3TM6A 1ZHBB 1AHWB 4YJZL 3AB0B 2DQEL 3L1OH 1WBXA 4WDIA 2JIXB 3OX8A 2Y7QA 4QHUB 2D2OA 3SGDI 2LTQB 4OV5A 1KLGA 3NFPB 4OZFG 4MJID 4XI5D 4NO3B 5CLWA 3L95A 32C2A 4ISVA 1PVHA 3TVMD 5C2BH 5T3XE 4LLUB 1JYNA 1NGXA 5KSBF 2EKJA 3SE9L 5J1AB 4XMLH 5EH1A 4OLUH 3WKNA 4P2QA 4L4VB 3AU1A 3IAQA 1QNZL 3ZKXC 1X4XA 5EZLA 1RIVH 3G6JA 4M4PA 3JV4B 5FYKL 3I3BA 1U8MB 4KHXL 4S0SD 4JFEA 2VLKB 2BJML 4G7YH 4X6DF 1T83A 4DN3L 1TMCB 3ZL4L 1AD0A 3CFKA 5JR1L 5HGHA 2VAAA 3E6FB 3TA3A 4EN3A 4G8IA 3IFOB 1T7XA 3LRSA 1M7IB 1YEHH 1A6VL 1JGEB 2IADA 3FO9A 1XGPB 4PGCA 3QHTC 5EC2B 3SGEI 3HKFA 5IROC 5HVWA 4KRMB 4C83B 1QZ1A 3GJFK 5D71L 1FFOB 2FB4L 3UEZA 4PGJA 2JIXD 3K46A 5DRNB 1QFUL 2A6IA 1JF5A 3JWNC 1OLLA 1MCNA 2CDFA 3BD5A 1ZWIB 4E0RA 4PJ7A 2EO1A 1YEJL 2EE9A 3R8BB 5J7CC 1AIFA 1YEIH 5AWNL 4N8VA 1JGLH 3L7EA 1FZMA 5I0DA 3MRFB 1BQHG 1J1XL 1MRDH 4L4VD 4ODTL 4GO6B 3MRMA 2G9HB 2R0ZH 2D31B 3VXNA 4P3CL 3HMXH 3UJIH 4WI2A 4KGLA 1JHKL 3PWPE 5IMKB 1H3WM 1CR9H 1GIGL 3WDIA 4YAQB 1A7RH 2VLKD 2YPLE 5D7SL 1OAKH 2J4WL 3GMQB 1B2WH 1R0AL 2EDQA 3O11B 3BHBA 5HDQL 2X4TA 2HTKD 1U8NB 2V7HA 4GKNA 1VFBA 1TETL 4QOKB 3RDTA 3VA6A 3DXAE 4E5XA 5TE6H 2VQ1A 4YZFE 1OARH 3VI4E 3SGJC 2XKNB 1RZFH 2F54E 4XXCC 3PL6B 2FECI 3FT2B 5KVGH 2GYSA 3NMEA 2VDKH 1TDQA 2JCCA 1YEKL 3PHQB 1NMBH 1A2YA 2F5AL 1OWRM 3MGOA 2HTLC 3TNMB 4MNGB 3WFDH 1CDHA 1HHJA 3SDDC 3N0PB 5CZVH 1T66C 2J8UA 1N64H 5ITFB 1T0PB 4NBZB 1A1OA 1BWWA 1I1YB 3MOBH 1I9JH 4JKLA 4A6YH 5HI3C 3LV3A 2R29H 3V6BR 5B39G 5K33A 4NGHH 5D2LA 3DVIA 4D3CH 1X44A 5CEYA 4JN2A 3BT2H 2MKWA 4HK3N 1F3JA 1HSAA 2GFBA 2HJFB 5C0BE 2FBJL 4QOKD 5ADOH 2XWTA 3SCMC 3AM8A 3CDGB 1A3RH 1BOGB 1OOAA 1K4CA 2EDLA 3L1OL 3VXPA 3ZMRA 3FQNB 1Q94A 3F8UB 1EJ6A 5F7HA 3MLWH 5IOPB 1CN4A 1DBKH 4MVBD 3PL6D 2XN9A 3D5OF 4FTVA 4OIBA 1IAIH 2JLLA 4HK3J 1QFHA 1RZ7H 2XTLA 1HIMH 2BVQB 2IQ9H 4JFDA 2C4FU 5C2BL 4NFDA 5KVFH 2OQJA 4I0PC 4XMLL 1N0LA 3HPLA 4OLUL 2GSGB 3I6GB 5I0ZA 4PJHF 4OZIB 1PW3A 1RIVL 3G5YA 3PP4H 4ZFOA 4HH9A 3QDHA 3IVKB 3UTOA 3U6RB 2C1OA 2E6PA 4G7YL 1UADC 5EOTA 3QXWA 4JAMB 3GMPB 5SX5H 2H2SD 3BO8B 3QI9C 4CMMA 1F6LL 4LRIA 5F72S 1EUUA 5IFHH 1NC2A 4OFDA 2XY1A 4RAUB 3K4ZA 3RVUC 5I1GH 2ZSWA 3SDXF 4JRXA 5D72H 4ZUSB 2VLRE 1YEHL 2KZWA 5E8EA 4RWYH 4L8CA 1H15A 1OCWH 5D93C 4DGYH 3QEQA 2CXKA 4PR5A 1F45A 1MELA 5HGBA 1FYTA 3ARRA 3FT3A 3IKKA 1MY5A 5SX4I 2OTWA 3IFPB 4WFHD 4QXTA 3EZ8A 2BVEA 1I8MA 2V6HA 2VR9A 4JFXB 2IBGA 2YRLA 1YEIL 4L8DB 2UWEB 1IBGH 3CD4A 1MRDL 3MV11 3T3ME 3FTGB 4NN7B 1ORSA 2I9LA 2R0ZL 4ORGB 3O4OB 5LXGH 5JOFA 4HGWA 3HMXL 3UJIL 2K7QA 2P8PB 1EJOH 2YN3A 4XTRD 1CR9L 3CVIH 4HKXA 2ATPB 2BY2A 3T2NH 4NKMA 4W68A 4YIQA 1OAKL 1B2WL 2XWJA 5AG8A 4PLJD 4U0QB 3MRLB 4G6FB 3B9KB 5CIPA 5KZCB 1KIRA 4E42B 4KDTC 4YX2H 2BSTB 4G9DB 3H9HA 3O9WA 4HBCH 3V4VH 3O3AB 1QO3B 1J05B 3QAZB 2WBKA 2PXYB 1RZJC 2A9NH 3ZE0E 2E9JA 3DPBA 5FHAH 1OARL 5FUZH 3S6CA 4OLZH 3EAKA 2CUHA 1RZFL 2O5ZH 3D39E 2L7UA 5KVGL 5CWSA 3D85B 3E8UH 5IMMB 2VDKL 4LPWA 5I1LB 2YHGA 1JMZA 2FJHB 4JFOB 1KJ2A 1NMBL 4FS0A 2DICA 4K7FB 5C0GA 3VWKC 3QNYA 1FSKC 3WFDL 3O8XA 5D8JH 3WJJC 1FNEB 3VJ6A 5CZVL 4RGNC 4R90H 1N64L 2P44B 3QEUB 1AR1C 1MHEB 1AGCA 2WLYA 3L3HB 1A02N 1NBYA 1WF5A 4P46C 1KG0A 1I9JL 1NCBH 1J12A 1TVHA 2XT1B 1SJVA 2CDGA 2R29L 2KH2B 4NGHL 4G6FD 3B9KD 4D3CL 5KZCD 5C0AB 1D5BA 3BFOA 3BT2L 2NW3A 5F9WC 5FGCE 4KXZH 2RB8A 2VXTH 3ARGC 3B6SA 5ADOL 2PXYD 1J11A 2QEJA 5FFLA 1A3RL 3OKOB 2GY7B 3MBEC 3IRZA 3MLWL 5CJXC 1XF4A 1DBKL 5A2LH 3V7AE 4PB0H 2Z31B 2QQLH 1CE6B 1IAIL 1A4JA 3D85D 1RZ7L 5E9DA 3OKDB 1HIML 2IQ9L 3PWNB 3QFJA 5KVFL 4G8GE 1JUFB 3JVGC 2G5BA 4Z7WB 2HFEB 1DQLH 3PP4L 3O6MH 1DANT 2NZ9C 4BFGA 2PTUA 4IRJC 5E94B 3TEUA 1HHGA 2HFTA 3JSSA 2C1PA 2Z35A 4ZQKA 1I1AB 4ELMB 5IFHL 1G7JB 1E27B 5C0AD 5I1GL 2UYLA 1FE8H 5D72L 4BM7A 3W11D 2COQA 3PGCA 2ATKB 1OCWL 5CUSH 4DGYL 4GXUM 1ORQB 3BP5A 2XTJC 4DZ8B 1FVDA 4CMHB 2VLLB 4IOFC 4UIKH 2P24B 2Z31D 5SWZE 4N0YH 1GVIA 5HHVH 1N5YH 5FF6A 3EYQC 5IROA 3CJJA 3BXNA 1IBGL 1MLCB 2Q7YB 4BFIA 1YMHA 1FBIH 5LXGL 3V79C 4LASL 2ADJB 2DQTH 2YXFA 1EJOL 1PGRB 3CVIL 5HYQA 3LSOA 1UVQA 1CDGA 4YHPA 1FORH 1MH5B 3T2NL 2FX9H 5D2NC 3O6KH 1CXHA 2VDLH 1MAJA 3L6FA 5FGRA 1R3HB 2EYRA 4KK9C 4GG6F 2VAJA 4EVNB 1I1AD 4QRSA 3HLAA 5FYJE 4OM0H 1S9XA 4YX2L 1LEIB 1G7MB 3DYOA 1QOKA 4HBCL 4LCYA 1WZLA 3V4VL 1W2KT 4ZYKA 2A9NL 2ZUUA 4KKLC 5FHAL 3VFGH 4QRRB 2AKRB 2YPVH 4R7DA 5FUZL 4OLZL 4OD3H 5FM5M 4GKZB 4DKFH 1F4AA 2O5ZL 4Z7UE 5IM7A 1U8HB 3E8UL 5DSCA 1FZKA 1JVKA 2H3NA 2OR7A 4GRMA 4NZUH 3OTTA 4ZO7A 4BQCA 2FX8H 1JYVA 5B3JF 1K85A 3M1BA 3MXVH 3QJHA 5DHVB 1HDMA 1SEQH 2R23B 5DTFB 3SGJA 3OB0K 5D8JL 2GUOB 3BOVA 3GSNA 4UNVA 4XXCA 5D7IE 3GGWB 1QBLH 3TFKC 3IXTA 4R90L 1G6RA 3HUJF 1LO3H 1RJLB 3D1MC 3ZYOA 2ZZUT 3BPOC 3KLAA 5KS9B 4LPUA 4BQ9A 4YNYB 3BRDA 1NCBL 2BNRE 5ESQB 4KKAC 1KLFA 2P5WA 3EHBD 4J2XA 4P59H 3UXFA 2AV1A 3V7AG 5JXEC 3SDDA 4J3XA 4OF3A 2IMNA 2XKSA 2QHLA 2WSKA 3UC0H 4OF5A 4XNYL 4XXDB 3ZDZF 5GIRB 4QRRD 4MZ3A 3QZWG 3V6ZA 1UEYA 4AEHH 5D7LB 4PB0L 4PGEB 5CJ5A 2QQLL 3G08B 5IMLB 2CLZA 5I9QC 5JIIA 1TFHA 3X12B 5IEHB 4TVPE 5F7WC 3BIAX 4HZLA 4PGDA 3SCMA 4J4PC 5L2JA 1BBJA 3QO1A 1BJ1J 1BVLA 4HKJB 5FOBB 1QYGH 2E27L 1DQLL 2JB6B 3OR6B 5DMKA 3O6ML 3VFWA 3RU8H 1JV5A 3UTSA 5E6YA 1YY8B 1CWVA 1YDPB 3QUYB 5D1QC 1S9VA 3SY0B 3HZVA 3MREA 4I0PA 4DOHE 2X4PB 2QKIA 4PJBA 1ODAA 4D0DA 2FX7H 1FE8L 4PY7B 4MD5B 3ZKND 4AQ1B 3T0XA 2YBRB 4LSVH 4J3SA 4LMQI 4U6XB 5E4EC 3ZKMC 5DEGB 4C55A 5EU4B 1RK0A 3QI9A 4O2FA 1X5YA 3BH8B 2PW1B 4GG8A 2JELH 2FJFB 1RI8A 4UIKL 1WLHA 5D7LD 1C5DA 1EA9C 2D03H 4OKVA 4N0YL 2R9HD 4G8EB 3KPQA 1YNTB 3DHMA 4PJEE 3MO1A 5HHVL 1N5YL 3JWDH 4R7NB 2ED8A 4GS7C 3UTQB 4NN5B 3HAEH 3RNKB 2NX5B 2YZ1A 3V6OC 4D9RE 3NABH 3M45A 1A6AB 2GJ6E 2X9XA 3F65A 3MV8E 3MNVA 4V1DE 2YMXH 1FBIL 4D0BB 3DRTA 1EZVX 3D18A 1JWMB 2DQTL 1FORL 3S5LG 1ZT7A 4KJQD 1JHTB 5FAAA 2FX9L 3O6KL 4HK0B 4QRPB 3QUYD 2Y5TA 5F7MC 2VDLL 4DQOH 1BD2B 4OM0L 4P2RA 2FHCA 1A9BA 5CIPH 1K6QH 1MY7A 1GOFA 3VFGL 3K4AA 2YPVL 1CYGA 5ICXA 4OD3L 3X14A 4DKFL 1YEDA 1OGAE 4ZPTA 1WAAE 3DNKA 2NY1C 4KDTA 4JM4H 1IRAY 4KKBC 5GJTL 5I18H 3MZGB 3VFSB 3A67H 3RWHB 2ADIA 4F7PB 4NZUL 3KPRA 2FX8L 1XCTA 2H6PA 3AXLA 3O4LE 1XR8A 4ODXB 4TYUA 4XCNB 1FL3B 3MXVL 1SEQL 4WWID 3WUWA 2JTDA 2UUDH 4HS6B 1KJ2H 3V52H 1QBLL 3CCHA 2OLDA 1DQTA 3V5KB 3IDNB 1ED3B 4RX4A 3MRIB 3SDCC 3ZT7A 3VFUB 1LO3L 5IF0A 4N90E 3R8QA 3RWEA 2X4QA 3UBXI 3VGDA 3F62A 1E4JA 3LKPB 3V5DA 4QRPD 4WI8A 1RZGA 3NN8B 3VWKA 3NFSH 3P9MA 2FYYB 4P59L 1AXSB 3VG9C 3WJJA 1J8HE 3UC0L 5EC1B 2AXFB 1JTOA 5E5MA 3G9AB 3HPJA 1HNFA 5C0FA 2AJZA 2BNQA 3WHE1 1OB1A 4JANA 1Q8MA 4P46A 1MNUH 3IKCA 4U3CA 4XB7A 3L5IA 2X5PA 4AEHL 2MPAH 4WCYL 3IETB 1HHKB 2HP4A 3OV6A 3KR3H 5JW5B 1PYWB 3RUGB 1QLFB 3ARGA 5I1DA 4WW1A 3KHOA 2WP3O 3PNWA 2EE3A 5L6YH 3F12B 4Q0XH 1CTOA 1QYGL 3UTTB 3MBEA 5CJXA 2X42A 3FO0H 5GRVK 4JM2B 3RU8L 4JKPH 5IBLD 5M94B 2AABH 4L3AA 2EKSA 2PTTA 1KTDA 4UV7L 4DVBB 3RX7A 2X89D 4PV8A 5FKAB 4S0TD 3FB7A 5FYKU 5EO1A 3GEWB 4WGVB 2VZ1A 2VABB 3JVGA 4ZFZB 2O5XH 2FX7L 3BGMB 2FL5B 4E41E 5B38A 1A3QA 4IRJA 5CBAA 2WQ8A 3QDJA 1GGYA 4YHLL 4XNZB 2DWEA 4LSVL 1AE6H 2VKWA 3HNSH 1JI2A 2MJWA 5KOVC 3EUUA 4NO5B 1G9MC 2JELL 2C3XA 2X4OB 3CSPA 2D03L 5J9PA 4BSVA 5IFJB 4XHQA 5EBGA 4EI5C 3FB5A 3Q0HA 3JWDL 2CUMA 4Q6IC 2HJKB 5GGVY 4U1KB 3MFGB 4MJ5B 3NABL 2OCFD 3O3EB 1S78D 4Q9CA 1EFXB 5DJAB 3MC0A 1FN4B 3UTTD 2YMXL 2QBWA 3KLSA 3O0RH 4JM2D 4DUVA 1U36A 1NFDA 5C0EB 4MD4B 3GSVB 1U8IB 1MRCH 4DQOL 5C08A 2WM0A 4OZIF 1KTRL 1TTUA 2VL5B 3BYTA 3WHE0 4TUOB 1VFUA 5MEOA 2BC4A 2GY5A 3ILPB 1W0WB 4PS4H 2ZOLB 5HHPA 4C56A 4HS8H 3B83A 3QHZL 1K6QL 1UB6B 4P4KB 3KNBA 1LE9A 5D2NA 3T2OA 2OTPA 3SDAB 3O3DB 2XI9A 3J7HA 3BDXA 2OI9B 1D5MB 4LLDA 3FB6B 4LHUB 4LEOB 4JM4L 5KG9A 3A67L 2BVOB 4JFFA 5DQDH 1AGDA 1KCSH 4KHTH 2X1QA 3RAJH 3AMLA 5CEZD 2DL2A 4OCSH 2DJ4A 1EFXD 5HPMA 4X6EB 4YGAB 1KJ2L 3V52L 3DROA 5K9QI 5EDXA 3QFDA 3O3BA 3SJVA 2XZZA 4TNWK 2UWEF 4P5MA 1EIBA 1FL5B 3GSNH 3KXFA 3QRFM 3IFNH 3LQZA 1T22B 4AIZB 2VSCA 1UA6H 3ULUH 3NFSL 5I66B 1YQ2A 4H25B 4CNIA 3PP3H 3MJ8A 5F1NB 4LNRB 1T7WA 1NAMA 4OLXH 2OR9H 3BQUB 4P4KD 3G6DH 5MEPA 1OD7A 5EOQH 3DVNB 2NCMA 4GUPA 3FCTA 1MNUL 3SDAD 4PJCE 1K3ZA 1JZ7A 1HNGA 1RZ8B 4XC3H 3HI5H 1L6XA 2P42B 2MPAL 4JRYB 1ZA3B 4LHUD 5JXEA 3QB7C 4FFWD 3EYFA 3P40A 1H5BC 3MCKB 3KR3L 5IKCB 2ITCB 5C7XH 4OCNC 4NQCE 5L6YL 3QH3A 4Q0XL 3QQ9C 2A38A 2CLRA 1T04A 5TDPB 2XIDA 1JIBA 3FO0L 1R5IB 3C60C 4JEGB 4JKPL 4UQ3B 1HHIB 4JDZB 2AABL 5EBMA 2A73A 3TCLB 3F7QA 2ZKHH 4J4PA 3LEXA 3VXTA 4M62H 5LAXA 4LCWE 1G1CA 1A1NA 2R56L 3DMMB 4NT6A 2O5XL 4YHMH 3PDDA 1U93B 3OHXA 1IGTB 4HJGB 2Y6SC 2LAAA 1T7ZA 3TBYB 4CJ1A 4HCRH 4K71B 1JPFA 1F58H 1YJDC 3CMOH 2A9MH 3C8HA 3OKNB 4U6HB 3BQUD 1AE6L 4IJ3C 1Z0MA 5D1QA 5E7FA 3HNSL 2BOCB 1D5XB 2WINB 3K2UH 4X8XA 4JRYD 1LEKA 5H2BB 2E9WA 4M7ZC 4Q97A 1YPZB 3BZDA 3CFEA 4RRPA 2Q1EA 3Q6GH 3EW3B 3WXVH 1FNGB 2FCBA 2NY2C 2OK0H 3QPQC 5KSVA 1AGEB 3GK8H 1QA9A 1CQKA 2FJGB 1F5WA 3O0RL 3GHBH 1W72A 2IQAA 2J1KA 4HHAB 3VFVA 1KYOK 4GT7A 5BVJA 5IHLB 3G04B 4AL8H 1P6FA 1MRCL 2HMID 3T4AB 3VXUE 4JREC 4Z7WF 3V6OA 3AS1A 3FO2A 4LQ1A 1KCRH 4L29A 3WUZA 3DMMD 3H7BB 4PS4L 2PYEB 1HQ4B 1MUJA 4B5EA 4HS8L 5DD0H 5HYSA 3PHSA 2I60H 4X6CE 4M1GH 1NDMB 4XRCB 1Z0NA 4HLJA 5GXBB 5I8CA 4U1LB 3TO2B 1JI1A 3QDMA 4ELMF 2UUDK 2GTZA 5J4MA 4K7PX 4N0FA 1T5XA 4MNQB 1WCBA 4M5YH 4X98A 5HDLA 3KPOA 5DQDL 2ITDB 4NOBA 3OG6B 4GG6E 1KCSL 4KHTL 2LVEA 1DE4B 1QRNB 3RAJL 5E56A 5HY9B 1CFTB 2VLJB 6CGTA 3MFFB 3WO4C 3L7FB 1Q9OA 4QXWA 1YN6B 5DI8B 4OCSL 3TT1H 4F7CA 1Q9LA 2PTVA 1RZJH 5EZIH 3EOTH 1TVDA 3NCJH 3QIUC 3VXSE 3B43A 5E08H 2BX5A 4GKOA 4R8WH 5A2IH 3GSNL 3IFNL 4Y5VC 4XCYB 3ULUL 5INCB 1AQKH 5F21B 5F88B 5JPMA 4OZFA 4PLKD 1QSEE 2ICWB 5ISZE 2WK2A 1KYOJ 3OL2A 3LRGA 1WJ3A 2PYED 4OLXL 3UBXB 1PG7W 3SDCA 5D7JC 1ZVHA 1J9CT 1KFAH 2B4CC 2OR9L 4IHOB 5KJRH 5DO2D 1H0DB 3G6DL 3VD5A 2E7LC 5EOQL 3U83A 3CSYA 1DL7H 4YXLH 1GXEA 1UACH 4X7FC 3GIVB 4U1IA 4XC3L 3I75B 3HI5L 3X3GH 1WC7B 1MQ8A 4MNQD 3RPIA 4KJWC 4O58H 1S7XB 4NQEA 4R4ND 4ZSOB 5C7XL 5E1AB 2EZ0C 1A1MA 1JZ6A 1INDH 1QRND 3LIZL 2VLJD 4I18C 3D0VA 2CH8A 2ERJC 2IANE 4D8PA 4L1HA 4D94A 5IW6A 4NO0A 5EOCH 1DLHB 4AENB 4XBPA 3VWJC 1NBZB 2ZKHL 5L7XH 4M62L 5FECB 3EJZC 4MX7A 4QRUA 5EPMA 5D6CB 2KKQA 4HCRL 1F58L 4YBQD 4CUCA 5KS9F 3CMOL 3VFPA 2A9ML 2P5EB 1YZZA 1PY4A 1BQHA 4P2CG 1AO7B 3VRJB 4FFYH 5KVMC 2UY6A 3K2UL 5ANMB 3TWCH 1X5IA 4XNMA 4R26H 4NNXA 3T77B 3Q6GL 3NFNB 4LPVA 4MXQC 3WXVL 3FOLB 2OK0L 1K8IA 4EQ3A 3X13A 2IH1A 3IJHA 3BVNB 3BZFB 3GK8L 1PFCA 1GC1C 2XXMB 4ZPVA 5GRXG 4PJFE 2VL4A 12E8H 3C5JB 3GHBL 2D7QA 2Z93B 2NLJB 3ZSSA 4H8WH 1M71B 3PDGA 4MJ6B 4EI5A 4AL8L 3W5MA 1CQYA 2W0PA 4Q6IA 4Z7QF 3BX7C 1KIQA 4F7EA 4RDQF 4MNHB 1KCRL 1PBYA 2MWCA 4FP8H 5FYKD 3TPUB 4HG4K 2GK2A 4NQSB 2CO6B 5DD0L 2NY6C 5FKPA 2I60L 3T4YB 4M1GL 4UDTA 4HSQA 3RL2A 3ZHLA 4GRLC 4IOIB 3DTXB 5DJXB 2P5ED 4ODSH 2ZUYA 4ONFH 3P4MB 2P49B 4IRSB 3QIWB 3VXOA 3HB3C 2X6MA 4HUWA 1AO7D 3DUSA 4I2XB 5TDOB 3FOMB 4Y4KB 5CZKA 3GSUA 3DV4B 3RY5A 2DQIH 3QIBC 4M5YL 2VKXA 1I85C 4ALAH 5C07B 1KULA 1ULVA 3OPZH 1J1OL 1MPAL 5B39A 4L9DA 1TCRB 5EO0B 3TT1L 4B7LA 4MMZC 5EZIL 3EOTL 3NCJL 5F3BA 3DGGA 5TQ0H 5E08L 3HC0A 1VCAA 4R8WL 3TYFA 1OAZH 3MOQA 2IFFH 2ADGB 3DUUA 3QHFH 3CFBA 3ZLQC 4UT7H 4CW1B 2X1XR 3ARFB 1AQKL 3UTZA 1I3UA 3DX9A 3GSOB 1XIWB 1M4KA 3BRFA 2DYPA 2X09A 5B4MC 1IM9B 4PJ8C 1KFAL 3MRCA 4U1JA 4YPGB 5KJRL 1FJ1A 3BE1H 5DD3L 1NAMH 2X1PA 4IRSD 3U0WH 1KGCD 3MRGA 3QIWD 3MA7B 3KG5A 5AG9A 1V05A 4HG4J 4YXLL 1UACL 4Y4KD 4OBRA 3X3GL 4PJXE 4OTXH 4U1HA 1G7QA 2MHAB 4L8SB 3DWTA 1DEEA 3T0WA 2X4RB 4X7TA 3BMWA 1HILA 1Q38A 4L9LC 4O58L 5LGHH 4XHJC 5I1IH 1CD0A 3ULVE 5C07D 1YYMH 1INDL 1I8KA 2R2HA 2Y06H 1EEYB 3HR5A 4OIIH 3DBXB 4WI6A 5LGJA 2BDNH 5SWSE 1E28B 3C9NA 3ZZ1A 3CFJB 3PQYB 5CKAA 4LVNB 4OD2B 2UY7A 1H5BA 5EOCL 1CFVH 1OL0A 4NDMA 4OZHF 3GBMH 3TBSA 4BZYA 1HYRC 5L7XL 3ARFD 2VXSH 3C2AH 3RVVC 4XPTH 3F7YB 1XIWD 3NCYP 1J7VR 1IM9D 4LNVA 3C60A 2YPLA 3SKOB 4WWKC 5HHOA 1J0JA 5E00B 4M5ZH 5B8CB 4RFEA 4ZUUA 2ESVB 1JWSB 4FFYL 4UT6H 5C09B 4NQDE 5DD5H 1J0ZA 3TWCL 4GW5A 2B5IC 2X4NA 5FO8B 4R26L 3EDDA 2AJ3A 1U91B 4GMTH 5C86A 3DXAA 3MUY1 3WIHA 3QG6A 3UAJD 3SHSA 1HEZB 4MXWH 2KBGA 3LN5B 3LPWA 4M43H 1XGQA 5DQ9A 1ZT1B 3PQYD 12E8L 3H9ZA 1TVBB 1KTLB 1A4KA 1EUTA 3RUGF 4AJ0A 1NGYA 1N8ZB 1SBBA 4H8WL 3AAZB 3U30C 1U95B 3SGKC 3BKMH 4F2MB 4Z76A 3NCEB 5INDB 4TSBH 4HULB 4RMRA 4JM2F 5J12C 4FP8L 1XH3A 4PJIF 1VGEH 4U4BA 5A16B 5TPWH 2AS5M 3HNVH 4M9OA 4NCDA 5F8RC 1K3IA 5HI5D 3WIFB 1LE5A 3B2UC 4ODSL 4ONFL 4R0LB 3UTPD 4CRPA 3RWIA 5TH2B 4ZO6A 2ARJA 5A3ID 4JY5H 1G7LA 2ESVD 5C09D 3STZA 5SWQB 1WK0A 2DQIL 1Z5LB 2VYRE 2IF7A 5KVEH 4ALAL 4P57A 1UC6A 4F8QA 2DQUH 1CD1B 1LP9E 5IB1B 3OPZL 1AFVH 4WFEE 3QNXA 1CE1H 4LAQH 4Y16C 2BSRA 2H41A 3DX7A 4YK4B 2FZ3B 2R2EA 1TNNA 5EFIB 4QT5B 5TQ0L 3LKSA 1OAZL 1CGWA 4KY1H 5GGQH 2IFFL 2WWMC 3QHFL 2BMKB 1DN0A 2NY4B 4UT7L 3QCVH 3S96B 3MMEB 3PWVB 3ORJA 4P5KB 3RQ3A 3RKPA 4R3SA 3QIUA 3DO3A 3FQRA 1A6PA 3KPNA 4OZFH 4R96B 1TZIA 3NPZB 4LSRH 5ENWA 4JO1L 3BE1L 5JTWA 4Y5VA 1NAML 1OGTA 1QLRB 3U0WL 1IILE 1ZGLA 5IEKA 4QNPF 1A64A 4OTXL 3EOBA 4Z5RB 1SJHB 3NOIA 3GBNH 2XZAH 5LGHL 4JB9H 2KDGA 5D7JA 3RZCC 5I1IL 1YYML 3PIQB 2P48B 3U0TB 2DQGH 1J5OL 2Y06L 2ZG1A 5BQ7B 5IQ9B 2E7LA 2BDNL 1XT5A 4OGZA 5K9KA 1ES0A 5DD6B 4LLYA 2K9UA 1FZJA 4HPOH 5F70A 4LBEB 3SQBA 1NDGB 3QQ3B 1CLCA 1CFVL 4K94C 4Y5YC 5DVLA 1NSNH 4FFVC 3GBML 1B9ZA 3C8KA 2NY4D 3BESR 3S88H 1S7RB 2Y1VA 3RWDA 4F7MA 2VXSL 3C2AL 3ELAT 4I18A 3CH1A 1C7TA 4OAWA 4LLWA 1SMOA 4O4YH 4XPTL 3RGVC 5DRZA 5CEXB 1CZ8H 1FVCA 4FQHA 2GK0A 4M4RA 3JV6B 4LOUC 1DP0A 4N1HB 5J13B 1EBPA 1H8SA 43C9A 1MFNA 1ZT4A 4M5ZL 3VWJA 1JHLH 1ROWA 1WT5C 5DJZA 1V5JA 1P4LA 2VSDA 2WV3A 3DI3B 4LDOB 3L5WB 5DD5L 5C0NC 2BRQA 3T08A 4URTB 2LU4A 1F00I 2Q86B 4GMTL 1I7RA 4GAGH 4Z0XB 2IAMB 2DIAA 3MYZA 3ECBA 4LSSH 5ETUB 1D5ZB 2DLIA 4MXWL 3ZHDA 2I9TB 2OTUA 1F2XK 2HFFA 2BCKA 15C8H 2X4SA 3DETC 4ZNEA 3G6AA 5IK3B 1BFOB 4HIXH 3T0VA 5EOCJ 1V3JA 4MAYB 3TCXA 2A6JB 3EDFA 5DK0B 1REIA 2K7PA 4KC3B 5MP6H 5I16A 4YHNA 5MHSE 3BZEB 1S3KH 3BKML 1HKLH 1FC2D 5BS0B 4LLVB 4TSBL 4ZMAT 4LVHB 3QNZA 4FQJH 2D9CA 3KJ6H 1VGEL 2MSPA 5TPWL 2DN7A 4YR6B 4OFYD 3HNVL 1LDSA 1NCWH 2AW2A 3BDYH 1U8QA 3VE0A 1L9MA 4CN4A 4BH7A 4ENED 4O2CA 4X7CC 3WNKA 4POYA 1Y6MR 4JY5L 1DBJH 2AXHA 2GHWB 4PREB 2XRAH 3SQOH 3U36B 1MFAH 2D4DA 1TITA 3OKMB 4M93C 3CPLA 4RMQA 5KVEL 1YC7A 4U1NA 5GRWA 1CIUA 2DQUL 4RMVA 2IAMD 2D9QB 3LOWA 3O6LH 2Z91A 1AFVL 4GRLA 1CE1L 4LAQL 1QD0A 5DFVD 4ETYA 4WO4C 2HN7A 4HIJB 1YPZF 1FIEA 3VGAC 4MXVF 4APQB 1L9NA 3T0EB 1S7UB 3QIBA 4MAYD 2VWEE 1I85A 5DFWH 2CQVA 2IWGA 4KQ3H 4KY1L 5GGQL 3CU1A 4G8GA 1IT9H 3QZWA 5DC4B 4RISH 3QCVL 5T3XH 4NPYA 2NY3B 5BS0D 5BZDB 2EIZA 3DX8B 3AC0A 4R97B 1BGXH 3GMNA 4WUUE 1Q9KB 4LSRL 5IW3A 4RIRA 2FO4B 5D5MB 2XG4A 1UCBH 1QSFE 2E6JA 4MD0B 5CJQH 4O2EB 1DCLA 4PGBB 2OMBA 4XPBH 5MERA 2AV7B 4PD4K 5IP4A 3GBLA 2Q20A 2HT3C 3GBNL 2XZAL 4XAWH 1S7SA 4BH8A 4JB9L 4PJ8A 2A6KB 4ONHB 2DQGL 2D0FA 1H9VA 2YPKA 1WBXB 4WDIB 5SWZA 4MQTB 3OX8B 2Y7QB 2GIYA 2NY0C 1JBJA 4IIQC 4PPTA 4OV5B 4APQD 4HPOL 3T0ED 3FONA 5JW4Q 3BW9A 1IEBA 4L9LA 4HDIB 1NSNL 3LY6A 5FA4A 3L95B 3KGRA 2NTFA 4ISVB 5HXMA 4CU7A 1NMCB 3S88L 2C7UA 1NGXB 1OM3H 2VE6A 2NY3D 3VW3H 4P2QB 4O4YL 5FB8B 3AU1B 2V5TA 1KEGH 2G2RA 1CZ8L 3WLWC 5F6IB 5DJDA 4JFZH 3DYPA 3G6JB 3HG1A 4PJAB 5IB3A 4U0RC 3C6LC 4YDVA 1ETZA 1LO2H 1T6WA 3BD3A 4KRLB 4MA8H 2BSSB 1TPXC 2QTEA 1JHLL 3GSXB 4ZAKB 3L3KA 3OXRA 5TGBA 5D96C 3ARUA 2VAAB 5HGHB 5T33H 5IBUB 4G8IB 4EN3B 4GAGL 5EU6E 1YQVH 4H20H 4N1CA 3S5LA 4Q9QH 3LRSB 4LSSL 4P23C 3FO9B 3SO3B 4BSWA 3VXRB 4WWKA 2WANA 3ARDB 3L3DA 15C8L 3R4DA 5HJ3A 3WIHH 4Z7UA 4PD4J 1YJDH 1RQ5A 3IDUA 4HIXL 2WP3T 2IPUG 3VGEA 3PWLB 4XX1E 2A6IB 4FRWA 2CDFB 3SPVA 3TIEA 3VFNA 3UJJH 4PJ7B 5MP6L 3VU2A 1VADA 2EYTB 2EDOA 1AIFB 5K59F 1S3KL 3QXUA 1HKLL 2FH6A 3JV0A 1S5HA 4JFEE 3L7EB 3BEVA 4MA3B 5BMFH 4FQJL 3KJ6L 4P2QD 5IGXH 2YWYA 2N7AA 1NUGA 3R0NA 1R5VB 3KYOA 3QO0B 1U8KA 3K74B 3MRMB 1NCWL 2NZIA 3BDYL 3I84A 3MJ9H 3K81A 4EDXB 1KENH 3Q5TA 2JJSC 3V5HB 4NYLA 3SGKA 1DBJL 3DHJA 3MXWH 4OZGE 2XRAL 4UAOC 3DX6B 4ZAKD 3SQOL 1MFAL 3BHBB 2ZNXA 4EN3D 3E3QE 1U8OB 2V7HB 3O6LL 4GKNB 4F33B 1PG7H 1VFBB 1UZ6E 1L7TH 4JDVB 3VXRD 5F7EH 3K8MA 1KELH 3ARDD 3IFLH 4E5XB 4M61A 2VQ1B 3W9DB 1BZ9A 2YN5A 5DWUH 5A43C 2FGWH 4JPWH 1UXSB 5FO9A 4KQ3L 1EO5A 1IT9L 5IVZA 2JCCB 4RISL 5T3XL 3L5JA 2EXWD 3BPLB 2CK2A 4Y16A 3FQWA 4KI1A 5GJSH 4OQTA 4I8DA 3MGOB 2AEWA 1BGXL 4NNPH 1T4KA 4KH2A 3NGBB 3U9PH 1HHJB 4GKSA 1PKOA 4ODWA 3D48R 1SJEA 1CK0H 1RK1B 4HW6A 4KROB 1WWBX 2A2QT 1OPGH 1WBYA 1A1OB 1UCBL 4AEIH 4DKEH 5CJQL 4LHQB 4RGMB 3LV3B 3IS1X 1JNNH 2W0FA 5D2LB 4LLQA 2ID5A 1A5FH 3QUZC 5TF1H 3ZE1F 4XAWL 5C0RH 4YC2C 1HSAB 1CXIA 4PRNB 1YN7A 1GZPA 4C54A 1QKZH 3RI5K 5AZ2H 2OJEB 5I17A 2XWTB 5I1CL 4X6DA 2XWBB 3ALPA 3MA9H 3F7PC 4V2BA 3WS6C 5BO1H 2AXGA 4LCUA 2XN9B 4YHZH 5DC9B 4FTVB 4MMXC 5ICYA 3RZCA 2VISA 2J8UE 2WBWB 4XVJH 4W70A 2O61B 2WAHA 1MIMH 1QFPA 1OM3L 4V1DA 3WE6A 3VW3L 1A7NL 1LO5B 2V7NA 3HPLB 4O9HH 1KEGL 2PYFA 3RL1B 3U4AA 4MWFA 1MVUB 4QRTB 4JFZL 4BA8A 4HH9B 4Z9KB 4LLMB 4UIMA 2Q7NA 2OMNA 4KROD 4Y5YA 4Z7VE 2OP4H 2C1OB 1LO2L 4M8QA 3H3BC 4MA8L 1PAMA 5EOTB 5ALBH 2JK5B 5EBWB 3ZDYE 1DQQA 3N06B 4FQCH 4UBDC 1QRKA 4KKNA 1A7QH 2C4XA 4OZHE 4GOSA 3RGVA 5T33L 1CG9B 1NC2B 1YQVL 4H20L 4Q9QL 2ZSWB 4JRXB 5DZLA 3EDEA 2PKDA 1H15B 1UT9A 2FNBA 1OGAA 1YJDL 4JFDE 4PR5B 4QTHA 1WT5A 3FT3B 2F5BH 4KGJA 2W92A 4P2OB 5DJCB 2ZUWA 2DWDA 2L0DA 3HAEB 2XN9D 1I8MB 3O6FC 3JUYA 4FTVD 4PJ5E 3MRDA 4G9FD 3MRJB 5GS2H 1EO7A 5KAQG 5D1ZB 5BMFL 5EBLA 3MRPB 3PWUA 1ZHLB 5GGVH 5IGXL 1MAMH 1ORSB 1JP5A 5T5FH 3MJ9L 4RDQG 5JOFB 2I07A 4HGWB 4X4XA 4CN1A 1KENL 5IBTH 2FGZA 5JA8B 4W6WB 1JNHA 3MXWL 4X7DC 2OM5A 4NKMB 1P7KA 3X3FH 2XWJB 4OLYH 2VIRA 3QEQE 4FG6D 2BNUA 5CIPB 1FYTE 1NC2D 5CJOH 5CAYB 4P49A 3RWJA 3H9HB 5C2UB 3MACH 5CBEB 4JRXD 4PJDB 2CDEA 2GTWA 2R1XA 1PG7L 1AC6A 4XZUA 1L7TL 4YHKH 4J3VA 4Y19E 5F7EL 1KELL 3B9EA 5F7UA 3IFLL 3BYYA 4Y2OA 3U0PA 1HXYA 5DWUL 2YUWA 3OKKB 3DSFH 4QHKJ 5CHNA 3U7WH 2FGWL 4JPWL 1DZBA 4P2OD 5CWSB 4IS6A 4WW2C 5MENE 5ESVA 1T1XA 2IBZX 1KJ2B 4G43A 4Z7NF 5D1ZD 3S37X 4WO4A 5GJSL 3QNYB 5JDSA 2Q76B 4NNPL 4X9GA 4XI5C 3U9PL 2YD2A 1CK0L 3ILQC 4HH8A 3QWOA 3DV6B 4JQIH 1AGCB 3X17A 1OPGL 4AEIL 4DKEL 3I02B 1KG0B 1TVHB 4E41A 3R1GH 2CDGB 1JNNL 1A5FL 5TF1L 2NW3B 5LWYL 5DEFA 5SV4A 5C0RL 5CSZA 1QKZL 3BP7B 5AZ2L 3ESVF 5E2WH 4X80H 2Q6WA 2NYYC 3B5HA 5I71C 2VXUH 3MA9L 1T7YA 2YSSA 3GMLB 3BISA 3IJSA 5L9DH 5BO1L 3X11A 4QYOB 4CJ0A 3BDBA 4YHZL 4JLRA 4UUJA 5HI4D 4GW4A 3AB0C 2W65A 4XVJL 5E9DB 4KTDH 1I8IA 1MIML 1BJ8A 3K1DA 1SYVA 3MV7E 1T2QH 4GRWF 4O9HL 4MJ2A 2G5BB 5IIEB 1ZK9A 4IIQA 4TUKH 4XBGA 5C70A 4JY6A 3OR7B 1JWUB 1IJ9A 2N1KA 2YD9A 3WNOA 2OP4L 1I75A 3KPSE 5D70H 5T1LB 2UZIH 5ELIA 4MS8D 1HHGB 5ALBL 3QJFA 5KSUA 1MCFA 2C1PB 1EEUA 2I5YH 1LK2A 4FQCL 2Z35B 4ZQKB 1A7QL 2Z8WC 2JJUA 5HTSA 2JJTC 3ZKXB 1R5WB 2FSEA 4NC1E 1U2CA 4JZNA 2P8LB 3D9AL 2UYLB 5EIVA 5ACZB 1S7TB 4FNLL 3PGCB 5L0QB 3C6LA 1VSCA 4M6NH 5CP7A 3QFJE 1JYWA 3BP5B 4NN6B 2F5BL 4Q74A 5FCSH 2FIKA 3VI3F 2MQCA 1FVDB 3SE3C 1DBBH 1ITBB 4XNQB 5JW3H 3OKYA 4P23A 5DVKA 5E9DD 4D9QD 4NQUA 2GCYA 3BXNB 4PJ9C 2R39A 5FUCC 1BVZA 2WWKO 4MGXA 2BK8A 1AQDA 5GGVL 1Z6JT 1MAML 5HHXH 4BFIB 5T5FL 2D0HA 1YMHB 4I3SH 2RAMA 3TNNA 3FJTA 1OT1A 3K80A 3MNWA 5IBTL 5HYQB 4YHPB 5T1LD 1NEUA 3X3FL 3I6KA 4OLYL 4XP1H 1X6NA 2EYRB 1NEZA 1OW0C 4J8RA 4JO2H 4QRSB 3HLAB 1S9XB 2N56A 1EO8H 1KOAA 1UQSA 3MACL 3HE7C 5JW4R 4LCYB 4M7JH 4PJCA 1SJXA 1OWWA 4N5ED 4YHKL 2JJSA 1FNFA 4U7KA 1E4WH 4IRZH 4R7DB 3LKNA 1G9NC 2ZPKH 5JORB 5TDNB 3S36X 1YEEH 5DYOA 3DSFL 3U7WL 4AQOA 2PW2A 1EH9A 3GKWH 3T1FA 1UZ8A 5DSCB 1FZKB 2H3NB 3P11H 4KFZC 3NCFB 4TVPH 3TP4A 4I13B 2H8PA 1C12A 5IVXB 3QJHB 2DM3A 1HDMB 3PL6C 2M8XA 1F2QA 3GSNB 1T0NB 1ADQA 1NGWA 2F8VA 4G80B 3IXTB 4OQTH 3FRUB 4LCWA 2GI7A 1WISA 1QPXA 3O2VH 1UKSA 3KS0H 2P5WB 3IU3A 4ONGH 4P4RA 2EC9T 2AV1B 4JFQA 4XGZA 1IVLA 3SDDB 5HVFB 4YWGH 3AVEA 1Y6KR 2DI9A 5DVMA 4G3YH 5E2WL 2H2SC 4X80L 3QCTH 1N6UA 5C0JA 2RGSA 1AXIB 1T1YA 2VXUL 4DUXA 4AM0A 1Z3GH 3V6ZB 1XF5A 5L9DL 4LHUG 3QUZA 1EGJA 2CLZB 2ZUTA 4J3UA 3RVWD 4NUJA 3U4EB 4KTDL 3MUGA 4HZLB 4PGDB 3SCMB 4W81A 5L2JB 1XCQB 1T2QL 4WFFE 4BK4A 2LQRA 2NQCA 2MTPA 4R9HA 3HFMH 3WS6A 3C8DA 2P5WE 3EDKA 4ZS6D 3VXUA 3GI9H 3ULUD 5D70L 1OP3H 2UZIL 2XOTA 4NQVB 3RNQA 5GGSA 2W0LA 1S9VB 2I5YL 4ZUTB 2NY7H 3HZVB 3QXDA 4K94H 4ZOEA 2QKIB 1F6AB 4PJBB 4NNYB 1NBVH 4X6CA 5FYJL 1ZS8A 2HTLD 4GAYA 5D5MF 3IDJB 1AKJB 1BAFH 5I8EA 3SDDD 5EN2A 1MJJA 5MEQA 1T66D 1ZXQA 3IGAB 4M6NL 1UENA 3D69A 4Y5XB 3LQAC 3REWA 3QI9B 4O2FB 1DBBL 4GG8B 4GG6A 1DQJA 3QISA 1C5DB 4YPJA 5JW3L 1TZGH 4UTBH 2YXMA 4N0CD 5D93B 3UTSE 3VXSA 1WUNT 3SCMD 5TF0A 1B0GA 3VH8G 4HV8A 4X99B 2ICCA 3KJ4B 5HHXL 2R1YA 2NXYB 3ZTJG 5GZNC 4I3SL 3DRTB 3O6FA 1MFEH 3IDIB 4YFLF 1QSEA 4RZCA 1CL7H 2PF6A 2Y5TB 3R06A 4XP1L 1JL8A 3O4OC 2CMRH 3G6JF 4JO2L 5FXCH 3MLPA 4PJAF 2GITB 3BP4B 1B90A 1EO8L 3LN4A 1AKJD 4F80A 4KTEH 1EVTC 4M7JL 2HG5A 1C5CH 3JWOC 1MCSA 4U3HA 1E4WL 4IRZL 4UOJA 2ZPKL 1A6ZB 4BELD 1YEEL 1PJ9A 4G5ZL 2NR6D 3RVXD 1YEDB 3QI9D 4ZPTB 1NBQA 2V5MA 3GKWL 3QAZC 3VCLA 2PXYC 3ARXA 3P11L 2ADIB 4TVPL 1I7UB 2X9WA 1FL6A 1U41A 3KPRB 3WL9B 1XCTB 2H6PB 1XR8B 1RUMH 3FQUB 2OSLA 4G8FA 1S9WA 1CDBA 3FT4B 3WUWB 4MCYA 4JHZA 1MCEA 1PKQE 2EDTA 4PJ7F 2NXYD 2XYCA 1AXTL 1ZOXA 4OQTL 4P2RE 1JRHH 5ICZA 4NRYB 4WW2A 3RWEB 2ZUQB 3V5DB 3MRHA 3O2VL 2ICEA 1FV1B 1LGVA 3HS0B 1FSKB 4ONGL 3GM0A 3BI9X 5DUMH 1OAYH 2IH3A 1RJZA 4S1SL 4G3YL 4OKDA 2D3VA 2AGJH 5E5MB 3QCTL 3HPJB 5C0FB 3TBWA 1IMHC 2AJZB 2BNQB 3MV9D 4Y8AA 5ERWB 4U3XA 5LBSL 1Z3GL 4HIHA 5D9SB 1NCUA 3B3IA 1MVFA 2AP2A 3KPPB 5T1KA 4UTAH 3TPKA 2H9GA 3MUZ1 3OQ3B 2P46B 3FB8B 2VZTA 3NACL 2ED7A 1YUHA 4JZOA 1IZKA 1T20B 5JHDD 4HUVA 1JF6A 4LL9A 4WW1B 3KPRD 1FH5H 1X9QA 4WIQA 2GSIA 2IPKB 1I4FA 2V5RA 1S9YA 2G60H 4OFVA 3HFML 2Z31C 3MBEB 1HXMA 2JCCF 4N8PA 3GI9L 4LDEB 4S2SB 1ZHNA 1IGFH 4FQLH 4RGNE 2PTTB 1JZ3A 4X0KB 3LMJH 2NY7L 4RFNB 4K94L 4PV8B 4QHUA 5JOPE 3FB7B 1NANH 5EO1B 3QA3B 1NBVL 2VO5A 3NFPA 4XT1C 4HJ0C 3OJDA 1BP3B 3EYOA 1BAFL 1FNHA 3M8OH 1CGVA 4NQTA 3UBXG 3G5XB 4LLUA 2H32A 4HAGA 4IRJB 4LP4A 2VC2H 3QDJB 5CBAB 1AR1D 5J1AA 3MUJA 5SV3A 4X4YB 2DWEB 2BNQD 2VWEC 1V3KA 4TNWF 2X10A 3MGTB 4X5XA 2RQ8A 5JHLH 3HZMB 2JJTA 1FO0A 4L4JA 4Y89A 1U8MA 1U8JA 4BSVB 3LZFH 1TZGL 4QHKI 1P4IH 4UTBL 1VFOA 1WQVT 3FB5B 3ABZA 1F13A 3FFDA 4CMHC 3E6FA 3REVA 3QWQB 3SE3A 3MBED 1G7PB 3JTTB 2FEDD 1XGPA 2WUBH 2FLBT 1MFEL 4HWBH 3UP1A 1NFDB 3JBG7