4QO1A

P53 dna binding domain in complex with nb139
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
127
structure length
127
Chain Sequence
VQLQESGGGLVQAGGSLRLSCAASERTFSTYAMGWFRQAPGREREFLAQINWSGTTTYYAESVKDRTTISRDNAKNTVYLEMNNLNADDTGIYFCAAHPQRGWGSTLGWTYWGQGTQVTVSSGGGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A nanobody modulates the p53 transcriptional program without perturbing its functional architecture.
pubmed doi rcsb
source organism Lama glama
molecule tags Apoptosis, transcription
molecule keywords Nb139 Nanobody against the DNA-binding domain of p53
total genus 30
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qo1A00
5SX5H 4GRMA 2NY2D 1IM9B 1RHHA 1ZT1A 5E6YA 5FO9A 1RZIB 4UIMA 4LCYB 4GRLB 1CFVL 4K7PL 3KAAA 4PJGE 4HJ0C 4V1DD 2FL5A 1P7KB 5D1QD 5DEFA 3GMQA 4MAYB 3CU7A 4F37F 2VXTL 3M17B 3CXHJ 1JUFA 4IS6A 4Y2DC 4LL9A 4XAKD 2JIXA 3RNKA 3MRBA 5I1IL 1W0VA 1OAXL 3G6AA 3B2VH 4OTXH 2D0FA 3K2UL 3L3HA 4KGJA 2Q7YA 1R3KB 2WUBL 4LLQB 4WEBL 4AIZB 4OZIB 4RGNC 5EA0L 1UWGH 4JFEE 3G6JF 4XWOC 4KHXH 1FYHB 1F6LL 1HQRB 3NCYS 3X14A 4XNMA 4YHLH 4IM8A 3G9VA 4XGZA 5FF6A 4RMRA 1GGUA 2IJ0C 4PP2B 4L8CB 2OR9H 2I26N 1KCRL 3UZVB 1KJVB 4Q0XH 3MR9A 2P43B 4WNQB 4JFZL 1MNUL 5B8CA 3DHMA 3VH8G 3ALWA 4TVPD 4NYLA 2HKFH 3C5ZC 5IW6A 5FXCH 2W59A 1P4IL 1W0VB 2E9BA 4KJPD 4HKXB 4L3EA 4PJHE 3CC5B 1HHIB 2XQBL 2PXYB 3D0LA 3LEXB 2AQ1A 1ZS8A 4NQXB 3S96A 2CDFA 1E28B 5CHNA 2NY2B 5I74B 4DTGH 3ARXA 1GJIA 3LOWA 3BDXA 1LE9A 1KCRH 3L3KA 4O5LL 1QSZA 3L9RB 3QUZA 2EIBA 5IMOA 3HNTL 1OQXA 5DK2A 4LCUB 2WAHA 3F5WB 4MXQC 3S37L 3FFCB 2J8UB 3ESUF 3MJ9A 1FVEB 1OGAE 4H88L 2DKUA 1S7RB 3ZDXF 2JJSA 4PPTA 3ZHKA 1I1AB 5AD0A 3E6FB 3DYMA 1NBVH 1YNKL 3HZYB 3T4YA 4Y1AB 8FABA 5ID0A 2BOBA 1WAAA 4DN4L 4K9EH 2X44D 3NZ8B 3MXVH 3JV4B 3MLRL 3VFUA 3VE0A 1JHLH 4TQEL 3P4MB 5BJTA 2R2EA 4XP1L 1JI1A 1JTTA 1MOEA 1LK2A 1XCTB 1IGTA 2BRRL 5HDBE 4ONOA 4P46C 4Y2DB 1Z0MA 3OXSB 4UT9L 1RUQH 1EERB 1FVCB 1G7JA 4J4PD 2CUMA 2WWMC 3VXRE 3H7BA 4KXZH 3RJQB 2VXVL 3QIWB 2CLRB 3U46A 4GXUM 4P4KB 3X14B 5JOFB 1SYSA 4XGZB 4EUPB 3LSOA 3NGBB 3O3DB 1EJ6A 3WYRA 3CK0H 1J8KA 5ID1A 5KSVB 4MA3B 3JV0A 1GOGA 3T09A 1L7IH 4OCXL 3ZSTA 4EDWH 4JRYB 4AT6A 2YD2A 2OK0L 1BLNA 3HMWH 5MI0C 4GKOA 2BOCA 1V05A 1JNHB 1ZT4B 2UWEE 5IVXE 4I2XA 3P4MA 5BJTB 2A9MH 2AK4B 5FUCC 4UT9H 2OI9C 2X4SA 5I17B 4JDVB 4ZFZB 3P2TA 1YJDC 1M71B 5I15H 5I1JH 4GW5A 2R69L 2Z35A 3BJ91 4AQ1B 5ITBL 3L95B 1FFOA 1KTKE 3PIQB 5FKPA 2CRYA 3R4DA 3RVUD 4PJ7F 1OD9A 3OHXA 3O3BA 3QDGE 2DLEA 3MLYH 4GUPA 2VLJA 3QCTH 4WWID 5ALBH 4N0RA 2PF6A 4RWYL 1EFXB 3KJ4C 3GSNB 5ILTH 5IHUH 1CICB 4L1DA 2M8XA 1U42A 2DQUL 3IETA 1O7SA 4KROD 4DEPC 3FQRA 3IRPX 1NGXB 5JPNA 3BYYA 5FGCE 4HK3J 3OL2A 1E4XL 1LMKA 2R0LL 1AXIB 2VLKD 4YO0A 3G6DH 4RGOL 1KCVH 4XMKL 1MREL 4Y0GA 1G9NC 4R2GD 5D7LA 3PQYB 4YDJA 3C60D 3NPZB 2ZSVA 1AD0B 5EU4A 3OAYH 1HQ4A 4KZEH 1UT9A 1DN0A 1FO0B 3KLSA 4K7PH 3UTTB 4X0KB 5J06A 1GAFL 2VXSH 1ND0B 5D2LA 1J8HE 3REVB 4NKQB 1PZ5B 4JRXB 2OTUA 4JFDD 4R9HA 4WI8A 2VLJB 4LCWD 5EC1A 4ZPVA 1DBKH 5I66B 2E7LC 3CX2A 5JA9A 3EYQC 1KIPB 1Z9LA 2BX5A 4O58H 3QO1A 4XAKE 3BZDA 5CSZA 2IG2H 3HZMB 3LEXA 1ACYH 4JO3H 3RVVD 3MNVA 5FM5O 5EOCL 1MCJA 3MNZB 4OCLC 4MA8L 1ETZB 3VD4A 4R96A 1A14L 3EYFB 4M6AA 3NA9H 4BQ9A 5CJQL 4ETQB 1ZV5A 1W2KT 3LN9A 5AZ2L 4P4KC 1K9TA 3RBSA 1TNMA 3LHPL 3BD5A 4TSAH 1ZT4A 3QPXL 4OCYH 1A3LH 5E1AB 4Z8FL 3UTPD 3KYOB 3UJTL 1OT1A 2X4QA 2AEQL 3VA2C 4JREC 1IAKB 2Y6SC 4IIQA 2L0DA 2VZOA 3PUCA 4EIGB 3TVMD 2X41A 2NR6C 1QG3A 1XGUA 4OFYA 3PABB 3ECBA 4PJIB 3WUZA 1K2DB 4MVBC 1R3KA 3RZCD 4G8EA 4PJBB 4TVPE 1G0XA 5I1HH 3NAAH 2XKUA 1UCBL 5ANMA 4ZFGH 1T2JA 1XAUA 4XCEB 4U1NA 5F1IA 4DUXA 5DR5H 3SO3B 1F4WH 4Z77A 2EDJA 4YQXH 1JGVH 1MLCB 2YPVH 4KJWD 3D3VE 5MENE 5E99L 4DVRL 5I71B 4XP5L 1NLBL 2FEDD 3BO8B 3MROA 5H37G 2ADFL 4I0PA 4EI5B 4FQLL 2PCPB 5J1SC 5E56A 3V5HA 1G9ML 2JTDA 5JIIA 4FXKA 4BKLA 3QXDA 1UGNA 5C0BD 1S3KL 2CLRA 5JQ6H 3MV9E 4LQFH 5GGQH 4I9WD 3T08A 2QADD 3QISA 3MLZL 4HEPG 5DF0A 1WICA 4G8GD 3N1GC 2YOCA 4M4RA 5DJZA 4P23B 1CVRA 2I60L 4HWUA 1YPZA 3RWGA 1DUZA 3EAKA 1YYLH 2OTUB 4P59H 5IVXF 3FB6B 4XAWH 2GJ6D 2NY4D 3EJZD 2OTWB 4HS6A 3ZSSA 3CFEA 4GRWE 2H2PD 1FGVH 4EI5D 4QOKB 1H9VA 4JDVA 1OT2A 1PQZA 3TN0A 3E2HB 1GGBL 4Y4HC 1T7VA 4WI6A 5DT1H 1X6LA 1HSBB 5D70H 3FB5A 2Q86A 1OLZA 3IDJA 4GG8A 1VENA 3TGXA 1SYVB 2XKNA 1J10A 4RNRB 5I1EL 2DICA 4OF6A 2VR9A 5L9DH 2W65A 4UNVA 1TJIL 3OJMB 2IFFL 4HLJA 3RTQC 2QLVB 4ZS6D 4A2MA 2FLBT 3TV3H 3RTQA 1OAUH 1CFNB 4X6CB 3CLFL 4DVBA 3BOVA 3EGSA 2HTLD 3O6FB 1HN1A 2FX7H 5ACZA 5GS1B 4LLVB 1TZIA 1UJ3B 3C8KA 1GGBH 3K3QA 2ZOKA 4NKDA 1TZGL 4JQIH 4YDJB 3MRDB 5SX4H 1QLFB 4U4BA 1A6WL 3MACH 5DZNA 5J6GA 2BC4A 1NEZG 1QKZL 1LO3L 1FG2A 3PXHA 3P9LB 4UTAL 5AUMB 3AXLB 3N1QC 4K7FB 4AH2B 4WO4A 1OAKH 2V2TA 1CFVH 3B9VA 3LSOB 4HW6A 2VN7A 1UM4H 4JZJA 2F19L 2DQFA 5T3XE 2NMSA 3FCTA 1X5ZA 3TYGL 4A6YH 2K7PA 3GMLA 4G9DB 5T33L 1I8KB 3LCYA 3ZTNL 3GBLA 1BQHA 1T2XA 1KG0B 2H26A 3NN8A 1KV3A 1CL7L 1PD6A 5DO2D 1AFVL 1KIPA 3RDTA 5C0EA 4PJXF 4C57C 2W0KA 5L88H 4JFXB 2C1PA 4UU9B 2X7LB 3QCUH 1WIPA 2DIAA 1MPAH 4FTVD 5JZ7C 1C5DA 2X4SB 2P8MB 5GGVH 2FJHB 5DQ9A 5D2NA 5C0CE 4OQTA 3PWJA 3G5XA 3DNKA 1A6AB 3QNZB 3NPSC 3QWRD 3AVEA 4YDKL 3Q1SL 3TT3H 5CINL 4HIJA 1Z9SA 4PJ9D 3OKKB 4F3FA 1OAQH 3W0WD 4F15B 2PTTA 5KOMC 4CW1A 4Z7QF 1RIVL 4H1LH 3CJJA 5C0CB 5JHDA 5DEGA 3WFBH 2E6JA 2XZAL 4RMQA 4M1GH 5KW9L 1LP9F 4Q74A 4GG6E 4N1HB 4N0UE 4OAWB 5TF1H 2G5BB 3O41A 1KB5L 3FQRB 1KSRA 2A1WH 1DBAH 2YD4A 1MPAL 1I8MA 3H0TB 2BVQA 3QI9D 4NO3A 4FFWC 4YFEA 1RU9L 4LPTA 2ICWA 1QR4A 2NW2B 4JO2L 5E94A 3THMH 5DXWA 4GKZA 1E0OB 2N56A 5INCB 5JNYB 2EIEA 1N2RA 3KR3H 4IHOB 3R1GH 1HINL 3R8QA 2Y07L 3GHEL 4JY4A 3L9RA 3QWQB 1ZE3C 2XRAH 3ARBD 1JE6A 1DVFA 2HWZL 4DTGL 2NXZD 4XP6H 3KLDA 3FJTA 3MRKA 3U6RB 3NCCB 4J8RA 5C0CA 5JHDB 5TGBA 2DMBA 5DEGB 3BPOB 1T1ZA 3RJDA 2C7UB 2F58L 4L3CA 3MRBB 1DVFC 5MEQA 5A2JH 3C60A 4MJ6B 4GMTL 3FRPA 3T1FB 3KXFD 4JPVH 3PWPD 4K3JH 2CRZA 5KTEL 4HWZB 4JFEB 4OZFA 2VLLA 4OLWH 5E6ZA 1XF4B 4DGVH 4S1QH 5JOEA 1A1NA 3I50H 4MX7B 2ERJB 3P9MB 3ALPA 3QIUA 3DUSA 5C3TA 1B0GA 3VGHA 4YBLB 1WAAF 4PREA 5HGBA 3C8HA 5J3HC 3V6FA 1F6FB 2FGZA 3U0WH 1OP9A 2Q3AA 2M1KA 2H9GA 3AU1A 3EHBC 4LQFL 5MEND 2F58H 3EOBA 3O8XB 1SYVA 2XKNB 1F11B 4ESKA 4WU5A 2A73A 4NUJA 5IW6B 1KELL 1AGBA 3S4SB 1QVOB 5FA3B 1G7LB 3HUJF 1IAIM 2PR4L 2NNAA 4JY5H 4L9LC 4N9GA 3CD4A 4Z0XB 5I74C 3PV7A 5SV3A 3S35L 5EU7C 4FQCH 1S7TB 4E41A 1EXUA 3AB0C 3MBEA 1J88A 1UJ3A 1A6TB 2XWTB 4PG9B 5C92A 1CD1A 4FNLH 4LIQH 4DCQA 3QEHA 2YWZA 3MX0A 2DIBA 3JWNC 4EZMA 4EOWL 1EMTH 3UYOD 2DMKA 1AXTH 4WJ5B 3TPUB 1D5ZA 3VMPA 1D7FA 1UM4L 1FNEA 1NFDB 1FYTA 1WBXA 1F4HA 3OZ9H 4PJ7E 4HS8L 2EC8A 3PDDA 4PRHE 2V5SA 2A73B 2QHRH 1FSKC 4KQ3L 2Y5TB 4YWGL 4LHUD 1U8HB 2FX9H 1YEHL 3QUXC 4YEFA 4NOFA 4BZ1L 3LQZA 4OLYL 5I9QC 1QYGL 4PJIE 5KVGH 4PIRF 2X9XA 1QSEE 3MREA 2NXZB 1W72H 3C9NA 4LEOA 1UB5A 1ZHNA 4H1LB 4FFVC 5FYJD 4ZAKC 5F7EH 1UXSB 4ERSL 5JTWA 4RX4D 2WANA 3BI9X 1EGJA 2NXYD 1UQSB 4RGOH 4XMKH 1X7QA 4N0FB 2GFBA 4PJGB 3D25B 4TPRH 4XBGB 1FSKB 3VD5A 4DCQB 3ZHLA 3FOLA 3HZKB 1MHCA 1E28A 1LO2H 4E0RB 3OKDB 3OZ9L 2Z91B 1GOHA 4RZCB 5F96L 4P9HC 1NGYA 1JZ6A 1ED3B 2P8LA 1A6ZB 4XVJL 5HJ3A 2F54E 2N4IA 3BIBX 4WV1C 4BELD 5E70A 2FIKA 1EDQA 3VD9A 3TJEL 4J3TA 3A67L 1X5IA 1DR9A 1JRHI 5C6TH 1M6OB 5C0CD 1DFBL 4WU5B 5FYKU 4DAGH 5D4QA 2ESVD 3P0VL 5ADOL 25C8H 3V0VB 2APFA 5ETUA 1IGJB 3D9AL 7CGTA 1QLFA 1BGXL 4ZAKD 2YWYA 3H2WA 4ZUWA 3FB7A 3SDXB 2BDNL 4Y4FD 2IF7A 4QRQB 1XGTA 3MCG1 5F6IB 1T5XA 5D1XD 2Q3ZA 2XTJD 4D0DB 5EUOA 4NZUH 4PR5B 1PYWA 1IAKA 2A6KA 1R3IL 3DROB 2VQ1B 4OCRL 1NH6A 5LGJA 3I3EA 1G7JB 3QHTC 5TF1L 4ZSOB 1T1XA 4H0IA 5D2NE 3ILPA 3KPLA 2AJSH 3GMNB 3MV8A 1UKTA 5ADOH 1RFDL 2WWMD 1S78D 5A40E 2BY0A 5LAXA 2PO6C 2OK0H 5L6YL 5SV4A 1JZ3A 5JHDE 4JAMB 5KANG 2NW3B 1QQDB 3GNML 4PLJC 2IC2A 2H8PA 2EH7L 3RGVB 3DUSB 1J8HA 2IADB 2CUHA 4NN6B 4KKLD 5DDHB 1KCUH 1J0HA 4FXLA 1NBQA 3WXWL 4G9FB 4Y5VC 3K74B 4HJJH 3WNPA 2OM5A 3MRPB 1DL7H 4JFHE 1DN2A 3KXFE 4PJGA 1X5XA 5DHYB 1NC2A 3LKQA 2HN7B 5JQ6L 3QUZC 3GIVA 4PJFE 3UXFA 4X5XA 3WXWH 5IMLA 4KJPC 1QSEA 3T4YB 1RZ8B 8FABB 4XP1H 5ID0B 3PE9A 2NY6D 5F1NB 1H8OA 1BP3B 1HH6B 1Y6NR 1BFTA 5B4MC 4X99B 1A3RH 3IETB 1FRGH 2PYEE 3DURB 5GS0D 4JY4B 3GSUA 4LCCB 2Z4QA 1HH9A 1XF2A 3NCEB 4P2YA 2ORBL 4I48A 4YNYB 4X4ZA 3V4PH 1TPXB 3INUL 4LVNB 3ARRA 2E7CA 3I3BA 4M7JL 2DQIL 4JANA 1WUNT 3TPUA 1JPSL 4U31A 4Y5YB 3B6SA 1T89A 1N7MH 1QZ1A 2C3GA 4JHBA 4YHML 2B2XL 4PS4L 1MEXH 3BKYH 1DN0B 1FO0A 3CH1A 4ZOEA 3GBMH 3RVTD 5BO1H 3LV3A 5HVHB 1UC6A 3BISA 5DD6B 1BZQK 2N1KA 4JKMA 4CVXA 1BHGA 5IB3A 3DVNB 1G7QA 5JORB 1CXIA 3UDWA 5HHPB 4GLRI 4MQ7A 3GMOA 3ILPB 5E03A 1G7PA 1RZFH 3IFNL 3CFDA 3SGEI 1IAMA 4X7DC 5CBEB 3MUJA 3TYFB 1A5FH 3Q3GA 4GKSA 2R1YB 5EO0B 4P3DB 1JYVA 3E0GA 3L3JB 4GW1B 2H9GB 3TWCH 3OF6A 2Z91A 5IB1B 1TZHB 3GSXB 2A83A 5I1IH 4O4YH 3QDJE 2C1OA 2PO6B 1CFBA 2XT1B 1AE6L 3NCJH 4Z7UA 4R26H 4XCCL 3JWDL 4ZTOL 1EHLL 3I75B 3O9WC 5JW4N 5DRWA 1Q0XL 1A6UH 1IBGL 4I3GA 3O2VH 4IIQB 1T1WA 3DX6B 4H5SB 4LKCA 2R29L 1UH3A 5DMKB 5I18L 5E1HB 3LS5L 4QRPE 5FOBB 3C09B 3WIHA 1NCNA 4W6XB 2X4TB 1CLOL 5CMAA 1DQLL 3RWIA 5F9JB 4KZDH 3MLTB 2F5AL 4M1CC 3LB6D 3GJEB 5DD3L 4PBWD 4WCYL 4ENED 5D93C 5DK0A 4E41D 5I1CH 1U8MA 2J12B 5CEZL 1BBJB 1LVEA 3SDDB 4GLRH 1YNTB 4GKNB 3SJVB 1SJEA 3Q1SH 4LHJB 3KPQA 5C0GB 4QLRA 1ZLVH 2ESVE 2XQBH 3MCKA 5GRJL 5HGHB 1RY7B 4XMLH 4OZ4B 1RHFA 5E5RB 2DLHA 4FQIH 5A3ID 4XC3L 1NCBL 1S7WA 2A1WL 1M05A 3BW9B 3EDKA 5ICXB 1CDJA 5TQ0L 1G9MH 2D7PA 4AIZA 5C09D 1UXSA 1VKXA 3BZFA 1T03H 4UOW1 4LLUA 3VRJB 3KPRA 1H5BA 2NY7H 5I76A 3EOTH 2HG5B 1MFBH 3MRRB 3TBYA 3UTQB 1HIMH 4FQXA 4TUJA 3LKOA 1N6QH 4U0RC 4NO0B 5HHOA 4URTB 1NJ9A 5JXEA 2KH2B 4U2ZA 1U8JB 4KKBD 5BVJB 4EBQH 2WUCH 2ARJQ 1P4LB 1BOGA 1YPZF 4KI5C 3MRPA 9CGTA 2R4RH 3D69B 1VGKA 3SGKC 5D7IA 2HJLA 2R2CA 2YPKB 4CJ1A 3P0YH 2R9HC 1BZ7A 2DRUA 5AG8A 4WUUB 5CIPB 3ZZ1A 4ZFFB 4OCWL 4M1CD 3WEXA 2QHLA 2EDXA 2YHGA 2V2XB 1YY8B 1EJOL 3OB0H 4ZO8A 1B3JA 3ECBB 3D39D 1QR1A 2K3TA 2ADJA 4WHDA 4HKJA 2AEIT 5DJ6B 1ZOXA 1BX2B 4L4JA 3SEPA 1V8HA 5CEZD 2BRQA 3KPMB 1IM3A 1K8IA 4DGVL 2EYRB 2IPTL 4B5EA 3Q6GH 1YJDH 2W9DL 4DOHB 1MVUB 4YBHA 5JW4R 3EYVB 1MAKA 4LKCB 3QUMH 1JV5B 5DMKA 1AR2A 2EEDA 2XTLA 2CDEA 1RULH 3EYFA 1A6WH 1PYWB 1IEAA 3VXNA 4UTAH 3QA3A 4IRJC 4KKCC 5TQ2L 2QQLH 2PTVA 2JCCF 1F4XL 2D0HA 4ZFFA 3GMPB 5GHWL 2OR9L 4Y88A 4A6YL 3VDBA 1DUZB 3SKMB 3T1WA 3ULUE 4E41B 2Q8AH 2QTEA 5M95B 2ZKHH 5HXMA 1XCTA 1S9WB 4LSQH 4PB9L 3MJ7B 3HAEG 4Y5XB 3KPSD 2A6DB 3ZMRA 1N8ZB 2IPKA 3LQMA 4Y2DA 1G9EA 3LN5A 1HHGA 1HK6A 4FQPA 4P2RA 1QNZH 3SQOL 3VFNA 1IGCH 3QZWA 1MJJB 4K8RC 1DVFB 2DM2A 4WIQA 4PJXB 1GGIL 3KYNA 3OMZA 3QT2A 1NAMH 1NBZB 3QIBD 2FZ3A 4F7CA 1MWAH 1CDIA 4Z7UE 4YHPA 1J0YA 1BPVA 4HIJB 1J1OL 3TV3L 1BIHA 3IRZA 4HUUA 3ZT5A 4PJEB 1EO5A 4UT7H 2VLJD 4YDKH 3GIZH 1OTTD 5DRWB 1PKOA 2FRGP 1IGFH 3MODH 1CWVA 3IF1A 2AJXL 3K1DA 1P53A 3LEYH 4H1LA 3G5VA 3L7FB 2BVTA 5FHBL 4P23A 2BMKA 3QDGB 1OP5H 3RWCA 5HYJA 3H42L 4NM8H 1M71A 1U8NA 2FX8H 1JPFB 2Q20A 2Z35B 3ESVF 4DW2L 4H26B 3DMMC 3CFKB 5EZOL 3QZWB 3DRQB 4F58H 4HEME 3MYJB 1JRHL 1CLZL 5IFAL 1F3RB 1JV5A 2EDWA 3SDAA 1KPRB 4C56D 2VLRB 3F65A 4U1LB 1HE7A 4J6RH 2LTQB 3HB3D 3W39B 3WIIL 1RAMA 1HZHL 2WNGA 2WBJB 2IALA 32C2A 4MWFB 1AH1A 3QNXA 3G5VB 3GMPA 4JO1H 3V6OC 3SE9H 1FNHA 4KK8D 5DURB 3OGCB 1MCDA 4G6FD 4JEGB 3TO2B 3FFDA 3QRGL 4L4TE 3FQUA 4X0KA 3CFBB 1U93B 3MMEB 4NQUA 4WW2B 1NBYA 5BRZE 2PXYC 1JNJA 3ARDC 3GMQB 4QRRA 4J1UA 4S0TD 4IS6B 2F8VA 5MEPB 2AJZA 1EVUA 3VFNB 3ETBF 5GRXG 2AW2A 3GSVA 5DVKA 4OZHE 2EICA 1C5CH 5C2BL 4KRMB 3DTXA 2W1NA 5J7CC 1JZ5A 5CJOL 3VXTA 35C8H 2MWCA 1KNOB 3F58H 3P9WB 5E8OA 4Z76B 3QNXB 4ZSOE 1BD2D 3VFWA 3T8XB 2XZCH 4K23L 2DWDA 3VFMA 3O2WH 3HRZA 1IC7H 2LQRA 2VSCA 1C08A 1N2RB 5FM5M 1R24B 4MJIB 3DI2B 4TSBL 3OB8A 4M8QA 4QXUL 1P5UA 4B53A 4FP8H 4PRBA 3HG1E 3U1SL 3KJ4B 5T1LD 2VXQL 1G9MC 4LCIH 4M1DH 4PV9B 5EN2A 1AO7B 1OAYH 4X9FA 1CDGA 2LU3A 1D6EA 3CAFA 4ZXBC 5D6DA 2VDQL 2VH5L 2VJXA 3HI1A 3N9GL 4MZ2A 5B22A 1BMGA 1JP5A 2OJEA 3WUWG 2FL5B 3C6SB 2HT3D 4XAWL 3WBDA 1HHIA 2XACC 1SQ2N 3B5HA 5GGTH 4NRXA 2IBZX 2H3NB 4Z7QE 5EWIH 5B39G 3BJLA 2EO9A 2P8PA 4O2EB 5L2KB 2QHRL 2OTPA 4KPHL 3SDXA 2KDGA 1HYSC 3V5HB 5A2LH 1NGWA 1T83C 3NIGE 1NMCB 3CDGA 2WUBH 1WV7T 3PP4L 4M6ML 2R0WH 3FRUB 1RUML 5FO8B 1X4XA 4LLMB 1LEKA 1J1PH 2W60A 3L1OH 1P2CA 3DIFB 1U6AL 1AO7D 1NBYB 1JBJA 4PJCF 1ZWIA 5EWIL 2X4OB 1XIWC 5HHPA 2OTWA 4HS6B 3ROOB 1HILB 1V3LA 1F90H 1H15A 5KS9F 3V0WH 1M7IA 4LSDA 3L6FB 4LOUC 3MRHA 4NQEA 3QFJE 1U8PA 1C1EL 4OV5A 4KUCD 3GSNH 2IGFL 4HIEA 2J7LA 4X4ME 4C54A 3OQ3B 1MLBA 1VESA 5ERWB 1INQA 3DV4A 4IDLA 3X11A 4ZOAA 1ZHLB 4GW1A 1RSFA 2VDRH 2VR5A 1I3RB 3ES6B 4F9PC 5ETUB 2R1XB 1FIGH 1BQSA 1IEAB 2QQNL 1SMAA 3PWLB 2VLJE 3QA3B 1QEWA 3VI4F 3TYGH 4GAJH 4LNRB 4QGTA 4BQ6A 5EULV 3O11B 4BZ1H 1H8NA 2HT4C 2MHAA 1AE6H 1WTLA 3RU8H 3VGFA 5E7FA 3DX9B 4MAYD 5KVDH 5F3BA 5I19L 4YZFF 1S7RA 2FECL 1RZ7L 4ZSOA 3QP3A 4PJ9C 4TSCH 5ACZB 3EUUA 2DLGA 4TUOA 4K9EL 5F7LB 5JXAH 1QFUH 4OIIH 3B9KC 1TVBA 4UQ2A 5ADPL 1X7QB 5DJAB 4ZYKB 4L8BA 3WS3B 5ITFB 5LVEA 3DBXA 2BRRH 3S97C 3X11B 1V3MA 3ARFA 2NY1D 3PP3K 2DQEL 2XG5A 4GG6B 4PG9A 4XMPH 4LIQE 1D5IL 1IGIH 2VLRD 3VW3H 4AL8L 1KN2L 3IT8D 4FFWD 1LO0H 4DGIL 4XWOD 4QRSB 8CGTA 1N3NB 4WCYH 4FQHB 4G3YL 2EYSB 3CSYB 4MA7L 4OZHA 2V9QA 1FORH 4X6DB 4W4NA 2DQEH 1MCBA 4RFNC 1PBYA 4I3SH 1YN6A 5DVOA 1FYTB 1WBXB 1RU9H 3Q0HA 2VLME 4CVUA 1IT9H 5CJXA 3NFSH 5IQ7H 1BVKB 3GIVB 5K9JH 3DIFA 1U92B 1TCMA 1FH5L 2HH0H 2P8MA 4QO1A 5A2IH 1T21B 3PDGA 3MRLB 3AREB 1BLNB 3QUMB 2VERN 4C58B 3U0PA 1FAIH 1S9XB 2XKSA 2Q8BL 3VXMB 1FVDA 4HUNB 2OYPA 4NKMA 3OJ2C 3T04D 1T5XB 5IEKB 1ND0A 3WFCL 4EKXA 1CFTA 1L9MA 3KXFB 3B9KD 3FZUC 5BS0A 5T3ZD 1J86A 3WEXB 3SJVD 2DTMH 2OQJB 5DD0H 3PIQA 5LJYH 5LXGL 2VZUA 2Z92A 1XF5B 3TNNB 2Y1VA 3EO9L 1FL3B 3MV8B 1MQKH 3BKMH 4FZEL 3HNSH 3SE4A 4CDGC 5CEXB 2P24A 4X98A 4L3EE 1TFHA 3HG1D 1SEBB 1K8DA 1U92A 4ZS7L 5LGHL 1QFWM 4OQTL 1ETZA 5DHVH 3ARGD 3UYRL 2EXYD 3AAZA 1A7RL 1OSPH 4AG4L 5IB3B 4RISH 3VD7A 4ZDHA 3FOMA 4NGHL 2OSLA 1FL5A 5ISZB 3GO1L 3BIAX 4XXCC 1MHHA 5DD5H 2UY6A 4NHCH 2OJZH 1RJYA 5E8PA 4PP1C 3S5LB 2G9HB 4QF1A 1DQJB 5JA8B 4OF3A 3DSNA 2O5ZH 2NY5L 2GTZA 2Y5EA 4NNPL 4MS8C 2AGJL 3IAPA 1KCVL 2ZCLL 1KLGB 1UYWH 3JTTA 5F89A 4N0YH 1PSKL 5FECB 2DQHH 5M94B 1RIUH 3REVA 3N85L 1SY6H 2I07A 3SHSA 4J3WA 2H32H 4JFDE 1DBKL 3DUUA 4BQBA 1JHTB 2H32B 3RNQB 1FRGL 2BJML 1MFNA 1R3JA 4NP4H 4Y7MA 3K7UA 1EEUA 3GMMA 4QCIB 5DSCA 4Z78B 1S5HB 2YZ1A 1F13A 4M8QB 5GISL 3GJFA 3QDGD 5HGBB 3CVHL 1U3HA 5HDQL 3KPRD 3VJ6A 3N06B 3O9WD 5L2KE 4MGXA 4WI7A 3MLVH 1I1AC 4WUUE 1T22A 1D5MB 2FHBA 2D9CA 3MGOB 4NN6C 5KVDL 2QR0A 3QPQC 3UBXB 5GISH 2DN7A 4P23C 3DO7A 3S5LG 3BP7B 4HQQL 4HFWA 4OF7A 5GZOC 4QYOA 3SGJA 3QG7L 2NTSP 4GXUN 3WS6A 3EW3B 3KS0J 1IAIL 5KSUB 5C07D 3TFKC 2EC9U 5J13B 2HLAB 1RZ8A 4PRPE 5DGQA 4HC1L 1QPPA 4W6WB 4OUUA 1X4YA 4M3KB 3WS6C 4GW4B 5CWSA 5F7MC 4NWUL 1AGFA 2NLJB 1XGYH 5DMIL 3OKOB 3VXSB 3K46A 5JQHC 3LPWA 1IM9A 1RHHB 1ZT1B 3PWUB 5D9SB 4I8DA 3RFZC 1FL5B 5ISZA 1MHEB 3QPQD 4UV4L 1BVLB 4BKLB 4M6NL 3FQTA 3B6SB 1JWMB 2OI9B 3VFRA 1GZQA 4G9FD 4EXKA 1UM5L 1KXQE 3ZE0E 3ROOA 3HE7D 1AI1H 1XF3B 3SGKA 3ZTJH 4JY6B 4HUWA 3UYPA 2LTQC 3KHOA 3MRHB 1WEJH 4NQCE 4NQEB 2P46B 1XT5A 1VPOL 4RGNB 4O51A 1EUUA 5C07B 3IDXL 3PGDB 5IB5B 3HMXL 5D7JA 1Z0NA 2OZ4A 3SE9L 1HKFA 2R9HD 4JZJC 3X3GH 4LP4A 1J0KA 4BQCA 2O93L 1MHPH 3OJDB 4R2GB 2FBJH 5I9QB 4HH9B 5CBAB 3GSWA 3EDDA 1F5WA 3CXHK 3P77A 1E4KC 2DDQL 4NQVB 1BJMA 4LF3A 3BGAA 2EH8L 1QBAA 4N1CA 4FQXC 2PO6D 2PW1A 4L8CA 4KAQH 4RGMC 2FYYA 3AS1A 3ZYIA 3TCLB 1UACH 5CUSH 1TVDA 2D0GA 1BQHB 1BEYH 4PJBE 3PHOA 3U0TA 4U6VH 5F72S 3CLEL 1FV1B 1BBDH 1SJXA 4ZODA 5GRWA 5DFVD 3NBNA 4BH7A 4KMTH 3C60B 3KPSA 4MJ6A 1D3CA 1M7XA 1A7QH 5EPMA 4R3SA 1YEHH 1ZS8B 1CN4A 2D9QB 4LEXH 2P5WE 2DWEB 4L9DA 3NTCL 1NAMA 3MA7B 2IFFH 3HE7C 5DWUH 3V4UL 4X7SH 4G6JL 3C5JA 1MFDH 4KROB 5HI4C 3UZEA 4ENEC 5KAQG 5CMAB 2DLIA 3R0NA 2P48B 1TMCB 1M7DB 1IC4L 2G60H 1U8OB 4X8JA 4DQOL 2WWKO 4WWKA 1OY3B 4B7IA 2Q7NA 4LDEB 4PJCA 4HS3B 5DUPH 1LHZA 3ISWA 1BWMA 1T80A 2GJJA 2M2DA 5GS0C 1PG7W 5J13C 4LKXA 2XY1A 5JPMB 4OI7A 5AEAA 4PJDA 4PJIF 2IAND 5EU3B 3CUPB 4WFED 4FQCL 4L4TA 3ZDZF 4JAMA 3MGTB 4MD5B 3RUGA 2UWEB 2BVEA 4S10A 1YYMH 1MIEH 2BERA 5GS2D 2EECA 1J8HB 3NCFB 4XWGL 1WGOA 1VB9A 5CEYA 2A77H 3U4AA 1UWEH 5C09E 1S7UB 3G6JE 4O51B 4MCYB 4NZDA 1RZGB 5C0BA 1QRNB 2GCYA 1HOCA 1JPGB 2EXWD 3PWJB 1MEXL 3BKYL 4LHUB 3MLPA 2R8SL 4U7MA 2X4UB 5EBLB 1WWCA 3ZT6A 4QHMB 5GGSB 3RWHB 1EIBA 3WMSA 5HVFB 4H26A 4X6CE 3VXQB 2NYYD 1PX3A 2YUXA 2UZIL 4DGYL 5F8RC 1D5XA 3WSQL 3EKCA 3BP7A 3FT4B 3KWWA 4RSVA 4FQJH 2VKXA 5HI4D 3DVGB 1HQRA 3KPNB 2YPVL 4YGVA 3WFDL 5J11B 3FFCD 3O3DA 5I1LB 4PJCE 2I9TB 3SKJL 4S1DD 3EFFA 3AY4C 1CE1H 1N0XL 4W4OC 5L2KD 4ZNEE 1A4JA 3L3HB 1AQDA 3MOAH 2B4CL 1YC7A 1UCTA 2IALB 1MRCL 1XF2B 2VLKA 1YECH 3BUYB 1UB5B 5IWLA 2GUOA 5EH1A 5CEZE 1PG7L 3PGFH 5AYUL 5A16B 2VR4A 3RHWF 4MNHA 4M7KL 2OCFD 4LQ1A 4N90E 1ZHKA 4FQ2L 4MXWH 2DWEA 2AK4E 3MCLH 1NAKL 3F62A 2J88L 1UH4A 4PJXE 3S36L 5I8OH 1T1YA 5D7IE 1S7VB 2RB8A 5KSBA 4P2OA 3LHPH 2P42B 5HJ3B 4JHWL 1I1RA 4JVUA 1KXTB 1A6VL 1CG9A 4FQ2H 4MXWL 3LH2L 2H3NA 4RDQG 1A47A 2H1PH 3CDYA 3QHFH 4GBXA 3OAZH 5T1LA 2I5YL 4MNQD 3IDMA 1JGUH 3CVIL 1OM3H 5C9JB 4ODWB 4WW2F 1OTSC 1MH5A 3HC3H 4N5UA 5FM8A 3EFDL 1GSMA 4F8TA 5C07E 3S4SG 4FG6C 2HT2D 4G5ZH 4NQVA 3HZYA 1XIWA 2OL3A 1QLRB 1TJGH 2BP3A 1CBVL 1LDPH 5DFTA 1HQ4B 4JDTH 4AENA 1FNEB 4UV4H 4DFIA 2EYSA 3CSYA 1KTRL 3GI9L 3B5TA 5J4MA 2Y5TA 4YDLC 2V2WB 3FFCA 3E8UL 2CKBA 3RDTD 4Y1AE 1X5YA 4XP4L 5AWNL 4WRLA 3U0TB 1CFSB 4HBCL 4X6FA 1T20A 4UNUA 3VXSE 1XCQB 1HWGB 4GRWH 1WWAX 1V7NL 3KYKH 3QIWA 3P30H 4Y89A 4P4KA 1N6UA 1Z3GL 5H35B 3ARED 2DM7A 5ERWA 3O6ML 4JM2C 4FQ1H 1E4WH 4NNXB 4NJ9L 1AGFB 2D03L 4BZ2H 4G6AD 3D18B 3MOBH 2BY2A 2JF1A 4N5EC 2BOCB 2GY7B 1C7SA 4OBSA 4OGYH 4WV1B 5A16A 1E6OH 3O11A 5D1QB 3TJHC 2I60H 4XPGH 5DS8A 1ZGLM 1XGQB 3MLVL 4BSVB 5HGDB 1K5NB 4JQXC 1MUJA 4PRHD 2ZCKL 1UZ6F 3IFOB 4MA3A 1P1ZA 5HYJE 4NZTL 1ADQH 3GMRB 5KVFH 3MGTA 3CZFB 3I2CL 3WLBB 2MSPA 5SWZB 4K2UH 1C08B 1CR9H 2XPGB 3IDNA 4KK8C 3ARYA 5IROA 4B7LA 1HILA 2ZNXA 4X7TA 3NFPA 5BVJA 2YKLL 1I7RB 2MJWA 1SEQH 1RZGA 4LF3B 5FGBC 2AQ3A 3K4AA 1EMTL 1FO0H 1RK1A 3HI5L 3LMJH 1D6EB 1TQBC 5MP6H 3SDXF 4LLWA 1Q9LA 5JHLL 1N64H 3QIBB 4OZHB 4HXAL 4JKPH 1T66D 4WDIA 1CZ8L 4G6ML 2E27L 3EHBD 5E08H 3LN4A 1RZKH 2C3HA 4G8FB 3ARBB 3MRFB 1CR9L 3TNMB 4J3XA 1U91B 4LVNC 5F7YC 4HUVB 2CIKB 1HNGA 4Z18A 2P8PB 1A3LL 1MI5A 2YD1A 2NXYB 5D1ZA 3V6ZA 2EDRA 5LG1A 3QIUD 1CK0H 4PRID 3BQUA 3FMGH 3IFLH 3SKOA 1IZJA 4P9HL 5TJWK 3IU4H 1UKSA 5BW7A 1WEJL 4OZFG 3BT2H 4GBXC 1VGEH 1UXWA 3TH3T 5DJAA 3G6JB 1GPOH 2AABL 4P46B 5SWQB 3GI8L 3H9HB 3ULUH 2AERT 1P4BL 3QIBA 3NCJL 3QUYA 3U7AA 1OCWL 2G5RA 1TCRB 3MODL 3SE3A 5ICZB 4YK4C 3G9AB 3EIFA 1X44A 3RBGA 4S1RL 2NY1C 1OGTB 5D5ME 3KVQA 1XZ0B 4ODTH 4H8WC 4PGCB 5GJSH 1R0AL 3BPCA 4HQQH 3PWVB 4MA8H 3HNVL 2P45B 2V7NA 3BYTA 1QBML 2VABA 3ZDXE 1ACYL 1MLBB 3QDAA 3QI9B 3QFDA 4JO3L 3OAUL 2C3XA 3NACH 4M43L 1MHHB 3ES6A 5K9QI 1T6VN 4IOSD 1YY9D 2W0LA 4KVNL 3GUTB 4YXHH 3PWUA 2NY3B 3MRIB 3VXMA 1AGEA 4X6BB 4OCYL 4F7TA 3GKWH 1YEEL 3MBEC 1E4KA 3R1GL 5ISZE 1A9BA 3ELAT 5GJTH 2CLZA 1NC4B 5J89A 4NO0D 3H3KA 1NKOA 1I3VA 4JZNB 4MNQE 2XY2A 1LO5A 4C83B 4H8WL 1QO3A 3IKKA 3U7YL 5ADPH 3T3PF 3QHFL 3P30L 3EYUL 2KZWA 4AEIL 1JGUL 3MJ8A 4RGND 1WCBA 5KSAC 3SDDC 1U8NB 5DK3A 3FT2B 3SDXE 3MV8E 3T2NH 2C1PB 3PGCA 4UU9A 1UEMA 1OARL 5JLZA 1AJ7L 2ATKA 4GG6A 3R06B 1VSCA 4NDMA 3PWPB 1A7PH 1NGZA 3B43A 4EQ2A 1Y6KR 2B1AH 2DLFL 3KJ6L 3M1BB 5L7XL 3VA6A 2YXFA 4KJYA 2KQMA 3UYRH 4WO4C 5JO5A 1A9EB 4NQCB 1BEYL 3R0MA 1I8LA 1GL4B 1LO5B 2HKHL 4C83A 3W2DH 2R0KH 4XZUA 2XWBB 5FECA 3FT3A 5L7XH 5I1AA 4POUB 4XP9H 4TNVF 4QRTB 4IOFD 3IDMB 2DQTL 4GS7C 1T04B 4FFYL 4YXKL 1JVKA 3BPLC 5ILTL 1JGEB 5E94B 1OSZA 3WFDH 4C4KT 1NCCH 4NCDA 4XPBL 1OD7A 2ATKB 4HGWB 3E2HC 1P7HL 3BP4A 3QJHA 4PB0H 1U58A 1YNTA 4GKNA 3S98A 4XXDB 5E08L 4KU1A 5GIRB 1YZZA 5D1XA 3IKCA 4N0CD 4BSWA 3DXAE 4ZOCA 3I6GB 4PLNC 1VFAA 3ME0A 1ZEAL 4A2LA 4MCZB 2F5BH 1BAFH 3VGAC 3QDJD 1RIHH 1UH2A 4WTZA 4PGDA 3QCVH 2HRPL 2OZ4H 3D1MC 1K8DB 3V79C 1WFUA 4WY7H 3S37H 1CGVA 1HXMB 2VLMD 3HS0A 3VRJA 1EZVX 1T1WB 1JWUB 1RUAH 1UA6H 3BN9C 4ORGA 3PP3H 3TT1H 4P3WA 3EDJA 3N1MC 3NIDF 2G9HA 1OTUC 4QF1B 3GI8H 5F9WB 4E42B 1Q9KA 3U0PB 4C4KO 2CR3A 1A7NL 4BH8A 1X5KA 4CADA 3FB8A 3JSSA 4F80A 5GIRA 4HXBH 3RL2B 4HIXL 4L3AA 1HZHH 4XT1C 5IEKA 5DS8B 3X12A 4M03A 3GRWA 2VZTA 4JFFA 43CAB 2AI0H 2R4SL 3EDFA 5DHXB 2QBWA 5D5MA 1QA9A 5HYQA 3LIZH 5IUSA 4DJMA 1RJCA 4NZRH 4Y4KA 4HUUB 4Q2ZB 3ULVD 1UA6L 3HAEA 3QDJA 1KN4L 2ZSWB 3BEVB 3IFPA 3QQ3B 3U7WH 3ARGB 4BK5A 3RVTC 4YHLL 3QQ4A 4TPRL 1P7KA 4EJ1C 2ZG1A 3BZ4B 2BNRD 5BZWB 4UT6L 2X89D 5DUML 3TN0C 4DWHA 1NAMB 1IMHC 2P5ED 1UWXH 4Y5VA 4F33B 1A7NH 4JFPA 2F8XC 5I66A 5E95B 3RVUC 1J18A 2AEPL 4TSCL 2ILLA 4KDWA 3H0TA 4YZFE 5TE6H 2HKFL 4L8DA 4L8SB 4F8QA 2BCKB 4L4VD 4ZFOL 3DO7B 2BSRB 4OLVL 4M7LH 2AXFA 3LKSA 4NPYB 4S1RH 3S8WA 4WI3A 1CG9B 5C0ND 4HWBL 4KQ4L 3CX5K 1Y0LB 3HUJE 1U8HA 4NC0B 1P7QA 4YHNB 3D48R 3QQ3A 1MRFH 3ULVC 1UCBH 1QBMH 1JFQL 4OJFL 3WIIH 5EORH 5GQBA 3DUUB 4ZUTB 1HHGB 3U82B 2I5YH 2OBGA 1MH5B 2XA8L 1WIOA 2YA0A 5HVHC 2H1PL 2ADFH 5KVEH 1I75A 5BQ7B 1I1AD 2FB4L 4KRPD 1B90A 2WBJC 1NGZB 3IDYC 2FO1A 2BY3A 4S1SH 4M6NH 3FOLB 3HZKA 3AM8A 2XG4A 3DARA 4LP5A 4ELMF 2MCPL 2ED9A 3MJ6A 4J12A 4WUUD 5CLTA 1DBBL 1D5MA 3T77A 5FDWB 4U1KB 5I73B 4OT1L 3UTTD 4KK6D 4CADB 4KK5C 3VH8A 4QNPF 5I1LA 2I9TA 1LWRA 4HS3A 2DM3A 1GC1L 3RVVC 3GSVB 3QHZH 5ISZD 1UEYA 4W4OA 5HHXL 5D96C 2R0ZL 1AD9B 2EDBA 1NMCC 3T2NL 3D0LB 3CGTA 1EBAA 5IBLD 5TDPA 5F9WC 4PGBA 3VRIB 5JW3H 3EYQD 3RPIA 2XZQH 3AM8C 3FZUD 3QYCA 3TBWB 3VFVA 1QOKA 4Y4KB 5A3IC 1BIIA 4XVTL 3MRMA 4S1QL 5FUOH 1IEHA 1AGBB 4YDIL 5KSUA 5BMFH 2VTFA 3HI6L 4PRPD 3CSBA 2FJGA 3MYJA 1DLFH 5JIKA 4LGPB 2VDMH 5IFHL 4WEUD 1Z3GH 1RMFL 1MWAA 2DI8A 2RHEA 1MFEH 2DB8A 1N3NA 4GQ9L 1D9KB 1HSAB 3OXRB 5ICYA 3FN0L 1ZGLB 1WBYB 4XC1L 5DRNA 5TPWH 4F9PA 1YYML 4ZO6A 1A7BA 5CZXD 3ARGC 3WO4C 4Y19E 4PRNA 4HFUH 3C6LA 2ZCHL 4ONFL 4ETYA 5KS9B 5E6IA 5CP3H 2YD9A 2MQCA 3PHQA 2YK1H 4JQIL 1MJ8L 4KK5D 2BVPB 5L8JB 2IBGA 15C8H 4G9FE 5BZDA 3VXME 2DOCA 3WNNA 2V9RA 3GO1H 4MNGA 4WGVB 2EDHA 3HI6H 1ADQA 3LKNA 2VIRA 1C12A 1NCAL 3HE6B 1TLKA 4KROC 1ZANH 2X05A 1KT2B 1EA9C 5ALBL 1GIGL 3KPPB 4ZUTA 4H20H 3M1BA 2EDFA 4AENB 3FO2B 4HBQA 1JYWA 3QEQB 1FZKA 3BP6A 2A0LC 4NQDA 1NPUA 3O6FA 3GBNH 3L7EB 2HTKD 5IK3B 2B0SL 3AFLA 3SDYH 3W11D 1ZT7B 1DCLA 3FO1A 3U4BL 3HHRB 1HHJA 2CIIB 5DHYA 4JO4H 4TVPL 1JMZA 1O7VA 2QKIA 1WWWX 2QADC 5EBWB 1NGQH 5EU6D 5DA4A 4Q9QL 3T0VA 4JG1L 5IJVA 4OF0A 3UAJD 5D6DC 1G84A 4L4VA 4I5BB 2HVJA 1U8KA 3IDYB 1ZSDB 3BRDA 1T0MB 4RMUA 2GT9B 3DLQR 3WN5B 3SBWC 1M7IB 3LD8B 3D2UB 1FYTD 2F74A 3G08A 2VIRB 2OX5A 5EPMB 1LNUB 4I2XE 1KIRA 3Q5TA 1NGXA 5C1MB 4LHUA 2BFVH 1ZLUH 4D9LL 4PJ5B 2AABH 3I85A 4WV1A 1I4FA 4CKVX 4Q6IB 4XCYB 1U2HA 2X7LA 3CMGA 4WFHD 4I0KA 3U83A 4GUPB 4JG0H 4HMEA 4YXLH 1NCUA 2COQA 4L9LA 3G5XB 2OL3H 4FG6D 1LP9A 4GAYB 4LLDA 4CNIB 4MJID 3QQ9C 2YUWA 3JZ7A 1ZTXL 3VXRD 1JGDB 2DQJH 2WBKA 5D7KD 2Y7QA 1TTUA 1WFTA 4ORGB 3L3GA 2VABB 4ODSH 2BNQA 3VCLA 2XA8H 1NMAL 4X6FB 5JW5B 1XCQA 4I77H 4WFEE 3VFSB 3ULVE 2AJUL 2GK0B 3LQAL 3CFDB 5JW4M 3V0VA 5JR1H 1QFOA 4X83A 4M62H 5IVXA 2DKSA 3G08B 4HLZH 4L4VE 3G6AB 3MV9A 4MNHB 3IGAB 4MMXC 4YFLF 2PETA 3ZE0F 3BWAB 3VFUB 1DQDL 3VGGA 3FRUA 1UWXK 1JTOA 4PGJA 4AL8H 2XN9E 3A6BL 43CAA 5EN2B 2YPLB 5CILL 4K94C 5MERB 2PYFA 4HK0B 5GGTA 1FHGA 4OIBA 4CMMB 4WUKH 1LP9B 4GAYA 4XPTL 4S1DC 1Q72H 3C6LC 1T0NB 2BXYA 1U8PB 1Z5LB 4Z9KB 4I3SL 5ACLA 5C08E 2HJFA 5DRZA 5FYLL 5IQ7L 5D1ZB 3V6ZB 1AC6A 5CWSB 2EO1A 2F54D 1LEGA 4NO2B 1MSPA 4WUKL 1ORQA 3DX7B 3QQ9D 2BNQE 3CMOL 1CXFA 4OLWL 1J7VR 4TOYH 1HH6A 1FAKT 3U36A 3GJEA 3E6HB 5CILH 2IEPA 1KC5H 5F7KC 4A6YA 2JIXD 2HN7A 4LLWB 4MD4B 4XB8A 3RY5A 1MCQA 4ODHH 3QI9C 1IE5A 2FO4B 3T4AA 4HC1A 3TBTB 1PG7X 3S36X 3LKRA 2NY0D 4CGTA 3UTTE 1R5VB 2VE6B 3DXAB 4K7PY 5DFWH 2HJFB 2HMIC 1OSZB 4KHTL 4R7NB 4AEEA 4D8PB 3QI9A 1INDH 1R3LA 2OR8A 1A3RL 4NZRL 4DZBA 3GNMH 3TVMA 4KXZI 1KLUB 2DQTH 3BPLB 1JPSH 3P4NA 3MROB 3WE6A 3FOMB 5SWSB 4NRZB 1TPXC 5GGSY 3F7VA 3LRHA 1KPVA 5DZOA 4ZG1A 1OP3K 5J1TC 3THML 4XI5C 2LVEA 1INDL 4JN1L 3E3QC 4U05A 1DVFD 4I18A 1P4BH 5KG9B 3BAEL 3VH8B 1KPUB 1ZEAH 3RDTC 1H3WM 3C8DA 3DVFA 3REWB 5TFSH 3BGFC 5TDNB 3WFHB 5EZIH 4Y19D 2EXWC 3RWGB 1VFBB 3WLBA 4HKJB 5C2UB 3UBXG 5DJ6A 2NY0C 4LSVL 4TUKL 3P4OB 4K07A 3V2AR 3PGCB 5JLZB 5IBTH 5IMMA 1FJ1A 5CCKH 4CN6A 4TNVK 2FJGB 1SVCP 4Y4HA 4LSRH 1FN4A 1TETH 3DYOA 3RIFK 35C8L 4U1SB 1FQ9C 2B0SH 2G2RA 1KPVB 1GRWA 1VFUA 3BAEH 5IHZB 5H2BA 3MNZA 1JNHA 2VQUA 4R96B 3CZJA 3ZTNH 4PJFB 5HY9B 2ZOLA 5IW1B 3M8OH 4FZ8L 4YGAB 1PG7H 1MCRA 4OKDA 2VZVA 5D1XC 3G04B 2JB6A 2XFXA 4TUKH 3CU1A 1KJ2L 3AS0A 5C0BE 1CFNA 4X6CA 5D7LE 4Y19A 3O2DH 4YHOH 4JPKL 1GCFA 5HYJD 1EFXA 3HE6C 3O3UN 3RZWA 1TENA 2W91A 1DQJA 3SE4C 4LOUD 1KG0A 3NN8B 2QV2A 4XNQA 4J2XA 1FZJB 4KK9C 4L8DB 1E4XI 1GZPA 4LGRB 1RUKH 5EG6C 4F7PA 3EYUH 4IEFB 1FYTE 4DFHA 2E3VA 4R4FH 1S8DA 1CS6A 4DUWA 1AHWA 4IRZL 3IXAA 3VGDA 4CN4A 2Q76A 4GSDH 1S9YA 1JHTA 2H32A 3CFCH 2PYEB 4NFDA 4GAGH 4I0PB 5TF0A 2DQJL 3J7HA 5GGRB 5C0IB 5F7NC 4OFDA 3QEUB 1A4JB 1QPXA 1F4XH 5HHQB 4ZOBA 3ZE1F 2E9WA 1XF5A 4IMLB 1OM3L 5JW4Q 3HZVB 3QUZD 1KCSL 5IT2L 5DVNA 4HFUL 4AM0A 2WP3O 4ZD3L 4M62L 1GVIA 3O6KH 1C5DB 1KULA 1MCHA 5C2BH 5T1DL 4CAGA 4JM4L 1EV2E 1QSFB 1IL1A 1CT8B 4PLOB 4ZDHB 2R0KL 1ZA3B 1MCOL 4MB4A 2GJZB 4OQTH 3SY0B 3EZ8A 1KLFA 1I9IH 1AIFA 1KCLA 1A7RH 2AK1L 3DRTB 3FQNA 3U9UB 3LDBB 3UDWC 2AXHA 5E00A 5LXGH 1IC5L 1I8LC 2LAGB 2XN9D 4Y8DC 4OCWH 5GGRA 4M7LT 3O4OC 1TVHA 2CDEB 3I6GA 4WHYG 1FIGL 4PY7B 5HTSA 3L3GB 1MF2L 4IRJA 4NNPH 5F7EL 3BDYH 4KV5E 3TBWA 4GRMB 3U46B 2XA3A 1P84J 3X3FL 1TJHL 1JNNH 3SJVE 5CP7A 1IQWH 2XWJB 5CGMA 5FUZH 4X9HA 4NGHH 5JUEH 1F8TH 4DZBB 3OPZL 2V7NB 2WMPA 3VXSA 1QSFA 4JG1H 4P23D 1ZGLA 4LPVA 3GZKA 1QFWI 3D39A 1KB5A 4L3ED 5GSVB 4L8SA 1YMMB 5GGUB 3C5JB 4FTVE 2ZZUT 2NCMA 3SQBA 1KFAL 1D5BB 4QKXB 2BHZA 4NQCA 1C16B 4XBPB 2Z4QB 2W0PA 2BFVL 1FG2B 4M6OL 1H3VA 3CVHB 4OM0H 5HHME 1IFHL 3L5XL 1FFPB 3EOAB 1VEOA 2YKLH 4DGIH 2CMRL 3RGHA 3QDJB 3HAEB 3FTGA 1JRHH 4KKLC 5IB2A 3CH1B 2OL3L 1T4KB 3ZT7A 3C2SA 3X13B 3D85D 3BP4B 4BA8A 2FGWL 4HXAH 1R6VA 4JVWA 1QNZL 5DJCB 2VYRE 4Z0BH 2FYYB 4EN3B 2IG2L 2UZIH 4DGYH 2XWTA 1WQVT 4NQXA 4BFEA 1X5JA 1UG9A 4WU7A 3HI1B 1EHLH 4V1DA 4PYHA 1WBZA 2BHUA 3K4ZA 2IPUK 2FHCA 5EO0A 1H3TA 4AYFA 5JO5B 4JPKH 5FGBA 4H0GA 3H9YA 1NFDA 4P9HH 3LZFH 1I3GL 4NQCD 2VDRL 5EZLA 4PV8A 2PTUA 1F2QA 4P2RE 3WD5L 4ZUVA 3WJLA 4WW2C 1PEWA 1DP0A 3ARVA 5GS3A 3C2AH 5I16B 1MCWW 32C2B 4PRPA 4POZC 1T2QL 2HFEB 2BZDA 4NSKB 4NO3B 5JXAL 3DOSA 1TDQA 4DVBB 4HG4J 4NOBA 1I7UA 5CP7B 4OZIA 3OAYK 4NT6B 1NCBH 2X6MA 4LSSL 5F6HI 4HD9A 4LCWB 1Q9OA 3RIAK 3F6LA 2YMXH 1MCKA 2HWZH 4Q9RL 1PAMA 3EYSL 3U9PL 5ALCH 2X70B 3RGVD 1I9JH 5FA4B 4PUBH 4M7ZB 2GKIA 2NY7L 1QACA 3HNVH 5HPOA 2FH8A 1CFQA 4J6RL 4X9GA 2EYTA 2EDYA 1BZ9B 4UI2A 5FYKD 3QUXB 3ZKNC 2C5DC 5F7UA 3VFSA 1MCEA 1T1ZB 1FCCA 2ED8A 3VXUE 1AKJA 3C5SB 4P2QA 4M9OA 2BK8A 2VH5H 5F9OL 5BVPH 1SYSB 3N0PB 4EUPA 4P46A 3VG9C 2P5WD 1LEIA 1AR1D 5C9JA 3H9HA 3MRGA 4MQXC 4DW2H 4Z7WA 1XH3B 2AS5M 4LU5H 2VDLL 1CI5A 4L8SC 4LIQL 1XF4A 3WUWA 1A1NB 2IPTH 3AB0B 3L7EA 2QADB 2HAZA 1IGJA 2FEDC 4U3XA 4QTHA 2LVCA 1XGPA 2Q8BH 2ID5A 3K8KA 3VRLF 1EGJL 4Z7VF 3PQYD 4NO0A 5HHOB 5JUEL 3VG9B 5D7SH 4FXKB 5DGRA 4P57A 3QXDB 1DBMH 5IVNA 3NIDE 3QEQE 1EZVY 4TUOB 2YRZA 4MQSB 4OBRA 1REIA 1X5FA 3U1SH 3VMOA 3KYKL 4X9IA 2DLFH 3KJ6H 5I1KH 3BH8B 1IBGH 2BNRE 1N5YH 1FGVL 4OD3H 4XNXL 4ZUSA 5HSFA 4FP8L 5EBMB 5B4MD 4NN7C 4PJGF 2WSKA 2X4NB 2V17L 3T3MF 4X6EA 2EEBA 1BX2A 4ACPA 4Z95H 5GSVA 1KENH 3IDUA 5F6IC 1A0QH 4BZ2L 4TTDC 5J1AB 2HVKB 3T2PA 4RFNB 5FCUL 4U1KA 4GH7B 3QSKB 3OR6A 1FFRA 3NIFF 3CDFA 1OGAA 5DQJA 5A2FA 2J6EL 4NQDB 4GAJL 4CNIA 1GGIH 4CVWA 2F54A 1A02N 1D5XB 1W0WA 4RQQA 5GRVK 1C5CL 3FT4A 3KWWB 3BSZH 1AD0A 3KYOA 5EU4B 2Q86B 3CVHA 4UAOC 5EOQL 3ARSA 4XCNA 1I7ZA 1M1SA 3F7RA 1TXKA 3ROLA 3UTSA 4WTWA 4HKBA 4JFZH 2A77L 2Z31A 3IDGB 3W82A 4JGJA 4YK4B 3EO1A 1QLRA 2Q8AL 1RVFH 3CX5J 5HGAB 4HUMB 5SWSA 1XR8B 3F8UB 3WN5A 4X4YB 2DQHL 2F74B 4YHOL 4Q9QH 1QLEH 1YA5A 1YQVH 1UADC 2G75A 5F7DA 3WJLC 5T1MA 1U95A 4DAGL 3RIFF 4JFOA 3C8KB 4DK3A 3C6LB 1JZ8A 3LDBC 4LPXA 4HIEB 4XTRD 2A2QT 5BS0B 5IQ9A 4OZHF 4KK6C 1OGAB 4Y8AA 4K8RH 5K9QG 1MHCB 4G8IA 3QUZB 1U3ZA 4WW1B 5DI8A 5FYJL 3MRQA 1NL0H 1BQUA 1ZWIB 2VC2L 4UZGA 4Y5YA 1F3JA 4IRSA 3UMTA 4BJLA 3PV6A 1DDHB 2R2BB 4KAQL 1SEBA 3TNMA 3ROLB 3MLZH 2CDGB 3VU2A 1MRCH 3TZVC 4K55A 1S9VA 4APQC 1VEMA 3SO3C 5EZLB 4M5YH 1K6QL 5D72L 3TBVA 4OB5H 3VRIA 4QHUB 3P11H 5L6YH 4CVXB 1VCAA 4IRJD 4OCSH 4GS7B 3JV4A 1U8IB 3VI4E 1CGSH 2F53B 3E6HA 4PJ8B 1LDPL 3ABZA 4KMTL 3SDAD 4OLZH 1K2DA 4JM2F 4WI5A 1NMAH 1D5BA 1YC8A 4Y5XC 3PP4H 3OF6D 5SWQA 3V6BR 2AJYL 5I19H 2VKWA 1JCKA 2GIYA 1RZJH 4HZLB 5B21A 3QWRA 5HDOA 4PRNB 4CVZA 5BS0D 4TULH 4GO6B 4D3CL 1KEMH 2D2OA 2HLFD 1EEQA 2AK4D 3CCHA 5IV2A 3DUHA 3GMMB 1WT5C 4BYHA 4RWHA 4X6DA 5LGHH 3GJFB 3WLWD 3DX6A 4H5SA 4F7PB 3TJHD 4HKBB 1W0YT 4Y2OA 3GKZA 4M3JA 3EOYG 2ZKHL 4P2RD 2E7BA 3H7LA 3QXUA 1A7OH 1I7TB 3V0AC 5GRJH 3S37X 2XIDA 4WVRA 1H0DA 1DLHB 1AKJD 4LSQL 4P2QD 2DQGH 4ZPTA 3D18A 4QTHB 4ONHA 5FYKE 4Q7DA 3D3VD 4XH2A 2VO5A 1AGEB 4X6BA 1Q8MA 2D7QA 3GRWH 5E9DA 4X4XB 4G9FA 1YEFL 5T1MB 4GRWB 2A9NH 3VXUD 1JGDA 1FPTL 1MHPL 1FFOB 5GJTL 3RKPA 3ULVL 4OSUL 3X3GL 2JJWA 1K5NA 1JK8A 1NAML 4UB0H 3O2WL 1UB6A 2D4DA 2X9WA 5ECJE 2D3VA 1L6ZA 2A6JB 3T0EA 1HCFX 2X4TA 2AV1B 5F9JA 3QUMA 3MV9B 3PXJA 5CEXA 4Y1AD 1X6NA 5IVZA 5E4EC 5L2JB 3IJSA 3MFGB 2G2RB 1INEH 5F1IB 5TDOB 4RWYH 1YJDL 2BJMH 2FJHA 4TSBH 4ELMA 1YN7A 4MDJB 5DJYA 3QUYC 1H5BB 4LLYB 5MENB 4NRZA 2WQRA 3VWKB 3JWDC 1BVLA 1FG9C 3Q48A 3JVGC 4OLUH 4QRQA 5I15L 1W0WB 3EJJX 2EZ0C 2QQLL 1Q0YL 3BE1L 4FTVB 2VLRE 1JK8B 1F6AB 5D7IB 3VWKD 4AY0A 4F7EA 5IFJB 2AXJA 5EIIA 3BN3B 3PQYE 4KH2A 1H5BC 5FK9A 1EAPB 1UVQB 3ARFC 1RZFL 2Z31B 1H3XA 3WL9A 1OSPL 1T04A 4YHZH 1YMHA 4BQ8A 2PXYD 4FQXB 1HI6A 3QEQD 1S9KC 3PWNB 2H2PC 1B4RA 4LPWA 1HDMA 2DAVA 3IXTB 2R2EB 5DD3H 1F8TL 2FLRT 4JM2D 3WHXB 3MJGX 3MACL 4CMHB 3V6OE 1CCZA 2AAVA 3UTOA 3N85H 4ERSH 2XXMB 4W68A 5HHNB 3X17A 3B83A 5IHZA 2FNBA 5HHVL 1S7QB 3STZB 3IDIA 2ZUQB 4ODVL 4IMKA 2BVOB 3S3JA 1F3JB 1B6DA 1CDHA 4NWUH 4K3DH 3MZTA 1BJ1J 4LRIA 5B38B 2O5XL 3TA3C 3VI3F 4K3EH 3UC0H 5I1CL 3S88L 2ICWJ 5I8CA 4Z7UB 1FDLL 3QULA 1IKFH 3GSRA 3W11C 4RIRA 3MLSH 4JR9H 4Z78A 4B0MM 1IAOA 4AG4H 3RKDD 3QRFM 2OXHA 4G42A 2AVGA 1FFNA 5CD3B 3MA7A 1WBYA 3Q6FB 4UT7L 2P7TA 4HWEH 4RMTA 3O4OB 2W38A 4U1NB 2PKDA 4U33A 2FIRT 2NR6D 4WFGD 4EBQL 5IKCA 1MLCA 3OKMA 5DJ8B 1MRFL 2X1OA 3I6KA 2BC4B 1KTDA 3QDMD 2CLVA 4PJ7A 3I02A 4GRLC 2MOVA 3X12B 3W0WE 5IJKA 1KN2H 4CVZB 3ZL4L 2V6HA 1F4AA 5HYQB 3MUHL 3UPRB 1UZ8A 2HRLA 1QEWB 2AP2A 3CUPA 1S7SB 3MR9B 3MUZ1 5C71A 3U7WL 5TQ0H 3DWTA 4IRZH 5FB8B 1FNSL 4HGWA 3O0RH 2NNAB 4Z0XA 2VE6A 3DXAA 5C0EB 2HFEA 5IEHB 4I4WB 4WHTA 2P5WB 4YXHL 2G75B 5F7DB 5C0BB 4DOHE 2NLJA 1BREA 3AUVA 1SMOA 1I7TA 4Y4KD 3S7GA 5IT2H 2FZ3B 4PLKD 3HFMH 4XPHH 3OTTA 4M5ZH 3W0WB 2AJ3A 2GAZB 2X70A 1ITBB 4LSPH 5ESQB 3LKOB 5FA4A 3KLHC 4UDUA 4K3HA 4PJBF 3V52L 1D5IH 1IGIL 3TESA 2YUZA 2HVJB 4IDJH 1CLCA 3NCBB 3EFFB 1Y0LA 3SBWA 1YMMD 4JB9H 3HC3L 4NRYB 3TZVB 4APQB 2BMKB 2X1XR 3O6FD 2A6IB 1T4KA 4UDTA 3G6DL 1RUKL 4ORZC 4DQOH 4MNGE 5B38A 2BVQB 3UJJL 4UTBL 3FKUS 4LLAA 5I30H 4CDHA 2ZG3A 3O4LD 4NCC1 4J7RA 1CD8A 2ZUQC 2BNRA 1S5IH 3BPNC 3NZ8A 4LFHG 1C1EH 5C70A 1A4KB 1RJLB 2EH8H 3GJFH 3CNKA 4LVEA 1MVFA 2XXCB 4O9HL 5KVGL 1WBZB 3T2QA 4UDUB 1A21A 2NX5A 2E7LA 4WEBH 4R97C 3C5ZD 1AY1L 4RZCA 3MZGB 5C08B 4R4BA 4U6VL 3CK0L 3TN0B 5FO9B 1FL6A 1G9NH 4HV8B 1T7ZA 4FRWA 2J4WL 1SY6L 5C0GA 3KLAB 1IGML 4ZXBA 4N8PA 2AXGA 3VXTB 1UJTA 1YEKH 3VXPA 4ZNCD 3SPVA 4G8GB 1P6AB 3OBAA 5SWZE 1R5IA 5HGGS 4ONHB 3CFJB 3IAQA 4NP4L 4QRPB 2WQ8A 1EAJA 1OAKL 1D9KA 3AAZB 3BHBA 2KQNA 1ZLSL 4X80L 4KUCF 2AK4A 4NM4L 4MB3A 1IEBA 5CJ5A 1WC7B 1CFQB 4QOKD 5KVFL 4HIIB 2Q76B 1R3HB 4JVPA 5EZOH 5C0FA 2AJ3B 4WO4D 1KYOK 1UB6B 1EUTA 3UJIL 2VQ1A 4LK4A 2ZPKH 5MEOA 5DJ2A 2UWEA 2E6PA 2M26A 3VWJC 2B20A 3BZEB 1A6ZA 1OAQL 5DJZB 3TEUA 1IAOB 4PBXA 3DVGA 5FFLA 4AM0B 2FSEA 3MLRH 4XCCH 4Z7WB 2Z8WC 1G0YR 2F15A 3FCTB 3CXDH 4PV8B 4X8XA 2QQKL 1YN7B 4MDJA 3BH9B 3IU3B 4HUKB 3B3IB 3LKPA 4ISVB 3DI3B 1CGUA 4F57H 5IKCB 3D6GA 2CDFB 5E8DH 4K9EC 1B4JL 4OLXL 4AEFA 4ONGH 2V5RA 4QTIL 4ZUUB 1F02I 2WV3A 2RR3A 1NFIA 1UZ6E 2HH0L 4HIHA 3STBA 2GY5A 2XN9B 2VL5B 4AEHH 3MRKB 3U6RA 2OMBA 1JNLH 1XF1A 2CDGA 5AWNH 2HJKA 4F57L 5ID1B 4U7KA 4DKEL 4F3FB 1F00I 4PJAB 2VDNL 3F5WA 4JRYD 4D0DA 5B39A 4PJDF 4PJIA 5FHAL 1WVZA 5FB8A 4IMKC 4K23H 1U8KB 4QEGA 3RGVC 2GSIA 3A6CH 5IVOA 25C8L 3QRGH 1DBJL 1E6JL 5DT1L 1CLOH 4UMGA 5GPRA 2CXGA 4OLXH 3V5DB 1Q1JL 3VWJD 2X9YA 4OUUB 3TP4A 4FFZH 3IDIB 2V7HA 4FABH 2EE2A 3KPTA 2H8PB 3UTSE 3KNBA 5HPMB 1MJJA 1WITA 2A74B 1IGFL 4PRHA 1N4XL 5KAQF 1NBZA 4YQXL 4RX4A 3SGDI 3V6OA 5DR5L 2J8UF 1KJVA 5FUCE 5FYJU 3WKMH 4XNYH 3RWEB 1DQML 2E8YA 3GSQB 4GBXB 3RPIB 5F7HA 4KVCL 1FN4B 2Z31D 5TH2A 3TT3L 5GS0H 5KSVA 5FGCB 1JF1B 3MJ9H 5DQDL 3P73B 3D85B 3BMVA 3W9EA 2DD8L 1Z9OA 2X2YA 2JB5H 4G7YH 1CIDA 5ESVA 5C8JA 3O9WB 3P0YL 3TO4A 4KWUA 4X6DF 2YZ8A 3WXVL 3DVIA 4XP4H 5FV1L 4Q9BA 5GGVY 4ODUA 3S35H 2NTFA 1FVCA 5A43C 5DEZA 5T33H 3PG2A 3GSUB 2B1AL 1FAIL 4PJEE 3TLRA 4G6MH 4J23A 2ZJSH 5I8KH 1T1XB 4H25A 3B9DA 5BZDB 1BBDL 3I75A 2X89A 5FEBA 1YN6B 3NGBC 2LABA 5KANI 3O2VL 3G5ZA 2AKRB 1SJHA 2IGFH 5C0AE 4MWFA 4HS8H 5D1ZD 2ZUWA 4NUGL 5HI5C 2IMNA 4FQQA 5C8JB 2GFBB 1INEL 1KJ2A 4IMLA 1B88A 5F7FA 3PL6D 1WC7A 3JTSB 4MAUL 1LO3H 3SDDA 1MJ8H 4HIIA 3GSOB 3QXVA 1BJ1H 3RZCC 4RBPK 4UINL 2NXYC 3ZDYF 2HFTA 2NY6B 4X5WB 1FGNL 5MEPA 5EU6E 2Z93A 4XBEL 3DX8A 2XNAB 3HPJA 2JK5B 4P46D 3IGAA 3OG4B 4I5BA 1S7WB 2FX7L 2Y07H 5F1NA 5FV2A 3OSKA 3QEGH 4WFFE 4D8PA 3SY0A 1KEGL 4FQXD 1JI2A 3OGOE 2UUDK 1HEZA 3BZFB 2VNCA 4FHBD 1L7TL 4YPGA 3RI5F 1DE4A 4C55A 5HBBA 1A14H 3GJFK 3VFWB 5D2NB 1HKLH 3IU3A 1F58H 1CE1L 1N0XH 3SOBL 3B3IA 5B38G 4ODTL 1MI5B 2R69H 2CMRH 3MRGB 3VXMD 1LE9B 4JQXA 3K0WA 4I3RL 3G5YA 4PJHF 1ZHNB 4K94H 3WIHL 4OM0L 5SWZD 3UTTA 3BKCL 3UX9B 2BSSB 3H3PH 1ZMYA 5FGRA 1H3PL 4MNQA 1F3DJ 5BRZA 4Z6AT 2YD7A 4PJXA 4I0PD 4LMQE 1EEZB 4U6YA 5EUKA 5IHUL 4NZUL 4NM8L 1OTTC 1GAFH 3JVGA 1UACL 1EFQA 1WZKA 2I07B 3STLA 4F9LC 3RWDB 4OCMC 3CCHB 1NEUA 4MQ7B 3WNLA 1KB5B 4ZFOA 4UQ3B 4NBXB 5IFAH 3ZYOA 3MNVB 1JTPA 1K8IB 3KDMB 3MLSL 4IHOA 4RMSA 3L5HA 3RWCB 1OTSD 2YN3A 5HYJB 5ANMB 2NY0B 4JCLA 1CD1B 1E27B 4YE4L 4FMFA 5ITFA 2IADA 3IKCB 1OAXH 3L3JA 5I18H 4H88H 4D0CA 2ICCA 1A6VH 4XNYL 4XX1G 4Z7NF 3VXNB 2IANA 4KVCH 3V4VH 2KUTA 4ZS6C 2X4QB 1W72L 4YBQC 3VFGH 2D31B 2B5IB 1MIML 3TO4D 4ODSL 4XNZC 4PGCA 4J3UA 3I9GL 3OKEB 5CD5C 5CEZH 1RJZB 1S5HA 2WP3T 1NC4A 2IPUG 5I6XC 3FQXB 2FR4A 1OPGL 4HPOL 1MFCL 5JMRA 2VXVH 3RX5A 1VDGA 4AT6B 1MY7A 2Z8VC 4MXVE 3UAJC 3WE6B 5LGJB 3V4VL 3LS5H 2DTSA 4X5WA 3ZKMD 3T0EB 5GS1A 3M07A 4TN9A 4HAGA 1DQLH 3E6FA 5L0QC 1VADB 1G6RL 4U49A 1BFSA 4YEEA 4V1DB 3NCMA 1BFOA 3HC0B 5E8NB 3CFEB 5CSZB 2BHYA 2X42A 4N0FA 1E27A 3JV6A 4YIQA 1KCKA 1B2WL 3UJTH 5J6HA 4NKMB 2W9LA 4J4PA 5I6XB 2FX9L 1N4XH 5F97E 3ZKXC 1HXYA 4MQXD 3JV5A 4OUOA 1IC7L 2QSCH 4W81A 2FO4A 1BECA 2HLAA 1JPTH 5JZ7D 2QJDA 4K3JL 1ZVSA 3WV0A 4GAFB 4NJ9H 2VUYA 4JM4H 1K4DB 4LCIL 5JORA 3QXAB 2XWBA 3U48A 1WAAE 4X5XB 5T3ZL 4K7PX 3ZO0A 3V5DA 1QSFE 2Y6SD 4KTYA 4PJFA 4QY8B 5HY9A 4JRYA 1EH9A 3QDHA 4PJ9B 4OCRH 4DN3L 3NOIA 3H9SB 4MJIA 4BSJA 1S9WA 3WS3A 3DJ9A 3S3SA 3RVXD 1KJ2B 5IHBA 4LAQH 3VFRB 2YD5A 3L3KB 3SE3C 5GGQL 1F4YH 3NA4A 4Z7VA 3V8CA 1YEJL 4ALAH 1ADQL 2PW1B 1N59A 4R0LC 4WGWB 2HT3C 2C1OB 4R4NC 4MLSA 5D70L 4XRCA 3DYPA 4HPYL 3AS2A 5FKPB 1KB5H 3V5KA 3BMWA 2R0LH 5TE4L 4P4RA 4NUJB 1MRDL 4HH9A 2J6EH 3EO0A 5F93C 4BSVA 4R26L 1KJ3H 4O5LH 5GRVL 1G9NL 5L88L 2EDEA 1MFAL 5K9KA 5DUBA 4DN3H 1A8JH 4LBEA 4KPHH 4QXTB 4N8VG 1HINH 1AHWB 1IILE 1MVUA 4ETQA 5IBTL 1NCWL 4PGEB 5GRUL 3WDHA 2P7TB 4PJEF 3T0DA 1PJ9A 1B0WA 3BP5B 3QJFA 3HMXA 3OKLA 2OZ4L 1QTYT 1NGWB 1RUMH 1V3JA 2BSSA 1NGYB 2B39A 4ZO9A 2DYPB 4JQVC 5T1KD 2QQNH 3JV6B 3B2VL 2NYYC 3KXFA 5MEOB 3HR5B 4EI5C 2E5EA 4M1GL 3I02B 4J3OC 1MRDH 4Z7OF 2R1WB 4R4ND 4P49A 4LKXB 4PRAB 4UOW0 4ZTPL 4G6AC 4JFEA 3RU8L 2BNUA 3SCMD 2X4NA 1QFHA 1NGQL 2APVA 1NCCL 2J2ZA 2LE9A 3Q5YA 5ALCL 4LVHB 2MCG1 3V8OA 3DRTA 4Z77B 2VRAA 4FQJL 1ZA6A 4JO4L 4K71C 3OAZK 5BVPL 4OGAC 2ESVA 3PL6B 3EBAA 3D9AH 2C26A 3BKCH 3UPAA 4LLVA 2JCCB 1JWSA 5DURD 5KOVC 3JTSA 1BFVL 1BVZA 2N7BA 4R7DB 4PV9A 3GSOA 3VXRB 4G7VH 1O5DT 2HTLC 3PGFL 1JGVL 2EIDA 1WISA 3I9GH 4LHUG 5T5FH 1BZ7B 5D2LE 2DMCA 5B39B 5IESL 2DI9A 3OHXB 1NDMA 3I6LE 2VDKH 4M00A 5DC0A 4FTVA 5KSBE 4G3YH 3O4LA 3JUYA 1S7TA 5MEQB 2CK2A 3HE6A 2D7OA 1DE4B 3CC5A 3B5GA 1MJUL 3UJJH 1QFWH 1KELH 1QQDA 1MJ7H 1T66C 1VADA 4LSSH 3RPKA 2RIKA 3SDCB 4LSUL 5D7LD 4S2SB 4HUXB 3GK8H 3O6FC 3JWOL 1HDMB 3IXTA 3SCMC 3WDJA 3FN0H 3LKSB 4NPYA 3FQNB 1R24A 4P2CG 2P44B 1JGLH 2QSCL 4NUGH 3RQ3A 2VDKL 3BRGC 2R39A 3WFCH 1CU4H 1GH7A 1J12A 5CZKA 5HDLA 2O61B 4JRXA 5DJ2B 4PR5A 1G6RB 2BVOA 3T77B 6FABL 4HJ0D 1JNNL 2IQAB 4GBXD 3F12B 1U8IA 4P5KA 2FSEB 2HYMA 4OV6F 4OQ1A 1BM3H 2J5LC 3P73A 4HWZA 4OZFB 4M5ZL 2XWJA 4CN1A 1G6RH 3T2OA 5EFIA 3TWCL 5KZCD 4AIXA 3O45A 4OGXL 1ZHKB 4UB0L 3HE6D 4P5TC 2MPAL 3JXAA 4LPUA 3VFVB 3DETD 1L6XA 4M9PA 4HUXA 3HE7A 5DTFB 2EDQA 3KPMA 4WW2A 5CAYB 4JGUA 5E2VH 3P9LA 3L3OA 3IJYA 4QRRE 4EXPX 3U4EB 1VA9A 1PKQE 3RY4A 5FF6B 3LS4H 2B5IC 3H6JA 2E8ZA 3L5XH 4HX1A 5D9SA 3CDGB 5HVGB 2O61A 1ORSA 2N7AA 4HDIA 5HHMD 5I2IA 2OMNA 4G9DA 2VWEC 2ZPKL 4JQVA 2DQIH 5GXBB 5F8QC 1NUFA 3CFIC 2A9ML 3PJSB 2NXZC 3MRJA 2F5BL 1JHKH 3LS4L 3GB7A 3JBG7 5IOPB 5KSAB 4F7MA 1TVBB 5F71A 3SGJC 4XH2B 2EC9T 2DL9A 4YUEH 5KJRH 3KPRB 1Z9MA 3C08H 3MXWH 1FE8H 3FO9B 3VFPA 3GSWB 2AV7B 2ZOKB 3GBML 4M93B 2ICWI 4N90D 5D7JC 2NY5C 4NC1C 5DHVA 4JKPL 4ZPVB 4XXDA 4EN3D 3M45A 2JLLA 5DK2B 5LQBL 1AO7E 3U2SB 3CSGA 4OCSL 3ZDYE 2VL4A 5FHBH 1CGYA 5C0JA 2V2XA 3MFFA 4JJ5B 1PGRB 3ULVF 2YXMA 3F7YB 5J12B 3SDCC 3NFNA 1NLBH 3GSNA 3U30B 4UINH 1I8MB 1MCLA 1QBBA 3B9AA 4KJQC 4KRPB 3C9NB 2H6PB 2NZIA 1YPZB 3KYMB 4BUHA 4QXGL 2NW2A 1KB9K 4MDIA 3CZFA 2GYSA 1ZHBA 1L7TH 4OI9A 3V7MA 12E8H 4O4YL 1ROWA 4AEHL 2H26B 3MLTA 4MQTB 2GSIB 1TQCB 5IWLC 4QCIA 1G1YA 1AXTL 3SE8H 1QP1A 3O6KL 5H94A 5DK0B 3SDYL 5D1QC 1XGQA 1PQZB 1BWWA 1A4KA 4FNLL 4LMQI 1CXEA 2VAJA 3QNZA 1H3PH 4WNQA 3HE7B 5DTFA 4OTXL 3CFKA 1P2CB 1EO8L 4J4PC 2PTTB 4CW1B 2EYTB 2XRAL 4PB9H 2RCSL 3KHQA 2Z92B 3MV11 2PUQT 4L4VB 4P4RB 3GSXA 4DN4H 3GI9H 4NWTH 1DANT 3VXSD 4P4KD 1KNOA 3GHEH 3KDMA 3PDOB 1P6FA 4UBDC 4KJQD 2AJVL 5EOCH 1T3FA 1NMBL 1V7NH 3FB7B 4NQTA 3C5ZB 2Q6WA 4NZJA 3P0VH 2I24N 5HYEA 3ZL4H 3MRLA 3INUH 5HVWA 1CTOA 4G7VL 3WO4B 4GW4A 1KB9J 1E4JA 1RD6A 2YC1B 4JREB 4XVSH 3RL1B 4ZNEA 3GHBL 3AU1B 3KYNB 5J6GB 3OAUH 2EXYC 1VFOA 1W8OA 3BHBB 3MJ9L 3O8XA 4OLEA 5DQDH 4XP6L 5LWYH 2HT4D 3BQUC 3DROA 3VFPB 1F4WL 3CFBA 5IIEB 3HC4H 1FNSH 3LV3B 1IEBB 4RIRB 3EYOA 3OKDA 2CPCA 2LV4A 3TIEA 4PLKC 3B9KB 4HHAA 1QR1B 2VDOL 4P57B 2OJZL 4FXGA 2C3VB 3CSPA 1WZMA 2DBLL 3ULSB 3N1FC 5CINH 5IV2B 3NVQA 3DECA 4MS8D 4QHLA 3MLYL 3HRPA 2KKQA 2DBJA 5I1DA 3U2SA 2CXKA 3I6LD 4YPGB 3BZEA 1T0NA 3DV6B 1A7OL 3T1FA 5CJXC 3SKUD 4UBDD 1A6TA 4FABL 4JDZA 4ZUSB 3RZCA 3LQAC 1KTDB 4ODXA 4YIQB 4D0BB 2R1YA 3MV01 4R90H 2VB5A 5KN5A 3FB5B 2CK0H 2IFGA 3QWOA 4YX2L 1EPFA 3DGGB 3VXRA 5I76B 1PVHA 1IQDB 1OQOA 2ATPA 4HH8A 2PCPA 4I13B 4JO2H 5GRUH 5LCVL 5I1GL 3W5MA 3V95A 2FDBP 3V7AE 6FABH 2YD6A 1NFIB 4C56A 5E4IA 4JN1H 3NIGF 2FEEL 3PHSA 4MHHG 4N8CH 1LD9B 3GB7B 3H9SE 5K9OA 5ESVB 3FT2A 1A5FL 3IDNB 4O2FA 2AQ2A 1WSST 4YHIB 1TJIH 4PRIE 1FVDB 2ADGA 3OX8B 3QO0A 5HI3D 1ITCA 2IBZY 5C0AA 4JJHA 5DMGD 4YWGH 1KJMA 3TFKD 2J1KA 5K59E 4GKSB 4Z7UF 2CSPA 4JRWA 4JZJB 4XXCA 1Q9LB 1MWAB 4HCRH 3MV7D 2C4XA 2F5AH 4N8VB 5HYSG 3GDBA 5EOQH 2XZCL 3RWFA 5I1EH 3F7PC 3FONA 3OKEA 3W9DA 5B8CB 4QRRD 5F70A 1CGTA 2A74A 2B2XH 4KTDL 4P5KB 5FO8A 4NNYB 4LLMA 4U1MA 3P11L 1OAUL 5FDYA 2VZSA 2WLYA 3TVMC 2XQYK 1XGUB 4D9RD 3PWPA 4LVOB 5F1KC 2DYPD 3VFMB 1ZAGA 3RUGB 1KTLB 4NM4H 3BQUB 5F96H 3BP5A 5F7WC 5H35A 3GIZL 2EE9A 3OKLB 1YPZE 1EO8H 4KHXL 4PP1D 3W9EB 1RZJC 3J8F7 1XGTB 1ZLWK 4KDTC 3U4EA 2BNQD 4ZFZA 1KPUA 1J1OH 1QRNA 2GCYB 4EI6A 1DQQA 5JIPA 1AXSB 4JM2B 5KTEH 3A67H 5AUMA 3SKNA 4P5MA 5JIHA 2RBLA 1S7QA 1N6VA 5DO2C 4U1LA 3QEQA 4PD4J 4KMQA 1MCFA 5CUSL 2XNAA 4GOSA 5C3LD 4KKAD 5IB4A 2FGWH 1I9RL 5KW9H 2X1QA 5E8DL 3QCUL 2ATPB 5DJXA 3K80A 3SPVB 1A1OA 4QXGH 1ZGLP 1PKQA 1HHKB 2GSGB 4PTUB 3O8XD 1MFCH 1LO0L 1FLRH 2DQUH 1GZQB 5IOPA 3IS0X 1ODAA 4U1HA 4RGNE 1FFNB 4XMPL 1JNLL 3TO4C 1Q94B 5EOTA 1QBLH 3HUJB 1MIMH 2B7DT 2IAMB 1HIML 1T5WA 5JR1L 5T5NF 1NSNL 5C86A 4F58L 5GRZA 5I1HL 1MCPH 3B2UD 4R6UA 3WFEL 2CO6B 1JF6A 1DLHA 2UWEF 4ZD3H 1CXHA 1NCTA 4FQQB 1XR9B 1Y18B 3PL6C 2ZSVB 2QR0B 1FBIL 3QUKA 1SY6A 4XP5H 2WZPD 1OP3H 4Y4HD 2ENYA 3C2AL 1KCUL 3WFBL 1T1YB 3WKNA 1KENL 2IWGA 3BVNA 3NCYP 4OZIE 3WFEH 3TIEB 3IXAB 1TQBB 3MV9D 3WL9B 4I9WE 4QNPE 1QSEB 2K7QA 1QRND 4L5FL 1HI6B 5CS7A 1V7MH 2H2SD 1AGDA 1QO3B 2V9TA 1R5WA 2YA1A 4EOWH 3IFPB 2ZSWA 3BEVA 2Y36H 2VWEE 1ZHBB 5CGTA 3DV6A 5GSRA 5B3JF 3LN5B 4WFFD 5IMKA 4R90L 3ARBC 5TE7H 4I0CC 1NFDE 2IAMA 1IM3B 2Z8SA 3QFJA 5EU7E 4G6FB 3O3EA 3B8SA