4QO3A

Crystal structure of c16s/n18s/k12v/c117v/p134v mutant of human acidic fibroblast growth factor
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
142
structure length
142
Chain Sequence
HHHHFNLPPGNYKKPVLLYSSSGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSVKRGPRTHYGQKAILFLVLPVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermodynamics of Cysteine Substitution Suggest Unique Structural Role for Cysteine in Proteins
rcsb
molecule keywords Fibroblast growth factor 1
molecule tags Protein binding
source organism Homo sapiens
total genus 33
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4qo3A00
1NUNA 1TIEA 3P6IA 3RMXA 3BRFA 3BADA 3HALA 2ZR1B 1EV2A 2HW9A 1CE7B 1JT3A 4EKXB 5FZZA 1HWOB 3AJ5A 3FGMA 4I0YA 2ERMA 2MIBA 1QQKA 5FNXA 3POKA 3VUOA 4D8HA 2FFVA 1G9DA 5GAQA 7I1BA 2KKIA 4I4YA 4KBBA 1RZOB 1ISXA 4JP0A 4ZGRB 4QALA 2D22A 2F8XC 3OJ2A 3BAGA 1S0FA 1FMMS 1Z0HA 4I6IA 4EFQA 3NBNA 3CAHA 2D24A 3N0KA 4ZOTA 4KEJA 6I1BA 3FJEA 1RY7A 3N7MA 4L4IA 4QO3A 3C9ZA 4LO1A 4LO1C 4P0KA 4FGFA 1FN0A 3NBDA 5DSSB 3O4BA 1DFQA 1RG8A 4GOYA 4TLPA 3JUTA 3BB2A 1S0GA 3F1RA 2R9KB 2AFGA 3CA5A 3H6SE 4LO7B 2WRYA 4G9NA 1I1BA 2KI6B 3V79C 3IIRA 4QC4A 4IZEA 1R8NA 3WO2A 2RG9B 2BFHA 1YTOA 4EFRA 5DZUA 9ILBA 1UPSA 3IM5A 2UUSA 1AF9A 3BAQA 5BXSA 2BEAA 4I4XA 1WBCA 1ITBA 3A07A 4JKXB 1JLYA 2D43A 1DQGA 3VT1A 2QYIB 4I4QA 3VEQA 1EVTA 3VSFA 3O4AA 2E4MC 3CQAA 3RTJB 4D0ZA 2K8RA 3H6QA 1FWUA 3IM6A 1BFGA 3NBEA 2ET2A 1W3FA 5BQUA 4Z9WB 4A7ZA 3KMVA 2ZQNA 1JLXA 1FV2A 1T9FA 3AKIA 4H9WA 1HWNB 1SR4A 1SR4C 3I2XA 3BX1C 4OEEA 2DRZA 4JPZA 1IOBA 2D23A 3ILAA 1IILA 2K4AB 4P6AA 1AXMA 4EB2B 4JAWA 2F2FC 4QBCA 1Q1UA 2Q9XA 3V0BA 4D0TA 4KEIA 4LO2A 4J23B 3BA4A 4OUJA 3A23A 2HWMA 3R4UA 4I1EA 2BEBA 1F31A 1PUUB 1BFBA 5FZUA 3FUQA 1EPWA 4WBCA 2AQZA 2L5XA 2X2TA 4IHZA 4F34A 1W3AA 5FNWA 3Q7WA 4KEKA 2Z48A 1QQLA 1BARA 3CRHA 1BASA 3BAHA 1FV3A 4IQPA 1AVWB 4I8MA 5DUYA 1R8OA 3OJVA 4I4UA 2Y9GA 1NZKA 2HWAA 4HR6C 4ZLBB 5D63A 1BLDA 1DFCA 4XFSA 1YXWA 1V6WA 1BLAA 2YUGA 1IJTA 1W3GA 1TP0A 3PG0A 3PUBA 1G9BA 5FZYA 4ZFUB 3UJ4A 2LIEA 1K5VA 2NYYA 4XFUA 3O4DA 1ISWA 1ISYA 3HN1A 5F8SA 3ZX7A 3S8JA 2X2SA 4GP3A 3HOMA 3RTIB 3CA1A 3AZVA 4IONA 4I4SA 4IYBA 1WBAA 2KLLA 3W9TA 2D7IA 2VXRA 4LO3A 4A7KA 1BFCA 2MLLB 4LO3C 3ZXDA 1BFFA 3BAVA 2NP0A 1DZCA 3S8KA 4X37A 3FJ9A 3VT2A 4IY8A 3TC2A 2DRYA 4XFTA 1AFCA 4QKRA 3HBWA 3CU1B 4LO0A 4G1RA 3CRGA 3FJ8A 2LIQA 4USOA 4JKQA 3N7JA 3EF2A 4LO7C 3RMYA 4H04A 1MD6A 3FJDA 1HCDA 5EG6C 3HMYA 3FJIA 1G82A 1PC8B 4P0LA 3RSJA 3WO4A 2P39A 4DCKC 4ZKTB 2D7RA 1Z4SA 5EHAA 3Q7XA 2MC2A 2RSTA 5F8YA 1S0EA 1TWEA 1XHBA 1YF8B 3P53A 4I4OA 2HZ9A 1JT5A 3I2AA 4OWJA 3LTQA 3P6JA 4QD2C 3AH2A 4I3NA 3CA0A 3BAOA 3AKFA 1HKNA 1JT4A 3WMUA 2VSEA 2NTDA 3CRIA 5BQUC 3V0AB 3O5WB 21BIA 1S0LA 4USPA 1M2TB 3AKHA 3VSZA 1RMLA 5D62A 2Z49A 1HIBA 1E0OA 2Y9XE 4OEFA 3ZC9A 4QKSA 5B2HA 4Z8SB 4IZXA 3WMVA 4GAFA 4YOLA 4LO2C 2GZBA 1S0CA 4KC3A 3AJ6A 1BA7A 1DIWA 1M16A 4ISRA 1IRAX 4II0A 3UD9A 2Y9FA 1ONKB 2VXTI 4J2KA 5BXTA 1HCEA 4I4VA 3IM7A 3UDAA 1PWAA 1KNMA 2D20A 4ENDA 2VLCA 1YYNA 4HA2A 3VT0A 3Q7YA 4G9MA 1V6UA 2QN4A 3OBRA 4FVVA 2VUAA 1IHKA 4EFPA 1HWMB 4OEGA 4ZFYB 2ESUA 5BVPI 2FGFA 5BP5A 4ZA3B 3WINA 3H6RB 1Z2VA 1AVAC 2NM1A 3FJJA 4ZBVB 2WBCA 3F62B 2M49A 2RQ9A 1MC9A 1TFMB 3O44A 3VWCA 5G00A 1S0BA 1OQLB 3CA4A 4I1BA 1YBIA 2Q3NB 3BA7A 4X3AA 3I29B 4HJJA 4I4PA 4JQ0A 1XYFA 3AKGA 1TOOA 4DENA 1ISVA 3E8LC 4I4RA 5DVHA 3FJAA 4DEPA 4I2SA 3PMEA 3N7KA 1K5UA 1TTUA 4Q9GA 2I1BA 1DLLA 4EEEB 1TWMA 2XOAA 2IWTB 4OW4A 5F90A 4AN7B 3NJ5A 1D0HA 4LO0C 3FJFA 5BXPA 4GAIA 5E24E 3A21A 3FJHA 4L4HA 1A8DA 8I1BA 1JTCA 4Q9PA 1I1EA 4F83A 3ZC8A 4OWLA 4J2YA 3HSMA 4J2XA 1XZZA 3SNVA 1V6XA 3OBTA 3NBCA 3R4SA 2FFUA 2J3PA 2VU9A 3A22A 1IRPA 1II4A 3OJMA 1G9AA 3ZXGA 1T4QA 4G6MA 4I7IA 2FDBM 1ILR1 1JT7A 3AZWA 4XKIA 1J0SA 3CA6A 5D61A 3T8SA 1AVXB 3AH1A 3QR5A 3UJ0A 1VCLA 5I1BA 3D7WB 2ZQOA 1PZZA 3MPPG 3LLPA 1EYLA 2NVHA 4I37A 2DS0A 3V0AA 1L2HA 2NZ9A 3PHZA 4P0JA 5BOWA 1V6VA 2D1ZA 4QD2B 3WO3A 4CJMA 4ZFWB 3O49A 2IHOA 2E4MA 5EC5A 1AVUA 1WD3A 3QYDA 3B9UA 41BIA 3IAGC 3WA1A 2KH2A 1FWVA 3JRRA 3CA3A 2KI4A 4GP0A 4I96A 1Q03A 3MALA 4X38A 3K1XA 1QXMA 3O3QA 1Q04A 4G6JA 3O4OA 1PUMB 3BAUA 4Q91A 3OGGA 2GO2A 1DZDA 3BRGC 3BA5A 4IY9A 4QBVA 4PC4A 2P23A 2D44A 4GOVA 1G9CA 3O4CA 3FJKA 3OGFA 1DJSB 3AH4A 3FJCA 4A7YA 1FQ9A 4AN6A 1GGPB 2F2FA 2FO1A 3UD8A 3V0BB 3FJBA 1N4KA 4LO8B 5BXRA 4J2SA 1ABRB 1P63A 2K43A 4JRAA 2AXMA 1JQZA 1XG6A 1JY0A 3N7LA 3BRDA 1ISZA 1CVSA 2DREA 5JMCA 1FMZA 1S0DA 3BTAA 1WD4A 3FUOA 5JLVA 1IT0A 3UD7A 1SZ6B 4R6UB 4X39A 2VSAA 5BP5C 1FGAA 2AAIB 2Y9WC 3WINC 3H6RA 1DQOA 4OWKA 1HWPB 5F8WA 4ISQA 3FFZA 5HPZA 31BIA
chains in the Genus database with same CATH superfamily
1NUNA 1TIEA 3P6IA 3RMXA 3BRFA 3BADA 3HALA 2ZR1B 1EV2A 2HW9A 1CE7B 1JT3A 4EKXB 5FZZA 1HWOB 3AJ5A 3FGMA 4I0YA 2ERMA 2MIBA 1QQKA 5FNXA 3POKA 3VUOA 4D8HA 2FFVA 1G9DA 5GAQA 7I1BA 2KKIA 4I4YA 4KBBA 1RZOB 1ISXA 4JP0A 4ZGRB 4QALA 2D22A 2F8XC 3OJ2A 3BAGA 1S0FA 1FMMS 1Z0HA 4I6IA 4EFQA 3NBNA 3CAHA 2D24A 3N0KA 4ZOTA 4KEJA 6I1BA 3FJEA 1RY7A 3N7MA 4L4IA 4QO3A 3C9ZA 4LO1A 4LO1C 4P0KA 4FGFA 1FN0A 3NBDA 5DSSB 3O4BA 1DFQA 1RG8A 4GOYA 4TLPA 3JUTA 3BB2A 1S0GA 3F1RA 2R9KB 2AFGA 3CA5A 3H6SE 4LO7B 2WRYA 4G9NA 1I1BA 2KI6B 3V79C 3IIRA 4QC4A 4IZEA 1R8NA 3WO2A 2RG9B 2BFHA 1YTOA 4EFRA 5DZUA 9ILBA 1UPSA 3IM5A 2UUSA 1AF9A 3BAQA 5BXSA 2BEAA 4I4XA 1WBCA 4MZFB 1ITBA 3A07A 4JKXB 1JLYA 2D43A 1DQGA 3VT1A 2QYIB 4I4QA 3VEQA 1EVTA 3VSFA 3O4AA 2E4MC 3CQAA 3RTJB 4D0ZA 2K8RA 3H6QA 1FWUA 3IM6A 1BFGA 3NBEA 2ET2A 1W3FA 5BQUA 4Z9WB 4A7ZA 3KMVA 2ZQNA 1JLXA 1FV2A 1T9FA 3AKIA 4H9WA 1HWNB 1SR4A 1SR4C 3I2XA 3BX1C 4OEEA 2DRZA 4JPZA 1IOBA 2D23A 3ILAA 1IILA 2K4AB 4P6AA 1AXMA 4EB2B 4JAWA 2F2FC 4QBCA 1Q1UA 2Q9XA 3V0BA 4D0TA 4KEIA 4LO2A 4J23B 3BA4A 4OUJA 3A23A 2HWMA 3R4UA 4I1EA 2BEBA 1F31A 1PUUB 1BFBA 5FZUA 3FUQA 1EPWA 4WBCA 2AQZA 2L5XA 2X2TA 4IHZA 4F34A 1W3AA 5FNWA 3Q7WA 4KEKA 2Z48A 1QQLA 1BARA 3CRHA 1BASA 3BAHA 1FV3A 4IQPA 1AVWB 4I8MA 5DUYA 1R8OA 3OJVA 4I4UA 2Y9GA 1NZKA 2HWAA 4HR6C 4ZLBB 5D63A 1BLDA 1DFCA 4XFSA 1YXWA 1V6WA 1BLAA 2YUGA 1IJTA 1W3GA 1TP0A 3PG0A 3PUBA 1G9BA 5FZYA 4ZFUB 3UJ4A 2LIEA 1K5VA 2NYYA 4XFUA 3O4DA 1ISWA 1ISYA 3HN1A 5F8SA 3ZX7A 3S8JA 2X2SA 4GP3A 3HOMA 3RTIB 3CA1A 3AZVA 4IONA 4I4SA 4IYBA 1WBAA 2KLLA 3W9TA 2D7IA 2VXRA 4LO3A 4A7KA 1BFCA 2MLLB 4LO3C 3ZXDA 1BFFA 3BAVA 2NP0A 1DZCA 3S8KA 4X37A 3FJ9A 3VT2A 4IY8A 3TC2A 2DRYA 4XFTA 1AFCA 4QKRA 3HBWA 3CU1B 4LO0A 4G1RA 3CRGA 3FJ8A 2LIQA 4USOA 4JKQA 3N7JA 3EF2A 4LO7C 3RMYA 4H04A 1MD6A 3FJDA 1HCDA 5EG6C 3HMYA 3FJIA 1G82A 1PC8B 4P0LA 3RSJA 3WO4A 2P39A 4DCKC 4ZKTB 2D7RA 1Z4SA 5EHAA 3Q7XA 2MC2A 2RSTA 5F8YA 1S0EA 1TWEA 1XHBA 1YF8B 3P53A 4I4OA 2HZ9A 4H75A 1JT5A 3I2AA 4OWJA 3LTQA 3P6JA 4MZHA 4QD2C 3AH2A 4I3NA 3CA0A 3BAOA 3AKFA 1HKNA 1JT4A 3WMUA 2VSEA 2NTDA 3CRIA 5BQUC 3V0AB 3O5WB 21BIA 1S0LA 4USPA 1M2TB 3AKHA 3VSZA 1RMLA 5D62A 2Z49A 1HIBA 1E0OA 2Y9XE 4OEFA 3ZC9A 4QKSA 5B2HA 4Z8SB 4IZXA 3WMVA 4GAFA 4YOLA 4LO2C 2GZBA 1S0CA 4KC3A 3AJ6A 1BA7A 1DIWA 1M16A 4ISRA 1IRAX 4II0A 3UD9A 2Y9FA 1ONKB 2VXTI 4J2KA 5BXTA 1HCEA 4I4VA 3IM7A 3UDAA 1PWAA 1KNMA 2D20A 4ENDA 2VLCA 1YYNA 4HA2A 3VT0A 3Q7YA 4G9MA 1V6UA 2QN4A 4MZGB 3OBRA 4FVVA 2VUAA 1IHKA 4EFPA 1HWMB 4OEGA 4ZFYB 2ESUA 5BVPI 2FGFA 5BP5A 4ZA3B 3WINA 3H6RB 1Z2VA 1AVAC 2NM1A 3FJJA 4ZBVB 2WBCA 3F62B 2M49A 2RQ9A 1MC9A 1TFMB 3O44A 3VWCA 5G00A 1S0BA 1OQLB 3CA4A 4I1BA 1YBIA 2Q3NB 3BA7A 4X3AA 3I29B 4HJJA 4I4PA 4JQ0A 1XYFA 3AKGA 1TOOA 4DENA 1ISVA 3E8LC 4I4RA 5DVHA 3FJAA 4DEPA 4I2SA 3PMEA 3N7KA 1K5UA 1TTUA 4Q9GA 2I1BA 1DLLA 4EEEB 1TWMA 2XOAA 2IWTB 4OW4A 5F90A 4AN7B 3NJ5A 1D0HA 4LO0C 3FJFA 5BXPA 4GAIA 5E24E 3A21A 3FJHA 4L4HA 1A8DA 8I1BA 1JTCA 4Q9PA 1I1EA 4F83A 3ZC8A 4OWLA 4J2YA 3HSMA 4J2XA 1XZZA 3SNVA 1V6XA 3OBTA 3NBCA 3R4SA 2FFUA 2J3PA 2VU9A 3A22A 1IRPA 1II4A 3OJMA 1G9AA 3ZXGA 1T4QA 4G6MA 4I7IA 2FDBM 1ILR1 1JT7A 3AZWA 4XKIA 1J0SA 3CA6A 5D61A 3T8SA 1AVXB 3AH1A 3QR5A 3UJ0A 1VCLA 5I1BA 3D7WB 2ZQOA 1PZZA 3MPPG 3LLPA 1EYLA 2NVHA 4I37A 2DS0A 3V0AA 1L2HA 2NZ9A 3PHZA 4P0JA 5BOWA 1V6VA 2D1ZA 4QD2B 3WO3A 4CJMA 4ZFWB 3O49A 2IHOA 2E4MA 5EC5A 1AVUA 1WD3A 3QYDA 3B9UA 41BIA 3IAGC 3WA1A 2KH2A 1FWVA 3JRRA 3CA3A 2KI4A 4GP0A 4I96A 1Q03A 3MALA 4X38A 3K1XA 1QXMA 3O3QA 1Q04A 4G6JA 3O4OA 1PUMB 3BAUA 4Q91A 3OGGA 2GO2A 1DZDA 3BRGC 3BA5A 2NS2A 4IY9A 4QBVA 4PC4A 2P23A 2D44A 4GOVA 1G9CA 3O4CA 3FJKA 3OGFA 1DJSB 3AH4A 3FJCA 4A7YA 1FQ9A 4AN6A 1GGPB 2F2FA 2FO1A 3UD8A 3V0BB 3FJBA 1N4KA 4LO8B 5BXRA 4J2SA 1ABRB 1P63A 2K43A 4JRAA 4UY4A 2AXMA 1JQZA 1XG6A 1JY0A 3N7LA 3BRDA 1ISZA 1CVSA 2DREA 5JMCA 1FMZA 1S0DA 3BTAA 1WD4A 3FUOA 5JLVA 1IT0A 3UD7A 1SZ6B 4R6UB 4X39A 2VSAA 5BP5C 1FGAA 2AAIB 2Y9WC 3WINC 3H6RA 1DQOA 4OWKA 1HWPB 5F8WA 4ISQA 3FFZA 5HPZA 31BIA
chains in the Genus database with same CATH topology
1NUNA 1TIEA 3P6IA 3RMXA 3BRFA 3BADA 3HALA 2ZR1B 1EV2A 2HW9A 1CE7B 1JT3A 4EKXB 5FZZA 1HWOB 3AJ5A 3FGMA 4I0YA 2ERMA 2MIBA 1QQKA 5FNXA 3POKA 3VUOA 4D8HA 2FFVA 1G9DA 5GAQA 7I1BA 2KKIA 4I4YA 4KBBA 1RZOB 1ISXA 4JP0A 4ZGRB 4QALA 2D22A 2F8XC 3OJ2A 3BAGA 1S0FA 1FMMS 1Z0HA 4I6IA 4EFQA 3NBNA 3CAHA 2D24A 3N0KA 4ZOTA 4KEJA 6I1BA 3FJEA 1RY7A 3N7MA 4L4IA 4QO3A 3C9ZA 4LO1A 4LO1C 4P0KA 4FGFA 1FN0A 3NBDA 5DSSB 3O4BA 1DFQA 1RG8A 4GOYA 4TLPA 3JUTA 3BB2A 1S0GA 3F1RA 2R9KB 2AFGA 3CA5A 3H6SE 4LO7B 2WRYA 4G9NA 1I1BA 2KI6B 3V79C 3IIRA 4QC4A 4IZEA 1R8NA 3WO2A 2RG9B 2BFHA 1YTOA 4EFRA 5DZUA 9ILBA 1UPSA 3IM5A 2UUSA 1AF9A 3BAQA 5BXSA 2BEAA 4I4XA 1WBCA 4MZFB 1ITBA 3A07A 4JKXB 1JLYA 2D43A 1DQGA 3VT1A 2QYIB 4I4QA 3VEQA 1EVTA 3VSFA 3O4AA 2E4MC 3CQAA 3RTJB 4D0ZA 2K8RA 3H6QA 1FWUA 3IM6A 1BFGA 3NBEA 2ET2A 1W3FA 5BQUA 4Z9WB 4A7ZA 3KMVA 2ZQNA 1JLXA 1FV2A 1T9FA 3AKIA 4H9WA 1HWNB 1SR4A 1SR4C 3I2XA 3BX1C 4OEEA 2DRZA 4JPZA 1IOBA 2D23A 3ILAA 1IILA 2K4AB 4P6AA 1AXMA 4EB2B 4JAWA 2F2FC 4QBCA 1Q1UA 2Q9XA 3V0BA 4D0TA 4KEIA 4LO2A 4J23B 3BA4A 4OUJA 3A23A 2HWMA 3R4UA 4I1EA 2BEBA 1F31A 1PUUB 1BFBA 5FZUA 3FUQA 1EPWA 4WBCA 2AQZA 2L5XA 2X2TA 4IHZA 4F34A 1W3AA 5FNWA 3Q7WA 4KEKA 2Z48A 1QQLA 1BARA 3CRHA 1BASA 3BAHA 1FV3A 4IQPA 1AVWB 4I8MA 5DUYA 1R8OA 3OJVA 4I4UA 2Y9GA 1NZKA 2HWAA 4HR6C 4ZLBB 5D63A 1BLDA 1DFCA 4XFSA 1YXWA 1V6WA 1BLAA 2YUGA 1IJTA 1W3GA 1TP0A 3PG0A 3PUBA 1G9BA 5FZYA 4ZFUB 3UJ4A 2LIEA 1K5VA 2NYYA 4XFUA 3O4DA 1ISWA 1ISYA 3HN1A 5F8SA 3ZX7A 3S8JA 2X2SA 4GP3A 3HOMA 3RTIB 3CA1A 3AZVA 4IONA 4I4SA 4IYBA 1WBAA 2KLLA 3W9TA 2D7IA 2VXRA 4LO3A 4A7KA 1BFCA 2MLLB 4LO3C 3ZXDA 1BFFA 3BAVA 2NP0A 1DZCA 3S8KA 4X37A 3FJ9A 3VT2A 4IY8A 3TC2A 2DRYA 4XFTA 1AFCA 4QKRA 3HBWA 3CU1B 4LO0A 4G1RA 3CRGA 3FJ8A 2LIQA 4USOA 4JKQA 3N7JA 3EF2A 4LO7C 3RMYA 4H04A 1MD6A 3FJDA 1HCDA 5EG6C 3HMYA 3FJIA 1G82A 1PC8B 4P0LA 3RSJA 3WO4A 2P39A 4DCKC 4ZKTB 2D7RA 1Z4SA 5EHAA 3Q7XA 2MC2A 2RSTA 5F8YA 1S0EA 1TWEA 1XHBA 1YF8B 3P53A 4I4OA 2HZ9A 4H75A 1JT5A 3I2AA 4OWJA 3LTQA 3P6JA 4MZHA 4QD2C 3AH2A 4I3NA 3CA0A 3BAOA 3AKFA 1HKNA 1JT4A 3WMUA 2VSEA 2NTDA 3CRIA 5BQUC 3V0AB 3O5WB 21BIA 1S0LA 4USPA 1M2TB 3AKHA 3VSZA 1RMLA 5D62A 2Z49A 1HIBA 1E0OA 2Y9XE 4OEFA 3ZC9A 4QKSA 5B2HA 4Z8SB 4IZXA 3WMVA 4GAFA 4YOLA 4LO2C 2GZBA 1S0CA 4KC3A 3AJ6A 1BA7A 1DIWA 1M16A 4ISRA 1IRAX 4II0A 3UD9A 2Y9FA 1ONKB 2VXTI 4J2KA 5BXTA 1HCEA 4I4VA 3IM7A 3UDAA 1PWAA 1KNMA 2D20A 4ENDA 2VLCA 1YYNA 4HA2A 3VT0A 3Q7YA 4G9MA 1V6UA 2QN4A 4MZGB 3OBRA 4FVVA 2VUAA 1IHKA 4EFPA 1HWMB 4OEGA 4ZFYB 2ESUA 5BVPI 2FGFA 5BP5A 4ZA3B 3WINA 3H6RB 1Z2VA 1AVAC 2NM1A 3FJJA 4ZBVB 2WBCA 3F62B 2M49A 2RQ9A 1MC9A 1TFMB 3O44A 3VWCA 5G00A 1S0BA 1OQLB 3CA4A 4I1BA 1YBIA 2Q3NB 3BA7A 4X3AA 3I29B 4HJJA 4I4PA 4JQ0A 1XYFA 3AKGA 1TOOA 4DENA 1ISVA 3E8LC 4I4RA 5DVHA 3FJAA 4DEPA 4I2SA 3PMEA 3N7KA 1K5UA 1TTUA 4Q9GA 2I1BA 1DLLA 4EEEB 1TWMA 2XOAA 2IWTB 4OW4A 5F90A 4AN7B 3NJ5A 1D0HA 4LO0C 3FJFA 5BXPA 4GAIA 5E24E 3A21A 3FJHA 4L4HA 1A8DA 8I1BA 1JTCA 4Q9PA 1I1EA 4F83A 3ZC8A 4OWLA 4J2YA 3HSMA 4J2XA 1XZZA 3SNVA 1V6XA 3OBTA 3NBCA 3R4SA 2FFUA 2J3PA 2VU9A 3A22A 1IRPA 1II4A 3OJMA 1G9AA 3ZXGA 1T4QA 4G6MA 4I7IA 2FDBM 1ILR1 1JT7A 3AZWA 4XKIA 1J0SA 3CA6A 5D61A 3T8SA 1AVXB 3AH1A 3QR5A 3UJ0A 1VCLA 5I1BA 3D7WB 2ZQOA 1PZZA 3MPPG 3LLPA 1EYLA 2NVHA 4I37A 2DS0A 3V0AA 1L2HA 2NZ9A 3PHZA 4P0JA 5BOWA 1V6VA 2D1ZA 4QD2B 3WO3A 4CJMA 4ZFWB 3O49A 2IHOA 2E4MA 5EC5A 1AVUA 1WD3A 3QYDA 3B9UA 41BIA 3IAGC 3WA1A 2KH2A 1FWVA 3JRRA 3CA3A 2KI4A 4GP0A 4I96A 1Q03A 3MALA 4X38A 3K1XA 1QXMA 3O3QA 1Q04A 4G6JA 3O4OA 1PUMB 3BAUA 4Q91A 3OGGA 2GO2A 1DZDA 3BRGC 3BA5A 2NS2A 4IY9A 4QBVA 4PC4A 2P23A 2D44A 4GOVA 1G9CA 3O4CA 3FJKA 3OGFA 1DJSB 3AH4A 3FJCA 4A7YA 1FQ9A 4AN6A 1GGPB 2F2FA 2FO1A 3UD8A 3V0BB 3FJBA 1N4KA 4LO8B 5BXRA 4J2SA 1ABRB 1P63A 2K43A 4JRAA 4UY4A 2AXMA 1JQZA 1XG6A 1JY0A 3N7LA 3BRDA 1ISZA 1CVSA 2DREA 5JMCA 1FMZA 1S0DA 3BTAA 1WD4A 3FUOA 5JLVA 1IT0A 3UD7A 1SZ6B 4R6UB 4X39A 2VSAA 5BP5C 1FGAA 2AAIB 2Y9WC 3WINC 3H6RA 1DQOA 4OWKA 1HWPB 5F8WA 4ISQA 3FFZA 5HPZA 31BIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NUN A;  1TIE A;  3P6I A;  3RMX A;  3BRF A;  3BAD A;  3HAL A;  2ZR1 B;  1EV2 A;  2HW9 A;  1CE7 B;  1JT3 A;  4EKX B;  5FZZ A;  1HWO B;  3AJ5 A;  3FGM A;  4I0Y A;  2ERM A;  2MIB A;  1QQK A;  5FNX A;  3POK A;  3VUO A;  4D8H A;  2FFV A;  1G9D A;  5GAQ A;  7I1B A;  2KKI A;  4I4Y A;  4KBB A;  1RZO B;  1ISX A;  4JP0 A;  4ZGR B;  4QAL A;  2D22 A;  2F8X C;  3OJ2 A;  3BAG A;  1S0F A;  1FMM S;  1Z0H A;  4I6I A;  4EFQ A;  3NBN A;  3CAH A;  2D24 A;  3N0K A;  4ZOT A;  4KEJ A;  6I1B A;  3FJE A;  1RY7 A;  3N7M A;  4L4I A;  4QO3 A;  3C9Z A;  4LO1 A;  4LO1 C;  4P0K A;  4FGF A;  1FN0 A;  3NBD A;  5DSS B;  3O4B A;  1DFQ A;  1RG8 A;  4GOY A;  4TLP A;  3JUT A;  3BB2 A;  1S0G A;  3F1R A;  2R9K B;  2AFG A;  3CA5 A;  3H6S E;  4LO7 B;  2WRY A;  4G9N A;  1I1B A;  2KI6 B;  3V79 C;  3IIR A;  4QC4 A;  4IZE A;  1R8N A;  3WO2 A;  2RG9 B;  2BFH A;  1YTO A;  4EFR A;  5DZU A;  9ILB A;  1UPS A;  3IM5 A;  2UUS A;  1AF9 A;  3BAQ A;  5BXS A;  2BEA A;  4I4X A;  1WBC A;  1ITB A;  3A07 A;  4JKX B;  1JLY A;  2D43 A;  1DQG A;  3VT1 A;  2QYI B;  4I4Q A;  3VEQ A;  1EVT A;  3VSF A;  3O4A A;  2E4M C;  3CQA A;  3RTJ B;  4D0Z A;  2K8R A;  3H6Q A;  1FWU A;  3IM6 A;  1BFG A;  3NBE A;  2ET2 A;  1W3F A;  5BQU A;  4Z9W B;  4A7Z A;  3KMV A;  2ZQN A;  1JLX A;  1FV2 A;  1T9F A;  3AKI A;  4H9W A;  1HWN B;  1SR4 A;  1SR4 C;  3I2X A;  3BX1 C;  4OEE A;  2DRZ A;  4JPZ A;  1IOB A;  2D23 A;  3ILA A;  1IIL A;  2K4A B;  4P6A A;  1AXM A;  4EB2 B;  4JAW A;  2F2F C;  4QBC A;  1Q1U A;  2Q9X A;  3V0B A;  4D0T A;  4KEI A;  4LO2 A;  4J23 B;  3BA4 A;  4OUJ A;  3A23 A;  2HWM A;  3R4U A;  4I1E A;  2BEB A;  1F31 A;  1PUU B;  1BFB A;  5FZU A;  3FUQ A;  1EPW A;  4WBC A;  2AQZ A;  2L5X A;  2X2T A;  4IHZ A;  4F34 A;  1W3A A;  5FNW A;  3Q7W A;  4KEK A;  2Z48 A;  1QQL A;  1BAR A;  3CRH A;  1BAS A;  3BAH A;  1FV3 A;  4IQP A;  1AVW B;  4I8M A;  5DUY A;  1R8O A;  3OJV A;  4I4U A;  2Y9G A;  1NZK A;  2HWA A;  4HR6 C;  4ZLB B;  5D63 A;  1BLD A;  1DFC A;  4XFS A;  1YXW A;  1V6W A;  1BLA A;  2YUG A;  1IJT A;  1W3G A;  1TP0 A;  3PG0 A;  3PUB A;  1G9B A;  5FZY A;  4ZFU B;  3UJ4 A;  2LIE A;  1K5V A;  2NYY A;  4XFU A;  3O4D A;  1ISW A;  1ISY A;  3HN1 A;  5F8S A;  3ZX7 A;  3S8J A;  2X2S A;  4GP3 A;  3HOM A;  3RTI B;  3CA1 A;  3AZV A;  4ION A;  4I4S A;  4IYB A;  1WBA A;  2KLL A;  3W9T A;  2D7I A;  2VXR A;  4LO3 A;  4A7K A;  1BFC A;  2MLL B;  4LO3 C;  3ZXD A;  1BFF A;  3BAV A;  2NP0 A;  1DZC A;  3S8K A;  4X37 A;  3FJ9 A;  3VT2 A;  4IY8 A;  3TC2 A;  2DRY A;  4XFT A;  1AFC A;  4QKR A;  3HBW A;  3CU1 B;  4LO0 A;  4G1R A;  3CRG A;  3FJ8 A;  2LIQ A;  4USO A;  4JKQ A;  3N7J A;  3EF2 A;  4LO7 C;  3RMY A;  4H04 A;  1MD6 A;  3FJD A;  1HCD A;  5EG6 C;  3HMY A;  3FJI A;  1G82 A;  1PC8 B;  4P0L A;  3RSJ A;  3WO4 A;  2P39 A;  4DCK C;  4ZKT B;  2D7R A;  1Z4S A;  5EHA A;  3Q7X A;  2MC2 A;  2RST A;  5F8Y A;  1S0E A;  1TWE A;  1XHB A;  1YF8 B;  3P53 A;  4I4O A;  2HZ9 A;  1JT5 A;  3I2A A;  4OWJ A;  3LTQ A;  3P6J A;  4QD2 C;  3AH2 A;  4I3N A;  3CA0 A;  3BAO A;  3AKF A;  1HKN A;  1JT4 A;  3WMU A;  2VSE A;  2NTD A;  3CRI A;  5BQU C;  3V0A B;  3O5W B;  21BI A;  1S0L A;  4USP A;  1M2T B;  3AKH A;  3VSZ A;  1RML A;  5D62 A;  2Z49 A;  1HIB A;  1E0O A;  2Y9X E;  4OEF A;  3ZC9 A;  4QKS A;  5B2H A;  4Z8S B;  4IZX A;  3WMV A;  4GAF A;  4YOL A;  4LO2 C;  2GZB A;  1S0C A;  4KC3 A;  3AJ6 A;  1BA7 A;  1DIW A;  1M16 A;  4ISR A;  1IRA X;  4II0 A;  3UD9 A;  2Y9F A;  1ONK B;  2VXT I;  4J2K A;  5BXT A;  1HCE A;  4I4V A;  3IM7 A;  3UDA A;  1PWA A;  1KNM A;  2D20 A;  4END A;  2VLC A;  1YYN A;  4HA2 A;  3VT0 A;  3Q7Y A;  4G9M A;  1V6U A;  2QN4 A;  3OBR A;  4FVV A;  2VUA A;  1IHK A;  4EFP A;  1HWM B;  4OEG A;  4ZFY B;  2ESU A;  5BVP I;  2FGF A;  5BP5 A;  4ZA3 B;  3WIN A;  3H6R B;  1Z2V A;  1AVA C;  2NM1 A;  3FJJ A;  4ZBV B;  2WBC A;  3F62 B;  2M49 A;  2RQ9 A;  1MC9 A;  1TFM B;  3O44 A;  3VWC A;  5G00 A;  1S0B A;  1OQL B;  3CA4 A;  4I1B A;  1YBI A;  2Q3N B;  3BA7 A;  4X3A A;  3I29 B;  4HJJ A;  4I4P A;  4JQ0 A;  1XYF A;  3AKG A;  1TOO A;  4DEN A;  1ISV A;  3E8L C;  4I4R A;  5DVH A;  3FJA A;  4DEP A;  4I2S A;  3PME A;  3N7K A;  1K5U A;  1TTU A;  4Q9G A;  2I1B A;  1DLL A;  4EEE B;  1TWM A;  2XOA A;  2IWT B;  4OW4 A;  5F90 A;  4AN7 B;  3NJ5 A;  1D0H A;  4LO0 C;  3FJF A;  5BXP A;  4GAI A;  5E24 E;  3A21 A;  3FJH A;  4L4H A;  1A8D A;  8I1B A;  1JTC A;  4Q9P A;  1I1E A;  4F83 A;  3ZC8 A;  4OWL A;  4J2Y A;  3HSM A;  4J2X A;  1XZZ A;  3SNV A;  1V6X A;  3OBT A;  3NBC A;  3R4S A;  2FFU A;  2J3P A;  2VU9 A;  3A22 A;  1IRP A;  1II4 A;  3OJM A;  1G9A A;  3ZXG A;  1T4Q A;  4G6M A;  4I7I A;  2FDB M;  1ILR 1;  1JT7 A;  3AZW A;  4XKI A;  1J0S A;  3CA6 A;  5D61 A;  3T8S A;  1AVX B;  3AH1 A;  3QR5 A;  3UJ0 A;  1VCL A;  5I1B A;  3D7W B;  2ZQO A;  1PZZ A;  3MPP G;  3LLP A;  1EYL A;  2NVH A;  4I37 A;  2DS0 A;  3V0A A;  1L2H A;  2NZ9 A;  3PHZ A;  4P0J A;  5BOW A;  1V6V A;  2D1Z A;  4QD2 B;  3WO3 A;  4CJM A;  4ZFW B;  3O49 A;  2IHO A;  2E4M A;  5EC5 A;  1AVU A;  1WD3 A;  3QYD A;  3B9U A;  41BI A;  3IAG C;  3WA1 A;  2KH2 A;  1FWV A;  3JRR A;  3CA3 A;  2KI4 A;  4GP0 A;  4I96 A;  1Q03 A;  3MAL A;  4X38 A;  3K1X A;  1QXM A;  3O3Q A;  1Q04 A;  4G6J A;  3O4O A;  1PUM B;  3BAU A;  4Q91 A;  3OGG A;  2GO2 A;  1DZD A;  3BRG C;  3BA5 A;  4IY9 A;  4QBV A;  4PC4 A;  2P23 A;  2D44 A;  4GOV A;  1G9C A;  3O4C A;  3FJK A;  3OGF A;  1DJS B;  3AH4 A;  3FJC A;  4A7Y A;  1FQ9 A;  4AN6 A;  1GGP B;  2F2F A;  2FO1 A;  3UD8 A;  3V0B B;  3FJB A;  1N4K A;  4LO8 B;  5BXR A;  4J2S A;  1ABR B;  1P63 A;  2K43 A;  4JRA A;  2AXM A;  1JQZ A;  1XG6 A;  1JY0 A;  3N7L A;  3BRD A;  1ISZ A;  1CVS A;  2DRE A;  5JMC A;  1FMZ A;  1S0D A;  3BTA A;  1WD4 A;  3FUO A;  5JLV A;  1IT0 A;  3UD7 A;  1SZ6 B;  4R6U B;  4X39 A;  2VSA A;  5BP5 C;  1FGA A;  2AAI B;  2Y9W C;  3WIN C;  3H6R A;  1DQO A;  4OWK A;  1HWP B;  5F8W A;  4ISQ A;  3FFZ A;  5HPZ A;  31BI A; 
#chains in the Genus database with same CATH topology
 1NUN A;  1TIE A;  3P6I A;  3RMX A;  3BRF A;  3BAD A;  3HAL A;  2ZR1 B;  1EV2 A;  2HW9 A;  1CE7 B;  1JT3 A;  4EKX B;  5FZZ A;  1HWO B;  3AJ5 A;  3FGM A;  4I0Y A;  2ERM A;  2MIB A;  1QQK A;  5FNX A;  3POK A;  3VUO A;  4D8H A;  2FFV A;  1G9D A;  5GAQ A;  7I1B A;  2KKI A;  4I4Y A;  4KBB A;  1RZO B;  1ISX A;  4JP0 A;  4ZGR B;  4QAL A;  2D22 A;  2F8X C;  3OJ2 A;  3BAG A;  1S0F A;  1FMM S;  1Z0H A;  4I6I A;  4EFQ A;  3NBN A;  3CAH A;  2D24 A;  3N0K A;  4ZOT A;  4KEJ A;  6I1B A;  3FJE A;  1RY7 A;  3N7M A;  4L4I A;  4QO3 A;  3C9Z A;  4LO1 A;  4LO1 C;  4P0K A;  4FGF A;  1FN0 A;  3NBD A;  5DSS B;  3O4B A;  1DFQ A;  1RG8 A;  4GOY A;  4TLP A;  3JUT A;  3BB2 A;  1S0G A;  3F1R A;  2R9K B;  2AFG A;  3CA5 A;  3H6S E;  4LO7 B;  2WRY A;  4G9N A;  1I1B A;  2KI6 B;  3V79 C;  3IIR A;  4QC4 A;  4IZE A;  1R8N A;  3WO2 A;  2RG9 B;  2BFH A;  1YTO A;  4EFR A;  5DZU A;  9ILB A;  1UPS A;  3IM5 A;  2UUS A;  1AF9 A;  3BAQ A;  5BXS A;  2BEA A;  4I4X A;  1WBC A;  4MZF B;  1ITB A;  3A07 A;  4JKX B;  1JLY A;  2D43 A;  1DQG A;  3VT1 A;  2QYI B;  4I4Q A;  3VEQ A;  1EVT A;  3VSF A;  3O4A A;  2E4M C;  3CQA A;  3RTJ B;  4D0Z A;  2K8R A;  3H6Q A;  1FWU A;  3IM6 A;  1BFG A;  3NBE A;  2ET2 A;  1W3F A;  5BQU A;  4Z9W B;  4A7Z A;  3KMV A;  2ZQN A;  1JLX A;  1FV2 A;  1T9F A;  3AKI A;  4H9W A;  1HWN B;  1SR4 A;  1SR4 C;  3I2X A;  3BX1 C;  4OEE A;  2DRZ A;  4JPZ A;  1IOB A;  2D23 A;  3ILA A;  1IIL A;  2K4A B;  4P6A A;  1AXM A;  4EB2 B;  4JAW A;  2F2F C;  4QBC A;  1Q1U A;  2Q9X A;  3V0B A;  4D0T A;  4KEI A;  4LO2 A;  4J23 B;  3BA4 A;  4OUJ A;  3A23 A;  2HWM A;  3R4U A;  4I1E A;  2BEB A;  1F31 A;  1PUU B;  1BFB A;  5FZU A;  3FUQ A;  1EPW A;  4WBC A;  2AQZ A;  2L5X A;  2X2T A;  4IHZ A;  4F34 A;  1W3A A;  5FNW A;  3Q7W A;  4KEK A;  2Z48 A;  1QQL A;  1BAR A;  3CRH A;  1BAS A;  3BAH A;  1FV3 A;  4IQP A;  1AVW B;  4I8M A;  5DUY A;  1R8O A;  3OJV A;  4I4U A;  2Y9G A;  1NZK A;  2HWA A;  4HR6 C;  4ZLB B;  5D63 A;  1BLD A;  1DFC A;  4XFS A;  1YXW A;  1V6W A;  1BLA A;  2YUG A;  1IJT A;  1W3G A;  1TP0 A;  3PG0 A;  3PUB A;  1G9B A;  5FZY A;  4ZFU B;  3UJ4 A;  2LIE A;  1K5V A;  2NYY A;  4XFU A;  3O4D A;  1ISW A;  1ISY A;  3HN1 A;  5F8S A;  3ZX7 A;  3S8J A;  2X2S A;  4GP3 A;  3HOM A;  3RTI B;  3CA1 A;  3AZV A;  4ION A;  4I4S A;  4IYB A;  1WBA A;  2KLL A;  3W9T A;  2D7I A;  2VXR A;  4LO3 A;  4A7K A;  1BFC A;  2MLL B;  4LO3 C;  3ZXD A;  1BFF A;  3BAV A;  2NP0 A;  1DZC A;  3S8K A;  4X37 A;  3FJ9 A;  3VT2 A;  4IY8 A;  3TC2 A;  2DRY A;  4XFT A;  1AFC A;  4QKR A;  3HBW A;  3CU1 B;  4LO0 A;  4G1R A;  3CRG A;  3FJ8 A;  2LIQ A;  4USO A;  4JKQ A;  3N7J A;  3EF2 A;  4LO7 C;  3RMY A;  4H04 A;  1MD6 A;  3FJD A;  1HCD A;  5EG6 C;  3HMY A;  3FJI A;  1G82 A;  1PC8 B;  4P0L A;  3RSJ A;  3WO4 A;  2P39 A;  4DCK C;  4ZKT B;  2D7R A;  1Z4S A;  5EHA A;  3Q7X A;  2MC2 A;  2RST A;  5F8Y A;  1S0E A;  1TWE A;  1XHB A;  1YF8 B;  3P53 A;  4I4O A;  2HZ9 A;  4H75 A;  1JT5 A;  3I2A A;  4OWJ A;  3LTQ A;  3P6J A;  4MZH A;  4QD2 C;  3AH2 A;  4I3N A;  3CA0 A;  3BAO A;  3AKF A;  1HKN A;  1JT4 A;  3WMU A;  2VSE A;  2NTD A;  3CRI A;  5BQU C;  3V0A B;  3O5W B;  21BI A;  1S0L A;  4USP A;  1M2T B;  3AKH A;  3VSZ A;  1RML A;  5D62 A;  2Z49 A;  1HIB A;  1E0O A;  2Y9X E;  4OEF A;  3ZC9 A;  4QKS A;  5B2H A;  4Z8S B;  4IZX A;  3WMV A;  4GAF A;  4YOL A;  4LO2 C;  2GZB A;  1S0C A;  4KC3 A;  3AJ6 A;  1BA7 A;  1DIW A;  1M16 A;  4ISR A;  1IRA X;  4II0 A;  3UD9 A;  2Y9F A;  1ONK B;  2VXT I;  4J2K A;  5BXT A;  1HCE A;  4I4V A;  3IM7 A;  3UDA A;  1PWA A;  1KNM A;  2D20 A;  4END A;  2VLC A;  1YYN A;  4HA2 A;  3VT0 A;  3Q7Y A;  4G9M A;  1V6U A;  2QN4 A;  4MZG B;  3OBR A;  4FVV A;  2VUA A;  1IHK A;  4EFP A;  1HWM B;  4OEG A;  4ZFY B;  2ESU A;  5BVP I;  2FGF A;  5BP5 A;  4ZA3 B;  3WIN A;  3H6R B;  1Z2V A;  1AVA C;  2NM1 A;  3FJJ A;  4ZBV B;  2WBC A;  3F62 B;  2M49 A;  2RQ9 A;  1MC9 A;  1TFM B;  3O44 A;  3VWC A;  5G00 A;  1S0B A;  1OQL B;  3CA4 A;  4I1B A;  1YBI A;  2Q3N B;  3BA7 A;  4X3A A;  3I29 B;  4HJJ A;  4I4P A;  4JQ0 A;  1XYF A;  3AKG A;  1TOO A;  4DEN A;  1ISV A;  3E8L C;  4I4R A;  5DVH A;  3FJA A;  4DEP A;  4I2S A;  3PME A;  3N7K A;  1K5U A;  1TTU A;  4Q9G A;  2I1B A;  1DLL A;  4EEE B;  1TWM A;  2XOA A;  2IWT B;  4OW4 A;  5F90 A;  4AN7 B;  3NJ5 A;  1D0H A;  4LO0 C;  3FJF A;  5BXP A;  4GAI A;  5E24 E;  3A21 A;  3FJH A;  4L4H A;  1A8D A;  8I1B A;  1JTC A;  4Q9P A;  1I1E A;  4F83 A;  3ZC8 A;  4OWL A;  4J2Y A;  3HSM A;  4J2X A;  1XZZ A;  3SNV A;  1V6X A;  3OBT A;  3NBC A;  3R4S A;  2FFU A;  2J3P A;  2VU9 A;  3A22 A;  1IRP A;  1II4 A;  3OJM A;  1G9A A;  3ZXG A;  1T4Q A;  4G6M A;  4I7I A;  2FDB M;  1ILR 1;  1JT7 A;  3AZW A;  4XKI A;  1J0S A;  3CA6 A;  5D61 A;  3T8S A;  1AVX B;  3AH1 A;  3QR5 A;  3UJ0 A;  1VCL A;  5I1B A;  3D7W B;  2ZQO A;  1PZZ A;  3MPP G;  3LLP A;  1EYL A;  2NVH A;  4I37 A;  2DS0 A;  3V0A A;  1L2H A;  2NZ9 A;  3PHZ A;  4P0J A;  5BOW A;  1V6V A;  2D1Z A;  4QD2 B;  3WO3 A;  4CJM A;  4ZFW B;  3O49 A;  2IHO A;  2E4M A;  5EC5 A;  1AVU A;  1WD3 A;  3QYD A;  3B9U A;  41BI A;  3IAG C;  3WA1 A;  2KH2 A;  1FWV A;  3JRR A;  3CA3 A;  2KI4 A;  4GP0 A;  4I96 A;  1Q03 A;  3MAL A;  4X38 A;  3K1X A;  1QXM A;  3O3Q A;  1Q04 A;  4G6J A;  3O4O A;  1PUM B;  3BAU A;  4Q91 A;  3OGG A;  2GO2 A;  1DZD A;  3BRG C;  3BA5 A;  2NS2 A;  4IY9 A;  4QBV A;  4PC4 A;  2P23 A;  2D44 A;  4GOV A;  1G9C A;  3O4C A;  3FJK A;  3OGF A;  1DJS B;  3AH4 A;  3FJC A;  4A7Y A;  1FQ9 A;  4AN6 A;  1GGP B;  2F2F A;  2FO1 A;  3UD8 A;  3V0B B;  3FJB A;  1N4K A;  4LO8 B;  5BXR A;  4J2S A;  1ABR B;  1P63 A;  2K43 A;  4JRA A;  4UY4 A;  2AXM A;  1JQZ A;  1XG6 A;  1JY0 A;  3N7L A;  3BRD A;  1ISZ A;  1CVS A;  2DRE A;  5JMC A;  1FMZ A;  1S0D A;  3BTA A;  1WD4 A;  3FUO A;  5JLV A;  1IT0 A;  3UD7 A;  1SZ6 B;  4R6U B;  4X39 A;  2VSA A;  5BP5 C;  1FGA A;  2AAI B;  2Y9W C;  3WIN C;  3H6R A;  1DQO A;  4OWK A;  1HWP B;  5F8W A;  4ISQ A;  3FFZ A;  5HPZ A;  31BI A; 
#chains in the Genus database with same CATH homology
 1NUN A;  1TIE A;  3P6I A;  3RMX A;  3BRF A;  3BAD A;  3HAL A;  2ZR1 B;  1EV2 A;  2HW9 A;  1CE7 B;  1JT3 A;  4EKX B;  5FZZ A;  1HWO B;  3AJ5 A;  3FGM A;  4I0Y A;  2ERM A;  2MIB A;  1QQK A;  5FNX A;  3POK A;  3VUO A;  4D8H A;  2FFV A;  1G9D A;  5GAQ A;  7I1B A;  2KKI A;  4I4Y A;  4KBB A;  1RZO B;  1ISX A;  4JP0 A;  4ZGR B;  4QAL A;  2D22 A;  2F8X C;  3OJ2 A;  3BAG A;  1S0F A;  1FMM S;  1Z0H A;  4I6I A;  4EFQ A;  3NBN A;  3CAH A;  2D24 A;  3N0K A;  4ZOT A;  4KEJ A;  6I1B A;  3FJE A;  1RY7 A;  3N7M A;  4L4I A;  4QO3 A;  3C9Z A;  4LO1 A;  4LO1 C;  4P0K A;  4FGF A;  1FN0 A;  3NBD A;  5DSS B;  3O4B A;  1DFQ A;  1RG8 A;  4GOY A;  4TLP A;  3JUT A;  3BB2 A;  1S0G A;  3F1R A;  2R9K B;  2AFG A;  3CA5 A;  3H6S E;  4LO7 B;  2WRY A;  4G9N A;  1I1B A;  2KI6 B;  3V79 C;  3IIR A;  4QC4 A;  4IZE A;  1R8N A;  3WO2 A;  2RG9 B;  2BFH A;  1YTO A;  4EFR A;  5DZU A;  9ILB A;  1UPS A;  3IM5 A;  2UUS A;  1AF9 A;  3BAQ A;  5BXS A;  2BEA A;  4I4X A;  1WBC A;  4MZF B;  1ITB A;  3A07 A;  4JKX B;  1JLY A;  2D43 A;  1DQG A;  3VT1 A;  2QYI B;  4I4Q A;  3VEQ A;  1EVT A;  3VSF A;  3O4A A;  2E4M C;  3CQA A;  3RTJ B;  4D0Z A;  2K8R A;  3H6Q A;  1FWU A;  3IM6 A;  1BFG A;  3NBE A;  2ET2 A;  1W3F A;  5BQU A;  4Z9W B;  4A7Z A;  3KMV A;  2ZQN A;  1JLX A;  1FV2 A;  1T9F A;  3AKI A;  4H9W A;  1HWN B;  1SR4 A;  1SR4 C;  3I2X A;  3BX1 C;  4OEE A;  2DRZ A;  4JPZ A;  1IOB A;  2D23 A;  3ILA A;  1IIL A;  2K4A B;  4P6A A;  1AXM A;  4EB2 B;  4JAW A;  2F2F C;  4QBC A;  1Q1U A;  2Q9X A;  3V0B A;  4D0T A;  4KEI A;  4LO2 A;  4J23 B;  3BA4 A;  4OUJ A;  3A23 A;  2HWM A;  3R4U A;  4I1E A;  2BEB A;  1F31 A;  1PUU B;  1BFB A;  5FZU A;  3FUQ A;  1EPW A;  4WBC A;  2AQZ A;  2L5X A;  2X2T A;  4IHZ A;  4F34 A;  1W3A A;  5FNW A;  3Q7W A;  4KEK A;  2Z48 A;  1QQL A;  1BAR A;  3CRH A;  1BAS A;  3BAH A;  1FV3 A;  4IQP A;  1AVW B;  4I8M A;  5DUY A;  1R8O A;  3OJV A;  4I4U A;  2Y9G A;  1NZK A;  2HWA A;  4HR6 C;  4ZLB B;  5D63 A;  1BLD A;  1DFC A;  4XFS A;  1YXW A;  1V6W A;  1BLA A;  2YUG A;  1IJT A;  1W3G A;  1TP0 A;  3PG0 A;  3PUB A;  1G9B A;  5FZY A;  4ZFU B;  3UJ4 A;  2LIE A;  1K5V A;  2NYY A;  4XFU A;  3O4D A;  1ISW A;  1ISY A;  3HN1 A;  5F8S A;  3ZX7 A;  3S8J A;  2X2S A;  4GP3 A;  3HOM A;  3RTI B;  3CA1 A;  3AZV A;  4ION A;  4I4S A;  4IYB A;  1WBA A;  2KLL A;  3W9T A;  2D7I A;  2VXR A;  4LO3 A;  4A7K A;  1BFC A;  2MLL B;  4LO3 C;  3ZXD A;  1BFF A;  3BAV A;  2NP0 A;  1DZC A;  3S8K A;  4X37 A;  3FJ9 A;  3VT2 A;  4IY8 A;  3TC2 A;  2DRY A;  4XFT A;  1AFC A;  4QKR A;  3HBW A;  3CU1 B;  4LO0 A;  4G1R A;  3CRG A;  3FJ8 A;  2LIQ A;  4USO A;  4JKQ A;  3N7J A;  3EF2 A;  4LO7 C;  3RMY A;  4H04 A;  1MD6 A;  3FJD A;  1HCD A;  5EG6 C;  3HMY A;  3FJI A;  1G82 A;  1PC8 B;  4P0L A;  3RSJ A;  3WO4 A;  2P39 A;  4DCK C;  4ZKT B;  2D7R A;  1Z4S A;  5EHA A;  3Q7X A;  2MC2 A;  2RST A;  5F8Y A;  1S0E A;  1TWE A;  1XHB A;  1YF8 B;  3P53 A;  4I4O A;  2HZ9 A;  4H75 A;  1JT5 A;  3I2A A;  4OWJ A;  3LTQ A;  3P6J A;  4MZH A;  4QD2 C;  3AH2 A;  4I3N A;  3CA0 A;  3BAO A;  3AKF A;  1HKN A;  1JT4 A;  3WMU A;  2VSE A;  2NTD A;  3CRI A;  5BQU C;  3V0A B;  3O5W B;  21BI A;  1S0L A;  4USP A;  1M2T B;  3AKH A;  3VSZ A;  1RML A;  5D62 A;  2Z49 A;  1HIB A;  1E0O A;  2Y9X E;  4OEF A;  3ZC9 A;  4QKS A;  5B2H A;  4Z8S B;  4IZX A;  3WMV A;  4GAF A;  4YOL A;  4LO2 C;  2GZB A;  1S0C A;  4KC3 A;  3AJ6 A;  1BA7 A;  1DIW A;  1M16 A;  4ISR A;  1IRA X;  4II0 A;  3UD9 A;  2Y9F A;  1ONK B;  2VXT I;  4J2K A;  5BXT A;  1HCE A;  4I4V A;  3IM7 A;  3UDA A;  1PWA A;  1KNM A;  2D20 A;  4END A;  2VLC A;  1YYN A;  4HA2 A;  3VT0 A;  3Q7Y A;  4G9M A;  1V6U A;  2QN4 A;  4MZG B;  3OBR A;  4FVV A;  2VUA A;  1IHK A;  4EFP A;  1HWM B;  4OEG A;  4ZFY B;  2ESU A;  5BVP I;  2FGF A;  5BP5 A;  4ZA3 B;  3WIN A;  3H6R B;  1Z2V A;  1AVA C;  2NM1 A;  3FJJ A;  4ZBV B;  2WBC A;  3F62 B;  2M49 A;  2RQ9 A;  1MC9 A;  1TFM B;  3O44 A;  3VWC A;  5G00 A;  1S0B A;  1OQL B;  3CA4 A;  4I1B A;  1YBI A;  2Q3N B;  3BA7 A;  4X3A A;  3I29 B;  4HJJ A;  4I4P A;  4JQ0 A;  1XYF A;  3AKG A;  1TOO A;  4DEN A;  1ISV A;  3E8L C;  4I4R A;  5DVH A;  3FJA A;  4DEP A;  4I2S A;  3PME A;  3N7K A;  1K5U A;  1TTU A;  4Q9G A;  2I1B A;  1DLL A;  4EEE B;  1TWM A;  2XOA A;  2IWT B;  4OW4 A;  5F90 A;  4AN7 B;  3NJ5 A;  1D0H A;  4LO0 C;  3FJF A;  5BXP A;  4GAI A;  5E24 E;  3A21 A;  3FJH A;  4L4H A;  1A8D A;  8I1B A;  1JTC A;  4Q9P A;  1I1E A;  4F83 A;  3ZC8 A;  4OWL A;  4J2Y A;  3HSM A;  4J2X A;  1XZZ A;  3SNV A;  1V6X A;  3OBT A;  3NBC A;  3R4S A;  2FFU A;  2J3P A;  2VU9 A;  3A22 A;  1IRP A;  1II4 A;  3OJM A;  1G9A A;  3ZXG A;  1T4Q A;  4G6M A;  4I7I A;  2FDB M;  1ILR 1;  1JT7 A;  3AZW A;  4XKI A;  1J0S A;  3CA6 A;  5D61 A;  3T8S A;  1AVX B;  3AH1 A;  3QR5 A;  3UJ0 A;  1VCL A;  5I1B A;  3D7W B;  2ZQO A;  1PZZ A;  3MPP G;  3LLP A;  1EYL A;  2NVH A;  4I37 A;  2DS0 A;  3V0A A;  1L2H A;  2NZ9 A;  3PHZ A;  4P0J A;  5BOW A;  1V6V A;  2D1Z A;  4QD2 B;  3WO3 A;  4CJM A;  4ZFW B;  3O49 A;  2IHO A;  2E4M A;  5EC5 A;  1AVU A;  1WD3 A;  3QYD A;  3B9U A;  41BI A;  3IAG C;  3WA1 A;  2KH2 A;  1FWV A;  3JRR A;  3CA3 A;  2KI4 A;  4GP0 A;  4I96 A;  1Q03 A;  3MAL A;  4X38 A;  3K1X A;  1QXM A;  3O3Q A;  1Q04 A;  4G6J A;  3O4O A;  1PUM B;  3BAU A;  4Q91 A;  3OGG A;  2GO2 A;  1DZD A;  3BRG C;  3BA5 A;  2NS2 A;  4IY9 A;  4QBV A;  4PC4 A;  2P23 A;  2D44 A;  4GOV A;  1G9C A;  3O4C A;  3FJK A;  3OGF A;  1DJS B;  3AH4 A;  3FJC A;  4A7Y A;  1FQ9 A;  4AN6 A;  1GGP B;  2F2F A;  2FO1 A;  3UD8 A;  3V0B B;  3FJB A;  1N4K A;  4LO8 B;  5BXR A;  4J2S A;  1ABR B;  1P63 A;  2K43 A;  4JRA A;  4UY4 A;  2AXM A;  1JQZ A;  1XG6 A;  1JY0 A;  3N7L A;  3BRD A;  1ISZ A;  1CVS A;  2DRE A;  5JMC A;  1FMZ A;  1S0D A;  3BTA A;  1WD4 A;  3FUO A;  5JLV A;  1IT0 A;  3UD7 A;  1SZ6 B;  4R6U B;  4X39 A;  2VSA A;  5BP5 C;  1FGA A;  2AAI B;  2Y9W C;  3WIN C;  3H6R A;  1DQO A;  4OWK A;  1HWP B;  5F8W A;  4ISQ A;  3FFZ A;  5HPZ A;  31BI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...