4QO3A

Crystal structure of c16s/n18s/k12v/c117v/p134v mutant of human acidic fibroblast growth factor
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
142
structure length
142
Chain Sequence
b'HHHHFNLPPGNYKKPVLLYSSSGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSVKRGPRTHYGQKAILFLVLPVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor 1
publication title Thermodynamics of Cysteine Substitution Suggest Unique Structural Role for Cysteine in Proteins
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 33
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4qo3A00
1YTOA 4DCKC 3BADA 1FWVA 1A8DA 3V0AB 3V0AA 1FQ9A 3LTQA 4KEKA 2YUGA 1L2HA 2Z48A 1BASA 5D61A 3CRIA 4I96A 2VUAA 2FO1A 3N7MA 4EEEB 1V6XA 2UUSA 4QKSA 3A22A 1QXMA 5EHAA 3Q7YA 4USPA 5BXTA 1JT5A 1G9CA 3BAOA 3QYDA 1DQOA 5FZUA 3CAHA 3CRHA 3VSZA 1DFQA 4I4PA 2D1ZA 4L4HA 4G9MA 4EFQA 5BVPI 2KI4A 2QN4A 3OBTA 2ZQOA 3OGFA 2MLLB 2HZ9A 4GP0A 4P0LA 2E4MA 2LIQA 4FVVA 4JP0A 2Q3NB 4AN7B 3UJ0A 1W3FA 1RY7A 4WBCA 1Z4SA 3BB2A 1YXWA 1JLYA 3BA4A 1Z2VA 4IY8A 4ZKTB 4OWKA 4ZOTA 4AN6A 1I1BA 3FJIA 3S8JA 1Q04A 2F8XC 1KNMA 4GP3A 3Q7XA 1RMLA 7I1BA 1ILR1 3N0KA 1XYFA 4J2XA 3AKIA 4FGFA 4Q91A 3O4OA 1M16A 1XZZA 1DJSB 4X37A 2VSAA 1XG6A 4OUJA 4KC3A 5E24E 4HA2A 2IWTB 5F90A 4G6MA 1R8OA 5G00A 4LO1C 3RTIB 3VT2A 5F8SA 5FZZA 4J2SA 1JQZA 3H6RB 4JQ0A 3V0BA 1ISWA 3ZXGA 3MALA 1BFGA 1WD3A 3V79C 3WO2A 4GOYA 5BXRA 4OWLA 3BAUA 1FV3A 1YF8B 1NZKA 1G9DA 5FZYA 2KH2A 3O4AA 3CA6A 2D7RA 3HALA 3KMVA 4QBCA 3JRRA 3JUTA 1S0FA 3UD9A 4QKRA 1FN0A 2AQZA 1WBAA 4LO1A 4DEPA 3FUQA 1D0HA 5F8WA 1ONKB 1OQLB 3P53A 1G82A 3ZXDA 4I4YA 1WBCA 3FJBA 3BRDA 1T4QA 4ENDA 1TP0A 2NZ9A 3PUBA 4D0ZA 3ILAA 5BP5C 2P23A 4GAIA 4I0YA 2DRYA 1I1EA 1AVAC 1E0OA 4P0JA 2KLLA 2LIEA 2Y9GA 3PG0A 1DZCA 1V6WA 2NM1A 1V6UA 2NTDA 2VXTI 5D62A 2NVHA 2VLCA 3CRGA 1IRAX 2I1BA 4LO0A 4J2KA 1K5VA 1W3AA 2F2FC 3CA0A 4LO8B 1G9AA 2E4MC 4JKQA 4ZGRB 2D7IA 4F83A 3EF2A 1IRPA 3BA7A 5BP5A 2RQ9A 2GO2A 4H04A 4I4XA 3BA5A 4I4UA 4OEEA 3WO4A 3OJVA 1BFBA 1AXMA 3VSFA 2ZQNA 9ILBA 4CJMA 4KEJA 1AVUA 1PWAA 2DRZA 4JRAA 3FJDA 4QC4A 5EG6C 4JPZA 2Y9FA 1S0BA 1YYNA 1WD4A 2KI6B 3RTJB 5GAQA 2F2FA 3N7JA 2MIBA 4QO3A 4EB2B 2ET2A 3HOMA 4LO2C 5BQUC 4TLPA 3O4DA 2Y9WC 1TOOA 4PC4A 2XOAA 5JLVA 1QQKA 4EKXB 4ZFUB 1JLXA 3FJ8A 1EV2A 1S0GA 3WMVA 2K43A 1HIBA 4H9WA 4Q9GA 3FJKA 4X38A 4HR6C 4OW4A 3I2AA 1XHBA 4F34A 1JT3A 5F8YA 3VWCA 1AFCA 4I7IA 1S0LA 1PZZA 3P6IA 3LLPA 2FDBM 3O3QA 4LO2A 3AKGA 4XFUA 5BQUA 1JT4A 5I1BA 1AVXB 3UD7A 3FFZA 5B2HA 3BAGA 3ZC8A 1RZOB 1IJTA 2NP0A 3BTAA 3NJ5A 1P63A 4I4RA 1IHKA 4I1BA 4Z8SB 3V0BB 5BXPA 1BFCA 5DUYA 3AKHA 3NBCA 2DREA 4II0A 4J23B 1SZ6B 4ZFWB 2M49A 3TC2A 1BARA 8I1BA 3O49A 2Z49A 2BEBA 4I4SA 1TWEA 3HN1A 4GAFA 3T8SA 2P39A 2NYYA 4D8HA 4EFRA 2Y9XE 3Q7WA 5BXSA 1RG8A 41BIA 2QYIB 4OEGA 4IY9A 2HWMA 3QR5A 4J2YA 1TTUA 3AZWA 4GOVA 2VSEA 4I1EA 5JMCA 5DZUA 4LO0C 2IHOA 3VUOA 3CA5A 4G9NA 4I6IA 3C9ZA 3R4UA 4I37A 3WINC 1FGAA 4ZBVB 1AF9A 3BX1C 4Q9PA 3FJ9A 3AKFA 1R8NA 4JKXB 2RG9B 2D44A 5D63A 3O4BA 1ISXA 2D24A 4IHZA 1ABRB 4G1RA 4I4VA 3FGMA 4EFPA 3WO3A 3NBDA 1UPSA 4R6UB 1M2TB 1II4A 1FV2A 1DZDA 2BEAA 3BRGC 3AJ5A 2FFVA 4HJJA 3WINA 3I29B 3FJFA 3IM7A 3CU1B 4I3NA 3AJ6A 4JAWA 3IM6A 1CE7B 4DENA 3O4CA 1G9BA 1DQGA 1FWUA 3CQAA 2Q9XA 1ISYA 4L4IA 3CA1A 3FJJA 2FFUA 1GGPB 4X3AA 3IM5A 2DS0A 1EVTA 4XKIA 6I1BA 21BIA 1W3GA 1PC8B 5EC5A 1T9FA 3A07A 1TIEA 3NBEA 4KEIA 2D22A 3AH4A 4XFSA 1MC9A 3RSJA 2X2TA 3P6JA 2R9KB 3O44A 4ISRA 1TWMA 3FUOA 3I2XA 2ERMA 4LO3A 1Q03A 3K1XA 4IYBA 3AZVA 3IIRA 3PHZA 3POKA 3UDAA 1BLDA 1JT7A 3FJHA 4I4QA 4A7YA 4QALA 2X2SA 1VCLA 3S8KA 5BOWA 2KKIA 2VXRA 1AVWB 3A21A 2AFGA 1HWOB 2ZR1B 31BIA 3E8LC 3VT1A 5DVHA 3D7WB 3WMUA 3BRFA 4P6AA 1DFCA 3FJAA 3BAVA 2L5XA 2AXMA 4OWJA 4KBBA 1SR4C 1S0DA 4IZEA 1BFFA 3OGGA 3VT0A 1PUMB 3CA4A 2K4AB 2ESUA 3H6SE 3PMEA 2MC2A 2HWAA 3OJ2A 2D20A 3CA3A 4IQPA 3A23A 1F31A 1TFMB 2J3PA 3FJCA 1K5UA 4I4OA 2BFHA 1JY0A 1S0EA 4A7ZA 3BAQA 1Z0HA 1HWNB 3HBWA 3BAHA 4P0KA 4ZFYB 1HCDA 1BLAA 1HKNA 2AAIB 3ZC9A 1IILA 2GZBA 4ZLBB 3FJEA 1NUNA 1ITBA 2FGFA 1SR4A 2HW9A 3R4SA 4USOA 3N7LA 1J0SA 2K8RA 4LO7C 3OJMA 3W9TA 3H6RA 3N7KA 2VU9A 3IAGC 5FNXA 5DSSB 3ZX7A 4IZXA 1HWMB 1BA7A 1JTCA 4Z9WB 1CVSA 3HSMA 4QBVA 3HMYA 4X39A 4D0TA 3OBRA 4ISQA 1HCEA 3B9UA 1V6VA 1N4KA 4G6JA 4ZA3B 1IOBA 4QD2C 2WBCA 1FMZA 3O5WB 4IONA 4XFTA 1YBIA 1HWPB 3WA1A 1ISZA 4LO7B 1EPWA 1IT0A 3H6QA 4OEFA 2D43A 1QQLA 3RMXA 1MD6A 3SNVA 3UD8A 2D23A 2WRYA 3VEQA 4A7KA 3AH2A 1ISVA 3UJ4A 3NBNA 5HPZA 1FMMS 2RSTA 3F1RA 1PUUB 4I2SA 1DLLA 1EYLA 3RMYA 3MPPG 3F62B 4I8MA 4LO3C 1DIWA 1S0CA 4QD2B 4YOLA 5FNWA 1Q1UA 3AH1A
chains in the Genus database with same CATH superfamily
1YTOA 4DCKC 3BADA 1FWVA 1A8DA 3V0AB 3V0AA 1FQ9A 3LTQA 4KEKA 2YUGA 1L2HA 2Z48A 1BASA 5D61A 3CRIA 4I96A 2VUAA 2FO1A 3N7MA 4EEEB 1V6XA 2UUSA 4QKSA 3A22A 1QXMA 5EHAA 3Q7YA 4USPA 5BXTA 1JT5A 1G9CA 3BAOA 3QYDA 1DQOA 5FZUA 3CAHA 3CRHA 3VSZA 1DFQA 4I4PA 2D1ZA 4L4HA 4G9MA 4EFQA 5BVPI 2KI4A 2QN4A 3OBTA 2ZQOA 3OGFA 2MLLB 2HZ9A 4GP0A 4P0LA 2E4MA 2LIQA 4FVVA 4JP0A 2Q3NB 4AN7B 3UJ0A 1W3FA 1RY7A 4WBCA 1Z4SA 3BB2A 1YXWA 1JLYA 3BA4A 1Z2VA 4IY8A 4ZKTB 4OWKA 4ZOTA 4AN6A 1I1BA 3FJIA 3S8JA 1Q04A 2F8XC 1KNMA 4GP3A 3Q7XA 1RMLA 7I1BA 1ILR1 3N0KA 1XYFA 4J2XA 3AKIA 4FGFA 4Q91A 3O4OA 1M16A 1XZZA 1DJSB 4X37A 2VSAA 1XG6A 4OUJA 4KC3A 5E24E 4HA2A 2IWTB 5F90A 4G6MA 1R8OA 5G00A 4LO1C 3RTIB 3VT2A 5F8SA 5FZZA 4J2SA 1JQZA 3H6RB 4JQ0A 3V0BA 1ISWA 3ZXGA 3MALA 1BFGA 1WD3A 3V79C 3WO2A 4GOYA 5BXRA 4MZFB 4OWLA 3BAUA 1FV3A 1YF8B 1NZKA 1G9DA 5FZYA 2KH2A 3O4AA 4H75A 3CA6A 2D7RA 3HALA 3KMVA 4QBCA 3JRRA 3JUTA 1S0FA 3UD9A 4QKRA 1FN0A 2AQZA 1WBAA 4LO1A 4DEPA 3FUQA 1D0HA 5F8WA 1ONKB 1OQLB 3P53A 1G82A 3ZXDA 4MZHA 4I4YA 1WBCA 3FJBA 3BRDA 1T4QA 4ENDA 1TP0A 2NZ9A 3PUBA 4D0ZA 3ILAA 5BP5C 2P23A 4GAIA 4I0YA 2DRYA 1I1EA 1AVAC 1E0OA 4P0JA 2KLLA 2LIEA 2Y9GA 3PG0A 1DZCA 1V6WA 2NM1A 1V6UA 2NTDA 2VXTI 5D62A 2NVHA 2VLCA 3CRGA 1IRAX 2I1BA 4LO0A 4J2KA 1K5VA 1W3AA 2F2FC 3CA0A 4LO8B 1G9AA 2E4MC 4JKQA 4ZGRB 2D7IA 4F83A 3EF2A 1IRPA 3BA7A 5BP5A 2RQ9A 2GO2A 4H04A 4I4XA 3BA5A 4I4UA 4OEEA 3WO4A 3OJVA 1BFBA 1AXMA 3VSFA 2ZQNA 9ILBA 4CJMA 4KEJA 1AVUA 1PWAA 2DRZA 4JRAA 3FJDA 4QC4A 5EG6C 4JPZA 2Y9FA 1S0BA 1YYNA 1WD4A 2KI6B 3RTJB 5GAQA 2F2FA 3N7JA 2MIBA 4QO3A 4EB2B 2ET2A 3HOMA 4LO2C 5BQUC 4TLPA 3O4DA 2Y9WC 1TOOA 4PC4A 2XOAA 5JLVA 1QQKA 4EKXB 4ZFUB 1JLXA 3FJ8A 1EV2A 1S0GA 3WMVA 2K43A 1HIBA 4H9WA 4Q9GA 3FJKA 4X38A 4HR6C 4OW4A 3I2AA 1XHBA 4F34A 1JT3A 5F8YA 3VWCA 1AFCA 4I7IA 1S0LA 1PZZA 3P6IA 3LLPA 2FDBM 3O3QA 4LO2A 3AKGA 4XFUA 5BQUA 1JT4A 5I1BA 1AVXB 3UD7A 3FFZA 5B2HA 3BAGA 3ZC8A 1RZOB 1IJTA 2NP0A 3BTAA 3NJ5A 1P63A 4I4RA 1IHKA 4I1BA 4Z8SB 3V0BB 5BXPA 1BFCA 5DUYA 3AKHA 3NBCA 2DREA 4II0A 4J23B 1SZ6B 4ZFWB 2M49A 3TC2A 1BARA 8I1BA 3O49A 2Z49A 2BEBA 4I4SA 1TWEA 3HN1A 4GAFA 3T8SA 2P39A 2NYYA 4D8HA 4EFRA 2Y9XE 3Q7WA 5BXSA 1RG8A 41BIA 2QYIB 4OEGA 4IY9A 2HWMA 3QR5A 4J2YA 1TTUA 3AZWA 4GOVA 2VSEA 4I1EA 5JMCA 5DZUA 4LO0C 2IHOA 3VUOA 3CA5A 4G9NA 4I6IA 3C9ZA 3R4UA 4I37A 3WINC 1FGAA 4ZBVB 1AF9A 3BX1C 4Q9PA 3FJ9A 3AKFA 1R8NA 4JKXB 2RG9B 2D44A 5D63A 3O4BA 1ISXA 2D24A 4IHZA 1ABRB 4G1RA 4I4VA 3FGMA 4EFPA 3WO3A 3NBDA 1UPSA 4R6UB 1M2TB 1II4A 1FV2A 1DZDA 2BEAA 3BRGC 3AJ5A 2FFVA 4HJJA 3WINA 3I29B 3FJFA 3IM7A 3CU1B 4I3NA 3AJ6A 4JAWA 3IM6A 1CE7B 4DENA 3O4CA 1G9BA 1DQGA 1FWUA 3CQAA 2Q9XA 1ISYA 4L4IA 3CA1A 3FJJA 2FFUA 1GGPB 4X3AA 3IM5A 2DS0A 1EVTA 2NS2A 4XKIA 6I1BA 21BIA 1W3GA 1PC8B 5EC5A 1T9FA 3A07A 1TIEA 3NBEA 4KEIA 2D22A 3AH4A 4XFSA 1MC9A 3RSJA 2X2TA 3P6JA 2R9KB 3O44A 4ISRA 1TWMA 3FUOA 3I2XA 2ERMA 4LO3A 1Q03A 3K1XA 4IYBA 3AZVA 3IIRA 3PHZA 3POKA 3UDAA 1BLDA 1JT7A 3FJHA 4I4QA 4A7YA 4QALA 2X2SA 1VCLA 3S8KA 5BOWA 2KKIA 2VXRA 1AVWB 3A21A 2AFGA 1HWOB 2ZR1B 31BIA 3E8LC 3VT1A 5DVHA 3D7WB 3WMUA 3BRFA 4P6AA 1DFCA 3FJAA 3BAVA 2L5XA 2AXMA 4OWJA 4KBBA 1SR4C 1S0DA 4IZEA 1BFFA 3OGGA 3VT0A 1PUMB 3CA4A 2K4AB 2ESUA 3H6SE 3PMEA 2MC2A 2HWAA 3OJ2A 2D20A 3CA3A 4IQPA 3A23A 1F31A 1TFMB 2J3PA 3FJCA 1K5UA 4I4OA 2BFHA 1JY0A 1S0EA 4A7ZA 3BAQA 1Z0HA 1HWNB 3HBWA 3BAHA 4P0KA 4ZFYB 1HCDA 1BLAA 1HKNA 2AAIB 3ZC9A 1IILA 4MZGB 2GZBA 4ZLBB 3FJEA 1NUNA 1ITBA 2FGFA 1SR4A 2HW9A 3R4SA 4USOA 3N7LA 1J0SA 2K8RA 4LO7C 3OJMA 3W9TA 3H6RA 3N7KA 2VU9A 3IAGC 5FNXA 5DSSB 3ZX7A 4IZXA 1HWMB 1BA7A 1JTCA 4UY4A 4Z9WB 1CVSA 3HSMA 4QBVA 3HMYA 4X39A 4D0TA 3OBRA 4ISQA 1HCEA 3B9UA 1V6VA 1N4KA 4G6JA 4ZA3B 1IOBA 4QD2C 2WBCA 1FMZA 3O5WB 4IONA 4XFTA 1YBIA 1HWPB 3WA1A 1ISZA 4LO7B 1EPWA 1IT0A 3H6QA 4OEFA 2D43A 1QQLA 3RMXA 1MD6A 3SNVA 3UD8A 2D23A 2WRYA 3VEQA 4A7KA 3AH2A 1ISVA 3UJ4A 3NBNA 5HPZA 1FMMS 2RSTA 3F1RA 1PUUB 4I2SA 1DLLA 1EYLA 3RMYA 3MPPG 3F62B 4I8MA 4LO3C 1DIWA 1S0CA 4QD2B 4YOLA 5FNWA 1Q1UA 3AH1A
chains in the Genus database with same CATH topology
1YTOA 4DCKC 3BADA 1FWVA 1A8DA 3V0AB 3V0AA 1FQ9A 3LTQA 4KEKA 2YUGA 1L2HA 2Z48A 1BASA 5D61A 3CRIA 4I96A 2VUAA 2FO1A 3N7MA 4EEEB 1V6XA 2UUSA 4QKSA 3A22A 1QXMA 5EHAA 3Q7YA 4USPA 5BXTA 1JT5A 1G9CA 3BAOA 3QYDA 1DQOA 5FZUA 3CAHA 3CRHA 3VSZA 1DFQA 4I4PA 2D1ZA 4L4HA 4G9MA 4EFQA 5BVPI 2KI4A 2QN4A 3OBTA 2ZQOA 3OGFA 2MLLB 2HZ9A 4GP0A 4P0LA 2E4MA 2LIQA 4FVVA 4JP0A 2Q3NB 4AN7B 3UJ0A 1W3FA 1RY7A 4WBCA 1Z4SA 3BB2A 1YXWA 1JLYA 3BA4A 1Z2VA 4IY8A 4ZKTB 4OWKA 4ZOTA 4AN6A 1I1BA 3FJIA 3S8JA 1Q04A 2F8XC 1KNMA 4GP3A 3Q7XA 1RMLA 7I1BA 1ILR1 3N0KA 1XYFA 4J2XA 3AKIA 4FGFA 4Q91A 3O4OA 1M16A 1XZZA 1DJSB 4X37A 2VSAA 1XG6A 4OUJA 4KC3A 5E24E 4HA2A 2IWTB 5F90A 4G6MA 1R8OA 5G00A 4LO1C 3RTIB 3VT2A 5F8SA 5FZZA 4J2SA 1JQZA 3H6RB 4JQ0A 3V0BA 1ISWA 3ZXGA 3MALA 1BFGA 1WD3A 3V79C 3WO2A 4GOYA 5BXRA 4MZFB 4OWLA 3BAUA 1FV3A 1YF8B 1NZKA 1G9DA 5FZYA 2KH2A 3O4AA 4H75A 3CA6A 2D7RA 3HALA 3KMVA 4QBCA 3JRRA 3JUTA 1S0FA 3UD9A 4QKRA 1FN0A 2AQZA 1WBAA 4LO1A 4DEPA 3FUQA 1D0HA 5F8WA 1ONKB 1OQLB 3P53A 1G82A 3ZXDA 4MZHA 4I4YA 1WBCA 3FJBA 3BRDA 1T4QA 4ENDA 1TP0A 2NZ9A 3PUBA 4D0ZA 3ILAA 5BP5C 2P23A 4GAIA 4I0YA 2DRYA 1I1EA 1AVAC 1E0OA 4P0JA 2KLLA 2LIEA 2Y9GA 3PG0A 1DZCA 1V6WA 2NM1A 1V6UA 2NTDA 2VXTI 5D62A 2NVHA 2VLCA 3CRGA 1IRAX 2I1BA 4LO0A 4J2KA 1K5VA 1W3AA 2F2FC 3CA0A 4LO8B 1G9AA 2E4MC 4JKQA 4ZGRB 2D7IA 4F83A 3EF2A 1IRPA 3BA7A 5BP5A 2RQ9A 2GO2A 4H04A 4I4XA 3BA5A 4I4UA 4OEEA 3WO4A 3OJVA 1BFBA 1AXMA 3VSFA 2ZQNA 9ILBA 4CJMA 4KEJA 1AVUA 1PWAA 2DRZA 4JRAA 3FJDA 4QC4A 5EG6C 4JPZA 2Y9FA 1S0BA 1YYNA 1WD4A 2KI6B 3RTJB 5GAQA 2F2FA 3N7JA 2MIBA 4QO3A 4EB2B 2ET2A 3HOMA 4LO2C 5BQUC 4TLPA 3O4DA 2Y9WC 1TOOA 4PC4A 2XOAA 5JLVA 1QQKA 4EKXB 4ZFUB 1JLXA 3FJ8A 1EV2A 1S0GA 3WMVA 2K43A 1HIBA 4H9WA 4Q9GA 3FJKA 4X38A 4HR6C 4OW4A 3I2AA 1XHBA 4F34A 1JT3A 5F8YA 3VWCA 1AFCA 4I7IA 1S0LA 1PZZA 3P6IA 3LLPA 2FDBM 3O3QA 4LO2A 3AKGA 4XFUA 5BQUA 1JT4A 5I1BA 1AVXB 3UD7A 3FFZA 5B2HA 3BAGA 3ZC8A 1RZOB 1IJTA 2NP0A 3BTAA 3NJ5A 1P63A 4I4RA 1IHKA 4I1BA 4Z8SB 3V0BB 5BXPA 1BFCA 5DUYA 3AKHA 3NBCA 2DREA 4II0A 4J23B 1SZ6B 4ZFWB 2M49A 3TC2A 1BARA 8I1BA 3O49A 2Z49A 2BEBA 4I4SA 1TWEA 3HN1A 4GAFA 3T8SA 2P39A 2NYYA 4D8HA 4EFRA 2Y9XE 3Q7WA 5BXSA 1RG8A 41BIA 2QYIB 4OEGA 4IY9A 2HWMA 3QR5A 4J2YA 1TTUA 3AZWA 4GOVA 2VSEA 4I1EA 5JMCA 5DZUA 4LO0C 2IHOA 3VUOA 3CA5A 4G9NA 4I6IA 3C9ZA 3R4UA 4I37A 3WINC 1FGAA 4ZBVB 1AF9A 3BX1C 4Q9PA 3FJ9A 3AKFA 1R8NA 4JKXB 2RG9B 2D44A 5D63A 3O4BA 1ISXA 2D24A 4IHZA 1ABRB 4G1RA 4I4VA 3FGMA 4EFPA 3WO3A 3NBDA 1UPSA 4R6UB 1M2TB 1II4A 1FV2A 1DZDA 2BEAA 3BRGC 3AJ5A 2FFVA 4HJJA 3WINA 3I29B 3FJFA 3IM7A 3CU1B 4I3NA 3AJ6A 4JAWA 3IM6A 1CE7B 4DENA 3O4CA 1G9BA 1DQGA 1FWUA 3CQAA 2Q9XA 1ISYA 4L4IA 3CA1A 3FJJA 2FFUA 1GGPB 4X3AA 3IM5A 2DS0A 1EVTA 2NS2A 4XKIA 6I1BA 21BIA 1W3GA 1PC8B 5EC5A 1T9FA 3A07A 1TIEA 3NBEA 4KEIA 2D22A 3AH4A 4XFSA 1MC9A 3RSJA 2X2TA 3P6JA 2R9KB 3O44A 4ISRA 1TWMA 3FUOA 3I2XA 2ERMA 4LO3A 1Q03A 3K1XA 4IYBA 3AZVA 3IIRA 3PHZA 3POKA 3UDAA 1BLDA 1JT7A 3FJHA 4I4QA 4A7YA 4QALA 2X2SA 1VCLA 3S8KA 5BOWA 2KKIA 2VXRA 1AVWB 3A21A 2AFGA 1HWOB 2ZR1B 31BIA 3E8LC 3VT1A 5DVHA 3D7WB 3WMUA 3BRFA 4P6AA 1DFCA 3FJAA 3BAVA 2L5XA 2AXMA 4OWJA 4KBBA 1SR4C 1S0DA 4IZEA 1BFFA 3OGGA 3VT0A 1PUMB 3CA4A 2K4AB 2ESUA 3H6SE 3PMEA 2MC2A 2HWAA 3OJ2A 2D20A 3CA3A 4IQPA 3A23A 1F31A 1TFMB 2J3PA 3FJCA 1K5UA 4I4OA 2BFHA 1JY0A 1S0EA 4A7ZA 3BAQA 1Z0HA 1HWNB 3HBWA 3BAHA 4P0KA 4ZFYB 1HCDA 1BLAA 1HKNA 2AAIB 3ZC9A 1IILA 4MZGB 2GZBA 4ZLBB 3FJEA 1NUNA 1ITBA 2FGFA 1SR4A 2HW9A 3R4SA 4USOA 3N7LA 1J0SA 2K8RA 4LO7C 3OJMA 3W9TA 3H6RA 3N7KA 2VU9A 3IAGC 5FNXA 5DSSB 3ZX7A 4IZXA 1HWMB 1BA7A 1JTCA 4UY4A 4Z9WB 1CVSA 3HSMA 4QBVA 3HMYA 4X39A 4D0TA 3OBRA 4ISQA 1HCEA 3B9UA 1V6VA 1N4KA 4G6JA 4ZA3B 1IOBA 4QD2C 2WBCA 1FMZA 3O5WB 4IONA 4XFTA 1YBIA 1HWPB 3WA1A 1ISZA 4LO7B 1EPWA 1IT0A 3H6QA 4OEFA 2D43A 1QQLA 3RMXA 1MD6A 3SNVA 3UD8A 2D23A 2WRYA 3VEQA 4A7KA 3AH2A 1ISVA 3UJ4A 3NBNA 5HPZA 1FMMS 2RSTA 3F1RA 1PUUB 4I2SA 1DLLA 1EYLA 3RMYA 3MPPG 3F62B 4I8MA 4LO3C 1DIWA 1S0CA 4QD2B 4YOLA 5FNWA 1Q1UA 3AH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YTO A;  4DCK C;  3BAD A;  1FWV A;  1A8D A;  3V0A B;  3V0A A;  1FQ9 A;  3LTQ A;  4KEK A;  2YUG A;  1L2H A;  2Z48 A;  1BAS A;  5D61 A;  3CRI A;  4I96 A;  2VUA A;  2FO1 A;  3N7M A;  4EEE B;  1V6X A;  2UUS A;  4QKS A;  3A22 A;  1QXM A;  5EHA A;  3Q7Y A;  4USP A;  5BXT A;  1JT5 A;  1G9C A;  3BAO A;  3QYD A;  1DQO A;  5FZU A;  3CAH A;  3CRH A;  3VSZ A;  1DFQ A;  4I4P A;  2D1Z A;  4L4H A;  4G9M A;  4EFQ A;  5BVP I;  2KI4 A;  2QN4 A;  3OBT A;  2ZQO A;  3OGF A;  2MLL B;  2HZ9 A;  4GP0 A;  4P0L A;  2E4M A;  2LIQ A;  4FVV A;  4JP0 A;  2Q3N B;  4AN7 B;  3UJ0 A;  1W3F A;  1RY7 A;  4WBC A;  1Z4S A;  3BB2 A;  1YXW A;  1JLY A;  3BA4 A;  1Z2V A;  4IY8 A;  4ZKT B;  4OWK A;  4ZOT A;  4AN6 A;  1I1B A;  3FJI A;  3S8J A;  1Q04 A;  2F8X C;  1KNM A;  4GP3 A;  3Q7X A;  1RML A;  7I1B A;  1ILR 1;  3N0K A;  1XYF A;  4J2X A;  3AKI A;  4FGF A;  4Q91 A;  3O4O A;  1M16 A;  1XZZ A;  1DJS B;  4X37 A;  2VSA A;  1XG6 A;  4OUJ A;  4KC3 A;  5E24 E;  4HA2 A;  2IWT B;  5F90 A;  4G6M A;  1R8O A;  5G00 A;  4LO1 C;  3RTI B;  3VT2 A;  5F8S A;  5FZZ A;  4J2S A;  1JQZ A;  3H6R B;  4JQ0 A;  3V0B A;  1ISW A;  3ZXG A;  3MAL A;  1BFG A;  1WD3 A;  3V79 C;  3WO2 A;  4GOY A;  5BXR A;  4OWL A;  3BAU A;  1FV3 A;  1YF8 B;  1NZK A;  1G9D A;  5FZY A;  2KH2 A;  3O4A A;  3CA6 A;  2D7R A;  3HAL A;  3KMV A;  4QBC A;  3JRR A;  3JUT A;  1S0F A;  3UD9 A;  4QKR A;  1FN0 A;  2AQZ A;  1WBA A;  4LO1 A;  4DEP A;  3FUQ A;  1D0H A;  5F8W A;  1ONK B;  1OQL B;  3P53 A;  1G82 A;  3ZXD A;  4I4Y A;  1WBC A;  3FJB A;  3BRD A;  1T4Q A;  4END A;  1TP0 A;  2NZ9 A;  3PUB A;  4D0Z A;  3ILA A;  5BP5 C;  2P23 A;  4GAI A;  4I0Y A;  2DRY A;  1I1E A;  1AVA C;  1E0O A;  4P0J A;  2KLL A;  2LIE A;  2Y9G A;  3PG0 A;  1DZC A;  1V6W A;  2NM1 A;  1V6U A;  2NTD A;  2VXT I;  5D62 A;  2NVH A;  2VLC A;  3CRG A;  1IRA X;  2I1B A;  4LO0 A;  4J2K A;  1K5V A;  1W3A A;  2F2F C;  3CA0 A;  4LO8 B;  1G9A A;  2E4M C;  4JKQ A;  4ZGR B;  2D7I A;  4F83 A;  3EF2 A;  1IRP A;  3BA7 A;  5BP5 A;  2RQ9 A;  2GO2 A;  4H04 A;  4I4X A;  3BA5 A;  4I4U A;  4OEE A;  3WO4 A;  3OJV A;  1BFB A;  1AXM A;  3VSF A;  2ZQN A;  9ILB A;  4CJM A;  4KEJ A;  1AVU A;  1PWA A;  2DRZ A;  4JRA A;  3FJD A;  4QC4 A;  5EG6 C;  4JPZ A;  2Y9F A;  1S0B A;  1YYN A;  1WD4 A;  2KI6 B;  3RTJ B;  5GAQ A;  2F2F A;  3N7J A;  2MIB A;  4QO3 A;  4EB2 B;  2ET2 A;  3HOM A;  4LO2 C;  5BQU C;  4TLP A;  3O4D A;  2Y9W C;  1TOO A;  4PC4 A;  2XOA A;  5JLV A;  1QQK A;  4EKX B;  4ZFU B;  1JLX A;  3FJ8 A;  1EV2 A;  1S0G A;  3WMV A;  2K43 A;  1HIB A;  4H9W A;  4Q9G A;  3FJK A;  4X38 A;  4HR6 C;  4OW4 A;  3I2A A;  1XHB A;  4F34 A;  1JT3 A;  5F8Y A;  3VWC A;  1AFC A;  4I7I A;  1S0L A;  1PZZ A;  3P6I A;  3LLP A;  2FDB M;  3O3Q A;  4LO2 A;  3AKG A;  4XFU A;  5BQU A;  1JT4 A;  5I1B A;  1AVX B;  3UD7 A;  3FFZ A;  5B2H A;  3BAG A;  3ZC8 A;  1RZO B;  1IJT A;  2NP0 A;  3BTA A;  3NJ5 A;  1P63 A;  4I4R A;  1IHK A;  4I1B A;  4Z8S B;  3V0B B;  5BXP A;  1BFC A;  5DUY A;  3AKH A;  3NBC A;  2DRE A;  4II0 A;  4J23 B;  1SZ6 B;  4ZFW B;  2M49 A;  3TC2 A;  1BAR A;  8I1B A;  3O49 A;  2Z49 A;  2BEB A;  4I4S A;  1TWE A;  3HN1 A;  4GAF A;  3T8S A;  2P39 A;  2NYY A;  4D8H A;  4EFR A;  2Y9X E;  3Q7W A;  5BXS A;  1RG8 A;  41BI A;  2QYI B;  4OEG A;  4IY9 A;  2HWM A;  3QR5 A;  4J2Y A;  1TTU A;  3AZW A;  4GOV A;  2VSE A;  4I1E A;  5JMC A;  5DZU A;  4LO0 C;  2IHO A;  3VUO A;  3CA5 A;  4G9N A;  4I6I A;  3C9Z A;  3R4U A;  4I37 A;  3WIN C;  1FGA A;  4ZBV B;  1AF9 A;  3BX1 C;  4Q9P A;  3FJ9 A;  3AKF A;  1R8N A;  4JKX B;  2RG9 B;  2D44 A;  5D63 A;  3O4B A;  1ISX A;  2D24 A;  4IHZ A;  1ABR B;  4G1R A;  4I4V A;  3FGM A;  4EFP A;  3WO3 A;  3NBD A;  1UPS A;  4R6U B;  1M2T B;  1II4 A;  1FV2 A;  1DZD A;  2BEA A;  3BRG C;  3AJ5 A;  2FFV A;  4HJJ A;  3WIN A;  3I29 B;  3FJF A;  3IM7 A;  3CU1 B;  4I3N A;  3AJ6 A;  4JAW A;  3IM6 A;  1CE7 B;  4DEN A;  3O4C A;  1G9B A;  1DQG A;  1FWU A;  3CQA A;  2Q9X A;  1ISY A;  4L4I A;  3CA1 A;  3FJJ A;  2FFU A;  1GGP B;  4X3A A;  3IM5 A;  2DS0 A;  1EVT A;  4XKI A;  6I1B A;  21BI A;  1W3G A;  1PC8 B;  5EC5 A;  1T9F A;  3A07 A;  1TIE A;  3NBE A;  4KEI A;  2D22 A;  3AH4 A;  4XFS A;  1MC9 A;  3RSJ A;  2X2T A;  3P6J A;  2R9K B;  3O44 A;  4ISR A;  1TWM A;  3FUO A;  3I2X A;  2ERM A;  4LO3 A;  1Q03 A;  3K1X A;  4IYB A;  3AZV A;  3IIR A;  3PHZ A;  3POK A;  3UDA A;  1BLD A;  1JT7 A;  3FJH A;  4I4Q A;  4A7Y A;  4QAL A;  2X2S A;  1VCL A;  3S8K A;  5BOW A;  2KKI A;  2VXR A;  1AVW B;  3A21 A;  2AFG A;  1HWO B;  2ZR1 B;  31BI A;  3E8L C;  3VT1 A;  5DVH A;  3D7W B;  3WMU A;  3BRF A;  4P6A A;  1DFC A;  3FJA A;  3BAV A;  2L5X A;  2AXM A;  4OWJ A;  4KBB A;  1SR4 C;  1S0D A;  4IZE A;  1BFF A;  3OGG A;  3VT0 A;  1PUM B;  3CA4 A;  2K4A B;  2ESU A;  3H6S E;  3PME A;  2MC2 A;  2HWA A;  3OJ2 A;  2D20 A;  3CA3 A;  4IQP A;  3A23 A;  1F31 A;  1TFM B;  2J3P A;  3FJC A;  1K5U A;  4I4O A;  2BFH A;  1JY0 A;  1S0E A;  4A7Z A;  3BAQ A;  1Z0H A;  1HWN B;  3HBW A;  3BAH A;  4P0K A;  4ZFY B;  1HCD A;  1BLA A;  1HKN A;  2AAI B;  3ZC9 A;  1IIL A;  2GZB A;  4ZLB B;  3FJE A;  1NUN A;  1ITB A;  2FGF A;  1SR4 A;  2HW9 A;  3R4S A;  4USO A;  3N7L A;  1J0S A;  2K8R A;  4LO7 C;  3OJM A;  3W9T A;  3H6R A;  3N7K A;  2VU9 A;  3IAG C;  5FNX A;  5DSS B;  3ZX7 A;  4IZX A;  1HWM B;  1BA7 A;  1JTC A;  4Z9W B;  1CVS A;  3HSM A;  4QBV A;  3HMY A;  4X39 A;  4D0T A;  3OBR A;  4ISQ A;  1HCE A;  3B9U A;  1V6V A;  1N4K A;  4G6J A;  4ZA3 B;  1IOB A;  4QD2 C;  2WBC A;  1FMZ A;  3O5W B;  4ION A;  4XFT A;  1YBI A;  1HWP B;  3WA1 A;  1ISZ A;  4LO7 B;  1EPW A;  1IT0 A;  3H6Q A;  4OEF A;  2D43 A;  1QQL A;  3RMX A;  1MD6 A;  3SNV A;  3UD8 A;  2D23 A;  2WRY A;  3VEQ A;  4A7K A;  3AH2 A;  1ISV A;  3UJ4 A;  3NBN A;  5HPZ A;  1FMM S;  2RST A;  3F1R A;  1PUU B;  4I2S A;  1DLL A;  1EYL A;  3RMY A;  3MPP G;  3F62 B;  4I8M A;  4LO3 C;  1DIW A;  1S0C A;  4QD2 B;  4YOL A;  5FNW A;  1Q1U A;  3AH1 A; 
#chains in the Genus database with same CATH topology
 1YTO A;  4DCK C;  3BAD A;  1FWV A;  1A8D A;  3V0A B;  3V0A A;  1FQ9 A;  3LTQ A;  4KEK A;  2YUG A;  1L2H A;  2Z48 A;  1BAS A;  5D61 A;  3CRI A;  4I96 A;  2VUA A;  2FO1 A;  3N7M A;  4EEE B;  1V6X A;  2UUS A;  4QKS A;  3A22 A;  1QXM A;  5EHA A;  3Q7Y A;  4USP A;  5BXT A;  1JT5 A;  1G9C A;  3BAO A;  3QYD A;  1DQO A;  5FZU A;  3CAH A;  3CRH A;  3VSZ A;  1DFQ A;  4I4P A;  2D1Z A;  4L4H A;  4G9M A;  4EFQ A;  5BVP I;  2KI4 A;  2QN4 A;  3OBT A;  2ZQO A;  3OGF A;  2MLL B;  2HZ9 A;  4GP0 A;  4P0L A;  2E4M A;  2LIQ A;  4FVV A;  4JP0 A;  2Q3N B;  4AN7 B;  3UJ0 A;  1W3F A;  1RY7 A;  4WBC A;  1Z4S A;  3BB2 A;  1YXW A;  1JLY A;  3BA4 A;  1Z2V A;  4IY8 A;  4ZKT B;  4OWK A;  4ZOT A;  4AN6 A;  1I1B A;  3FJI A;  3S8J A;  1Q04 A;  2F8X C;  1KNM A;  4GP3 A;  3Q7X A;  1RML A;  7I1B A;  1ILR 1;  3N0K A;  1XYF A;  4J2X A;  3AKI A;  4FGF A;  4Q91 A;  3O4O A;  1M16 A;  1XZZ A;  1DJS B;  4X37 A;  2VSA A;  1XG6 A;  4OUJ A;  4KC3 A;  5E24 E;  4HA2 A;  2IWT B;  5F90 A;  4G6M A;  1R8O A;  5G00 A;  4LO1 C;  3RTI B;  3VT2 A;  5F8S A;  5FZZ A;  4J2S A;  1JQZ A;  3H6R B;  4JQ0 A;  3V0B A;  1ISW A;  3ZXG A;  3MAL A;  1BFG A;  1WD3 A;  3V79 C;  3WO2 A;  4GOY A;  5BXR A;  4MZF B;  4OWL A;  3BAU A;  1FV3 A;  1YF8 B;  1NZK A;  1G9D A;  5FZY A;  2KH2 A;  3O4A A;  4H75 A;  3CA6 A;  2D7R A;  3HAL A;  3KMV A;  4QBC A;  3JRR A;  3JUT A;  1S0F A;  3UD9 A;  4QKR A;  1FN0 A;  2AQZ A;  1WBA A;  4LO1 A;  4DEP A;  3FUQ A;  1D0H A;  5F8W A;  1ONK B;  1OQL B;  3P53 A;  1G82 A;  3ZXD A;  4MZH A;  4I4Y A;  1WBC A;  3FJB A;  3BRD A;  1T4Q A;  4END A;  1TP0 A;  2NZ9 A;  3PUB A;  4D0Z A;  3ILA A;  5BP5 C;  2P23 A;  4GAI A;  4I0Y A;  2DRY A;  1I1E A;  1AVA C;  1E0O A;  4P0J A;  2KLL A;  2LIE A;  2Y9G A;  3PG0 A;  1DZC A;  1V6W A;  2NM1 A;  1V6U A;  2NTD A;  2VXT I;  5D62 A;  2NVH A;  2VLC A;  3CRG A;  1IRA X;  2I1B A;  4LO0 A;  4J2K A;  1K5V A;  1W3A A;  2F2F C;  3CA0 A;  4LO8 B;  1G9A A;  2E4M C;  4JKQ A;  4ZGR B;  2D7I A;  4F83 A;  3EF2 A;  1IRP A;  3BA7 A;  5BP5 A;  2RQ9 A;  2GO2 A;  4H04 A;  4I4X A;  3BA5 A;  4I4U A;  4OEE A;  3WO4 A;  3OJV A;  1BFB A;  1AXM A;  3VSF A;  2ZQN A;  9ILB A;  4CJM A;  4KEJ A;  1AVU A;  1PWA A;  2DRZ A;  4JRA A;  3FJD A;  4QC4 A;  5EG6 C;  4JPZ A;  2Y9F A;  1S0B A;  1YYN A;  1WD4 A;  2KI6 B;  3RTJ B;  5GAQ A;  2F2F A;  3N7J A;  2MIB A;  4QO3 A;  4EB2 B;  2ET2 A;  3HOM A;  4LO2 C;  5BQU C;  4TLP A;  3O4D A;  2Y9W C;  1TOO A;  4PC4 A;  2XOA A;  5JLV A;  1QQK A;  4EKX B;  4ZFU B;  1JLX A;  3FJ8 A;  1EV2 A;  1S0G A;  3WMV A;  2K43 A;  1HIB A;  4H9W A;  4Q9G A;  3FJK A;  4X38 A;  4HR6 C;  4OW4 A;  3I2A A;  1XHB A;  4F34 A;  1JT3 A;  5F8Y A;  3VWC A;  1AFC A;  4I7I A;  1S0L A;  1PZZ A;  3P6I A;  3LLP A;  2FDB M;  3O3Q A;  4LO2 A;  3AKG A;  4XFU A;  5BQU A;  1JT4 A;  5I1B A;  1AVX B;  3UD7 A;  3FFZ A;  5B2H A;  3BAG A;  3ZC8 A;  1RZO B;  1IJT A;  2NP0 A;  3BTA A;  3NJ5 A;  1P63 A;  4I4R A;  1IHK A;  4I1B A;  4Z8S B;  3V0B B;  5BXP A;  1BFC A;  5DUY A;  3AKH A;  3NBC A;  2DRE A;  4II0 A;  4J23 B;  1SZ6 B;  4ZFW B;  2M49 A;  3TC2 A;  1BAR A;  8I1B A;  3O49 A;  2Z49 A;  2BEB A;  4I4S A;  1TWE A;  3HN1 A;  4GAF A;  3T8S A;  2P39 A;  2NYY A;  4D8H A;  4EFR A;  2Y9X E;  3Q7W A;  5BXS A;  1RG8 A;  41BI A;  2QYI B;  4OEG A;  4IY9 A;  2HWM A;  3QR5 A;  4J2Y A;  1TTU A;  3AZW A;  4GOV A;  2VSE A;  4I1E A;  5JMC A;  5DZU A;  4LO0 C;  2IHO A;  3VUO A;  3CA5 A;  4G9N A;  4I6I A;  3C9Z A;  3R4U A;  4I37 A;  3WIN C;  1FGA A;  4ZBV B;  1AF9 A;  3BX1 C;  4Q9P A;  3FJ9 A;  3AKF A;  1R8N A;  4JKX B;  2RG9 B;  2D44 A;  5D63 A;  3O4B A;  1ISX A;  2D24 A;  4IHZ A;  1ABR B;  4G1R A;  4I4V A;  3FGM A;  4EFP A;  3WO3 A;  3NBD A;  1UPS A;  4R6U B;  1M2T B;  1II4 A;  1FV2 A;  1DZD A;  2BEA A;  3BRG C;  3AJ5 A;  2FFV A;  4HJJ A;  3WIN A;  3I29 B;  3FJF A;  3IM7 A;  3CU1 B;  4I3N A;  3AJ6 A;  4JAW A;  3IM6 A;  1CE7 B;  4DEN A;  3O4C A;  1G9B A;  1DQG A;  1FWU A;  3CQA A;  2Q9X A;  1ISY A;  4L4I A;  3CA1 A;  3FJJ A;  2FFU A;  1GGP B;  4X3A A;  3IM5 A;  2DS0 A;  1EVT A;  2NS2 A;  4XKI A;  6I1B A;  21BI A;  1W3G A;  1PC8 B;  5EC5 A;  1T9F A;  3A07 A;  1TIE A;  3NBE A;  4KEI A;  2D22 A;  3AH4 A;  4XFS A;  1MC9 A;  3RSJ A;  2X2T A;  3P6J A;  2R9K B;  3O44 A;  4ISR A;  1TWM A;  3FUO A;  3I2X A;  2ERM A;  4LO3 A;  1Q03 A;  3K1X A;  4IYB A;  3AZV A;  3IIR A;  3PHZ A;  3POK A;  3UDA A;  1BLD A;  1JT7 A;  3FJH A;  4I4Q A;  4A7Y A;  4QAL A;  2X2S A;  1VCL A;  3S8K A;  5BOW A;  2KKI A;  2VXR A;  1AVW B;  3A21 A;  2AFG A;  1HWO B;  2ZR1 B;  31BI A;  3E8L C;  3VT1 A;  5DVH A;  3D7W B;  3WMU A;  3BRF A;  4P6A A;  1DFC A;  3FJA A;  3BAV A;  2L5X A;  2AXM A;  4OWJ A;  4KBB A;  1SR4 C;  1S0D A;  4IZE A;  1BFF A;  3OGG A;  3VT0 A;  1PUM B;  3CA4 A;  2K4A B;  2ESU A;  3H6S E;  3PME A;  2MC2 A;  2HWA A;  3OJ2 A;  2D20 A;  3CA3 A;  4IQP A;  3A23 A;  1F31 A;  1TFM B;  2J3P A;  3FJC A;  1K5U A;  4I4O A;  2BFH A;  1JY0 A;  1S0E A;  4A7Z A;  3BAQ A;  1Z0H A;  1HWN B;  3HBW A;  3BAH A;  4P0K A;  4ZFY B;  1HCD A;  1BLA A;  1HKN A;  2AAI B;  3ZC9 A;  1IIL A;  4MZG B;  2GZB A;  4ZLB B;  3FJE A;  1NUN A;  1ITB A;  2FGF A;  1SR4 A;  2HW9 A;  3R4S A;  4USO A;  3N7L A;  1J0S A;  2K8R A;  4LO7 C;  3OJM A;  3W9T A;  3H6R A;  3N7K A;  2VU9 A;  3IAG C;  5FNX A;  5DSS B;  3ZX7 A;  4IZX A;  1HWM B;  1BA7 A;  1JTC A;  4UY4 A;  4Z9W B;  1CVS A;  3HSM A;  4QBV A;  3HMY A;  4X39 A;  4D0T A;  3OBR A;  4ISQ A;  1HCE A;  3B9U A;  1V6V A;  1N4K A;  4G6J A;  4ZA3 B;  1IOB A;  4QD2 C;  2WBC A;  1FMZ A;  3O5W B;  4ION A;  4XFT A;  1YBI A;  1HWP B;  3WA1 A;  1ISZ A;  4LO7 B;  1EPW A;  1IT0 A;  3H6Q A;  4OEF A;  2D43 A;  1QQL A;  3RMX A;  1MD6 A;  3SNV A;  3UD8 A;  2D23 A;  2WRY A;  3VEQ A;  4A7K A;  3AH2 A;  1ISV A;  3UJ4 A;  3NBN A;  5HPZ A;  1FMM S;  2RST A;  3F1R A;  1PUU B;  4I2S A;  1DLL A;  1EYL A;  3RMY A;  3MPP G;  3F62 B;  4I8M A;  4LO3 C;  1DIW A;  1S0C A;  4QD2 B;  4YOL A;  5FNW A;  1Q1U A;  3AH1 A; 
#chains in the Genus database with same CATH homology
 1YTO A;  4DCK C;  3BAD A;  1FWV A;  1A8D A;  3V0A B;  3V0A A;  1FQ9 A;  3LTQ A;  4KEK A;  2YUG A;  1L2H A;  2Z48 A;  1BAS A;  5D61 A;  3CRI A;  4I96 A;  2VUA A;  2FO1 A;  3N7M A;  4EEE B;  1V6X A;  2UUS A;  4QKS A;  3A22 A;  1QXM A;  5EHA A;  3Q7Y A;  4USP A;  5BXT A;  1JT5 A;  1G9C A;  3BAO A;  3QYD A;  1DQO A;  5FZU A;  3CAH A;  3CRH A;  3VSZ A;  1DFQ A;  4I4P A;  2D1Z A;  4L4H A;  4G9M A;  4EFQ A;  5BVP I;  2KI4 A;  2QN4 A;  3OBT A;  2ZQO A;  3OGF A;  2MLL B;  2HZ9 A;  4GP0 A;  4P0L A;  2E4M A;  2LIQ A;  4FVV A;  4JP0 A;  2Q3N B;  4AN7 B;  3UJ0 A;  1W3F A;  1RY7 A;  4WBC A;  1Z4S A;  3BB2 A;  1YXW A;  1JLY A;  3BA4 A;  1Z2V A;  4IY8 A;  4ZKT B;  4OWK A;  4ZOT A;  4AN6 A;  1I1B A;  3FJI A;  3S8J A;  1Q04 A;  2F8X C;  1KNM A;  4GP3 A;  3Q7X A;  1RML A;  7I1B A;  1ILR 1;  3N0K A;  1XYF A;  4J2X A;  3AKI A;  4FGF A;  4Q91 A;  3O4O A;  1M16 A;  1XZZ A;  1DJS B;  4X37 A;  2VSA A;  1XG6 A;  4OUJ A;  4KC3 A;  5E24 E;  4HA2 A;  2IWT B;  5F90 A;  4G6M A;  1R8O A;  5G00 A;  4LO1 C;  3RTI B;  3VT2 A;  5F8S A;  5FZZ A;  4J2S A;  1JQZ A;  3H6R B;  4JQ0 A;  3V0B A;  1ISW A;  3ZXG A;  3MAL A;  1BFG A;  1WD3 A;  3V79 C;  3WO2 A;  4GOY A;  5BXR A;  4MZF B;  4OWL A;  3BAU A;  1FV3 A;  1YF8 B;  1NZK A;  1G9D A;  5FZY A;  2KH2 A;  3O4A A;  4H75 A;  3CA6 A;  2D7R A;  3HAL A;  3KMV A;  4QBC A;  3JRR A;  3JUT A;  1S0F A;  3UD9 A;  4QKR A;  1FN0 A;  2AQZ A;  1WBA A;  4LO1 A;  4DEP A;  3FUQ A;  1D0H A;  5F8W A;  1ONK B;  1OQL B;  3P53 A;  1G82 A;  3ZXD A;  4MZH A;  4I4Y A;  1WBC A;  3FJB A;  3BRD A;  1T4Q A;  4END A;  1TP0 A;  2NZ9 A;  3PUB A;  4D0Z A;  3ILA A;  5BP5 C;  2P23 A;  4GAI A;  4I0Y A;  2DRY A;  1I1E A;  1AVA C;  1E0O A;  4P0J A;  2KLL A;  2LIE A;  2Y9G A;  3PG0 A;  1DZC A;  1V6W A;  2NM1 A;  1V6U A;  2NTD A;  2VXT I;  5D62 A;  2NVH A;  2VLC A;  3CRG A;  1IRA X;  2I1B A;  4LO0 A;  4J2K A;  1K5V A;  1W3A A;  2F2F C;  3CA0 A;  4LO8 B;  1G9A A;  2E4M C;  4JKQ A;  4ZGR B;  2D7I A;  4F83 A;  3EF2 A;  1IRP A;  3BA7 A;  5BP5 A;  2RQ9 A;  2GO2 A;  4H04 A;  4I4X A;  3BA5 A;  4I4U A;  4OEE A;  3WO4 A;  3OJV A;  1BFB A;  1AXM A;  3VSF A;  2ZQN A;  9ILB A;  4CJM A;  4KEJ A;  1AVU A;  1PWA A;  2DRZ A;  4JRA A;  3FJD A;  4QC4 A;  5EG6 C;  4JPZ A;  2Y9F A;  1S0B A;  1YYN A;  1WD4 A;  2KI6 B;  3RTJ B;  5GAQ A;  2F2F A;  3N7J A;  2MIB A;  4QO3 A;  4EB2 B;  2ET2 A;  3HOM A;  4LO2 C;  5BQU C;  4TLP A;  3O4D A;  2Y9W C;  1TOO A;  4PC4 A;  2XOA A;  5JLV A;  1QQK A;  4EKX B;  4ZFU B;  1JLX A;  3FJ8 A;  1EV2 A;  1S0G A;  3WMV A;  2K43 A;  1HIB A;  4H9W A;  4Q9G A;  3FJK A;  4X38 A;  4HR6 C;  4OW4 A;  3I2A A;  1XHB A;  4F34 A;  1JT3 A;  5F8Y A;  3VWC A;  1AFC A;  4I7I A;  1S0L A;  1PZZ A;  3P6I A;  3LLP A;  2FDB M;  3O3Q A;  4LO2 A;  3AKG A;  4XFU A;  5BQU A;  1JT4 A;  5I1B A;  1AVX B;  3UD7 A;  3FFZ A;  5B2H A;  3BAG A;  3ZC8 A;  1RZO B;  1IJT A;  2NP0 A;  3BTA A;  3NJ5 A;  1P63 A;  4I4R A;  1IHK A;  4I1B A;  4Z8S B;  3V0B B;  5BXP A;  1BFC A;  5DUY A;  3AKH A;  3NBC A;  2DRE A;  4II0 A;  4J23 B;  1SZ6 B;  4ZFW B;  2M49 A;  3TC2 A;  1BAR A;  8I1B A;  3O49 A;  2Z49 A;  2BEB A;  4I4S A;  1TWE A;  3HN1 A;  4GAF A;  3T8S A;  2P39 A;  2NYY A;  4D8H A;  4EFR A;  2Y9X E;  3Q7W A;  5BXS A;  1RG8 A;  41BI A;  2QYI B;  4OEG A;  4IY9 A;  2HWM A;  3QR5 A;  4J2Y A;  1TTU A;  3AZW A;  4GOV A;  2VSE A;  4I1E A;  5JMC A;  5DZU A;  4LO0 C;  2IHO A;  3VUO A;  3CA5 A;  4G9N A;  4I6I A;  3C9Z A;  3R4U A;  4I37 A;  3WIN C;  1FGA A;  4ZBV B;  1AF9 A;  3BX1 C;  4Q9P A;  3FJ9 A;  3AKF A;  1R8N A;  4JKX B;  2RG9 B;  2D44 A;  5D63 A;  3O4B A;  1ISX A;  2D24 A;  4IHZ A;  1ABR B;  4G1R A;  4I4V A;  3FGM A;  4EFP A;  3WO3 A;  3NBD A;  1UPS A;  4R6U B;  1M2T B;  1II4 A;  1FV2 A;  1DZD A;  2BEA A;  3BRG C;  3AJ5 A;  2FFV A;  4HJJ A;  3WIN A;  3I29 B;  3FJF A;  3IM7 A;  3CU1 B;  4I3N A;  3AJ6 A;  4JAW A;  3IM6 A;  1CE7 B;  4DEN A;  3O4C A;  1G9B A;  1DQG A;  1FWU A;  3CQA A;  2Q9X A;  1ISY A;  4L4I A;  3CA1 A;  3FJJ A;  2FFU A;  1GGP B;  4X3A A;  3IM5 A;  2DS0 A;  1EVT A;  2NS2 A;  4XKI A;  6I1B A;  21BI A;  1W3G A;  1PC8 B;  5EC5 A;  1T9F A;  3A07 A;  1TIE A;  3NBE A;  4KEI A;  2D22 A;  3AH4 A;  4XFS A;  1MC9 A;  3RSJ A;  2X2T A;  3P6J A;  2R9K B;  3O44 A;  4ISR A;  1TWM A;  3FUO A;  3I2X A;  2ERM A;  4LO3 A;  1Q03 A;  3K1X A;  4IYB A;  3AZV A;  3IIR A;  3PHZ A;  3POK A;  3UDA A;  1BLD A;  1JT7 A;  3FJH A;  4I4Q A;  4A7Y A;  4QAL A;  2X2S A;  1VCL A;  3S8K A;  5BOW A;  2KKI A;  2VXR A;  1AVW B;  3A21 A;  2AFG A;  1HWO B;  2ZR1 B;  31BI A;  3E8L C;  3VT1 A;  5DVH A;  3D7W B;  3WMU A;  3BRF A;  4P6A A;  1DFC A;  3FJA A;  3BAV A;  2L5X A;  2AXM A;  4OWJ A;  4KBB A;  1SR4 C;  1S0D A;  4IZE A;  1BFF A;  3OGG A;  3VT0 A;  1PUM B;  3CA4 A;  2K4A B;  2ESU A;  3H6S E;  3PME A;  2MC2 A;  2HWA A;  3OJ2 A;  2D20 A;  3CA3 A;  4IQP A;  3A23 A;  1F31 A;  1TFM B;  2J3P A;  3FJC A;  1K5U A;  4I4O A;  2BFH A;  1JY0 A;  1S0E A;  4A7Z A;  3BAQ A;  1Z0H A;  1HWN B;  3HBW A;  3BAH A;  4P0K A;  4ZFY B;  1HCD A;  1BLA A;  1HKN A;  2AAI B;  3ZC9 A;  1IIL A;  4MZG B;  2GZB A;  4ZLB B;  3FJE A;  1NUN A;  1ITB A;  2FGF A;  1SR4 A;  2HW9 A;  3R4S A;  4USO A;  3N7L A;  1J0S A;  2K8R A;  4LO7 C;  3OJM A;  3W9T A;  3H6R A;  3N7K A;  2VU9 A;  3IAG C;  5FNX A;  5DSS B;  3ZX7 A;  4IZX A;  1HWM B;  1BA7 A;  1JTC A;  4UY4 A;  4Z9W B;  1CVS A;  3HSM A;  4QBV A;  3HMY A;  4X39 A;  4D0T A;  3OBR A;  4ISQ A;  1HCE A;  3B9U A;  1V6V A;  1N4K A;  4G6J A;  4ZA3 B;  1IOB A;  4QD2 C;  2WBC A;  1FMZ A;  3O5W B;  4ION A;  4XFT A;  1YBI A;  1HWP B;  3WA1 A;  1ISZ A;  4LO7 B;  1EPW A;  1IT0 A;  3H6Q A;  4OEF A;  2D43 A;  1QQL A;  3RMX A;  1MD6 A;  3SNV A;  3UD8 A;  2D23 A;  2WRY A;  3VEQ A;  4A7K A;  3AH2 A;  1ISV A;  3UJ4 A;  3NBN A;  5HPZ A;  1FMM S;  2RST A;  3F1R A;  1PUU B;  4I2S A;  1DLL A;  1EYL A;  3RMY A;  3MPP G;  3F62 B;  4I8M A;  4LO3 C;  1DIW A;  1S0C A;  4QD2 B;  4YOL A;  5FNW A;  1Q1U A;  3AH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...