4QOBA

Crystal structure of cpop1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
87
structure length
87
Chain Sequence
TKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASYYEDYAAELVVAVLRDMRMLEEAARLQRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of cPOP1
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Pyrin domain-containing protein 1
total genus 34
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02758 PYRIN PAAD/DAPIN/Pyrin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4qobA00
1UCPA 1NGRA 4JQWA 2YVIA 2NAQA 4O7QA 3CRDA 2DBFA 2N80A 2YQFA 2LWDA 2HM2Q 2YGSA 1Z6TA 4ZBWA 2BBZA 2YU0A 3T6PA 2GF5A 2DBHA 3MOPG 4O6XA 4NQKA 2B1WA 4UZ0A 4D8OA 4DWNA 2O71A 4IZ5E 3EZQB 2DBGA 1D2ZB 2A9IA 2KM6A 4O9FA 2MN4A 3MOPA 2G7RA 2IB1A 2P1HA 2LWEA 4IZ7B 4P4HA 4I16A 2MS7A 4M9ZA 4N1JA 2BBRA 2A5YB 3QF2A 4JUPA 2F1SA 3LQRA 3MOPK 1CY5A 2NZ7A 1DDFA 1A1WA 1N3KA 1D2ZA 3CL3A 4O9LA 1C15A 2OF5A 2N7ZA 3YGSP 3KATA 1E41A 1CWWA 2MPCA 2L9MA 4P4HI 1DGNA 2L6AA 2NSNA 4RHWA 4EWIA 4FH0A 4M9SA 4F42A 4E9MA 2VGQA 1FADA 2D96A 3EZQA 2N00A 1WXPA 2N83A 4LWDA 2DO9A 2M5VA 3J6JA 1ICHA 4M9XA 2DBDA 3LQQA 4N1LA 2N1FA 2KN6A 4A2QA 1WH4A 1E3YA 4RHWE 1PN5A 2MB9A 4A2WA 2N97A 1WMGA 4F44A 2MS8A 4QOBA 3J63A 1A1ZA 3YGSC 4IZAB 4N1KA 2LS7A 1YGOA 2OF5H
chains in the Genus database with same CATH superfamily
1UCPA 1NGRA 4JQWA 2YVIA 2NAQA 4O7QA 3CRDA 2DBFA 2N80A 2YQFA 2LWDA 2HM2Q 2YGSA 1Z6TA 4ZBWA 2BBZA 2YU0A 3T6PA 2GF5A 2DBHA 3MOPG 4O6XA 4NQKA 2B1WA 4UZ0A 4D8OA 4DWNA 2O71A 4IZ5E 3EZQB 2DBGA 1D2ZB 2A9IA 2KM6A 4O9FA 2MN4A 3MOPA 2G7RA 2IB1A 2P1HA 2LWEA 4IZ7B 4P4HA 4I16A 2MS7A 4M9ZA 4N1JA 2BBRA 2A5YB 3QF2A 4JUPA 2F1SA 3LQRA 3MOPK 1CY5A 2NZ7A 1DDFA 1A1WA 1N3KA 1D2ZA 3CL3A 4O9LA 1C15A 2OF5A 2N7ZA 3YGSP 3KATA 1E41A 1CWWA 2MPCA 2L9MA 4P4HI 1DGNA 2MJMA 2L6AA 2NSNA 4RHWA 4EWIA 4FH0A 4M9SA 4F42A 4E9MA 2VGQA 1FADA 2D96A 3EZQA 2N00A 1WXPA 2N83A 4LWDA 2DO9A 2M5VA 3J6JA 1ICHA 4M9XA 2DBDA 3LQQA 4N1LA 2N1FA 2KN6A 4A2QA 1WH4A 1E3YA 4RHWE 1PN5A 2MB9A 4A2WA 2N97A 1WMGA 4F44A 2MS8A 4QOBA 3J63A 1A1ZA 3YGSC 4IZAB 4N1KA 2LS7A 1YGOA 2OF5H 2XV9A
chains in the Genus database with same CATH topology
1UCPA 1NGRA 4JQWA 2YVIA 2NAQA 4O7QA 3CRDA 2DBFA 2N80A 2YQFA 2LWDA 2HM2Q 2YGSA 1Z6TA 4ZBWA 2BBZA 2YU0A 3T6PA 2GF5A 2DBHA 3MOPG 4O6XA 4NQKA 2B1WA 4UZ0A 4D8OA 4DWNA 2O71A 4IZ5E 3EZQB 2DBGA 1D2ZB 2A9IA 2KM6A 4O9FA 2MN4A 3MOPA 2G7RA 2IB1A 2P1HA 2LWEA 4IZ7B 4P4HA 4I16A 2MS7A 4M9ZA 4N1JA 2BBRA 2A5YB 3QF2A 4JUPA 2F1SA 3LQRA 3MOPK 1CY5A 2NZ7A 1DDFA 1A1WA 1N3KA 1D2ZA 3CL3A 4O9LA 1C15A 2OF5A 2N7ZA 3YGSP 3KATA 1E41A 1CWWA 2MPCA 2L9MA 4P4HI 1DGNA 2MJMA 2L6AA 2NSNA 4RHWA 4EWIA 4FH0A 4M9SA 4F42A 4E9MA 2VGQA 1FADA 2D96A 3EZQA 2N00A 1WXPA 2N83A 4LWDA 2DO9A 2M5VA 3J6JA 1ICHA 4M9XA 2DBDA 3LQQA 4N1LA 2N1FA 2KN6A 4A2QA 1WH4A 1E3YA 4RHWE 1PN5A 2MB9A 4A2WA 2N97A 1WMGA 4F44A 2MS8A 4QOBA 3J63A 1A1ZA 3YGSC 4IZAB 4N1KA 2LS7A 1YGOA 2OF5H 2XV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UCP A;  1NGR A;  4JQW A;  2YVI A;  2NAQ A;  4O7Q A;  3CRD A;  2DBF A;  2N80 A;  2YQF A;  2LWD A;  2HM2 Q;  2YGS A;  1Z6T A;  4ZBW A;  2BBZ A;  2YU0 A;  3T6P A;  2GF5 A;  2DBH A;  3MOP G;  4O6X A;  4NQK A;  2B1W A;  4UZ0 A;  4D8O A;  4DWN A;  2O71 A;  4IZ5 E;  3EZQ B;  2DBG A;  1D2Z B;  2A9I A;  2KM6 A;  4O9F A;  2MN4 A;  3MOP A;  2G7R A;  2IB1 A;  2P1H A;  2LWE A;  4IZ7 B;  4P4H A;  4I16 A;  2MS7 A;  4M9Z A;  4N1J A;  2BBR A;  2A5Y B;  3QF2 A;  4JUP A;  2F1S A;  3LQR A;  3MOP K;  1CY5 A;  2NZ7 A;  1DDF A;  1A1W A;  1N3K A;  1D2Z A;  3CL3 A;  4O9L A;  1C15 A;  2OF5 A;  2N7Z A;  3YGS P;  3KAT A;  1E41 A;  1CWW A;  2MPC A;  2L9M A;  4P4H I;  1DGN A;  2L6A A;  2NSN A;  4RHW A;  4EWI A;  4FH0 A;  4M9S A;  4F42 A;  4E9M A;  2VGQ A;  1FAD A;  2D96 A;  3EZQ A;  2N00 A;  1WXP A;  2N83 A;  4LWD A;  2DO9 A;  2M5V A;  3J6J A;  1ICH A;  4M9X A;  2DBD A;  3LQQ A;  4N1L A;  2N1F A;  2KN6 A;  4A2Q A;  1WH4 A;  1E3Y A;  4RHW E;  1PN5 A;  2MB9 A;  4A2W A;  2N97 A;  1WMG A;  4F44 A;  2MS8 A;  4QOB A;  3J63 A;  1A1Z A;  3YGS C;  4IZA B;  4N1K A;  2LS7 A;  1YGO A;  2OF5 H; 
#chains in the Genus database with same CATH topology
 1UCP A;  1NGR A;  4JQW A;  2YVI A;  2NAQ A;  4O7Q A;  3CRD A;  2DBF A;  2N80 A;  2YQF A;  2LWD A;  2HM2 Q;  2YGS A;  1Z6T A;  4ZBW A;  2BBZ A;  2YU0 A;  3T6P A;  2GF5 A;  2DBH A;  3MOP G;  4O6X A;  4NQK A;  2B1W A;  4UZ0 A;  4D8O A;  4DWN A;  2O71 A;  4IZ5 E;  3EZQ B;  2DBG A;  1D2Z B;  2A9I A;  2KM6 A;  4O9F A;  2MN4 A;  3MOP A;  2G7R A;  2IB1 A;  2P1H A;  2LWE A;  4IZ7 B;  4P4H A;  4I16 A;  2MS7 A;  4M9Z A;  4N1J A;  2BBR A;  2A5Y B;  3QF2 A;  4JUP A;  2F1S A;  3LQR A;  3MOP K;  1CY5 A;  2NZ7 A;  1DDF A;  1A1W A;  1N3K A;  1D2Z A;  3CL3 A;  4O9L A;  1C15 A;  2OF5 A;  2N7Z A;  3YGS P;  3KAT A;  1E41 A;  1CWW A;  2MPC A;  2L9M A;  4P4H I;  1DGN A;  2MJM A;  2L6A A;  2NSN A;  4RHW A;  4EWI A;  4FH0 A;  4M9S A;  4F42 A;  4E9M A;  2VGQ A;  1FAD A;  2D96 A;  3EZQ A;  2N00 A;  1WXP A;  2N83 A;  4LWD A;  2DO9 A;  2M5V A;  3J6J A;  1ICH A;  4M9X A;  2DBD A;  3LQQ A;  4N1L A;  2N1F A;  2KN6 A;  4A2Q A;  1WH4 A;  1E3Y A;  4RHW E;  1PN5 A;  2MB9 A;  4A2W A;  2N97 A;  1WMG A;  4F44 A;  2MS8 A;  4QOB A;  3J63 A;  1A1Z A;  3YGS C;  4IZA B;  4N1K A;  2LS7 A;  1YGO A;  2OF5 H;  2XV9 A; 
#chains in the Genus database with same CATH homology
 1UCP A;  1NGR A;  4JQW A;  2YVI A;  2NAQ A;  4O7Q A;  3CRD A;  2DBF A;  2N80 A;  2YQF A;  2LWD A;  2HM2 Q;  2YGS A;  1Z6T A;  4ZBW A;  2BBZ A;  2YU0 A;  3T6P A;  2GF5 A;  2DBH A;  3MOP G;  4O6X A;  4NQK A;  2B1W A;  4UZ0 A;  4D8O A;  4DWN A;  2O71 A;  4IZ5 E;  3EZQ B;  2DBG A;  1D2Z B;  2A9I A;  2KM6 A;  4O9F A;  2MN4 A;  3MOP A;  2G7R A;  2IB1 A;  2P1H A;  2LWE A;  4IZ7 B;  4P4H A;  4I16 A;  2MS7 A;  4M9Z A;  4N1J A;  2BBR A;  2A5Y B;  3QF2 A;  4JUP A;  2F1S A;  3LQR A;  3MOP K;  1CY5 A;  2NZ7 A;  1DDF A;  1A1W A;  1N3K A;  1D2Z A;  3CL3 A;  4O9L A;  1C15 A;  2OF5 A;  2N7Z A;  3YGS P;  3KAT A;  1E41 A;  1CWW A;  2MPC A;  2L9M A;  4P4H I;  1DGN A;  2MJM A;  2L6A A;  2NSN A;  4RHW A;  4EWI A;  4FH0 A;  4M9S A;  4F42 A;  4E9M A;  2VGQ A;  1FAD A;  2D96 A;  3EZQ A;  2N00 A;  1WXP A;  2N83 A;  4LWD A;  2DO9 A;  2M5V A;  3J6J A;  1ICH A;  4M9X A;  2DBD A;  3LQQ A;  4N1L A;  2N1F A;  2KN6 A;  4A2Q A;  1WH4 A;  1E3Y A;  4RHW E;  1PN5 A;  2MB9 A;  4A2W A;  2N97 A;  1WMG A;  4F44 A;  2MS8 A;  4QOB A;  3J63 A;  1A1Z A;  3YGS C;  4IZA B;  4N1K A;  2LS7 A;  1YGO A;  2OF5 H;  2XV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...