4QOKE

Structural basis for ineffective t-cell responses to mhc anchor residue improved heteroclitic peptides
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
244
structure length
244
Chain Sequence
b'SQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSVGIGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWSETGLGTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Structural basis for ineffective T-cell responses to MHC anchor residue-improved "heteroclitic" peptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 244
sequence length 244
ec nomenclature
pdb deposition date 2014-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qokE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qokE01
2JF1A 1TFHA 4GW4B 4O2EB 1FZJA 1F5WA 3VXRB 3ZZ1A 3QI9C 3RWHB 5FDWA 2CKBA 1T20B 2VZSA 1JMXA 2V2TB 2YUVA 3P0GB 5DLMH 4X9HA 3KLHD 3PDOB 1NMAL 5DK0A 5D2NB 3HE7B 5FHAL 3SDYL 3GJFA 1YJDL 4UV7L 3QUYC 3L7FB 3TWCH 4M4PA 3UC0H 4CJ0A 2MWCA 2DTSA 4WI4A 4LQFH 1MREH 4PYGA 2YK1H 3FB6A 4S1DD 1UKTA 1QD0A 2IALB 4WTZG 1C08A 5FIEA 5EU5A 3QG7H 2GT9B 2UVFA 3QEQB 4LU5H 4WRLA 3KPLB 3F7YB 4QHMB 5CJOL 3KYMB 4XCCH 1RVFL 3VXRE 3IJHB 1UWGL 2EH8H 2R2CA 2A9ML 5GZOC 2XTLA 3CDYA 1P1ZB 4XGZA 4HBCL 4PJEA 3AUVA 5I30H 2R0LL 3MUHL 5EBMB 4C56B 3DETD 4RA3A 4K8RC 2OJZH 4XNXL 5F3HB 1N0XH 4U4BA 4YK4B 2FECL 2HJLB 3O0RH 5LBSL 3EW3B 5CGYC 4R6UA 1DQLL 1V7NL 4V1DA 4EJ1C 2AK4D 3ZE0E 2F54B 1CDCA 3BRDA 5JDSB 3QEQE 3GIVB 4HT1H 4L9LB 1INEL 5SV4A 4LLYA 3R8QA 3FN9A 1DANT 1U8PA 4N8VA 3INUH 2GTZB 5DC0A 4NHCL 1WZLA 4GW5B 4KHXH 3O9WC 5CZVH 4MJ6A 4ZPVB 3CXHK 4X6FB 1WWWX 3WO3B 4YE4L 4C56E 1CICB 3SHSA 3MUGA 4TUJA 1DUZA 2AJYH 2QQQA 3EOYG 1CTOA 3V0WH 3T2NL 3U1SL 2EKSB 1NGXA 5HGHA 5B21A 4AENB 3STLA 3QDJE 4LDLB 5F3BB 4E42A 1I3GH 3SN6N 4TUOB 4EVNB 4DEPC 4LQ1A 4HPOL 4APQD 5C0FA 4B0MM 2I07A 4MA1B 2WINA 2F54E 4K3JL 2W0KA 2F53D 3EHBC 4NQEB 4P9HH 3SCMC 2LAGB 3R0MA 1KC5H 5EU7C 5F96H 2JB6A 4Q58C 3X13B 2IPTL 4XP5L 3O3EA 5FO8B 1R6VA 3UYOD 3IFNH 1UA6H 2QKIA 2X1WL 4LLQA 1HN1A 1HNFA 1QLRB 3GMRB 4M5ZL 3ES6A 1ZLVH 2Z92A 5F9WB 4QRUA 2M1KA 2HFTA 1TVBB 1HZHH 3JUYA 4PGZA 2XA3A 2HT3D 4X6BA 2R56H 2YZ1A 1TETH 2HWZH 4QNPF 3QIBB 4D0CA 2ED8A 4G6ML 1U3HC 5ISZB 5I1DB 4X5XB 1SJEA 5AUMA 5FYKH 1ODAA 3BP6B 1IQWH 2H32H 3S98A 3S3SA 2P8PA 1RD6A 4PJ9C 5CCKL 4M7ZB 3ULVF 1SJHB 2CKNA 2FJHB 4Y5YA 3CZFA 4G6KL 5IESH 1N6QL 1XIWC 3EDEA 1JRHH 3V2AR 4AEFA 4E41A 2YD7A 3PQYB 1VEPA 5F97E 1AO7D 1LO5B 1MLBA 2DLIA 1M7DB 5F71A 4PGJA 1K8DA 2WWKO 4O00A 4G3YL 5F7FA 2NY2C 5F7DB 3HC0B 4UTBH 3CH1B 2ILLA 4JRWA 4LSSH 4U1IB 3CIQA 4Z7UB 3T3PE 1TQBC 5ISZE 1QPXA 3K4DA 1AGDB 3LAFA 3KPMB 3IFLH 5I1HH 2EC8A 2ZNXA 4HIXH 3BQUA 3MX0A 5LQBL 4HGWA 2O61A 4MZ2A 4K3DL 4ODXA 4F58L 4HGKC 5T1LB 1FL5B 2IADA 3SDCD 1LDPH 4BFBD 1GSMA 3O2WL 4MLIA 1UXSA 4MA8L 3L5WB 5INCA 5C0BB 4NO3B 5KSAA 1SBSL 3LKNA 1NBVH 2M2DA 1ADQL 3IKCA 1QHOA 4Z7UE 4OFIA 5FB8B 4OSUL 4NNYB 4ORGA 5IHUL 5KVGH 1J5OH 2EO1A 4TSBH 4M9PA 3SKUD 3LDBB 1HDMA 2OK0H 4DK3A 4JGJA 2I60L 3A6BH 3ARGC 4Q9RH 3WKMH 5CJXA 1UVQA 4JDZB 5I1EL 4MWFB 2QLVB 5F1NA 3V6BR 2A9NH 4S1SH 4GAFB 5DUPH 5C0BE 5IEKA 5LXGL 4WI9A 1BFOA 4O02L 2DF3A 3MGTA 4WV1B 2PTTA 3RWEB 1IC4H 4AK1A 5ETUA 1A21A 1IC1A 1ZSDB 5CSGA 1JGDB 4QTHA 1AR2A 4AZ8A 2QJDA 1T2QH 3O9WA 3RDTD 5ANMB 1BQHB 4D9RE 3MRGB 3PWPA 3MCKA 1UWEH 4JKPH 5DA4A 3LN9A 1ZGLM 3IVKB 2OL3H 4Y4KD 2FYYB 2JJSC 3FOLA 4V2BA 1SMOA 4M1CD 2VZUA 5IJVB 3QULA 1P4IH 4Y1AD 1T0NA 1FZMA 3WFCH 3UDWC 1MJ7H 3SKJH 2ZCLL 5L9DL 4CVZA 4OZIF 4P5TD 5TPWH 4U7MA 2D9QB 3VH8A 3IDMA 1KACB 3DRTB 4Q0XH 2FNBA 3NZHL 3VFWA 3G6JB 2NY1C 4IMKC 1IBGH 2FB4H 4BKLA 3T2QA 5DD5L 5EU6E 4L4VD 3S37X 4WHYG 5CLTA 5AD0A 2VDMH 5IM7B 3KYKL 4XP9L 4OF0A 3AS0A 3OJDA 5D6CA 4YPGB 3CVIL 1YYLL 1I8LC 1G7IA 1QBBA 4M7KH 4N9OB 4TSCH 1CLYH 2V2WA 2DQFB 1LVEA 4LASH 4NNPL 2PO6A 3EO0A 2JKXA 1GGIL 4KK9C 5TH2A 5KG9B 2FH6A 4K3EH 4EI5C 3DVGA 3P4LA 5D4QA 2ENYA 3P4NA 5F7MC 2GJ6D 5C09D 3D18B 3RUGF 2ZPKL 2Q86B 3G6JE 5JOPE 1WZ1H 3K46A 5LKNA 2X40A 4JJ5B 5JOEA 2ZWLT 3B83A 4KQ4L 4X5WB 2CMRL 3CX2A 3C8DA 3L7EB 1AXTH 2WWMC 3VFGL 4NZDA 1MUJA 4GRMA 4PRPD 4FQJH 5BOZG 1LD9A 4ODSH 1FNGB 1CDJA 1JV5B 3SGEI 5F1SA 3T4AB 4HJGA 4KI5F 3ARED 1H3XA 4ZNEE 1Q9LB 3VFSA 2HFEA 3MV8A 3MLYL 3HB3C 4JANB 1A6UH 1YNLH 5CBAB 4XBEL 3QBTB 3LKPB 2QHRL 3KPSD 4N68A 1WF5A 2OR9H 3TNNA 3VW3L 1NBYA 3MRLA 4P59L 2NMSA 3VGHA 1A4KB 4YDLC 5IB2A 1KB5A 12E8H 2EDLA 5E5UB 1GGCL 5IKCB 3TA3A 5J3HC 5HPMB 4QHLB 4PRDA 2EDTA 4O58L 1HQRB 3NCYP 1N8ZA 4R26L 1NCNA 4QHNA 1MI5B 1YEKH 2BK8A 1HINL 4M6OL 1VSCA 1H3UA 3MRQB 2R2HB 3T2PA 2W60B 1QFUH 3O3BB 3QUZB 3ULVH 2AXFA 2WQ8A 4W4NA 2DICA 4RA0C 5DJ8B 5FGRA 5ESQA 3TPUA 3ARGA 2EYRB 3QQ9D 5IUSA 2VAJA 3QNXB 4RGND 2BMKB 3KVQA 4RMSA 3DV6B 4UOJA 4HMEA 4PJCB 3VFVA 4HWNA 2X1XR 4OM1L 1XF1A 3J8F7 5J7CC 1FSKC 2NXZC 3HCVB 3O41A 1NMAH 2HLFD 1AY1L 1ORSA 1LK3L 2NR6C 1QKZL 4FQLL 4FMKA 4Y8DC 5FHAH 2E6QA 3FZUC 2H26B 2G2RA 1YJDH 3DBXB 3SDYH 3VG9C 5ID1A 1VADA 3K80A 2W65A 5CP7A 1VACB 3X12A 4JQXA 4NO0D 3FO2B 4MA7L 1QFWI 3QAZC 1S3KH 1ZHBA 3JUZA 2X4NB 1IVLA 3DVNB 5MERA 3UJTH 5I8CB 5FA4A 3OB8A 4FFVC 5C0AD 5ITFA 4FG6D 4B41A 3TO4C 4M03A 5EBWB 3OKEB 4LPYA 3MYZA 3JVGA 1RVFH 4JN2A 1UWGH 4G9FD 5C0EA 4NWTL 4PJCE 2A9MH 3VA2C 5IFHL 2X4SB 4F7EB 4NQVA 3NZ8A 3SE9L 4JQIL 2W0FA 3V95A 3T65A 3W2DL 4PY8J 5ILTL 3GJEB 1BM3L 3G9AB 1T6WA 4K8RL 1HKLL 3RL1B 4XXDB 5LBSH 4Y89A 1XGRB 1T04A 1DQLH 3BPCA 1JTTA 3FOMB 4HIIB 3AY4C 3L3JA 4IHOA 5MEPA 1G6VK 1INEH 1JJUA 1WFNA 2NLJA 3UBXI 4XHJC 2ZOLB 1HCFX 5AG9A 3OXSB 5E5MB 1TZHB 2W07A 5I1KL 4NHCH 4FOMA 4PP2A 3OGCA 4P3CL 1FV1A 2QL1A 1QLFB 4QY8A 3LMJL 4ODBD 2HP4A 4F7MB 4YE4H 2OMNA 1W72L 5I15L 5FF6B 5C0JA 3T2NH 3U1SH 5DZOA 4MAUL 2Q6WA 1BD2A 3K1DA 3V6OE 4HPOH 4J1UB 4K7PX 5GRVK 1T1WB 3V5DA 1R3KA 2DI8A 4PD4K 4K3JH 3PF2A 1D6VL 1QHPA 1B0WA 2FGWL 5KANI 1IGML 4ALAL 1T89C 5B38G 3R8BB 1NEZB 1YDPB 2YD1A 3SEPA 2IPTH 4XP5H 3FQXB 4NUJA 5I73B 3NCBB 2VE6A 3S34L 5MENA 1Q72H 4EN3D 2P47B 5F6HJ 5F6IC 1QOKA 3VI4E 4X98B 3RAJH 1Z5LB 3RZWA 5J12C 1MFEL 1MCHA 4Z7VE 1N0LA 2YD8A 4R4ND 2D7TL 3WFEL 4U1KB 5DUBA 1NUDA 1N59A 3D85D 3OPZL 1T2JA 1JK8A 3DETC 1XZ0B 3RGHA 3OX8A 1MCKA 5E9DB 1U6AL 1DVFB 5HI3C 3AAZB 4HWEL 3BGMA 4ZFOB 3QH3B 3KNBB 4G6MH 2QSQA 3GI8H 4HIEB 5CEXA 1C7TA 5DF0A 5CP3H 5IROC 4M93B 3N1QC 4MXQC 1TQCC 5KJRL 1XH3B 3BZFB 4BM7A 3T77A 2B4CC 3G5YA 1P4LB 5CCKH 1BECA 4O5LL 5FOBA 1WTGT 2F5BH 4G6KH 1YPZB 1N6QH 1OOAA 3QG6B 5H94A 5MEQA 4HF5L 4P2RB 2FX8H 3AXLB 3VWKB 5L8JB 1UZ8B 2OP4L 3IDXL 3S3PA 1X5LA 4D9LH 1XAUA 4IBLT 4G3YH 5DVLA 5IBTL 4X6DB 3E6FA 1ES0A 5ACLA 2P7TB 3DOSA 5E9DE 3TC9A 4LLWA 2VLRD 4OZGB 4U1MB 1JIBA 4XP6H 3HI5L 5DMGC 3WNLA 3BP5B 4FQXB 1GZPB 2YPLD 5HDQL 1IKNC 2C26A 5HTSA 3MNZB 5DJDA 2DQIL 3UBXG 4NZRL 3BGAA 5LQBH 3QQ4A 1FDLL 1MFDL 3I2CL 5GZND 1NDGB 2NX5B 4K3DH 3ZDYE 2QQLL 5I1AA 1Q1JL 3VJ6B 1QLEL 4F58H 1ITCA 4P2RE 4Z6AT 4HJ0D 2CLVA 2HLAB 1ZMYA 3O2WH 2G5RA 4MA8H 3LY6A 4NBYB 3UAJD 1SBSH 5E7FA 3QO0B 3EO9L 1ADQH 1U95A 2E6JA 4X6DE 3S96B 3M07A 3O3DA 4LIQL 4OZGE 4G8FA 4IRSB 2H32B 1SHMA 4LHUB 3MBEB 1MIML 1K8IA 3EFFA 4G80B 2HT3C 4OSUH 2BP3A 4GRWB 4N8VG 5TDOA 3CFEA 2RJMA 4MD0A 5IF0A 5KANG 1S7QB 5KS9B 4QO1A 1G6RL 1BVLA 5BZWB 2NX5E 2I60H 2EE9A 2XY1A 3S5LG 1TDQA 2ZOKB 3IXTB 1T5XA 3HMXA 4Y5VA 1I9IL 5CEZD 1F4XL 3X11A 2ADFL 5I1EH 1JFQH 3V5HA 5DRWB 2VB5A 3PWLA 4RMTA 4HK0B 2NXYB 1K4CB 4YDJB 3S4SB 2XG5A 4O02H 2OTUA 4QT5B 1FO0A 3D39A 4HSQA 4GKSB 3ZSTA 1RK0B 4N9GA 4QXUL 4HUVA 3EZ8A 3GUTA 1J10A 4J3VA 4GRWE 4WW2C 4QWWD 2UWEB 1L6XA 1QPPA 4F2MB 2J8UE 4XNMB 5KS9E 1FFNB 2BSSB 2Q7YA 1XR9A 4Y19B 2BVQA 4MX7A 4PRHD 4JFDD 4PJXE 5IMOB 4WWKB 2L7UA 3HAEB 1KULA 1ORQB 3EO1B 4G9DB 2ZCLH 3UP1A 5L9DH 1T3FA 3HFMH 2QQNL 1KJ2A 3LS4L 4A6YH 3G6DL 4JO4H 1WIUA 4KJQD 4OQTL 2DMKA 3K0WA 3SDCC 3U36B 3FT4B 3MV8D 1LGVA 3STZB 4TPRL 5I18L 1T89A 1ZV5A 1XF4B 4CNIB 5DD5H 3WS6C 1L0YA 3S3JA 4XVTL 5KBNC 3KPPA 5FGBC 3ZDXF 4L8CA 3RY4A 3KYKH 2J4WL 3U6RA 1RULL 2VDKL 3MJ8B 1FG2A 2NY3B 2ITCB 2NW3A 1WQVT 4BK5A 4FFYL 1HI6B 2Z31D 3VXUA 5DHXB 3CVIH 1YYLH 1J11A 2BC4A 3B2VL 2VLKA 1U91A 4YIQA 2DQGL 4NNPH 1GGIH 3BP7B 2B1HL 2BVPB 3C60D 1LO0L 3VRLE 4Y7MA 3ARXA 3OZ9L 3VXSA 2H3NB 3ARRA 1TTFA 2ADGB 2ZPKH 1MLCA 1KFAL 1JPFB 3DI3B 4WI8A 4I77L 2CMRH 4YZFF 2NTFB 3VFGH 4PGBA 1FPTL 1L7TL 3WUWB 4J6RL 1BWMA 2SEBB 3O2DA 5FM8A 2OM5A 4UT9L 5IOPB 3CVHL 4P5MB 4RAUA 3TPKA 1UT9A 5DQ9B 3FCTB 3RDTC 2IMMA 1OTUD 3GIZL 5DO2D 3VGEA 3F7VA 5DRZA 5B3JF 1I1AA 5ICZA 3GHEH 3E2HB 3JZ7A 4PGDA 5FCUH 4U1NA 2DRUA 4Y4KC 3H9HB 2EDQA 2VYRE 2QEJA 4PJHA 4IOFC 3F7RA 4WFED 3L3HA 4KAQL 4M6ML 1BF2A 1N4XL 4XBEH 5BS0B 1DCLA 2AKRB 2QHRH 3C5SA 4R0LC 5K93A 3ZO0A 4P5TC 3TVMA 3P4MA 4PJDA 3VW3H 4JFED 3BWUC 4P59H 4BQBA 2HAZA 3RFZC 2DS4A 3KJ4B 5F7NC 4R4FL 4YEEA 3CGTA 2XTJD 5CD5D 3NCJL 1EEZB 3WL9A 1KELL 1GGCH 3U7YL 3QHZL 5D5MF 2PW1B 4X9FA 4O58H 3TZVC 4OFYA 4TNVK 2EC9T 2W9EL 4PJAB 1T2XA 4ELKB 4J23A 5T5FL 1DLHB 2EYSA 4R26H 5C0CB 3CPLA 4LOUD 4RNRB 4LNRB 2FO4B 4OUOA 3VFRB 1HINH 5IQ9A 4M6OH 1OHQA 4LLMB 4YDIL 3U7WH 5BS0E 1NFKA 1DTUA 4D2NA 5IB3B 4L4TD 1VGKA 4WDIA 5TDPB 2EDRA 3DGCR 2I25N 4H26A 4HS3A 3GSOB 1EBAA 4AIZA 1WT5A 2RQ8A 1CLCA 3VXOB 3U9PL 4EI6B 3CX5J 1J1OH 3RHWK 3KDMA 1D9KA 5LGJB 4OM1H 3UTTD 5SX5H 4YDVB 5IWLC 3W9DA 1GOFA 2FZ3B 5C0CE 2L0DA 4R96A 1LK3H 4FQLH 4WUUB 3D69A 4PTTA 1BVKB 2F8VA 4DZBB 3AREC 4M1GL 4MA7H 2EIZA 1UADC 5KZCD 5E8OB 3OF6D 3A6OA 5BQ7A 3BO8B 1UWXH 2R23B 3U4BL 2V2XB 4JRXB 5TGBA 5F1IA 4WI3A 5EORL 5DRNB 2YXMA 5JW4Q 4DVBB 4UDTA 1HHGA 3ARFA 5C0GB 3C9NA 3EOBA 4NWTH 5J1AA 2KH2B 2VZ1A 3NIGE 3OAZH 3IFPB 3OR6B 4TVPE 5IFHH 3MRBA 5GSRB 2D3VA 1A6VL 2LTQC 2YUWA 3SE9H 1EBPA 4JQIH 1N3NB 3W2DH 3ARDD 4R7DA 5T3XL 3VXTB 5ILTH 4RMVA 5IGXL 2YD3A 4K8RH 1HKLH 4XI5C 4O4YL 3U0TB 2YC1A 4Y2DB 5SWSA 1I7UB 3GM8A 4EIGB 1UB5B 3QIWA 3HZMA 5FYKU 1DBJL 4UNVA 4X9GA 5I1KH 4A2LA 4AEIH 4JFXB 1JWSA 4E5XA 3QQ9C 1ZK9A 4P3CH 4KUCF 2V7NA 4PIRF 3JTTA 2DYPD 4U0RC 4DN4L 3LMJH 2BDNH 4K9EC 1W72H 5I15H 4JPWL 5BRZA 1SYSA 3ULVE 3ROLB 4Y4HB 4HCRA 5E7BA 3TH3T 4NRYA 3P2TA 3TBYB 3NN8B 1MHHA 3LQAL 4MAUH 2HLFC 4YUEL 1QBLH 4P4RB 3V6FB 3UTZB 1XCTA 4GOSA 5EFIB 1YEGL 1EFXD 3UX9B 2LVCA 3MRPB 4FTVA 3ULUD 3M1BA 1D6VH 5ESAA 1OL0A 2FGWH 1IGMH 4ALAH 3RU8L 2EDKA 3HZYA 4LRIC 4ZFFB 3SJVA 5AYQA 2WIIB 3KHQA 4FG6C 5F6HI 3S34H 3HHRB 1I3RB 3KS0H 4I3RH 3BUYA 1OP9A 1MFEH 5E8NA 3ULSA 4HW6A 2D7TH 5F88B 3U30B 3WFEH 4I0PB 1F8TL 1HCVA 3T08A 5JZ7D 1ZHKA 3C2AL 5DR5L 3SKOB 4QRPA 4NO5B 1U6AH 3BHBA 4HWEH 1T1XB 1F13A 2J5LB 4W6XB 3KXFE 4MB3A 3TZVA 1XFPA 4JDTL 1KTDA 5EZIL 3T8XA 5FEBA 5KJRH 4I2XA 2VLJD 1MEXL 3AS3A 4P0DA 3B2UD 3D0VB 2Y06L 2B4CL 4O5LH 5H37H 2UYLB 1EJ6A 4HF5H 4PG2C 2PTUA 4KRMB 4N0UE 3TBVB 4LLUA 2Q8BH 1FL3A 2OP4H 3IDXH 3IGAB 4KRPB 4UQ2B 2EE6A 4OGXH 3WXVL 4ZFGL 5IW1A 4FQHA 4M8QB 5IBTH 2D4FA 4PTUA 2CIKA 3ZTJH 3HI6H 3D39D 2H2PD 3HI5H 1DN0B 3WNKA 4KDWA 2APFA 5HDQH 4PJ7A 4ZXBB 2ATPB 3QDMA 5IWLA 3MC0A 2DQIH 2V9TA 3W0WD 4S1QL 3DX8A 4NZRH 2AV1A 2F19L 3ROOA 1I8IB 4LCWA 3BE1L 4WNQA 1MFDH 1EVTC 3O6ML 2A38A 4LEXH 1BPVA 1Q1JH 2FEDC 1QLEH 1MHEA 2CLZA 2X9WA 3UROR 4RIRB 4EOWL 5IVOA 4WHTA 2YEZB 4HWBA 2QADD 1KB5H 3GMLA 5JQ6L 3RNQA 4EN3C 4YHML 4KH2A 5D1XA 4OUUA 1T0PB 4UUJB 1X5KA 1K4DB 3EO9H 3SQBA 5HYQA 4R4NC 3VGAB 4LIQH 2R0WL 3BZDA 4OZIE 1MIMH 3CU1A 5CIPH 1FH5L 1S7RB 2VKWA 3DSFL 5D9SB 3RUGB 3SY0B 2Z4QA 5HYSG 3KLDA 4WVRA 1UEYA 4M4RA 4P2OD 3B9KB 4HZLB 3AU1B 1G6RH 1I9EA 3MRCA 3WO4C 4BFIA 4C4KO 1UQSB 3D2UA 1RHHA 2CR6A 1I9IH 2ADIB 1F4XH 1SEBB 4H1LH 2ADFH 3DGGA 5A2IH 2FD6L 4C55A 1NEUA 1IM9D 4NKDB 4DQOL 2WK2A 1EZVY 2MHAA 2C1OB 4JZJC 3H3PL 1JZ4A 3EDKA 3GSXB 3BN9D 1QUNA 2BOCA 4HUXB 3OQ3B 4WO4A 4QXUH 2ZUQC 1SM3H 3DWTA 4J3UA 3RUGE 4ZUTB 4POYA 3LN5A 1MCFA 2UZXB 4JPKL 2X7LB 3ZE2F 2KZWA 5IMLB 5IMKA 1CL7I 3QXUA 3UTQB 1Y0LA 2IBBA 1Z9LA 1YC8A 4HZAA 1CFSA 5GZNC 4H5SA 3GBML 1DBAL 5C07B 3GNML 1L6ZA 3QIUC 3G6DH 4L3EA 5B8CC 4HEME 4OQTH 1OGAE 4HJ0C 1A6AB 4OI9A 4GLRI 1IEAA 4XAKE 4KI5E 4YHIB 1NC2B 3U9UB 4TPRH 3SE4A 5I18H 1X7QA 2C1PA 2M8XA 3EYFA 2FJGA 3UAJC 4X4ZA 3D25A 4AQOA 4P4KA 4XVTH 1FYHB 4FP8L 5FCSH 3TN0D 3KYOA 3QEUB 1RULH 2VDKH 3OG6B 1WBZB 1C8PA 1PKQA 1NGQH 4FFYH 3RTQB 4AYFA 5E4EC 5C86A 2IAMB 4BQCA 3DYMA 3H3BC 1FZJB 2APBA 3O4LA 2CR3A 3B2VH 4UT6L 3SE8H 3AC0A 1E4KC 5FDWB 2CKBB 3G08B 1RV6X 2R4RL 4M9OA 5T5NG 2B1HH 4DVRL 3FRPG 1S7UA 3KR3H 5DK0B 4MZ3A 3GJFB 1KFAH 1B6DA 3IDYC 4NQCB 4I77H 5ERWA 2HFGL 1BJ1J 3BGFB 4W4OC 5I8EA 3FAXA 1FPTH 1A7NL 4WTWA 1F02I 4UT9H 1A7RL 3CVHH 1ITBB 5EU5B 1Q94A 3MRNB 3F6LA 5FA3A 3EYOA 3GIZH 2EH7L 4PJHF 3EYQD 3WE6B 4EDWL 2HYMA 3ISWA 4A6YB 5J4MA 4ORZC 1ZEAL 1DBBL 3PG2A 3QUKA 5HGDB 2YHGA 5GIRB 4KAQH 4QOKB 2VO5A 5ENWB 5C0DB 2CRYA 1N4XH 1RIVH 2J3SA 1MRCL 4NQCE 3DMMA 2FX7L 3MRIA 1FZOA 2UY7A 4KJQC 5DEGA 4XWOD 1KT2B 4R4FH 1JPST 4V1DB 4DJMA 4X9BA 3NCJH 5CWSA 1AGBA 3AFLA 1KELH 4KU1A 3QDGB 3U4AA 1FFQA 1FC1A 3U7YH 4TSAL 3QHZH 5I2IA 4LLYB 4LSUL 3PL6A 5T1MA 4HG4K 1U8PB 2W9EH 1QRNA 2Z31C 1FBIH 5T5FH 1A5FL 2V7HA 3U0PB 5EIIA 2GITB 1X4XA 4GO6B 1RUPL 1REIA 4ODTL 2C3VA 4QOKE 5DHVH 4OGYL 1IAMA 3H3KA 2ZP0T 4YDIH 4TUJB 1DUZB 1VB9A 5GGQL 2IQAA 3C60C 5D7JD 1NGXB 1AFVL 1PY9A 5DJYA 5HGHB 1CLOL 3STLB 2ENSA 2BY3A 5CD3A 1WAAA 4PLNC 5LVEA 3P9MA 4L8BA 3D3VA 4V1DE 4Z0XA 2I07B 4X7TB 5SWSD 2WINB 5L7XL 3DECA 2AXJA 3U9PH 3QDGE 2DQUL 5T1KD 3QIWD 4X6CF 5KSBA 3ZTNL 3WS3A 3DI2B 4JZJA 4BSWA 4CJ1A 2JB6B 4HLZG 5IW6B 4QKXB 1WWBX 3O3EB 1CDHA 2WBJA 4LLQB 5C0IA 1ZVHA 5I71C 1NANH 2RFXA 5DO2C 5DD0L 3ES6B 4WW2F 1LILA 5I17B 5DJXA 4M1GH 5SWZA 1MCBA 2Z92B 1A6TB 2JK5A 5ELIA 4QRUB 4N90E 4HFWA 3NTCL 1H8NA 5JXED 3RP1A 3GI9L 3UJJL 3U4BH 5EORH 4JFYB 1I3VA 2N7BA 1Q0XH 1MSPA 2AV7A 4HX1A 5C0NC 2CUMA 4CW1A 5AUMB 1OW0C 3KYAA 1OSPH 1G7QA 4KKCC 4RBPH 5E00B 5IV2A 3QIUA 4F3FA 5E2TL 5CD5C 2D2OA 2VAAA 2P8PB 4YXKL 1A6VH 3SJVD 3CZFB 1KIQA 5T3XH 2XT1B 3BRGC 3QXVA 1YMMA 3DROA 4RFEA 2J8OA 4R9HA 4XNQA 4O4YH 4O2CA 1HIML 4IOSD 3MNWA 3MV7D 1CZ8L 1GXEA 3BKYL 1SJVA 1K8DB 5IB5A 5IFJA 1QQDB 3P30L 2NY6D 5EU4A 1ZLWK 3ZKQD 4HH9A 2FGZA 3CLFL 2IANA 4F7CB 3QI9B 4JFPA 1QFWM 1R3JB 1EJOL 1DBJH 3OG4B 3H0TB 3T0DA 1YZZA 3ARSA 3KGRA 3BQUB 4DN4H 5C2BL 2AABL 3MRDB 4HGWB 4D0BA 2HJFA 4NWUL 2O61B 1X5FA 4K9EL 4JPWH 4ODXB 2VISA 3I6LD 1OARL 4U6XB 3TLRA 2IADB 3LQAH 3SO3B 3T0ED 3TH2T 1UM4L 5JXAL 1UXSB 5KSAB 3MACL 1KJ2H 1G1CA 3HNSL 3IKCB 5HVHB 3RU8H 4L1HA 5B22A 4BH7B 2PTVA 3RI5K 4UIKL 4ORGB 1A3RL 3QDMD 4YAQA 1UH4A 3WCYA 1U58A 4YFLF 3RX8A 3P9LA 3OV6A 3KYNA 2VIRA 3BI9X 2BHZA 3BZ4B 2ZUWA 1W2KT 43CAA 3P4OA 3V4PL 4EKXA 2ZUXA 1F8TH 4M8VA 2R2EA 2XZQL 3C2AH 4ZTOL 3PDGA 3ARDC 1BFOB 1BX2B 1TTUA 4WWID 1FNEA 4KVCL 2BSTA 3SDDC 3ZKXB 3LD8B 1GGTA 4HWUA 4OF7A 5ETUB 5TFSL 5EZIH 4QTHB 2DJSA 5HGAA 3VXME 5CZXD 3O9WB 2CDFA 4MD5B 3PWPB 3CSPA 3MCKB 1MEXH 5KAQG 2Y06H 2B4CH 1S5IL 1HOCA 2GSGA 4CL7A 3Q6FA 4XXCC 3FN0L 5GGTL 4MJ2A 1EDQA 5D1QD 1LE9A 3NCMA 2BX5A 3MTRA 3FOLB 3I6GA 3QULB 2DL2A 5TE7L 3X14A 1KENL 3K8KA 4OBSA 4BSVB 2D7PA 1T0NB 1C5BL 5DTFA 4WHYH 4ZFGH 3WXVH 4YJZL 2R69L 4DZ8B 4JY6B 1AI1H 1S7TA 2HKFL 4NKMB 1T66D 4CVZB 5EUOF 1EERB 2PYEB 3VH8B 4PJ7F 2VUOA 4OF5A 4GH7B 1L0XA 3MRFB 1LP9A 3O4OC 4BKLB 3MV9E 4WO4D 4LK4A 4S1QH 2PXYD 2HG5B 5LG1A 5AD0B 3ULUC 3BE1H 4XPGL 1JZ3A 4WFHD 3O6MH 3RBSA 1PZ5B 3TT3L 1IAOA 1TPXC 4Y4FD 1AGEA 5ICXB 1P7QD 3OJDB 5D6CB 1I1FA 4NIKB 4EOWH 2R4SL 1G7IB 2AJ3B 4GRLA 5JQ6H 3PGDB 1CG9A 4E0RB 2PO6B 3EO0B 4YHMH 4Z0BL 4M7LT 4ZO8A 3SDXF 2PYEE 4N0FB 3LKOB 3WD5L 3PNWB 3P4NB 5L2KB 4Z7QF 1U3HB 2R0WH 1DBKL 5DC4B 3NGBB 3RWHA 1FH5H 3DSFH 4I3GA 2OXHA 4P2QD 5EU7E 5JZ7C 3L3GA 3MRHA 5E2VL 2FR4B 2W38A 2VLLB 4JO2L 5JQHC 2XZAL 1CTNA 4GRMB 2VDOH 5JPMB 1XIWB 2OZ4A 3OKKA 3ZDXE 2YN5A 5DMIL 3L7FA 4JHZA 4MD4A 1QBML 4NPYA 1H3TA 2FD6H 3B2UC 3C09C 5HD8D 4HJGB 1EH9A 1M1SA 3V7AG 4X7EC 4DQOH 2IALA 3VFSB 2ZSVA 1J1PL 3H3PH 3F7PC 3I3BA 2HFEB 3KPLA 3F7YA 5L2KE 3PABA 5A1AA 1GVIA 3NCCB 1LO4H 1TQBB 1HHJA 1F3DJ 2BNQE 5JIHA 2FATL 2DQHH 2HKHH 2OTPA 3QWRA 1OLLA 2X9YA 1NBYB 3MRLB 4JPKH 4OT1H 4XNZC 2JB5L 3IYLW 1G7PA 5IB2B 1KB5B 1GRWA 4IJ3B 5H35B 5F3HA 3QDJA 1IEBA 4CU6A 4NSKB 5GRYA 1DL7L 3VDCA 4PRDB 4KTYA 1BOGB 3GBMH 3GJFK 4UAOC 3GNMH 5JLZB 2AEQL 1J0JA 1TENA 1X44A 3PWJA 3NFNA 5B3JE 2JIXD 1VFMA 2WSKA 4QHNB 1IZJA 2QADC 2R0ZL 2BVUA 3PP4L 4XNYL 2GTZA 3FO1B 3C8KB 1VKXB 5K33A 2FBOJ 4FP8H 4ZPVA 1UYWL 4X6FA 5ESQB 3TPUB 1XCQA 3ARGB 4H1LB 3IDIA 2BHYA 1G0YR 2XWTB 4UT6H 4P2OC 3TJEL 5F3BA 1LMKA 3WHE1 4TUOA 4EVNA 2N4IA 4XTRD 2P44B 4H0GA 4DVRH 4J4PA 4MXVF 5D5ME 4ZODA 3SDDA 4R2GB 1QRND 3I50L 3O41B 3S36L 1ORSB 1E4XL 3OAYK 2P4AB 2I9LA 3GSVA 1X4ZA 2G2RB 3TYGL 5CEZL 1EHXA 3TIEA 1VADB 1C5DA 1F42A 2W65B 5CP7B 3TV3L 2O26U 1XGYH 4CVXB 3W5NA 3X13A 3HR6A 1CGUA 4JY5H 1ZHBB 3BN9C 1QLRA 4ZPTA 1DE4B 4GAYA 1KCVL 1A7NH 2X70B 1A0QL 1A7RH 2QQKL 4BUHA 3G5XA 2IGFL 3WNOA 1X3DA 4NFBA 4HKXB 2BVTA 2EH7H 4J12A 1FNSL 4JFFE 4EDWH 4JN2B 2VSDA 2JJVA 2XWJB 5C0EB 3LEYL 3GDBA 3T3MF 1DBBH 5EO9A 1SVCP 1YQVL 5JHDD 1EHLL 1Z2KA 3QIBA 2NY1B 5CBEA 5GRZA 4X5XA 2HJKA 3NZ8B 2WBJD 2W0FB 1KXQE 3T65B 4N8CH 3BP6A 5GGVH 2FX7H 2E7LC 1WCBB 4NQSB 5JNYA 1T04B 3MR9A 4LMQE 3L3JB 4IHOB 2HTKD 3MBXL 5MEPB 4NO2A 1A8JH 4NN5C 4TSAH 1Q9WB 2YA2A 1EK3A 1PFCA 1INQA 1VESA 3TN0C 4LSUH 2Y72A 1M7DA 1RZ8B 1A5FH 1YYML 3VWJD 1V3JA 1Y6KR 3DX7A 4QY8B 1R24B 1RUPH 3CH1A 4ODTH 4OGAD 1KPRB 3HNTL 4OGYH 1FZKA 1I85C 5F21B 3EDJA 1QVOB 4F15C 5GGQH 3QCVL 4H0HB 2YPVL 3KPMA 1CLOH 15C8L 1MCIA 2DJUA 1BD2B 5CJQL 5FUCC 4NN6C 3DXAE 5GRWA 1R3KB 4PJ8C 5L7XH 1YEIH 3DLQR 3FRUB 5FHBL 3BSZL 3ZTNH 1A1OA 4LCUB 3WYRA 5DVOA 5IHZA 3VG0L 3VFNA 1CDYA 4NO3A 3QDHA 4Q9QL 4ZD3L 4NUJB 4ZO7A 3WHXA 2VE6B 4KZEH 5DD0H 5MENB 3BPNB 3EYQC 4NNYA 5F7LB 3EJYD 3GKZA 2ICWA 3NTCH 3B43A 3GRWA 3TM6A 3GI9H 4J8RA 4PJ5A 5DUBB 3UJJH 1N59B 2OJEA 3O6LL 1EAPB 3VMOA 5LGHL 3OX8B 5BJTB 4CVWA 4OZFG 3BGMB 1YQ2A 3KWWA 5CEXB 4MWFA 4XWOC 1W0VB 2EIBA 3CJJA 5E2TH 5EA0L 3TIDA 3VI3F 1J0YA 3T77B 2QSVA 3H9YA 3W39B 4ZUWA 2I9TA 4PY7B 1TNNA 3RWEA 5MENE 5FUZL 4X7SL 1JGDA 1PX4A 5MEQB 5EU6A 1XGTB 2ICWJ 1MPAL 3MRGA 4LVOB 5EO0A 2LAAA 2GI7A 1CZ8H 1MHPL 3BKYH 2DM3A 2FYYA 2E7BA 5IJVA 3E6FB 1ES0B 5D7JC 2GY7B 4LLWB 3CLFH 4X6EA 3NCYS 1EJOH 4MJ5A 1NJ9A 2WQRA 1MJ8L 5DJDB 1NH6A 1FSKB 1X6LA 2NXZB 2XQBL 2V5MA 4MAYA 3CXDH 5C2BH 2AABH 2C3WA 3QQ4B 4P9ML 1GYAA 5I9QB 5I1AB 5DZLA 5D93C 3S6CA 4K9EH 2A73A 1W8NA 3BH9B 3C6LD 5CJ8A 5EOCL 1AE6L 1OARH 4FFWD 4QRRB 3VXPB 1HE7A 4JZOA 3V52L 5FFLA 4X8JB 1ZWIA 1A02N 1UM4H 5JXAH 1Y18B 3BPLB 4ELMA 3JWOC 2K1MA 1A1NB 2KUTA 3L3KA 3MACH 2Q76B 4NUGL 1RMFL 4WJ5B 1D3CA 3ARWA 3TO4B 5IB4B 1S7SA 3O11A 3MNVA 3O3DB 3HNSH 5JXEC 3B9EA 4G8FB 4KROD 1K8IB 4ZNEA 2VDRL 2X41A 1A3RH 2A1WL 3GSQA 4WHDA 5TDOB 3CFEB 3UPRA 4MD0B 5IF0B 1O7VA 1ZTXH 5EC2A 4DAGH 1QSEB 2Q86A 3UPCA 4B53A 3HR5B 4OFPA 1CLZH 2NNAB 4GG6A 1MCOL 4QRRE 3V4PH 3UTSB 3L7EA 1JF1B 4HXBL 3PIQB 2H2SD 3QCUL 3V5HB 5FOJA 3PWLB 2XZQH 4ZTOH 2OTUB 3KPQA 1FNGA 4PB9L 4M48L 1H3GA 3A67L 1JV5A 5FGSA 2ZKHL 4ZSOB 3VXRD 5TFSH 3GUTB 4JKKA 4ENEC 1EUTA 4EXPX 4LDEB 4POZD 1GCFA 2NY6C 1H3WM 4U1SB 4DOHB 4QRSA 4OGZA 1S5IH 5KOVC 2PW2B 3FN0H 5T3XE 1QSEE 5GGTH 4ONGH 5ECJE 3HE7D 4XMKL 3LKPA 4MX7B 5TE7H 1KENH 3UTSE 3LEVL 3MRJA 5HXMA 2R69H 3LIZL 4KC3B 5EDXA 3WFDL 5J6GA 1T3FB 4PJ8A 4QHUA 4LGRB 2HKFH 4AL8L 1KJ2B 1LP9F 3IAQA 5IKCA 5FKAA 4Y16D 3QEQD 5SWQA 5D96B 4QHLA 3T0EC 2YR3A 4ZSOE 4UU9A 4S0TD 4OZ4B 2G5BB 3EYUL 1F4YH 3QUML 4FMFA 2DWDA 4L8CB 3WN5A 4XVSL 1N5AA 4OZHF 4OD1L 4XPGH 4DOHE 3TT3H 1FVDB 4RWYL 5F6IB 3ULUL 2NW3B 3MRQA 3VXUB 2R2HA 4C56D 2R4SH 3WDHA 3ZE2E 3O3BA 2BC4B 2DIJA 1U91B 4YIQB 5DJ8A 3VXNA 1IGYA 5D70L 2EDHA 1I7ZA 3DO3A 5HGBB 2F54D 3VXSB 5E99L 1XR8A 3AM8A 5CSBA 3DV6A 4PJGA 1X9QA 3RX7A 3IDNA 4JREC 3EYSL 1TQCB 4JKMA 5E2VH 5E94A 1KB9J 2CJUL 2JJTA 1IGCL 3I3DA 1D5MB 3HCVA 4JO2H 4PGBB 2XZAH 3TESA 4FQQA 3DBXA 3U83A 1RZKC 1VACA 5DMIH 3VXUE 1CICD 5CZXC 2B1AL 1EV2E 1QBMH 3DJ9A 4TNWK 1NCBL 3NBNA 3QHFH 1I1AB 5ICZB 3DVNA 4PGDB 2IBGA 1D7FA 5D1QC 1G7MB 4U1NB 1J1PH 3PJSB 4PJHB 4Z7NF 3JTSA 3CC5B 2IH3A 4KDTA 3FQNA 2F8OA 3AB0C 4NQED 1BZQK 1T66C 5GJSL 3P4MB 5I16B 2ICCA 3F65A 4ZO9A 3A6CL 4F7EA 3MLTA 1E28A 2JB5H 4JZNA 1WV7T 4NQDA 2DBLL 3UYRL 3WL9B 3GJEA 3MLUL 2PXYC 3RL1A 1EEQA 1DL7H 2Z8VC 2VXVL 1XGRA 2XKUA 3V6OA 5FK9B 1QSFD 4Y4FC 5B4MD 4KMQA 3D48R 2K7QA 5GGRA 2AEQH 5DVMA 4DN3L 3E0GA 1MELA 4PJHE 2EYSB 3VFMA 1J88A 4Q6IC 3QIBD 4MNQA 4RRPA 3VCLB 3BPOC 5ISZD 3ILQD 3PP4H 5F8QC 3WLWC 3MLZL 2BNRA 4H8WL 4K7PY 1VGKB 1UYWH 3SBWA 4WDIB 4F9LC 4PJIA 4HS3B 4H26B 1BLNB 5FF6A 2VZVA 4AIZB 4Z7VA 3QJHB 1CE6A 4G6FB 2CPCA 2ZCHL 2MFNA 1KCUH 2ZUSA 3TJEH 5HYEA 1VGEL 1D9KB 2EXYD 3PQYD 4J1UA 5BW7A 1T1WA 1U8HB 2WIMA 3HE6A 1U8JB 3BWAB 3S36H 4X7DC 2NZ9D 5IBUG 4DW2L 1E4XH 4U2YA 3D69B 4PTTB 4ZS7L 3GHBL 3TYGH 5CEZH 5HD8C 1AO7B 5I75C 1LWRA 2C3HA 3TV3H 1P5UA 1NEZA 2ORBL 1P6AB 1YDPA 2EIZB 5FGCE 1RIUH 4O2FB 5BQ7B 1U8LA 2V17L 1KCVH 5HVFB 1I3UA 2F74B 5B39G 2BZDA 1A0QH 5F1IB 1H15A 2QQKH 4CMMA 2IGFH 3RVWD 4UDTB 2WP3T 4L5FL 1HHGB 3CFCL 1FCCA 3FFCA 4JE4B 5T1LD 3ARFB 3C9NB 5FO7A 1N6VA 3EOBB 4TQEL 3LEYH 5EWIL 1Y6MR 5J1AB 2AJZA 1UCBL 4ODHL 5C0BD 1YQVH 5FKPA 5E9DA 2ERJC 1EHLH 3MRBB 4X6CE 1OP3H 3SDCB 4ZFOA 1AQKH 2L7JA 3QH3A 2VXUL 3N50A 4HIEA 3OHXB 1F3RB 2EDYA 1AO7E 4R7DB 1XH3A 1K2DB 4HULB 4AIXA 3K1KC 3MPCA 4P46C 4D9RD 1CXEA 3GFUA 3ZDZF 1WBXA 4RAHA 2VABA 1ZKAA 5E8EB 2YC1B 1LHZA 3HS0A 5EZOL 3QG6A 2YMXH 3I84A 3MBXH 3WIHH 3AXLA 3VWKA 2C3XA 1UZ8A 3BDXA 3HZMB 1T1YA 3E6HA 3RIAF 4P99A 1T6VN 3BMVA 2FSEA 1J8KA 2VN4A 4WW1A 4E5XB 1YYMH 1ETZB 3QQNA 2V7NB 3EYVA 3HPJB 4OZGA 4TOYL 4YHOL 3BP5A 5KN5A 1GZPA 3QXAA 2AQ2A 4P23C 1IL1A 1NL0L 5BRZB 3MNZA 3QCVH 1SYSB 2YPVH 3KPOB 4NRYB 5C70A 3ARQA 5E70A 1MHHB 1CFQA 5CJQH 2AJVH 3QUXC 1NDGA 2NX5A 1ND0B 4NZJA 2DMCA 2O5YH 3MFGB 1CXHA 4LF3A 1BREA 1JP5A 3M1BB 1EO8L 5FHBH 1IGTA 3BSZH 4TUKL 2HVJA 2PETA 4RX4A 3ARZA 4Y4KB 4S0SD 1BEYL 4H20L 4Q9QH 1UCTA 4ZD3H 1MRFH 3S96A 4Y1AB 3IDJB 4L8SC 5F8RC 2BRQA 4QXWA 4KZDL 2H32A 3BUYB 5JOPD 1MWAA 4P5TB 5E8NB 4K23L 1A7BA 5BRZE 3ULSB 4EQ3A 4C59B 5J6HB 4OD3L 4Y5XC 2DIAA 2WBWB 3O6LH 2J8UA 1S7QA 5BZWA 5LGHH 5D7KE 3HC4L 3QNYB 1SJXA 1DEEA 4L4VB 3I75A 2ZOKA 4DKEL 4PJXA 4XP1L 1IRAY 4HKZA 4PV9A 3TZVB 5DRWA 1IJ9A 3TJHD 1DLFL 2E7CA 2DBJA 2DIBA 5EA0H 3T8XB 1TLKA 2HTKC 4LGPB 4I0CC 4GKSA 4Y1AE 1FYTD 5I76B 1RK0A 5FUZH 2ICWI 4X7SH 4JO3L 1AKJA 5JW5B 1MPAH 3VWJC 2W0PA 5C09B 3F12A 1FL3B 4OGAC 3QJFB 1J9CT 1MHPH 1FFNA 2BSSA 4MCYB 4FQHB 3M8OL 5IW1B 4L4VE 4KK5C 2CIKB 3O6FA 4MDJA 2DWEB 4WWKA 3Q5TA 1CE1L 4GXUN 5EUOB 4LSVL 4PJ7B 2X6MA 1MJ8H 3FQUA 4EBQH 2W1NA 2AQ1A 2XQBH 3O3UN 2AV1B 4U1HA 6FABL 5M7QA 3ROOB 4LCWB 4WNQB 3U36A 1AH1A 1ZHNB 2UY6A 1XF4A 2HRPL 2HVKA 5E95B 5EOCH 2CLZB 1AE6H 4ELMF 5HYIA 3PGFL 3V52H 3U7AA 5C09E 3GMLB 3L1OL 3RNQB 5BV7C 3OBAA 2R1WA 5D1XB 4OUUB 1OP5H 2XXMB 3KPSB 3JWOL 3O81A 4NUGH 3EJYC 1RMFH 3ZYZA 2O5XH 1ZA3A 2PF6A 5F89A 2B2XH 4PGEA 3SDXB 3B5HA 5EUOE 2VDRH 5DYOA 4PJ7E 3BP7A 2BVPA 1P7KA 3BX7C 2OYPA 2CH8A 2A1WH 1MCLA 4WI5A 4IIQC 3T1FB 4NDMA 5TDNA 3ALWA 4GG6F 2G75A 5HHMD 1KSRA 3QZWA 1NUFA 4N0RA 5AWNL 1MI5D 4BFIB 1G84A 1MCOH 4GMTL 3D2UB 1RHHB 3T1WA 2FJFB 2NTFA 2OL3A 3DGGB 4HXBH 4NGHL 3QCUH 1CQKA 3QUZD 3WUWA 5DFTA 2MHAB 5IOPA 1RUAL 3KPSE 4PB9H 3WEXB 4M48H 2FLRT 3O8XD 4CMHB 2XRAL 1OAYL 2ZKHH 2FIRT 5F9AC 2MJWA 3SDXE 5DURB 1LE5B 4LPCA 2Q3ZA 4I18C 4Z7QE 3H9HA 3LN5B 4UTAL 1EZVX 1WGOA 1MCJA 1KBGL 4P23A 5BS0A 4I9WD 4XMKH 2AKRA 4Q2ZA 5A16A 2Z9TA 2DLFL 1Y0LB 4RFNC 3LEVH 1CGTA 1HYSD 3QUXA 1OM3L 3LIZH 3T0VA 3WFDH 4H5SB 3CMOL 4AL8H 3C6LC 1BWWA 4L3EB 1XF3B 3VGDA 1NAML 1IEAB 1PJ9A 2PW1A 3BZEA 1X7QB 3BVNA 3EYUH 3EYFB 2FJGB 5GGRY 3D25B 4P4KB 3QUMH 4HDIB 1DLHA 3KPRA 5C0CA 3KYOB 4XVSH 4OD1H 4UV4H 2EEDA 4RWYH 4G9FB 1PKQB 2OMBA 5KAQF 2DAVA 3ULUH 5KVDL 1GC1C 1IGIL 1I8MA 3O3AA 5J56B 5JHLL 2YA1A 1NC4A 1PEZA 1BQHG 1HWGB 1KF9B 5TDPA 1KEML 2Q3AA 1C12A 3GSOA 4PJGF 1AHWC 1SBBA 5D70H 3QISA 4L3EE 5E6IC 4E9LA 2XQYG 5E99H 5T33L 4OF8A 2H2SC 1FFRA 2J12B 5KOMC 5LGJA 3EYSH 3SDAA 5JDJA 2CJUH 5ERWB 1IGCH 2RBLA 3LB6D 1BVKA 5KVEL 4IRJA 4G9FE 4OIIL 4FZ8L 3CX5K 3TBTA 3U0WL 1ACZA 1CU4L 1Q94B 1RZKL 2B1AH 2EDJA 5E8OA 1NCBH 5FA3B 3QWQB 4D0DA 2A77H 5DUMH 5D2NC 5DRNA 5IJKA 4DVBA 4FXGA 3QUKB 4QHKJ 3X3GL 3L3DA 3V0AC 4AM0B 4MXVE 2F8XC 2Q1EA 1UB6A 3QFDA 4MCZA 1OT1A 5GJSH 4FQ1H 1UENA 3IFPA 1AD0A 3MRIB 3V0VB 1HEZA 4CBPA 3A6CH 4Y16C 5EULV 1QACA 5DMKA 3UYRH 2DBLH 1WTLA 5CWSB 1AGBB 4U1GB 3MLUH 5EB9A 2EXWD 3NA9L 4ZAKA 1UXWA 4QYOB 1OTSD 1OLZA 5DJZA 3U0TA 3PL6B 5T1MB 4Y2DA 1DEDA 2JELL 3W82A 2V7HB 4F7PA 2MSPA 1CN4A 5GJTH 3FONB 4MYWB 1DVFD 4YK4C 3T3ME 4ODUB 1ZLSL 1U8NA 4JFXA 1ONQB 2IQAB 1NMCB 4PJIF 2ED7A 3MLZH 5DJYB 3ZYIA 1Y6NR 5CD3B 4HLZH 1X5XA 1J7VR 3P9MB 4L9LC 4L8BB 3JV0A 3D3VB 4YFEA 3WO4B 4Z0XB 1A47A 3B9VA 4NQXA 3ROLA 1P9MC 4WFGE 4P2RD 4IDLA 4WEUD 3PGCB 3RIFF 4PRIA 1D5IL 1VGEH 5KSBB 3GSNL 3V6FA 3WS3B 5D7LD 3UTZA 2W0LA 3HI1B 1T4KA 4JZJB 3BUTA 4BSWB 2VSCA 1CICC 4XVUD 3MRPA 4DW2H 3KXFA 4LPTA 3RWFA 4ZS7H 2RFXB 2ZUQB 3GHBH 5I8OL 5C1MB 1FORL 5DJXB 5SWZB 4FQXD 2ORBH 4ZQKA 5DRXB 2JK5B 1G9NC 5A3ID 1LO3L 4GAJL 8FABA 7CGTA 1KGCD 2WIIA 1E6OL 2V17H 1F6FB 1I3RA 2FHCA 4NT6A 3D3VE 4OI8A 3QCTL 4N0UA 2HMID 5EUKB 3PP3K 2AV7B 4L5FH 3G6AB 3CFCH 1SY6L 4RAVA 1PBYA 1S7WA 1WEJH 1G7QB 4TQEH 3RY6A 5EWIH 3HKFA 5IV2B 3QIUB 4F3FB 1BIHA 4ODHH 5B8CB 1NCAL 2VAAB 4Z77A 4NO5A 4U33A 5JW4N 2EC9U 5JO5A 1ZT7B 3MA9L 2YN3A 4M1DH 3ILPA 4U49A 4IRSD 4LHUD 1KIQB 4Z5RB 1DQDL 3MBED 1YMMB 3BH8B 4X99A 3T4YA 4RFEB 1GOGA 4XNQB 3MV01 4O2CB 1VENA 3WJJC 2VLRE 1KYOJ 4R8WL 2ZUYA 2Y7QB 3MNWB 1MCDA 4C57C 5EZOH 5E4EB 3ILQC 4NJ9L 2WUCL 3GSRA 2IJ0C 5IFJB 1AXIB 2HT4D 3S7GA 4EEEA 4KWUA 2IANB 4JVWA 3TBVA 3BDYL 4JFPB 7FABH 1Z9OA 4PRBB 4UQ2A 3CCHB 4M7ZC 2P5WD 3FQWA 4LCYA 1MAKA 2VQ1A 1TZGL 2NXYD 4FS0A 4I0KA 4X0KA 3LV3B 2LU7A 4YC2B 3HLAA 4YHOH 4TOYH 4OZIA 3FO0L 3IDYB 2EXYC 2MTPA 2PYFB 3VI3E 1EPFA 2VZ3A 1NL0H 2ATPA 2VISB 1K9TA 3KHOA 1YMME 1IAIL 1M7IB 1NDMA 1XMWA 2FBJL 1H5BC 2NZ9C 3DUUB 4LCCA 4Y0GA 5GS2H 2XV6B 3FT3A 4ZG1A 4NRXA 3B8YA 4Y19D 3I02B 2YEZA 1EO8H 2I5YH 4TUKH 4P3DA 2DLGA 1LQSR 4WWKD 4IDJL 1BEYH 4HEPG 4JFDB 4YAQB 2GK2A 3RVWC 2C3GA 3CMGA 5CEZE 5CP3A 4RDQF 2CK2A 4KZDH 3R1GH 3P9LB 1KCKA 1A6PA 1S7RA 4RRPG 4K23H 43CAB 3P4OB 1X5IA 3IS0X 2R2BA 2VLMD 3S9DB 3G04A 2BXYA 3HC4H 2NY3D 5D2LA 4ZUUA 1EGJL 4OLUL 4XP1H 2BSTB 2P5ED 3PDDA 1CGYA 1I1YB 2KL6A 3LKRB 1X5GA 4NKDA 2G60L 5HGAB 3IS1X 4JY4A 2CDFB 1OGAA 4MGXA 1IAIM 4JFDE 4LL9A 3JBG7 4U6VL 1GGYA 4HUXA 2GSGB 1HOCB 3Q6FB 4AT6B 2P24B 1LE9B 1QSZA 4F33B 5F1KC 3I6GB 4QGYA 1ZS8B 1JRHI 1NEZG 4ZUTA 3SOBL 5DTFB 2X7LA 2A6IB 4UOW0 4KKLD 4WU7B 4WV1C 4UILH 3RZCA 1ZGLA 1ZT4B 3QQ3B 4CAGA 1OCWL 2FO1A 1WISA 1CE1H 2GUOA 4FFZL 4LSVH 1LP9B 1ADQA 3WJLC 5GQBA 2FEEI 6FABH 5I71B 5D7IF 1U3JA 1PKOA 1IAOB 1DQJA 1YNKL 2HRPH 4HS8L 3EOAA 3PGFH 4OZHB 4XX1E 1OGTB 4K2UL 4QRQA 2DKUA 2P1YA 3QEUA 2XICA 1TMCB 3L1OH 1CCZA 1CG9B 2CGRL 1Z0MA 2DQEH 3C6SB 4FQIL 2IAMA 3JWOH 5BV7L 2IQ9L 1LO2L 4EUPH 1JF5A 3D0LA 5JIKA 3MA7A 2WZPD 3G08A 4GKOA 1LP9E 3L3GB 3MRHB 3RWJB 2NTSP 4RWHA 4QRTA 5C8JA 4WFFD 5TE6L 3VA6A 5DSCA 1F3JA 5AWNH 2WP3O 3ECBA 3OKKB 4NQCA 3TJHC 4YNYA 5TE4H 2KKQA 4GMTH 4MD4B 4OZHE 5AZ2L 3MROB 4NPYB 1LDSA 4NGHH 2ESVD 4WFEE 1L0QA 2FCBA 1TJHL 5MEOA 2XOTA 4Q6YA 2ZSVB 5CGTA 1RUAH 3MRNA 3CK0L 4NP4L 2XRAH 4GUPB 4L4TB 3PABB 1OAYH 5C0RL 4JFEE 5KSUA 2XZCL 3WE6A 1DUYA 1HHJB 4A6YA 4N1HB 1YN7B 2RCSL 4UTAH 5HGDA 2BXZA 4TVPD 4ZDHB 4XB7A 5GIRA 4QOKA 1KBGH 5ENWA 5C0DA 3V9FA 2Y6SD 4WUUD 2GKIA 4LHUG 1B0GB 2YD5A 4IM8A 3HUJF 5TF1L 1G7PB 2NYYD 1OAKH 4F80A 2DLFH 2X1OA 3PUCA 3QDJB 2CQVA 1B0RA 1IEBB 3UPAA 3EJJX 3GMQA 1OM3H 1KT2A 3UZEA 3N1PC 2HTLD 1FIGL 3CMOH 4GBXA 4JRXD 4PD4J 43C9B 2WUBL 3PWJB 3QDGA 4K94C 6CGTA 4OIAA 3NFNB 1NAMH 2Y23A 4ESKA 4L4TE 4LRNL 3O2VL 2AW2A 3QXWA 4Z7NE 1HXYA 3U0PA 1N64L 3S4SG 2GITA 5IG7B 1I1CA 3S37L 4GXUM 5E1HB 1E4WL 2R9HD 1XCQB 2CIIB 5KVDH 1KPVB 1KN2L 4N8PA 3IDIB 5JHLH 3MOQA 1GC1L 4U3HA 2ZCKL 1SYVA 3IU3B 1KEMH 3ARDB 4P57A 1YUHB 1ZLUH 4X7TA 1KG0A 5E6ZA 4JO1L 1CVRA 1WIPA 3SDDB 1DQQB 4JHWL 5T33H 5JMRA 4S10A 2I9LB 3GSVB 3QUZC 4X4ME 3HAEG 3TIEB 1C5DB 1A7OL 1TJIL 3NPSC 4DGIL 5IW6A 1JYNA 4JKWA 3NIFF 3O8XC 1AJ7L 4ZPTB 4GAYB 3ARBD 5KVEH 4LPWA 4PPTA 4PJBF 4FZ8H 5I17A 2Z8RA 1WVZA 3U0WH 1CU4H 3CFKA 1A6TA 1WSST 1RZKH 3G5XB 5A2FA 1EEYB 1MFCH 4Y4HD 1I9JL 2DYPB 3DHJA 3B9AA 3V4VL 3UJIH 3JWDC 5JPNA 1V3LA 4QHKI 4JFYA 5EO9B 4I1NB 3LQZA 2UZIL 3H7BA 5CBEB 1HYSC 2HJKB 1IKFL 5E00A 4DKAA 4ZFZB 4B7LA 4LKXB 1YEFH 3LRSA 4JM2A 1MWAH 3BAEL 4KKNA 5JNYB 3MR9B 4M5YL 4F9PC 5IT2H 4Z7WF 4HC1H 2MNUA 4M7JH 4UINL 1PVHA 3M17A 3P77A 4NO2B 3NA9H 5LCVL 3WSQL 1Z3GL 4RQQB 1INQB 5HDLA 5ACMA 3CUPA 3BEWB 2D7OA 2GJZA 4I0PD 3WUWG 2JELH 3WV0A 1BP3B 5BCAA 1QQDA 3BMWA 3MJ9L 3SGKC 5JA8B 3DX7B 4YX2L 3WDJA 3VRIA 5C9JA 4F7CA 1B4RA 2IWGA 3QI9A 1R3JA 4X83A 3RWGB 1FZKB 2YD4A 3ET9F 3H0TA 5D7SL 1ZLSH 4YHLL 1J1XL 5AZEL 3QPQD 2MOVA 1A6ZA 2G9HA 3RGVC 5CILL 3QEHA 3MRDA 3PHQA 1HILA 3QUYA 1PDKA 2XPGB 5DS8B 3S36X 2LQRA 2FIKA 3ZDZE 4U6XA 2BY0A 3QB7C 4JG0L 1D5IH 3LB6C 4CN4A 1A1OB 2EIDA 3GSNH 1OQXA 5IHZB 4KRPD 3VFNB 1DN2A 5DFVC 4UNUA 2DDQL 4ZOCA 3WHXB 2P46B 5I8OH 4OZFH 4MJIA 1FORH 3EZJB 3HG1A 4U31A 3VXMA 4BH7A 1LO3H 4ZXBD 2ICWB 1E6OH 1G9NL 2OI9C 4J8RB 4PJ5B 2OJEB 3VD7A 3WFZA 2I26N 4HIHA 1A4JA 1WLHA 1U8OA 3QCTH 3BZ4A 3W0WB 1CF8L 4KJYA 4LPVA 4OFVA 5L6YL 1SY6H 1GGBL 2VLJE 3KWWB 4R90L 2VMFA 4IS6B 5I73C 3X17A 4UAOB 1RZ7L 3TIDB 1BX2A 1EFQA 1NCAH 1U3ZA 1IZKA 1JZ5A 4JFHE 4ISVB 4ZUWB 2EXWC 2I9TB 2QADB 3R4DA 1OTSC 4GAGL 5ESVA 4JHAL 3MV9A 1DQDH 3BIAX 4OD2B 5EU6B 4PBWD 2VDLL 3MOBL 2RIKA 4GKNA 4MD5A 5EO0B 1W72A 4QF1B 1DVFC 4PJ5E 3B8SA 5E8DL 3B9KD 1I1RA 5F9OL 5HI5D 5CHNA 3DTXA 5FYJU 4NJ9H 3FO9B 3ZHDA 5GRVL 4M93C 3W0WE 5IFAH 2LU3A 4P2OB 2JTDA 4KKBD 3BDYH 4X6EB 4BSVA 3N06B 4MJ5B 4N1CA 1NJ9B 4DZ8A 4JY6A 4JQVC 2CRMA 5FO9A 4NKMA 1TZGH 2PYEA 5BVPL 1IC7L 1TNMA 4MAYB 1KJ3L 5C7XH 3P73B 4XAKD 3FO0H 4OCMC 3MRFA 3SCMA 3NIDF 4KKAC 2A73B 4OCWH 2X4RB 1IAIH 1VEMA 4JZOB 5DMJB 1EXUB 4XVUC 2HG5A 2FBJH 1BGXH 1ZWIB 3TCLA 4LHQB 2R29L 4JB9L 3GMPB 1PZ5A 4ELMB 5ICXA 4HWZA 2D4DA 3L3KB 2B5IC 3SGJC 5A3IC 1MVUA 1S7SB 2AJ3A 3O11B 3MNVB 1KCRL 1BIIA 4HMCA 3PGDA 5IW3A 4JRYD 4E0RA 3OKOA 3BT2H 2NY0D 3GSQB 4N0FA 3LKOA 5C07D 3PNWA 5L2KA 3UPRB 2HMIC 1FVEA 1U3HA 5EC2B 4EQ2A 2BNQA 5D1ZD 1NC2D 3WNPA 4GQ9L 5IVZA 4GG6B 3KS0J 4LSDA 4MQTB 2FR4A 2VLLA 4PJ9A 5DWUH 5D2LF 3C5ZC 5DD3L 2E6PA 1H3VA 3DX9A 4ELME 5A43C 5JPMA 1XIWA 3K3QA 4IRSC 3WFHA 2O5ZL 1EGJH 1QZ1A 3MBEC 2D7QA 3KPQB 4OLUH 3RTQD 1V3KA 2H41A 5E2UL 1D5BA 3OL2A 3VFUA 4UI2A 2G60H 1E27A 3GRWL 2A6KB 2HT4C 4U6VH 2FX9L 1Z9MA 2VDPL 4QRSB 3V6ZA 2YUZA 4LAJH 4LSQH 4LCIL 2P8LA 3C2SA 1S8DA 3LKQB 4UMGA 4GG6E 4NQCD 3BIKB 5JW4M 3SOBH 1P6FA 5DVNA 1KPUA 2XNAB 3MRJB 1BJ8A 4CADB 3QEGL 5DJ0B 3UEZA 2FHBA 4NN6B 1GJIA 5J6GB 4PJ8B 4QHUB 4U0QB 3VFTB 2EDNA 4HH8A 5AEAA 5H35A 5FKAB 1OCWH 4LDOB 4NSKA 5SWQB 4R7NB 1ZANL 4FFZH 4PJFA 4UU9B 1BOGA 2JE8A 1JNLL 5D5MA 5JLZA 5FYLE 4NKIL 1KN4L 2DWDB 3CDFA 5CIPA 3RA7L 2UUDK 3WN5B 1JUFA 1N5AB 2BSED 1O0VA 3OJVC 3R0NA 4KK8D 2DOCA 1YNKH 3C87A 4G5ZL 2VZTA 3W9EB 3FO1A 3C8KA 1VKXA 4PG9A 4LSPL 1G6RA 1PY4A 1TXKA 4K2UH 3OKMA 5FUCE 2CGRH 4CVUA 2VJXA 3DURB 3VXNB 1IGYB 4FQIH 3TNMA 4V1DD 3VD4A 4H1LA 3IJSA 5BV7H 1I7ZB 3MLVL 2IQ9H 4NZTL 1NUNB 1XR8B 1XT5A 3QDGD 2XWTA 1QFHA 4JFFA 3RKPA 4PJGB 1YN6A 3EJZC 4LVEA 3FQTB 5K9JL 3IDNB 2MCPL 2X42A 5GGSB 4HIJA 2NY3C 2GY5A 5E94B 2OBGA 2RAMA 2BCKA 5TE6H 2BRRL 3TBWA 4FQQB 1CFTA 4UV7H 3BKML 3T0WA 4N0CD 1S78D 4CVXA 5AZ2H 5DQDL 4ZO6A 2V9RA 1DE4A 2APWA 1TJHH 3TP4A 2X70A 1G0DA 2JJSA 3ZL4L 5DD6B 3HC3L 3SPVA 1WCQA 2B8OT 3CK0H 4NP4H 1BMGA 3JTSB 4HKXA 5CJOH 1J8HB 2B7DT 2IH3B 2XZCH 4PJGE 3UDWA 2XWJA 5E8PA 4RMQA 3FQNB 4KKLC 4OQTA 2RCSH 3EFDL 3IRZA 4HBCH 2H9GA 4YBLB 1WITA 2R0LH 1L7IL 3MLTB 4IMKA 5D93B 1E28B 2X89A 4JZNB 4NQDB 5TF1H 4XNXH 4GXVL 1WCBA 4LLAA 4NQSA 4YXHL 1T1ZA 4OQ1A 3SQOL 1YECL 1V7NH 3DXAA 1FIGH 1I8KA 2V6HA 4EUPB 5GGRB 2Y5TA 1I8LA 3I9GL 3K2UL 3VFMB 1Q9WA 2Y36L 3N1FC 4K94L 4RSVA 4LRNH 4ODVL 4MNQB 1J8HE 1FJ1A 3O2VH 3RKDD 5K9KA 4WTZA 2DM7A 4YHYC 1RZ8A 4EI5A 3QXTA 3MQIA 1N64H 2D7NA 5GS0D 1D5XA 2BNRB 4HUKB 1R24A 1KPRA 1W0WB 4PJIB 4NQDE 1R3LB 1QVOA 1GPOL 3LQAC 4Z7VB 1CE6B 1VFBB 1GC1H 3C5ZA 2ZCKH 3KLHC 4E41D 5BXFA 3CVHA 4NC2B 5J13B 1UZ6F 3DUSA 1FAIL 5CLWA 4Q7DA 3HE6B 4JHWH 3FRUA 2ZSWB 3I6KA 3OB0K 4LCUA 4MNQE 1AXSA 3QI9D 4S1DC 1A7OH 1TJIH 2NW2A 2VDQL 4XBPA 4DGIH 3MYJB 4OF6A 1OF2B 2E9JA 1A7QL 4WGVB 1I4FB 1AJ7H 2BNRE 1U8LB 3L5HA 5EU3A 4JKLA 3BQUD 4M5ZH 4M61B 4PJIE 5JR1L 1H15B 1BOYA 4CMMB 4TN9A 2AJSL 4XPBL 1MCCA 3RL2A 1I9JH 2R15A 3FFCB 4S11A 3B9DA 5FO7B 5E0QA 4NYLA 1EAPA 5LWYL 1NAMB 2AJZB 3JWDL 5FKPB 1HH9A 1T80A 5KSAD 2NYYC 5BJTA 1Q9KB 2GTWA 1CIDA 2UZIH 5DGRA 4JM2F 1IKFH 1W0VA 5JOFB 3MV7E 1X5AA 2HTLC 3QFJA 2OX5A 4O51B 2UV3A 5DHVA 1C1EL 1QO3B 3W39A 3BAEH 1WBXB 4PY7A 2ED9A 2VABB 3IU4L 3BIBX 3HS0B 3CU7A 4M5YH 4ZYKB 4UINH 1RZIA 3MRKA 4HAGA 1XGTA 3FB5A 2WM0A 3HRZB 2F15A 4KMLB 2A83A 3WSQH 1U2CA 1VEOA 2D03L 3MJ6A 3FFCE 1JYWA 2XN9A 4OV5A 1T1YB 3E6HB 2E3VA 2FSEB 5HHOB 4WW1B 3MJ9H 3I6LE 4YX2H 3EYVB 2R0KL 3GSWB 5KN5B 5D7SH 3QXAB 4X9IA 4YHLH 4APQC 1IL1B 1J1XH 5F9JB 5AZEH 1TCMA 3O9WD 5CILH 1CFQB 5GHWL 5ADPL 2KDGA 3PWPD 5JORA 1IMHC 3P0YL 1AGFA 3GK8L 4LVHB 3BH9A 5EOQL 3G9VA 4GG8A 4GKZA 3H2WA 4WHCA 3VXPA 4QRRA 2H6PA 1F97A 4FXKA 4LF3B 4X8JA 1G0XA 4JG0H 1IGTB 1CR9L 1Y18A 2HVJB 5C08A 4UNTA 1FNAA 3ARBC 5D1QB 1A1NA 1JNHB 3OJMB 2DDQH 4RGOL 5HHOE 2Q76A 4YLQT 1WZKA 4WI2A 3GMNA 5DA0B 3RWCB 4NC1C 4WJ5A 3BD4A 3NAAL 5IB4A 3TO4A 3TWCL 1A1MA 3D5OF 4KRLB 3PHSA 1A22B 3UC0L 1HWHB 4Y4HC 1WFTA 1DDHA 3RVTD 3FHQA 1MWAB 5IHUH 2XQYK 3WNMA 1G9NH 4LU5L 1QSEA 2ICEA 5EZJB 2J8UB 4XCCL 3HR5A 2Z8SA 4DCQB 1DEEB 2NNAA 1CF8H 3I75B 4PJXB 5L6YH 3UTSA 1GGBH 1JF1A 3PIQA 3LN4B 4R90H 4HKZB 4PV9B 4G43B 4Y4FB 3AY4A 5LXGH 1RZ7H 3KLSA 1T83C 2PO6D 4I5BA 5I8KL 2OTWA 3ZMRA 5FYKE 4NNXB 4PUBL 1N0XL 4ZSOA 1U3HD 3U30C 3O0RL 4QGTA 1C16A 5HHNB 3VGBA 4I0PC 1AKJB 3MOBH 4U1JA 4K3HA 4XCNA 4U1SA 1WWAX 3F12B 5K59F 2PW2A 5E8DH 1NCCL 5F9OH 3K4AA 2X1QA 4EDXB 3QPQC 5C92A 3O6FB 4MDJB 5CZVL 1GL4B 2V9QA 5GS1C 4LLDB 3FQUB 4W70A 1IC7H 4OJFL 4R97C 1JZ8A 1KJ3H 1P2CA 4U1HB 3NZHH 2YUXA 4KY1L 5I75B 5ADOL 5GGUB 5C6TL 2RR3A 2C4FT 5GXBB 4OZ4A 2G5BA 2HVKB 2OR7A 4KRPC 4OCRL 3HMWL 5EBLA 2X44D 1WIOA 1CFNA 3VD3A 5SX4H 4OKVA 5T1DL 2R29H 4XP9H 3MODL 3TH4T 1FVDA 3IF1A 2R1WB 4FRWA 4P9HL 2ZNWA 3NCEB 1KC5L 2KPNA 1T21B 4TNVF 5F96L 5CEYB 1ZA3B 5K9QI 3B5GA 4QXTB 5F89B 1KCRH 3TA3D 2E9BA 4PGEB 1JN6B 1R3HA 4WENB 4CU8A 5DYOB 4NM8L 1P7KB 4X4YB 2VXQL 5HGBA 3U82B 4NDMB 4GQPH 5TDNB 5ALCL 2G75B 4KDVA 3QZWB 5IROA 3ZT7A 4GQ9H 2NCMA 4KQ4H 5KSVB 1Q0YL 4P46B 1D5MA 2NY5C 2OL3B 1TETL 5DD3H 1KJVB 1NMBL 4L9DA 1HNGA 3VGAC 2O5ZH 3QT2A 3RHWF 4Z76A 3ARGD 1KJMA 4TVSa 1IQWL 4KPHL 1U92A 1KB9K 2AJXL 4NKOA 4YGVA 3MREA 3B9KC 5HI5C 1G7MA 1BBDL 5IESL 3PJSA 4M1CC 3MLYH 5EIQA 2FX9H 1Q9OB 3CC5A 4R2GD 4KKBC 1LEIA 4MNGE 5FYJD 5TQ0L 1IKNA 25C8L 4P23B 4LCIH 4Q2ZB 5A16B 1I9RL 3L6FA 1U93A 2WLYA 2J2ZA 5I16A 2F53A 5LGKA 3QUXB 3QEGH 3HUJB 4NKQB 1F58L 1EEUA 4UB0L 5LAXA 5EZLA 5FM5M 4PJFF 4QLRA 4DUXA 2Q20A 2F9BT 2FWOB 3EKCA 3HNVL 1ZANH 3BZEB 1HHHA 5FK9A 1FFPA 3BVNB 1JNLH 3CNKA 4OLYL 4NKIH 1TVHB 1KN4H 3KPRB 1AQDA 4JAMA 3RA7H 4U6YA 3VCLA 1F4WL 1LDPL 4G5ZH 5TF0A 3OAUL 4LEOA 4PB0L 3FB7A 1I8MB 3O3AB 2NY0C 1JGEB 4LSPH 1NC4B 5FM4A 4N1EA 1KTKE 3HUJE 2XIDA 3QO1B 4JEGB 5D1ZC 1BLNA 1C12B 1BQSA 2UVEA 2P43B 3MLVH 4NZTH 3QJHA 4NCC1 4PR5B 2AP2A 1J5OL 4K07A 5K9JH 2MCPH 3PE9A 4HXAL 3SDAB 5HYJB 4LNVA 1JGLL 5K9QG 3CZJA 1U8HA 3LS5L 5FECA 4X6CA 1U8JA 3BWAA 3WKML 3KPRE 1AY1H 3VH8G 2BRRH 1QKZH 4PGCB 1AO7A 2H8PB 2OXGA 4IRJB 3BKMH 3TBTB 2GAZB 2D0GA 4S1SL 5JHDE 1KIPB 4WW2A 5DQDH 5KVMC 4PJBB 4O2FA 4LBEA 4HHAA 4D0DB 4OLEA 1BD2D 2F74A 1DQML 2QR0A 1KXTB 3ZL4H 4FQPA 4FXGB 3HC3H 4NM4L 5D71L 1YA5A 2A2QT 1X5ZA 1YPZF 3L3DB 3B3IA 1UB6B 3PV7A 5BO1L 3QFDB 2Q7NA 3EFDH 4MCZB 5HYJE 1NKOA 4Z95L 1KOAA 1J86A 4OLZL 1AD0B 1HEZB 3QDAA 3SDCA 4W6YB 4PY8I 4LFHD 3OHXA 3VGGA 4GW1B 2Y1VA 5DMKB 3WFCL 5MEND 3WS6A 4J3TA 3C5JB 1K2DA 5FGBA 1BM3H 3NIFE 4LMQI 4ZAKB 3C8HA 4GXVH 1UXWB 4Z7WB 4YXHH 1LNUB 5H37G 3SQOH 1XF5A 4PJBE 1BQUA 5E8EA 1YECH 4KK8C 5DJZB 3U46A 5AYUL 1NGPL 5INDB 3OKLB 4JFOB 3PWUA 3FB8A 4F7PB 3I9GH 3K2UH 2Y36H 3OR7A 2D7MA 5HJ3B 4RMRA 1SQ2N 4K94H 4X7FC 4ODVH 5DT1L 3REWA 2FHFA 4NC0B 1U8NB 1YY8A 1B6UA 2HA1A 3L95A 4QNPE 4IIQB 3QR2A 1ETZA 3HPJA 4RGNC 4P48A 4YBHA 2A0LD 1ED3A 1GPOH 2J8HA 4LASL 2IF7A 4NQXB 3CDCA 3RWIB 3KPOA 1CFBA 3VDBA 4Z7WE 4PRIB 4MNHA 1T7YA 2PCPA 1ND0A 1FAIH 4F8TA 1T4KB 2R1XB 3AMKA 3RDTA 4N0CC 1S78C 5DHYB 4PS4L 3TGXA 5KS9F 3KXFB 1PG7L 3RWFB 2ATKA 2NY4B 5DI8B 4MMXC 1RU9L 2VDQH 1RHFA 3MGOB 4Y4KA 4ZS6D 1O7SA 4ZQKB 8FABB 1A7QH 1YNTB 1R5IA 4Y1AA 3IDJA 3NFPB 1A3QA 1T5WA 4WUKL 4NT6B 3QYCA 5JR1H 4R0LA 4P5TA 2AJSH 3I85A 4LP5A 4XPBH 4N0UB 5J6HA 4RFNB 1N7ML 4QRRD 5KW9L 3OPZH 4PRIE 4RAVB 1S7WB 3UYPA 4TVPL 4NBXB 5LWYH 1SEQL 3QNYA 3JWDH 3BJ91 4L4VA 3O6KL 2UWEF 4Z77B 4I48B 5JO5B 4H1LG 4YWGL 3TO4D 3ILPB 3BD3A 3CD4A 3CSBA 1ZLVK 3RPKA 4X99B 5FUOL 3K74B 3T4YB 3IETB 1BJMA 1C1EH 2AEWA 3C08L 2EDBA 5I76A 2E9IA 3IU4H 3H8NA 3RKDC 5B38A 3FHAA 1PD6A 3GSRB 4G8IA 3BDBA 5JW5A 2GJ6A 4L3AA 5C09A 2D03H 5CKAA 5GS0C 1KLUB 1UKQA 4NRZA 3QJFA 4M00A 3FQWB 4LCYB 4MCYA 2VQ1B 3MCG1 1H9VA 4Y5YC 3MUY1 4X0KB 3ARPA 5E6IB 2YS4A 4YO0B 2R0KH 2APVA 2DWEA 3HLAB 4OZIB 35C8L 5EUOA 5DJAA 2W9LA 4PRPA 1OD7A 4D94A 4G7VL 4LARL 1R5WA 4YEFA 1NDMB 5C3TA 4NCC2 4JJHA 5GHWH 5ADPH 1FDLH 1FG9C 3MXWL 3I2CH 1ZHNA 4LCCB 1MOEA 1XF2A 2QQLH 3P0YH 5I1JL 3GK8H 3AREA 3FT3B 3QWOA 5EOQH 2IFFL 4NRXB 4DGVL 4KXZI 5T3ZD 3OXRA 4NZUL 1CR9H 3GGWA 4P3DB 2DKSA 3BQUC 2GSIB 3AROA 2E7MA 4RGOH 1JGUL 5J1TC 3KPSA 4JM4L 3NAAH 1WFUA 3ME0A 1JZ2A 1S3KL 3SDXA 1NANI 1CXLA 3JWNC 3SO3C 3KLAB 1G1YA 3UJTL 3T1FA 5KSAC 3H9SB 2WW8A 4Y16B 3NIDE 2R2BB 1N5YL 3G04B 2GK0B 5HVHC 1WICA 5D2LB 4ZUUB 3L9RB 2VR4A 3UBXA 5MHSE 3VXUD 2FJFA 2AAVA 4PREA 3S35L 5DK2A 4LKCA 3PWVA 2VLKD 1A6WL 2BVOA 5JTWA 3EBAA 5D2NE 1TJGL 1OAXL 4JY4B 3DO7A 3TO2A 3WXWL 5I8KH 1OGAB 3WEXA 5HI3D 4PUBH 3VXSD 1YEDA 5CJXC 1RFDL 3ZHLA 1M71A 1LE5A 3MXVL 4MXQD 3H9SE 3AS2A 4PJAF 4LFHG 1NCCH 4O9HL 3ZKXC 4JCMA 3LD8C 1AP2B 3RZCB 2VN7A 1ZGLB 3MLPA 5D2LE 5E2WL 4AEHL 1S5HA 4WEMB 3MMEA 4J3SA 2GUOB 2DLHA 4YHPB 1I1AD 2I27N 2QQNH 3LS4H 3NVQA 4NO0A 3S5LA 1XF3A 4OJFH 4KY1H 5ADOH 4XRCA 5DMGD 5C6TH 1DQJB 3LRGA 4OCRH 3EOAB 4LRIA 2EKJA 5C0AA 3HMWH 1JZ6A 4HDIA 1JYVA 3TVMD 3BJLA 3NIGF 4QRQB 4M3JA 2J4WH 5T1DH 3MODH 4XCFL 4G9FA 5GRJL 4Q9BA 3RVTC 5EIVA 3JV6B 5IEHA 2VWEC 1F45A 3ALPA 3D0LB 3WLBA 4ZUVA 3MA7B 2DQGH 3S97C 4NM8H 1Q72L 1LO0H 4OFYD 3OZ9H 2VXQH 3RAJL 4QRTB 5C8JB 5ALCH 3Q1SL 5DSCB 1F3JB 1QSFB 3ECBB 5IB1A 4YNYB 2KZ1B 1CBVL 2PO6C 1Q0YH 2X4OA 1I7RB 1A14L 3Q5OA 5GGTA 1NMBH 1L7TH 1INDL 4J6RH 5DK3A 2NY5L 3BYYA 3MZGB 4ACPA 4GMSL 4HLJA 4CUCA 3GI8L 5MEOB 3NGBC 4PG2A 4NQEE 4OAWA 4KPHH 4LVNB 4G6FD 2AJUL 2AJXH 5KSUB 2D0HA 4QWWC 1DUYB 1GZQA 4GRWH 4G6JL 1WK0A 3V7MA 5EOTA 2F5BL 1WFOA 1D9KD 1BBDH 5CS7A 2FX8L 2MQCA 4M6MH 2K3TA 5TQ0H 4Q9CA 4AM0A 1CT8A 25C8H 1QR1B 1QSFE 1I9RH 5F9DC 4D9LL 2ADJA 1H5BB 4PV8A 3V0VA 3V5KA 1B0RB 4X4XA 1DFBL 3GMQB 1F58H 4UB0H 3TYFB 1QG3A 4XP6L 4MSWB 4KGJA 2GHWB 2J6EL 4GBXB 1ZGLP 1FIEA 3CSYA 3VMNA 4AG4L 3HNVH 3BKCL 4QYOA 1NFIA 4EN3A 1X5JA 4ZNCD 3ARFD 2GCYB 4OLYH 4G8EA 3SGDI 1HXYB 3FONA 2AQ3A 4IJ3C 2PNDA 4NN7C 2V5YA 3D85A 3TA3C 2CO7B 1F4WH 1G7HB 3EIFA 3PQYE 4ODUA 3OAUH 4PB0H 1ONQA 3MJ7A 3HAEH 3BXNA 1OB1B 1RJCA 1M05A 1U2HA 1MHCA 3SO5A 2DI9A 5IVXA 1SYVB 3ZT5A 4XH2A 3W11D 2VC2L 3LKSB 4P57B 1KG0B 3UTPD 4Z18A 1E0OB 3PGCA 2N56A 2WLZA 2CUIA 2FLBT 4HXAH 5J0BA 1JGLH 3HI1A 2CRIA 1B9ZA 3LS5H 2EDWA 1OTUC 1QFWL 4G8GB 3HRPA 3IFOA 4G6AD 1JFQL 3CFKB 5DRXA 4BQ8A 5BRZD 2CKBL 2VLRA 4IMLA 5GGVY 4R2GC 2YPLA 4ONOA 5JPNB 1DQMH 5D7KD 2JCCA 3OMZA 2ARJB 2EIEA 4NM4H 5EUKA 3LQZB 4JQXC 5D71H 3RI5F 2LABA 3G6AA 1UZ6E 3H7BB 2OQJB 3ORJA 4FTVD 1RJZA 4RGMB 5BO1H 5B8CA 2XTJC 4Z95H 4OLZH 2XY2A 2WNGA 3LRSB 4JM2B 5EC1A 3VE0A 2Z93A 1ZT7A 1AGCA 4IOFD 4G8GE 1JPTL 4JLRA 1NCTA 3JVGC 4Z5RA 3M17B 5IGXH 4M6AA 5CSZA 1PLGL 3BH8A 3P77B 3HFML 4FNLL 3HA0A 2XFXA 4A6YL 3BRFA 4JO4L 2CUHA 4LOUC 1A2YB 2Y7QA 3REVA 3CUPB 5AYUH 1NGPH 2YOCA 2GJZB 5L2JA 1S7XA 2EDOA 4HK3N 3ZKMD 1B88A 4QRPD 5C9JB 3IDUA 3M45A 1QNZL 3QA3A 3VRIB 1HSBA 1E4KA 5ANME 5DT1H 4PRBA 3CCHA 1QA9B 3TZVD 1KYOK 3HZVA 4ONHA 3LV3A 4AJ0A 1A6ZB 5IBLD 2G9HB 2YBRB 2CSPA 2LVEA 1MFAL 3QEHB 4KMTL 3IJYB 3PHQB 1HILB 2PYFA 4UIMB 3QUYB 4B50A 2FIKB 5F7WC 4W4OA 1M7IA 4YXLL 1JWUB 1FYTB 4DK6A 3QHTC 3DUUA 4YUEH 1ZAGA 2CO6B 1HQ4A 4BZ1L 3QRGL 3FFDA 1E4JA 1YEGH 1P69B 4M6NL 4PS4H 3I02A 1PG7H 1ZA6A 4R4BA 5J57B 2H45A 4MJIB 2DI7A 1RU9H 4GFTB 1GIGL 1MNUL 3HG1B 3NMEA 4JDVA 3VXMB 1F6LL 4PRHA 4JFDA 5ALBL 1XGPB 1IM3B 1NBZB 2APTA 2YPKA 4TRPL 1JI1A 2Q8AL 3DYPA 1BVZA 2E9WA 3LSOA 1J0HA 4HIHB 4KV5F 1A4JB 4LCWD 4WUKH 3OWEA 1BFTA 1U8OB 3GHEL 5FCUL 4KJYB 3RVXD 3THML 4D3CL 1N7MH 3GMOA 3P0VL 1FYTE 4XNUL 5KW9H 3WIHA 4TVPH 4B5EA 1LEGA 1SEQH 5DR5H 3BPNC 3O6KH 5D1XD 4YWGH 4XMLL 5ESVB 1I1YA 4LGSB 1N6UA 4FABL 3LKRA 4S1RL 4MJIE 3MV9B 4JDTH 2Z31A 3HG1E 5FUOH 5JIIA 4GKNB 4S2SB 3LPWA 3C08H 1W72B 4XCEA 4YFLI 5M95B 2GW5A 4AT6A 2MCG1 2P24A 4F33A 4XPFL 3DTXB 5CHNB 3C60A 1ZS8A 2V5RA 5IQ7L 2Z91A 1OSZB 1WWCA 4M43L 3D2UD 5HHMB 1QR4A 4ODWB 4DEPB 4XI5D 4MQ7A 2A6IA 5GS0L 3WIFB 4WU7A 2A0LC 3DV4A 5FO9B 2DQTL 1JHLL 1RZGA 5SV3A