4QOKE

Structural basis for ineffective t-cell responses to mhc anchor residue improved heteroclitic peptides
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
244
structure length
244
Chain Sequence
SQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSVGIGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWSETGLGTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Structural basis for ineffective T-cell responses to MHC anchor residue-improved "heteroclitic" peptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 244
sequence length 244
ec nomenclature
pdb deposition date 2014-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qokE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qokE01
4Z18A 1P84J 1EFXB 2H2PC 2H9GA 1Q8MA 4M02A 3LAFA 1AGDA 4MQTB 3PGFL 1HOCA 3JBG7 4KJYA 3QDJB 4RSVA 3SGKC 3BVNB 3N1FC 4OT1L 1FNGA 1MCRA 5EO9B 4MNGE 4KRPC 4RFEA 3DPBA 3MRKB 2EEDA 4EBQL 4I2XE 1PYWB 5I18L 15C8L 1WWBX 3CFKB 3TO2B 3IDYC 3QUKB 1DANU 2FR4A 1CE6A 3A67H 3QDHA 3DURB 4QRUA 3ZDXE 3OPZH 4UBDC 2GYSA 2ZNXA 1SYSA 4TVPE 1T3FB 4LPUA 4X6CA 4N0UE 1CT8B 3TBWB 5EBGA 3QCVL 5C9JB 1IVLA 4NJ9L 3U46B 4J6RH 3RKDC 4XI5C 3H9HA 4FFVC 3EYQC 3HNTH 2OCFD 2UUDH 4LLWB 4NIKB 5DD5H 4GQPH 5T33H 3O8XC 4XHJC 5CMAB 2J6EH 3RVVD 5SX4H 4PJGF 2R2EB 3VXQB 4GBXA 5KS9A 4GG6A 2R0LH 1HSBB 2CDGB 4PGJA 4RZCB 2CIIA 4WV1B 5CIPB 4ZAKB 2DKSA 3OL2A 3WO4C 1G7PB 4NNYA 2V5MA 3PP3H 3VWJA 1XF4B 1QSEB 1TJIL 1DL7L 3U7YL 4NUJA 5LGHH 5BV7H 2DQGH 2XA8H 3QXWA 2FX9L 1H3TA 4KQ3L 2VLKA 4G8EA 1CICD 5DJDA 3MTRA 5E4IA 2L4OA 5IG7B 4F15B 2H1PH 2CLZA 3SGDI 1NC4D 5E8OA 3MV7A 4NPYB 4K2UH 4UT6H 1R3LB 4KZDL 2K7QA 3BUYB 2GT9A 1FG2A 4J3TA 3KPOB 3GI9L 4JFHD 1QRNB 2D31B 1IM9B 1U8KA 1QSVA 4P2OD 4QRPB 5KAQG 5HYJD 4GMSH 1V7ML 2FBJH 1HXMB 35C8L 1HDMB 4HFWB 3X3GL 3ARYA 4H88H 1YYMH 5MENA 4XNUH 5HHMD 3WHE1 5B38A 5ALCL 4JRXE 5IT2L 5EZJB 1Y18A 1A7PH 5EBWA 3T3PF 4IOFC 3W9EA 4OD1H 1SJHB 2N1KA 1T21B 2J5LC 5K93A 3L5HA 4PJAB 4FXLA 2I24N 1GGYA 1V7NL 4X7FC 3CXHJ 4NQDD 4AIZB 4PB9H 4X7EC 1G7JB 4NQVA 2R0WL 4RIRB 3D0VB 5A43C 4HKZA 4XVUC 2SEBB 1BJ8A 2EDJA 4JPIA 3ZDYF 3PABA 1YQVL 1N2RB 2VXVH 4NNPH 4GRWE 4ZOBA 1KBGH 1U42A 4PJDF 5AWNL 3UTZB 4HWBL 2HA1A 1N59B 1NSNL 4I0PD 3THML 2F5AL 1CGXA 4FG6C 2VR5A 2IPTH 4LCWA 1A22B 4GG8A 4KKNA 3LV3A 1FG9C 1T04B 5DRZA 2IH3A 2NW2A 2F53B 2NLJA 1OPGL 2OYPA 2IALA 1K5NB 4URTB 3ES6B 3VFWB 1ZA6B 5L2KD 4ONFH 5EORL 1AHWA 1DBBH 1GZQB 1HHGA 4LLVB 1IC5H 1X5LA 3SN6N 3CU1A 2GJZA 1ZLSL 2APXA 4X8JA 1KPUB 3LDBC 5JDSA 5SWSE 1ZS8A 1JPFB 4G6ML 1PGRB 5CD3B 3VA6A 2V5TA 4G43B 2PNDA 5D7LB 3IFPA 1FZOA 3QNYB 3ULVE 2P5EA 1YJDH 3ARVA 5CWSB 1PLGH 4HK0A 5F8RC 1RK1B 4HJJH 4JDTH 4E5XA 1FVEA 5CKGA 3L3KB 2A6JA 4UAOC 2DQUH 1MWAL 3BJ91 3ZL4H 3SDDC 3WFHA 3EOYG 3QHFH 3G9AB 5HHXL 1MFEH 2DN7A 4PJBB 2DQFA 2BCKB 1ADQL 3EDDA 4MX7B 1RULH 5JW3L 4V1DE 4L8CA 1JZ6A 4YHOH 2FHCA 5HJ3A 4D8PB 1DANT 1IKNA 2NZ9D 5KSAC 5FM4A 1CGSH 4LDOB 4MYWB 4OFVA 1R5VA 1MHCB 2ZG3A 3WHXA 1UT9A 1FZKA 1I8IB 4X0KB 1I4FA 3WE6A 5JW4Q 3GIZH 4N5ED 3RWIB 3OZ9L 1XF5A 3PE9A 1FO0H 1SM3L 3BPNC 1BVLB 1H3XA 4NO5B 5E24E 1MSPA 2HVJB 5TJWK 3VWKB 1MWAA 1OAQL 2XFXA 1RZGB 5D7SL 5GJTH 3OKYA 3IU3A 4AH2A 5IMLB 4NYLB 3U0TB 4NZTH 1CLCA 3BSZL 5AYQA 4PV8A 1ADQA 4JN1L 3IDNA 3I6GB 1BEYH 2YEZB 4RGND 1B0RB 3BMWA 3MLVL 1BFOA 3N1MC 4Y1AA 5EFIA 2M8XA 5MEPA 1AD9A 1DSFL 3F7PC 3L3GA 3L3HA 4JFYA 5C0CE 4XAWH 3QWOB 2JJSA 2XQYG 2HFGH 2YPVH 3HZVA 4IDLA 4XPAH 3IJSB 4FTVE 5MHSE 4LCUA 1TITA 4R6UA 2CMRH 4OV6F 5EBMA 5TE6H 4O02H 1H3UA 2J2ZA 5D7IF 5GPRA 1LE5B 1B4JH 3LOWA 1AGBA 1A02N 5MEOB 1XR8A 3VXUD 1ZGLM 2YPLD 2JB5L 3ARFC 1EVUA 4NKMB 3V0VB 4OCWH 3UROR 5CBEB 2JTDA 4DGIH 3O0RH 3BYTA 4PB0H 2AK1L 4CDHA 3FQTA 1N6QH 1M71A 2Z91A 5EU6A 3N9GL 1MFCH 2HTKC 4XVJL 3PHQA 5I16B 3W11D 1FC2D 4F7MA 2Y36L 4MNQD 2IPKB 1E6OL 4GMTH 4PRBA 3WXWH 4N1HB 4XWOC 3T09A 1NGPL 1W8OA 2DMCA 4LEXH 4Y88A 3ILQD 3F7VA 3WXVL 3PQYB 3AB0B 3CX5K 3C60B 1XCTB 4WI4A 1TFHA 4U1LB 1JZ5A 2VDMH 3CMOL 3PWNB 3ARTA 1OWWA 2F8OA 2PR4H 4JAMB 5K9JL 3VRLE 4XP4H 3LQAC 5L0QC 3MLUL 1CBVH 1CDYA 1WIOA 1FFNB 4HEPG 4XCFL 2DQHH 2A0LC 2KQMA 3V4UH 4LHQB 1UKTA 4HULB 1SY6H 5IQ9A 3L9RA 1AP2A 2ZUUA 3LKOB 3QIBB 4XH2A 1TZHB 1MAML 5FIEA 5I75B 1KEGH 3LEVL 1CD1B 4JZOA 4OQTL 3JWDL 3FONB 3CGTA 2ZUSA 3B9AA 3RNQB 4JY4A 3KPNA 1EZVY 3SE4A 3CPLB 1BREA 1VFAB 4PIRF 4Q2ZA 5DYOB 5ISZD 3JTTA 2V9TA 4ZUTB 5I2IA 1OB1A 2BHYA 5KSVB 5J1AB 4J4PC 5H37H 4N1CA 4APQD 5HVHB 4OF6A 5D7JC 2Q8AL 3FRUA 4G8GB 1J8HD 4GKNB 5KN5B 4JLRB 2G2RB 3SKUD 5DF0A 4YHIB 2A77H 5TE4H 4F57L 3QUXB 2X7LA 3IFLH 4OQTA 1P1ZB 4R0LB 3OJDA 4C54A 3GHEH 3NFNA 5CJ5A 4Y4FB 5C9KA 1FGNL 1QLEL 1J18A 4ZFOB 2KBGA 1MCCA 3QG6B 4UTBH 4NCC1 3UYRL 2DQCH 3HUJB 1XF2B 3TBTA 43CAA 1IC7L 3ZDXF 1HYSC 4DN4H 4E9LA 2AJZA 2LTQC 1RD6A 5DRWB 3OXRB 4NO2A 4AQOA 5JHLH 4OLUL 1CTNA 5EULV 4NKDB 5B38G 4L8SC 3VCLB 4M1DL 5KOMC 2DF3A 2IGFL 1RIUL 1FRGH 2BSTB 3EAKA 5HYEA 2XTJE 2GAZB 4XCNB 4IRJD 4KUCF 5ENWA 1CIDA 3CZFB 1NCAH 2GK0B 4OM0L 4WGWB 1N3NA 3EO0A 3JV4A 2EH7H 3NIDF 5ADOL 4P5MB 1RI8A 2QADC 3LS4H 2OS7A 3P73A 4ODSL 1ORSB 1DEEA 2FL5B 1H5BC 4DKAA 1JRHI 5BXFA 3NZHL 2LU7A 1XGYH 1NUGA 1OAYH 2AEWA 2GUOB 5CLWA 4ZXBA 1ZA3A 1FNEA 2NY3C 1ZLUH 5IEKB 2FJGA 1E27A 3P9LB 1K4CB 5CHNB 4DK6A 3SDAD 1T0NA 3P30L 4NHUA 1EEYA 1ITCA 5T5FL 4Y16C 4N0CC 1GPOL 4YQXL 1Q9KB 5LKNA 2DDQL 1U93B 2V2XA 1KJMB 1LO3H 2D7TL 5F6HI 5KVGL 5LG1A 1LEIB 1EHLH 3SJVE 2ZJSH 2NNAA 3CD4A 3DNKA 3SE3A 2HTLD 4F9PC 5J6HA 1WQVT 4J1UA 3DI3B 4YFLI 4Z7OE 5ITFB 2YBRB 1VEPA 5TF1L 5JQHC 5LCVL 5IHZA 2UVFA 1T7VA 4PRDB 3MYJB 1A1OA 1OD9A 3AREB 4GRMA 4RMSA 4CMMA 1FCGA 3G6JF 5F7YC 4EN3D 2R23B 3RWHA 1VEOA 5DURB 4KJPD 2VLRD 1D9KA 1JPSL 3DUUB 4K23L 3MRRB 2DYPD 1HXYB 3C6SB 1WBYB 1OAZH 3RFZC 2ENSA 4WI5A 5DJYB 3F5WB 4NHCL 3BP4A 5T1KD 5I8EB 2HWZL 1UACL 4S0TD 5FECB 2I9TA 1YEKH 2AJSL 3PJSA 2IANA 3C2AH 4OZFH 5ESVA 4XZUA 5BRZD 1X7QB 1DDHA 2E9BA 5F96L 2XYCA 3BZFA 4PJ5A 1CXEA 1I7TA 4K8RC 4UV7L 4HEME 1NBYA 1KCUL 1RJZB 4JFQA 3HC4L 4NO0D 1KXQE 3H9SB 2A6KB 4QXTA 5F3HA 1Q9OA 3LMJH 4XXCA 3DUHA 4MNHB 2ITDA 3HNVL 1RZFL 3ARBC 5D7KE 3S4SA 1O5DT 1UKQA 4HH8A 2BHZA 4Z7UF 4JB9H 4EI6B 2E8YA 3OAYK 3OX8A 3SGEH 3P77A 1C7SA 5FO8B 2FJHB 4AYFA 3KJ6H 2WZPD 4Q6IA 3MYZA 1I8MA 3I6LD 4FFWC 4C83A 5AD0A 1ZWIB 2PTVA 4BZ1H 2E3VA 3ULVF 3UO1H 5GRZA 1JGDA 2WP3O 2HFFA 3DMMA 2H32B 2VLME 5C08A 2P8PB 5D70L 3DYPA 1OP5K 1W0VA 4KDWA 1GGIL 5E2WL 3E2HC 1P7QA 4E42A 2K1MA 1A14L 2JB6A 1U2HA 3ALPA 4H20L 4U05A 3UYPA 3TZVC 3MR9B 4PV9B 4Y5XB 3BP6B 2YRPA 2W9EL 3V5DB 1WC7A 1G9ML 4YFEA 1HHKA 1H3GA 1U8PA 4OAWB 1F4HA 4UDUB 4NBYB 1OT1A 2DQEH 3I2CH 1WWAX 1QYGL 4YBHA 3ZLQC 1T20B 3BGFC 1WVZA 5B8CC 4ELMF 2H3NA 3CXDH 4XTRD 1MJJA 3N1GC 4UQ3B 2D0HA 2IH1B 2UZIH 4TULL 3I50L 4CMHC 5IP4A 3GO1H 4BFIA 1PG7W 3RVXD 1I3RB 2QJDA 2OMBA 5ESAB 1ZHNA 5ESQB 3DTXB 2VLLB 3U9PH 3M1BB 4F37F 1CFVL 1FYHB 2XWBB 4HWUA 1S7SA 4Q9RL 2IPUG 3ARWA 4KK6D 3LEXA 3OKOB 4ZS6D 4RNRB 2HN7B 4LLQA 1CQYA 4NNXB 3IF1B 3BGMB 2EDYA 4NZRH 4F3FB 1YEEH 5E08H 1JHLH 1CWVA 1EO5A 2IADB 5IESL 5I30H 4GXVH 3RDTA 4UINL 4O2EA 1JWUA 3RWEB 1J5OH 3ARGB 1S7TA 4HXAL 1I9IH 5D5ME 2VITB 3MV9E 4OZHB 5IHUL 4L4TA 4OCSH 1MEXH 3HMXL 1RJCA 3RTQB 5E70A 1KB5L 4PRPB 2H8PB 2IPUK 4Y4HC 3OKMB 1LD9B 4X4YA 3BN9D 2CDEB 4KUZH 2D4DA 3H2WA 3V52H 1XMWA 4NP4L 2YD5A 5FO7B 1R0AL 1CDUA 3IFNL 2DWEA 4KRNA 3ULVH 1JPGA 3VI4F 1YEDA 1OARH 1NCUA 1SBBA 1XF3B 4KXZI 2OTWA 1LO0H 3P9MA 1PKQA 3BD3A 2DM3A 3UTPD 1QSFA 4I18B 4LGRB 3RL2B 3EDEA 1D7FA 1H8SA 5EOCJ 1MCOH 3MLWL 3REWA 5BS0E 1P5UA 2O5ZL 4L3AA 3HMXA 2BFVL 4BQ6A 5C0RH 3O6FA 1KB5A 4PTTB 4LBEB 5E2JA 5IF0A 3M17B 3DXAE 3IKKA 2HYMA 4DVBA 3V4PL 1QFWL 3MX0A 3P4OA 4IDJL 2V5YA 5LGJA 1NLBH 3HTLX 4JHZA 5I1IH 1DUZB 3GK8L 2AKRA 4K3DL 2ZOLB 5EWIH 1C16B 2DJ4A 2QBWA 1JTOA 4F7EB 3QFJE 3B5TA 3MNVB 4WGVB 3D0LB 3H3KA 4MZ3A 3TA3A 5C07E 5DMKB 2D03L 3OR7A 4MCYB 2M1KA 3TO4B 5J6GB 2EIZA 4ZPVB 1JWSA 4I77L 3PWLA 1J88A 1T4KA 2NYYC 1OLLA 2X44D 4NRXA 4WW1B 4WV1C 4ZAKC 4OZIB 5D1QD 2E9WA 4M03A 3EYOA 4LK4A 3D39E 3QJHB 5TE7H 3PWPB 4D3CL 3BDYL 4G9FB 4KI5E 3MLTA 4UU9A 5DC0A 5FKAB 3C8HA 2APFA 1CG9A 3QAZB 2DQDH 2H9GB 4F80A 2R2BA 1AGDB 1E4JA 1JMZA 1AE6H 5FKPA 4KJYB 5DJXB 2VE6A 3TJHC 3NBNA 5DC9B 1J1XH 4PRNA 4JJ5A 4F15C 1MRFL 2CSPA 1BQHB 4W70A 3QDMB 2PYEA 2ZUXA 3D9AH 1IGJA 5I1KH 2V2WA 5DD3H 2FR4B 2DBLH 1CE6B 5GRVL 4QRUB 1EMTH 1I7ZB 4OLVL 1RZKL 3UTTB 2Z4QA 4PJXA 3TH4T 1CVSC 1FORH 2FEDD 5KZCD 3NN8B 4U0RC 4MD5A 2X4QA 1KTRL 2V17H 1KYOJ 1QQDB 3KPLA 4KKLD 5E2VH 4MA1B 4P2QA 4HUVA 3JUZA 1JHKL 4XBEH 4DK3A 3OJ2C 1RUMH 4WHYG 2O61A 4G7YL 5H35B 5IW1B 3GHBH 4PS4L 1QSZA 1FFOA 3KPRE 1DQMH 1IQWL 1ZT1A 1ZV5A 5DEGB 2R39A 4NWUH 3VWJB 1U8IA 3EHBC 3MRQA 4WUUE 3BWAB 3PP4L 4NUJB 5L6YH 3P0GB 1HQ4A 4CW1B 4R90L 1VERA 1L9NA 2VLKB 4LSVL 2HRPH 1LQSR 4EOWH 4PJEE 4I3GA 4U6VL 3D85A 1DZBA 4LQFL 5I71C 2ZCKL 4GRLD 1DLHA 2PXYD 5BVPH 1IGTB 4I3RH 5E8OB 1MHPH 3TLRA 1QVOA 3MRNA 1JVKA 2V5RA 2ATPB 4IRZH 4K8RH 2X4TA 3CLEL 2V2TA 3QCUH 2MCPL 5DUBB 5E6ID 1AXIB 3F12A 5DQ9B 1KLGB 5DHVB 4G6JH 3ZZ1A 2V7NA 4CVXA 2IG2H 3NPSB 5FM5M 1MCEA 4HUUB 3WV0A 2FECL 3PWVA 3QIUD 3QWRA 3QI9A 4H5SB 4KMQA 3BQUD 2WSKA 4QYOA 2EIBA 1IAIM 3Q5OA 4RBPH 5EBWB 3S4SG 4NRZA 2X10A 4RGOL 3S97C 1U3HD 1NKOA 4FQIH 4HJGA 1B3JA 2DLFH 4MDJA 3HNTL 1UWXH 5IGXL 2A1WL 2J6EL 3I3EA 1NC4B 4I3SL 5JUEH 4KZEL 2HLFD 3TBSB 3U0WH 3ARPA 3EJYC 1KJ2H 3EFDH 4ZSOB 4L3ED 4JPIB 1J0JA 3PABB 4L29A 4UTAL 4GH7B 2R0LL 5EOCH 1J1PL 3OAZH 4YBLB 5DA0B 2YSSA 1MCSA 5T3XL 5HYJB 3RZCC 3S88H 2R9HC 2WUBH 1HH9A 2I26N 3P4LA 5DUMH 4Q7DA 3UJJL 4LCWB 5KJRH 5E9DA 3K8MA 4NDMB 5DRZB 2NLJB 3MBXH 2AXJA 1LO2H 3FAXA 4NKOA 4NQCD 3ZTJG 1CL7L 2H1PL 2VDKH 4JFEA 1QBML 2J6EA 5DJ0B 1XGTA 4JKPH 4NQDB 1HI6A 4IRSA 4P23D 2K7PA 4K2UL 5FYJH 2YR3A 4PLKC 3PL6A 4X8JB 1JTPA 1TCRA 2VWEE 3VWKC 2GSGA 2HT3C 1L0YA 2C1OA 5C1MB 5JDSB 3ARDD 4I8DA 3UTQB 4QRRE 3ESUF 5C2UB 1NGWA 3HG1E 5H94B 4GMSL 3IFPB 1FZOB 3T2QA 3KLHD 1YMHA 2P5EB 3P11L 4H88L 4Z7QF 1F5WA 1KN4L 2QEJA 1OTTD 3OV6A 4JQXA 1F3DJ 4DGYH 2GFBA 4B7IA 1F4YH 3L7EA 4PG9B 2A6JB 2Y07H 5L2KB 4XPTL 5FHBL 5BCAA 4M61B 1D6EB 2Z31D 3GKWH 5HYFA 2YUVA 4HWZA 2AEIT 4YWGH 2VH5H 4NFDA 3MV8D 4PB9L 3K2UL 3TYGH 3R1GH 2DQFB 3VDBA 2VXVL 5TDPA 1KG0A 4NNPL 4L8CB 1KBGL 1OAXH 3EJZD 4JO4L 5HJ3B 4MJIA 4ONGH 2BERA 5GRUH 5DR5H 5CCKH 1F90H 1YNTB 2OK0H 5DMJB 3TPUB 1FZKB 4MAYA 3AAZB 1GRWA 3WE6B 1I1RA 3IVKB 2AV1A 1XF5B 4WI8A 4PBXA 4MMZC 2AJYH 2ARJQ 3T0ED 1FCCA 4TNVK 4CVWA 3HE7A 3VRJA 3DUSA 4TUOA 5I15H 3QNZA 4HDIA 3W0WE 1KCSL 2XFXB 3H7BA 3NIFE 4LARL 1IMHC 2P49B 1IE5A 3WLWD 2IWGA 5SWZE 3AB0C 4N9GA 4F7TA 4PV8B 5JNYA 3SOBH 3C60C 3MLZH 1S78C 5DC4B 2NX5E 3IDNB 1KSRA 3L3HB 4JFYB 3O9WC 5C0AE 1P7HL 3KHQA 1IEAA 4KPHL 3WJLC 3MACL 1Z5LA 3EOBB 1RU9H 5BOPA 4MDIA 3VG0L 2L7JA 4JM2F 4ONHA 2DQIL 4RX4D 2AK4E 4HQQL 4GSDL 5SV3A 2FLBT 2XN9D 2C7UA 4JDTL 1MAJA 2X05A 3S35H 2YWYA 3QIBC 3RAJH 5SX4I 3IDGA 1FIGH 2DQUL 3QQ3B 2XZZA 3ZL4L 2BDNL 1A1NA 1DN2A 3QHFL 4OGYH 3ULUC 2DWDA 2HMIC 1XIWA 5DJ6B 1FP5A 5D5MF 1YEJH 3GJFH 2Z91B 4BFEA 5I1JH 4YHOL 1S7XA 4YHPB 5EU6B 12E8L 3SCMD 5ACZB 1PQZB 5C0BA 4WENB 1A3LL 1CGSL 2WIIA 5HVHC 3WDHA 1OQXA 4LRNH 4PRBB 5C0GB 3GIZL 1MI5A 4X6DA 4NRYA 4XBPB 1I75A 1FO0L 1YPZE 2QQKL 2P8MA 3K1DA 3DI2B 3HI1A 1ORQA 3VMOA 3SE9L 2IAMC 3ULSA 3VXUB 1NC2D 2UVEA 2AGJH 5GJTL 3S96A 1RJYA 2YPLB 2DM2A 3QEHA 5A2FA 4YHLH 3C9NA 4P2RD 4PRID 4Y4FC 1T0MA 1IEBB 1VHPA 2RCSL 2YD2A 4FFYL 1Q1JL 1TJGL 3MJ9L 4OM1L 4GW1A 1BBDL 4H26A 2F74A 2GY7B 3MO1A 1BEYL 2D2OA 5HPOA 2OQJB 2JCCE 2BOBB 2OP4L 2R69H 3D18A 5IQ9B 4F7CB 1AP2B 2AQ3A 3L9RB 3QT2A 2HFGL 4ENED 4HMDA 3IGAA 3QUYD 3G6AB 1MLCA 4OCNC 3GBNL 2CMRL 4ZUVB 5TE6L 4O02L 1FO0A 1MCWW 4JCMA 3VXSA 4JY4B 3KPNB 3QRFM 1KNOB 2G5BA 1LP9B 1FNSL 4Y19E 2XKUA 4Q2ZB 5GS2H 4P46A 3JTTB 2YA1A 4BJLA 5I2IB 2W91A 1OGAD 4PD4K 1OB1B 1YNLH 2R1WB 3OAUL 2EKJA 3L3IA 3T2NL 3MJ9A 4TTDD 5CGYD 4UV4H 1DQDH 3P9WB 3ZTNL 1MJUH 2GJJA 1F3DH 5CEZH 5IIEA 3MRHA 2P47B 2H2PD 3IDMB 3WIFB 1NMAH 3D69A 1FDLL 4IEFB 4R8WL 1IT9L 2ICCA 4EDWL 2G5RA 2X7LB 4ZQKB 4FS0A 5FYLH 1K4DB 4KRPD 1CD8A 3OJDB 2QHRL 1JK8A 2DIJA 2BNRA 2GJ6E 4OCMC 2VUOA 1I7RB 5ISZB 1Z2KA 1ODAA 2FNBA 4OUUA 4Z0BL 4KDTC 3U2SA 4M3KB 1W72B 4KQ4H 5DT1L 4UBDD 1HSAB 5DHYB 5GRVK 2AJZB 4X7SL 5DGRA 3HE6A 4FQ2H 5C0DA 4XP4L 5IW6A 1U3YA 3RKDD 4FFVD 1E0OB 1J8HB 3EYQD 2A9MH 5GGQL 2YRZA 3O8XD 4HUWB 4XHJD 2DQHL 3MRCA 1AD0A 1TENA 1FE8L 5DZLA 3V4UL 1LDPL 3FB5A 3ROOB 3WD5H 5F70A 3NTCH 2EYTB 2NQCA 1K8DB 2DL2A 1KEGL 4M6AA 5HXMA 1TIUA 5GGSA 5EUOA 4L4VE 5F7FA 1M7XA 3T04D 5KVFH 4FQXA 4EVNA 3FT4A 5F7NC 4JQVC 3AUVA 4PRHE 3P73B 2HFEA 4NQEE 3RP1A 4BELD 4ZUWB 1QA9B 5TGBA 1MFAH 1INQB 1JBJA 1UH3A 5D1XA 5ACLA 4AL8H 3PWJA 4D0DA 1GZPA 5F9WB 1FNEB 2MHAB 5CUSH 4PJEF 4NZUH 4X4ME 4M6MH 2FJGB 2VJXA 2ZCLL 5FF6A 3QUZA 5T3ZH 1YNKH 1DLFH 3SKNA 1Z9SA 4NHUB 1U8HA 5ANMA 5TE4L 3MGTB 5E1HB 3G6DL 3Q48A 3MCG1 2V2XB 1EJOH 4R97C 5DVKA 3PWUB 1UM4H 3GHEL 4X6BB 1S7QA 1TETH 2ESVE 4S1QH 4EI5A 1HQRA 2XKSA 1JZ7A 1FC1A 1TVBA 3EDKA 1EK3A 2Z35A 4FFZH 3Q6GL 4XBGA 4L1HA 2BMKA 3BIKA 3ULUF 2DQCL 3MUGA 1D5IH 2AJXH 2P24A 1M4KA 4OZ4A 1OQOA 4M1GL 4DN4L 3GSWB 5F9JA 1TJHH 2MNUA 1H8NA 4YH6A 2FGWL 3RWHB 5EZIL 4IOFD 1A9BA 1F3JB 2NY4B 4OFPA 4N90D 1O7SA 1U0QA 5FUOL 3T4AB 4Z7VA 3DVNA 3LD8B 3EYUL 3SDAB 3LKQB 1CGUA 3GSOB 1QG3A 2UUDK 5JPMA 3VXNA 2FX7H 5DD1L 5IROC 4XVUD 4YXLH 1CD9B 5K59E 1FBIH 2AI0H 1A6WL 4OLXH 1JZ2A 5AZEH 1BD2A 3NFPA 3SKJH 3PJSB 4S2SB 2IANB 4XZUB 1S7UB 3KWWB 4JZNA 3GKZA 4FG6D 4PJ5B 4GAYA 4NCC2 1CDJA 2GSIB 3FFCA 3PP3K 4HIIA 3RWJA 3H42H 1XGYL 2EC9U 4TRPL 3STLA 3RVTC 4EN3B 4DTGH 2VDQL 4QXTB 4O9HH 2VLRB 3L5XL 1XH3A 2BY0A 1FHGA 3DVGA 1RUPH 3AY4C 2DM4A 5L9DH 3S4SB 1JWMB 1RPQA 2BRQA 5EIIA 3QUMH 4KY1H 4LSSH 43C9A 3DX8A 1KEMH 4P5TC 1VENA 5FGRA 1IKFH 1NCBH 3OX8B 3P77B 4MJ5A 3AM8C 1LO3L 3ZKMC 4MWFA 2J1KA 1Q72L 3GJEA 1TQBB 4Q6IB 4YJZL 2P48B 1I8MB 2R15A 4KJWC 5BRZB 5DK2B 2BVUA 1T5XA 5LWYH 1RZIA 4KHXH 4YXHL 2WBKA 1CF8H 4N0FB 5DDHB 4ZFFB 3QULA 5GISL 4NO0B 3DRTA 2JELL 2MWCA 4YEFA 3NABH 4WDIA 3RWFB 3MRIB 1ND0A 4U6XA 3MXWL 4X9HA 3GSNL 4U7KA 3NCJH 3SDDD 4DKEL 3VGAB 2E6QA 4R4BB 3ULUH 1PEWA 2MKLC 3RTQC 4P99A 5HYIA 1EBPA 1OW0A 1P9MA 5MENE 4TVPL 2PCPA 1U8JA 2WAHA 3BISA 2F54A 3OKNA 3DHJA 2X4SA 3QZWB 5J13C 3V8CA 3FO0H 5J0BA 5KSAD 3HR6A 5DJZB 4M1CC 1ZHLA 3MUHL 3UJIH 4ZUUA 1N64L 5HTSA 2NY7L 4KUCD 3FN3A 4BKLA 4DQOH 3OTTA 4I18C 1I1YA 1U92A 3TNNA 5F7HA 3T4YA 2FJFA 2J4WL 4MNGA 4OIIH 3O45B 1ZHBA 2NY0C 3GSNA 5KSBE 2FD6H 4I2XA 1X6NA 2VZ3A 3LEXB 4U1KA 3SEPA 1A4KB 3NIFF 1MFBH 5IVNA 5F7UA 2AXFA 1Z9MA 2DI9A 3RHWF 2YN3A 2ZUYA 3QIWC 1S9KC 3W5NA 1G0YR 3QO0B 3KJ6L 4FP8L 1ZTXH 1Q0YH 3QRGL 4OZFA 4XP1L 4O2EB 2DL9A 1ZANH 3K1KC 1S7TB 4QF1B 3MLPA 1F45A 1DQLH 4Y5YB 5FM5O 4X4XA 3UO1L 5JHDD 4QRTB 5KVDL 4JFOA 3CCHA 4EZMA 4DCQB 3Q6FB 2F58L 1S5HA 1ZSDB 1MJ7H 4X4YB 4A6YH 1MLBA 2X9WA 5D9SA 4PR5A 4YAQB 4P3WA 4OCXH 3WSQH 3GGWA 3LPWA 4Q9QH 3RPKA 1W0WA 3ARFD 1DR9A 3QAZC 2DWEB 5AG9A 2PW2A 4BFBD 1WLHA 1U8MA 1J11A 2GTZA 4MCZB 3LRHA 5AAMA 4Y4KD 4W6WB 2FEEL 5EZLB 2OTWB 2Q87A 4RGMB 1PKQB 1AGFA 1X5XA 4KHTH 4LIQE 2DQEL 3IDIB 3I2CL 1QSFB 2VXQL 1B6UA 2HTKD 3SGJA 4OZGF 3WIHL 5HYSA 4TOYH 2VR4A 3I02B 4QTHB 1RHHA 1ZK9A 2B8OT 4M8QB 5T5NG 1UFUA 1AXSB 2XKNA 5AZ2H 3O6FB 3QDGD 4LF3A 5KW9L 1X4XA 5IF0B 3ARUA 1YUHA 1GYAA 3ELAT 2X42A 3P4OB 5LGJB 4XNYL 2WNGA 1UM5H 5GIRA 1INDH 1AKJA 1WF5A 4U1GB 4K7PY 3EO9H 4MA1C 5E2UH 3OR7B 2X4NA 4PJCF 4WEBL 3RVUD 5E08L 3MJGX 3HZYA 3DBXA 2EIZB 3FZUC 5IM7A 3G5YB 2YD9A 1CGVA 2A0LD 2KUTA 1T4KB 1FAIL 5EU4A 3VRIA 1NFDE 3LPGA 4PJ9A 3ZT5A 5IWLA 3MOAH 3WIHA 3Q1SH 1F4XH 3EYOB 1I9IL 3QXAA 4KDVA 2EC9T 3VWJC 3ZHDA 1P7KB 1A6UL 2JJWA 4PG2A 1YEGH 4M7LH 4IIQA 1RZ7H 3QXDA 4IRJA 1OAKH 4UILL 4YHYB 2R2BB 4G3YH 4D9RE 4LSRH 1Z3GL 1OP3K 5JQ6H 3AXLB 2FGZA 1CFTB 4QHUA 4XNMB 3WS6A 3HC3L 4PJHE 4PRNB 2R56H 4IOIA 3ULVL 4P3CL 1DQJA 2PYEB 5D7JD 1IGJB 2HKHL 4X6EA 5AUMA 1XCQA 1GGBH 4KK9C 5IMOA 5CZXC 1G7MB 2Z4QB 4WY7H 2EDOA 1QBLH 2EDQA 4LFHG 4LSQL 4X99A 4KTYA 3NPSC 3RUGE 2Z93A 5JMRA 3VA2C 4ZD3H 1U6AH 3U1SH 4BUGA 1OGTB 2OJEA 2DKMA 3KPPA 3PNWB 3VXMD 3BEVA 2LAGB 3NAAL 3GMPB 4P2QB 5SWSA 2MOVA 1HHHB 1DBMH 2ZCHH 2YMXH 1TTUA 2NXYC 3B6SA 4KMTH 4CU7A 4UOJA 5A40E 5I1IL 1HYSD 5EWIL 3WIIL 1JZ8A 4OGZA 4RFOL 1FFOB 3SGEI 3ZKQD 5BZWA 2OSLB 2GEEA 4FZ8H 1KELH 1ZT1B 4M93B 4JO2H 1E6JH 2XOTA 5L7XL 3MRQB 4ODVH 4LCCB 5DMIH 1WICA 1AY1H 4YBLC 3X17A 3FB7B 2BNUA 2ZWLT 5KZCB 5TE7L 3IB4A 1MCPH 1UZ6E 3D85B 4L9LA 5C0IA 3PIQA 1DLHB 2ENYA 4G5ZL 4V1DA 1QSEE 2EDNA 3BPOB 3L3DB 5C8JA 2QADD 4XX1E 3ZE2E 4G6KH 1AE6L 3MRNB 3ZYZA 1KIQA 1QEWA 3MRBA 3VXPA 2FEEI 4X4ZA 5L88H 2VABB 3S5LA 5ILTH 3D9AL 3ILPA 3Q3GB 4CVXB 5I1LA 5I1KL 3RX5A 1IBGL 1OSZA 2DBLL 4TSCL 1JGEA 3FO1A 4Z95L 4OTXL 2HJLA 4Y16D 4N0CD 5DQDH 1R3HB 2HRLA 1F2XK 1WUNT 3FB8A 4CNIA 4NRZB 3HRZB 2PXYB 1TQCC 4QRPE 3W82A 4YDKH 4UT9H 5E2VL 3SPVB 3TN0A 2KZ1B 3JV5A 3LEYH 5C0CA 2XRAL 1K2DB 2OZ4H 2VAAB 5A16A 5E6IB 4FTVA 5TDNA 5GS1A 1T2QH 3O6MH 1CDHA 2YC1A 1QFHA 1U8QB 1T80A 3B83A 1TXKA 3B2UC 3VU2A 1S7RA 2FIRT 3U4AA 3H3PH 3P40A 3EOAA 1HH9B 4H0IA 3BQUB 4N8CH 5DMGC 5ICXB 3S36L 5E9DB 1KXVC 1IKNC 5FGCE 1EO7A 5C6PB 4NKOB 1U3HB 1VFOA 4X6CF 5F9OH 1JV5A 3CUPA 1XGTB 1BM3L 1DE4A 1UA6L 1KN2H 1MHPL 5E94A 2ARWA 1NL0L 4XMPL 4L3EB 5FXCH 4K8RD 3PL6B 2PUQT 1JMXA 2PN5A 1VPOL 2F53E 4YDVA 5DWUH 2X9XA 3SBWA 2VXSH 3FQWB 1ED3A 2LFGA 5IFHL 1HWHB 5IB2B 4OD3H 5KS9F 3QNXA 1UZ8B 4GG6F 2HFTA 1KIRA 3ZE0E 4FQHA 1K8IB 1YMHB 4HS3B 2AJUL 3ARBD 4QHMB 3QYCA 2XACC 1MRDH 1ZLUK 5BV7B 4TNWF 1IAOA 1FZMB 4RQQB 4J3SA 4LSDA 5IK3A 5B39A 4PUBH 5CJXA 1MIMH 3O4LE 4FQIL 4D0CB 2RGSA 2DLFL 5EOQH 4U6YA 5D7LE 4XPGH 4P23B 5JUEL 4FFWD 1IZKA 3Q0HA 1AFVL 5DVMA 5EU5A 2XWJA 4LLYA 2DQTH 3ARDB 1U58A 4OZFG 4HJ0C 3DX6B 3CC5B 2A2QT 1TZGH 4YIQA 5C09B 4MJIB 3H6JA 2I07B 3V5HA 4JO3H 1AO7D 3S88L 1I8LA 2WUBL 3MQIA 2APBA 3RU8H 4MAYB 5DUML 3TZVD 2AV1B 4HWNA 2MJWA 3V79C 2Z8VC 3UTSE 4Y2DA 1JGUH 3PGDB 3MRMB 5DQJA 1MY5A 4TUOB 4TN9A 2EH8H 3QNZB 2Z31B 2FCBA 2LQRA 4FQCH 5IVZA 2VDKL 4NN5B 3CSGA 3X3FH 1A7QH 1GC1L 3O41B 4JKPL 4P3DA 1M7IA 4P2YA 3DYMA 3MV8B 5GS0H 5FYJD 3EZJB 4F7TB 5JNYB 3EZ8A 4JPVL 5HHVH 4MHHG 3VGHA 1MCIA 5HYSG 4YUEL 1EEZA 1XGRB 3N06B 1Z5LB 4PJGB 1N5AA 4WO4A 3DHMA 1RZ8A 4MDIB 2VLJD 4OSUH 1QPPA 3MFGB 3T0EB 3UZVB 1ZVSA 4DGYL 2C7UB 3PGFH 3VD7A 2KQNA 3KHOA 3EO1B 2HLAB 4OT1H 4EJ1C 1RQ5A 3BZ4A 2XT1B 3GKWL 5E2TH 5KOVC 1GOFA 5IB4A 2BSED 2VH5L 5JA9A 3SE4C 5I18H 1CFQA 15C8H 2NW3B 5FUCC 4P4KA 5D2LA 2VDNL 5GSRA 5JPNB 2X6MA 3JVGA 5EBLB 4Y4HD 3QCVH 3V4VH 4NJ9H 1NCNA 1X5YA 3RX7A 4E41D 3WDIA 1F90L 4M7ZB 5TFSL 4ZNEE 2ICWA 1EFXD 3U7AA 1VKXB 2F9BT 3IDXL 4S0SD 3GMQB 1TVHA 3QDJD 2LV4A 5C08E 1SJEA 2E5EA 4YZFF 1N26A 3B5GA 1SYVB 3JWDC 3S96B 1RJYB 3LN5A 3A6OA 4PJ7E 4MJ6A 4CUCA 3FT2A 5JOFA 3INUH 5GQBA 4GW1B 3BPLB 1TJIH 2EDLA 3CVHL 2F74B 1S3KH 4H26B 3FQXA 1DL7H 5MEQB 3U7YH 4ORGB 4U1HA 4HH9B 4JFXA 2FX9H 3SCMB 4W81A 2A6IA 5GGTL 3B9KA 1T1XA 4NM8L 4UQ2A 2QSTA 3SJVA 4HGMA 3PXJA 5CBAA 3D2UA 1RU9L 2FHFA 1FLRH 4U1MA 1S9VA 3DROA 3TT1L 1FO0B 4HLZG 3VXSB 4Z76A 4PY8J 4PJDB 1UWGH 4KZDH 2OR8A 3OGCA 4P46B 3RAJL 5I1DA 1NC2B 5GHWH 2NYYD 1CK0L 3GI9H 3S35X 1I8KA 3QEQD 4O51A 4PRIB 4XXDA 4OGYL 4ZAKD 3FKUS 1S9YB 4L8BA 1L6ZA 1YQ2A 4JANB 1V7MH 3STZB 3H9ZA 1MHEA 35C8H 3BUTA 3CVHA 3X3GH 3FQRA 4KI1A 3FL7A 5BVJA 3IRZA 4LEOB 3HPLB 5I1JL 5IIEB 4POYA 1G7HA 1TPXB 5GGTA 1WBZA 4DKDC 4FZEL 1JI2A 2X4OA 4NFBA 1MREL 5F9WC 4ZXBC 2D7PA 2EICA 1RVFH 3TJHD 4E0RB 3QUYB 4JVUA 4N0RA 4HUNB 4PJHF 1KC5L 5E5MA 3OKDA 4M3JA 3I75A 1D5XB 2CH8A 3MRLA 4G8GE 1B2WL 2R0WH 1KPVB 4FQJL 4NC1E 3W39B 4OUUB 1O7VA 1YQVH 1TZIA 1OGAB 1QBAA 2AGJL 3AS0A 1JHTA 2ADFH 3S5LG 4X98A 3V0AC 4AM0A 5AWNH 4JG0L 4YHLL 2HG5B 4HWBH 1PVHA 4NN6B 5HY9A 1QRND 1IM9D 1NSNH 4HIEA 4OD2A 1EDQA 1SEBB 5IW6B 4QXGH 2OJZL 3GJFA 1EFQA 3P4NA 2BSSA 5GZOC 4LSTL 1AD0B 3HUJE 4U33A 3FB5B 2ZSWA 1IGIH 3OKKA 3IYLW 3IS0X 3VFNA 4ELKA 5JR1H 3EKCA 2NY4C 2XI9A 5EORH 4XCYA 1D9KC 1C5CL 4KRPB 2OM5A 5HHNA 3LD8C 5GGSB 2ZPKL 4K55A 1A0QL 2Q7NA 4FQXB 3BPCA 1ZLSH 5GS2D 5DHXB 5E6YA 2DLEA 2HFEB 3EHBD 4QOKD 1HNGA 1VA9A 5HHOD 4JRYD 3KAAA 3SKMA 2B1AL 1HCVA 2P7TB 4Y7MA 4G6MH 4F37K 3VFSA 4JFPA 4D0DB 3EJJX 1G7LB 4UV4L 1DQDL 3TBYB 1SHMA 5CEZD 3QUZB 4IMKC 3O8XB 4R7NA 1R5WA 4Z0XA 5I8OL 4KKBC 4U1NB 2FATH 1U8HB 2BXYA 5ANMB 1TMCB 4MGXA 1E4KA 4XXCC 1MWAH 1YMME 5FYLD 4CGTA 4ZO8A 3MV9D 5HHXH 1T6WA 4OF8A 4C56E 1ADQH 5K9OA 3EYVB 5JW3H 1BVZA 5IHBA 4OZ4B 4I9WD 3IFOA 1TQBC 4Q6IC 5F9JB 4JM2A 1NAMH 2J8UE 4XPFL 4D9LL 5D7IB 4AENA 1A9BB 5FOBB 4Z5RB 1H3PL 1F02I 3OZ9H 2X70B 3DVNB 3DMMC 3KNBA 1SM3H 3WD5L 1W2KT 3MXVH 4S1SH 1OAQH 4QHLA 1X5JA 3B9DA 1P4LB 5D5MA 1FYTD 3VGAC 4XAKE 1BD2B 1Z9LA 3VD4A 3NFPB 4HF5H 2X1QA 3MCLL 1X4ZA 2B5IB 5JLZB 3KPSE 4JFFE 3RZCD 2R9HD 4JN1H 4JZNB 1Y0LA 1R3KA 3JSSA 2X41A 2FIKB 3MLVH 2R4SL 1BQSA 1DQQA 1PG7L 3FFCB 1J1OL 4C4KT 1DSFH 2QSCH 3RWJB 4RAVA 4JCLA 1G6VK 1T2JA 3IU4H 4QRSB 1NGZA 4M6ML 1XH3B 5FUZL 3HFMH 5T3ZD 1DLFL 1EEUA 1NDMB 5ELIA 3NA4A 3C6LA 5F1KC 5EIIB 2D0FA 3I3DA 4OB5H 1NJ9A 5IJVA 4PLKD 5IBTH 4XP6L 2VDRH 3VWKD 2HT3D 2DJSA 4MJ5B 4FXKA 3UXFA 5BS0A 4MWFB 1BIHA 1UM4L 2JB5H 4LSPL 3BE1L 5M7QA 4WHTB 1G9MC 3C5JA 2ADJA 2ZP0T 3DXAA 1D5IL 5EU7E 4P57A 4C55A 1UYWH 3QULB 5F72S 4XVJH 2HH0L 3UPAA 3OQ3B 2Y36H 3B43A 3QFJA 2BX5A 1TLKA 4U6XB 3CIQA 5C07A 2FB4L 4RBPK 1HINL 1AIFA 4Y5YC 4M7LT 3RVXC 1NGPH 4LHUD 2Z9TA 3WXVH 1UWXK 3GMNA 5CSZB 2BSRA 4BZ2H 3TVMD 4KV5E 5LJYH 4YXLL 1VEMA 3LDBB 4LMQI 2F54B 1DCLA 5TQ2H 3FO2A 3QISA 2AI0L 3D39A 2XG5A 2Y72A 3ORJA 3G5XB 3OAZK 5K9JH 2Y5TA 4ODWB 2P4AB 1MNUL 3MLUH 5DJ8A 1AGEA 5HDBF 2C3VB 5L8LB 4XCFH 4U1SB 5DJAA 2BZDA 2YXFA 1I1YB 5FDWA 1FVDB 3TNNB 2YA2A 4MNGB 2YUWA 5I8CA 1UB6A 1MAMH 4O9HL 1N0LA 1ZHBB 1QHPA 1FL5B 1OVZA 3LEVH 4OQTH 3SDDB 3JWDH 4U1KB 5I9QB 2Q6WA 3SDCA 2OL3L 1VFMA 1TTFA 4HG4K 3O81A 4Y0GA 3O6FC 1IAKA 4KY1L 3PQYD 1AGCA 3D3VD 2JIXD 3BN9C 1S78D 4N0UB 4HFUL 1UKSA 3BH8B 4K94L 1URLA 4X7TA 3VI3E 4P2RA 3O3EA 3NVQA 4XP9H 2R1XB 5KSAB 4U1GC 3O9WD 2WUCL 3TA3C 4OZFB 1EHXA 4R7DB 2Q8AH 5C7XL 4HXBH 1UCTA 1RFDH 2BNQE 2IMNA 4M5YL 2GITA 1WZKA 3JTSA 1CF8L 1I1AA 2M2DA 2VR9A 4LPCA 2VIRA 3QHTC 3HN3A 1KLUA 3NABL 3JZ7A 1S5HB 3GSQA 3QIBD 3QJFB 4PLOB 1X6LA 3KPRA 4ODUA 1MELA 2VDPL 4PR5B 4ZDHB 2OL3A 5T1LD 3GGWB 5MP6L 1W0WB 3ULUD 2CK0L 1CU4L 4ISVA 4P9HL 1GHFH 2PW2B 4QHNA 4WUUA 3LKNA 1U8MB 4YHYC 2HMID 2WBJA 5E99H 1JYVA 1U8OA 3UYRH 5D6DA 1SQ2N 4D0BA 3C5ZA 1IC7H 1UADC 4GLRH 3G5ZA 2BXZA 4QT5A 3A6CL 5EIQA 5EOTA 1FFQA 3WNOA 4OLUH 3UJIL 3VD3A 4HS6A 2EE3A 3T77B 1KYOK 1ONQB 3DV4A 1NCDH 4NC2B 2CGRL 4PYGA 4TPRL 2XKNB 1RIUH 4OFDA 5CEYA 2NY5H 5HSFA 4LF3B 1OTUC 3OB0H 5IOPA 4GUPB 4OM0H 4LASL 1S9WA 2IAMD 3CX2A 3OWEA 4MXVE 1VGKA 5FYKE 5GIRB 3IAQA 5ADOH 1MFBL 2BP3A 4RAHA 4HT1L 5ETUB 1NFKA 5JOPE 3BKCL 3FO9B 4OF3A 4NKIL 4Y4KB 2X4NB 4ODSH 4PJIE 4QGTA 4XNZB 4JRXB 2YK1L 3NACH 3NZHH 4NQUA 3I6KA 5EU4B 1ZTXL 1Q0YL 4O2CB 4PJ9B 4H25A 4CN6A 1MCJA 1R3IL 1ZANL 3WNNA 4JHWL 2ARJA 1D6VL 3O2VH 5T5FH 2E7LA 4O5LL 5A3IC 1HCFX 3QXDB 1B4RA 5KSUA 1GPOH 4U3XA 4YQXH 4AT6B 2DDQH 2FWOB 2YS4A 4LLDA 2X4RA 5KVGH 1R24A 2D7TH 2C3WA 3FQNA 4OZIE 3BI9X 3WSQL 4Q9QL 5KVMC 4HGKC 5HYQB 4IOIB 4G9FE 4YGVA 3O3DB 1IGCH 4X6EB 1CLOH 4KHTL 4LP5A 4O2FA 4NQXB 5IMOB 4FQQB 2VISB 3GJFK 4M00A 3CFDB 4PP2B 3BWUC 3WUWG 4RMWA 3VXTB 3NOIA 4Z7UB 1JPSH 3QDME 2Z93B 2X1OA 3EYFB 3HAEA 3AROA 2DQJL 3W5MA 1BLNA 3BEVB 3OKEB 1I3UA 4NT6A 4NBXB 2APTA 2X2YA 4NHCH 4QRRA 4R2GB 3HG1A 3VFUB 1N4XL 3B6SB 2W0FA 2R0KH 3UTTE 5BJTA 5C0BE 5GGRY 1INDL 5E6ZA 4WU5B 2PW1B 4RFNB 2AJSH 7CGTA 4JHAL 5BZWB 3TIEB 5D7JB 1MI5E 1WWWX 5F96H 3F8UB 4YDJA 3BXNA 4UV7H 4PD4J 4LP4A 4JR9L 4X6FB 1F4WL 1Z0NA 5HGAA 5E6IC 3HC4H 3MLRH 2XWTA 2Y25A 1CE1L 4JFDD 4HKXA 3O6LL 5DURD 1F2QA 2ZUWA 1HILB 3HNVH 2ZOKA 1RZFH 4L9LB 3PIQB 2MCG1 3R4DA 5EO1A 3DGGB 1YEGL 3OG6B 4M7LL 2W60B 4WWKA 3BQUC 3F7YB 4G3YL 4ZODA 4YE4H 3F6IA 1I1CA 4XB7A 4HIHB 4ELMB 1KIQB 1BX2A 3SDXE 3MRBB 3V6OE 1N5YL 3VXPB 5EC1A 3L3OB 4JDZB 4IRSC 1LE9A 5JIKA 2VZTA 5I1LB 2N7AA 4OKVA 5CFHA 1OSZB 5I76A 3PL6C 7FABL 2RQ8A 3FO1B 4XWGL 2KZWA 5D70H 3W0WA 5C6TL 3GSRA 5E2WH 1GGIH 3WEXA 4HCRL 1AR1C 4OFIA 1E4WH 4CNIB 2ADGA 4H20H 3BHBB 1AJ7L 3HLAB 5SWZA 5AAWA 2VDOL 4OV5B 2HKFL 3RNKA 1AI1H 3GSUB 2W9EH 2NX5A 3TN0B 4YPGA 2QADB 3LQZA 4YNYA 2ZCHL 4WTXA 1MCLA 3VFOA 2DD8L 3M07A 5C0AA 2H6PA 1MFDL 4C58B 5DTFA 2EYSB 1QYGH 2NXZC 1F6LL 2G9HA 3K2MC 5E8EB 2X4PB 2J8UF 2AK4A 2FYYA 4TULH 1S7RB 3I50H 4YDIL 3U4BH 4ODVL 1QHOA 2BY1A 2ICEA 2MQCA 4ZSOE 3O2WH 2YD3A 2LVEA 4I48A 3WNMA 5LAXB 4HCRA 4WI9A 3LHPL 5F1SA 4J3OC 1JZ3A 2WQRA 4Q9RH 4JFHE 3B9EA 4MAYC 5HYJE 1JN6A 4PJXF 1QFUL 3KLSA 5L8JB 4S10A 1NAKH 5HHME 4JVWA 5HD8C 1RUKL 4KJQC 3L5IA 3PF2A 5IESH 2Z31C 3I9GL 3MNWA 5KTEL 3RVTD 4YHKL 5L88L 4UINH 1ED3B 1RY7B 3QNXB 4HXAH 3VFTA 1YPZA 1ZVYA 1KIRB 5F7DA 4NQDE 4U49A 3HMXH 3HNSH 4H0HB 5I66A 1KB5H 5GZNC 1S7WB 3U83A 1GJIA 1IAOB 4P5TD 8CGTA 3ABZA 4Q0XH 1N7MH 3RWDA 1LO4L 5IK3B 4NP4H 1S5IL 2X09A 1R0AH 3IFNH 5E0QA 3U9UA 4NZDA 2QR0B 3ECBB 1YECL 4KJWD 1F13A 3LEYL 2JCCA 4CVZA 5JOEA 2QTEA 2VC2H 4DVRH 5HDQL 1J10A 1VACB 1V05A 5ERWB 1U58B 1BWMA 5L2KE 1T2QL 3T0AA 1U91A 3MLWH 5HPMA 3MBEA 3V5HB 1M1SA 1XIWC 5JIIA 1B0GA 3FB6A 4Y19A 2BFVH 2CKBL 2W9DL 1BAFL 5EPMB 1VFBB 3RTQD 1GXEA 4PRPD 4OF7A 1EV2E 5DK0B 1T22A 3VH8A 1RUAL 5D1ZA 4Y2DB 3V4PH 1QFWH 2EKSB 1FZJA 1YJDC 3L3JB 1LEGA 4K3DH 4NUGL 5D2NE 1HWGB 1WZLA 4GAFB 5FGBA 4UIKL 1JUFA 32C2A 4JZJA 2VO5A 4P3DB 2D03H 4M1CD 3LN4A 3LQAL 3K3QA 4UT7L 1KJ2B 4JPWH 5ID0B 4I77H 1BOYA 3T65A 4QHKJ 2VXSL 4PLNC 1PSKL 3DVFA 2O5XL 3MGOA 2NY0D 1EEZB 3MZTA 4D3CH 3BDYH 5JW5B 3BPLC 1N5AB 3L6FA 2CKBA 1RZ8B 3UDWA 1M6OA 4ZYKB 1MRDL 4U1IB 1B0WA 1HN1A 5TDOB 4XRCA 1P4BL 1WIUA 4GKZA 2NTFB 5GXBB 3QIWD 4CJ0A 1MIML 1CDBA 1WTLA 2XPGA 1V3KA 5EOQL 1MRFH 3BGFB 4TTGA 4RAUA 2XNAA 4U2YA 4QY8A 4PGEA 2WM0A 1CFQB 3G5VA 4Y8AA 5IVXE 2ATKA 4P46C 4R3SA 3RI5K 1Y6KR 3K80A 4JY6A 4OLVH 1RZKH 2PTTB 2YPKA 4M8VA 1N0XL 1ZE3C 1RK0A 3MUY1 2FDBP 3KXFA 4JO3L 5J12B 2VZOA 4L4VA 1D5BB 3RL1B 9CGTA 1ZLVH 2VLJB 5HGHA 4PRHA 4NQEA 4ZPTB 1WT5A 2ICWB 3FRPA 5I17A 1C5DB 5FB8A 2IFFL 3R8BB 3V6FB 1JHKH 4RGNE 2NCMA 1VCAA 4G7YH 3VGGA 5IB5B 5JW4N 3QUYC 3V9FA 5SX5H 5FEBA 4J4PA 4PS4H 3QQNA 3LN5B 4MJ6B 1A7QL 3FT2B 3MREA 1IQWH 1IQDA 2X4UB 4YHZL 5ICYB 1NCCH 4ALAL 5GS0D 1T1YB 2P1YA 2D7MA 5HHVL 3PP4H 4U1HB 2EXWC 1JFQL 5CS7A 3E3QC 1WIPA 2HJKA 4R90H 4Y4HB 1Q9WA 3VXUE 3DO7A 4LSVH 4UQ2B 3HE6C 2ESVA 4U1JB 2CUIA 2YPLE 4E41B 5CBAB 4U6VH 3U6RB 4LQFH 4S1RL 2ZCKH 3HAEG 4U1MB 1S9VB 3HPJA 3REVA 4OSUL 3DROB 5C6WH 3VD5A 3EDFA 1IAMA 2E27L 3DYOA 1IC4L 1U8LA 1RAMA 4PJ8A 3OGCB 2A9NL 1JNLH 3CLEH 4D9QD 1UENA 3FZUD 2MCPH 5I1DB 5CSBA 1ZHKA 25C8H 4MNQE 3JWOL 3RGVA 1I8KB 3O3BA 5E2TL 1C1EL 3IXTB 4L8BB 3WNPA 4M43L 4J3XA 4FQXC 4L8SA 4L3CB 3FQRB 3VWJD 3UBXI 1LP9E 1WCBB 2BVQA 4PGBA 4P0DA 1WEJL 2QHLA 1G7HB 4CBPA 1WBZB 5K33A 1MY7A 3WN5B 5D1XC 2VLKD 4G42B 3V4VL 5BO1L 5E00B 4RGOH 5I1HL 1QNZL 2MMXA 3HHRB 4WNQA 4LKCA 5IGXH 3QFDA 3QUZC 2A1WH 3ARQA 3OJMB 5E5MB 5I74B 4I3SH 4HZAA 4KZEH 3I75B 1YDPA 3MV7D 5GRJL 5HVGB 3TH2T 1UVQB 4O00A 4KK9D 4UTAH 1J1PH 4FNLL 2QLVB 3QEQB 2Q76B 4AM0B 5CZXD 3B8YA 4OLEA 5T3XH 1C7TA 4EI5C 5HY9B 3QQ4A 2ORBL 3INUL 3DSNA 3QG7L 2R2CA 4HIEB 4HS8H 1S3KL 3QEUB 3GJFB 4XPBH 4HZLB 4TYUA 3UJJH 3LKRB 3C08L 4ZTPL 4Z78B 1J9CT 1SMOA 1KJVB 1KPRA 2ZSWB 3OKKB 1OLZA 2DMBA 2NXYD 4ELKB 5D6CA 1FLRL 4HUXA 4XCYB 3FJTA 1CL7H 3WHE0 5HHNB 1QBMH 1PY9A 3CFEA 5J1TC 3V5KA 4NO3B 3FMGL 4TSAL 3T8XA 1UWGL 2IBZX 5I1AA 4X6DF 5F7MC 1SEQL 5GHWL 2HJFB 3VXRA 4EXPX 3SKMB 5C0FB 3RVWC 1YN6B 5IB1A 2EYRB 2B5IC 4JFPB 5FYKH 4I4WA 4U0RB 2CLRA 5HGBA 1IARB 1A1MA 3P11H 1T1ZA 3T0DA 1KN4H 3WUWB 5E56A 4ZTOL 4LCWD 1T83A 3RHWK 2Y4SA 4Z0XB 5IMKA 4DUVA 4BA8A 4X5XB 2J3SA 2CRZA 1MHHA 4MLSA 4XPTH 1RVFL 1HH6B 1IM3A 5FHBH 1FNHA 3RWCB 3S37L 3SDXF 1TNNA 5DEFA 1Y6NR 1MUJB 4NQSA 4W4OA 5C3LD 1T03L 1F00I 3FN0L 3K2UH 5DFWH 4GW4B 2PO6A 4HV8B 2ZSVA 1MFNA 1BIIA 5K9OB 4QOKB 1YY8A 5HHOB 3CAFA 4I5BA 4JRYB 2ADFL 5HGDB 4WUKL 4JO4H 4CADA 4EXKA 3GM8A 5KSBA 1YA5A 3IFOB 5CJBA 4JM2B 3HI5L 3BP7A 4AENB 3GIVA 4QXGL 5I71B 3ARBA 2P5ED 1OM3L 1A21A 5D8JH 1HHJA 1GVIA 4LIQL 3QXUA 3P0VL 1IGIL 5EN2B 2CIKA 5IB3A 2W65A 1P53A 5JR1L 5T5NF 4QHLB 1KCSH 4FQPA 1AR2A 2VDLL 4LARH 2VQ1A 5D5MB 2BVOB 3MV9B 4K3JH 4PREA 2VSDA 2M26A 1P9MC 1OW0C 3B2UD 1KIPA 3ZE1F 5IKCA 1A7OL 1BFVH 3VFVA 4AEEA 1I3GH 4PTUA 5CKAA 3VXOB 1DQQB 1XZ0A 3KYOB 2AJ3B 4WCYH 1DUYB 1EERB 4HWBA 5DMGD 2Y7QA 2EZ0D 1RJLA 3MV11 4KPHH 3ZMRA 2BC4B 3MACH 5FCUH 1UJ3A 4NSKA 3VG0H 2V9RA 3MUJA 4G8FA 2DQIH 4LPWA 1LK2A 1K6QL 4HQQH 5DRNB 4JDVB 3GMLA 3VH8G 4GSDH 2FATL 2L0DA 3AS3A 1BZ9B 4NJAH 3SQBA 4Y5VA 3UP1A 3D25A 2I9LA 4IMLA 4KU1A 4RMRA 5F21B 4FXKB 2BDNH 5I9QC 5B22A 4IHOB 1FYTB 4KC3B 3ZT6A 5B8CA 2VLRE 5F9AC 4BH7A 5M94B 3RZCB 3T2PA 3KJ4B 5L8KB 1JTTA 5IR1B 2ADJB 2W59A 1M05A 3DXAB 1EXUB 5EUOF 4JVPA 2EEAA 2A74B 4Y1AD 3UBXG 4A2MA 1MCKA 12E8H 4GO6B 3AMLA 3RX8A 1A3LH 1QPXA 4JKKA 1NAML 5I1EL 4G80B 3DX9A 3R06A 1EAPA 4CAGA 2VRAA 3DIFA 4GKSB 2V7HB 1AIFB 5BRZE 1D3CA 1BZQK 4DWHA 2QQKH 1FVCB 3GMNB 1FL6A 3QXVA 4DOHB 3MXVL 4S1SL 1NFDA 2AEPL 3SE9H 1DVFA 4J8RA 4YXKL 4MQ7A 4HKJA 3FO2B 5INCA 4HJ0D 3E6HB 3D39B 5F7KC 3WS3A 3GMMA 1SBSH 3OGOE 4HF5L 2RCSH 2P5WA 4FFYH 1Q1JH 1TJGH 4O58L 2R2HA 3MJ9H 2NY1B 4OM1H 1BWWA 1BBDH 3F65A 3BW9B 4LAJH 3TM6A 4ZUSA 5EDXA 4N0YL 2QSCL 5EU6D 2OP4H 1QRKA 4AK1A 5FDWB 1NAMA 3MFFB 4PJHA 3SGJC 1JPST 3IU4L 1R3JA 1UB6B 3PHSA 3QO1A 3I6LE 3FRPG 3HFML 1NLDL 2EDWA 3GBNH 4LHUB 1IAKB 3N0PB 3U0PA 1OP3H 1FNSH 3FT3B 3C8KB 2BJMH 3MRFB 1AGCB 3TVMB 4OB5L 4Z7VF 3QDJA 3CSYA 1I1FA 5IBTL 1GGUA 2VDRL 5IUSA 1DEDA 4MD0A 4MD4B 1IGMH 2ZUTA 3ETBF 5D4QA 3MRKA 3OAUH 4X7TB 3RUGA 1EIBA 3T2NH 1PYWA 5CP7A 3CFKA 4Y4KC 4WFHD 3ZTNH 4K7PL 4XNZC 3DURA 5E1AB 3MA7B 1NBQA 1WFNA 3JTSB 3A0OA 1UYWL 2XQYK 2B4CL 4HX1B 1HKLL 4PPTA 3TBWA 5F1NA 2ZUQB 2MSPA 5C9JA 1NUDA 1FDLH 1G1CA 4PJ9C 4R8WH 1IT9H 5IWLC 1KLUB 4EDWH 3U46A 4OLYL 3GSQB 4MQXC 5LBSL 3KPRB 5D72L 3SO5A 1H15B 3K46A 2QHRH 5CMAA 3N85H 1EH9A 3QUMB 4PG2C 4QHNB 4WUUB 3LKNB 2R2EA 4BZ2L 3D3VB 2JIXB 1K85A 4Z0BH 2X9YA 1U8OB 4YFDB 5DT1H 2EEBA 5TQ2L 4PJEB 4RZCA 3WS6C 4WV1A 4X7SH 5CIPA 2FX8H 3O9WB 4OIAA 1G7PA 2DIAA 5J57B 2N4IA 3RVUC 1XF4A 1QSEA 5HHQA 4HS6B 4U3CA 2P8LB 3DSFL 5GGQH 3DV4B 5FFLA 1FE8H 4UOW1 1JNNH 1LDPH 5DS8A 1EHNA 5IOPB 5E95B 3GBML 3MODL 3SQOL 5IG7A 5C3TA 6FABH 5T1LB 4BQCA 4N68A 5I6XB 1XGQA 4LPXA 1B90A 3QDAA 4NPYA 3WFEH 3DO3A 5F88B 2I5YL 4R2GC 1IEHA 3GMRA 3KPOA 4XNXL 1JYWA 1A6VL 2VMFA 5CP3A 4RFNC 2XQBL 4XP9L 3ULVC 2V9QA 4QRPA 4H25B 3BAEH 1HXMA 3Q2CA 4HXBL 3VFMA 1HDMA 1WBXA 3EW3B 4HFWA 5GGVY 2X89A 1RFDL 3WCYA 3IKCB 2ZCLH 1A2YB 3KDMB 2WIMA 2ARJB 1IJ9A 4LNRB 4HWEL 1MIEH 5HHPB 5JA8B 1GAFL 3GI8H 3UTPE 4BSVA 5KSUB 3G6DH 5FV1L 3CK0L 2IAMB 1SJHA 2X4RB 3FQNB 5C0EA 3HZKA 3CDCA 3LKPA 4L9LC 1WZ1L 3O11B 3RGHA 4AIZA 1GHFL 1G7JA 5FO9B 3D0VA 1CLYL 5E99L 3Q6GH 3LQMA 1A3RH 2EE9A 4X5WB 3NMEA 4TNWK 1XEDA 4M1GH 4O2FB 5DD6A 3UTZA 1HHIB 1N59A 4N9OB 2FGWH 5EZIH 1K3ZA 4ZXBD 3HCVB 5FUOH 3BH9B 1NCDL 2EXYC 3EYUH 3IETA 2NY5L 5D2LE 3VJ6A 2F53A 4QRQB 3X11B 1K5NA 3MJ8B 2C3XA 1F58H 4PY8I 4QGYA 1O0VA 3ES6A 5DD1H 3IJYB 4A6YB 3VFWA 1ZA6A 3HG1B 1KENH 2W0FB 1UQSB 1A6WH 2CXKA 4DEPC 4YHML 2VNCA 3TN0C 4AG4L 1JIBA 3SHSA 4YDJB 5BMFL 1MCNA 3VE0A 2XV6B 3NACL 4PYHA 5HGAB 5GZOD 4TRPH 1JPFA 3AMKA 1KB9K 4OJFL 1C12B 3O4LA 5GS1C 5CD3A 1PEZA 2VDQH 1WV7T 5D7LA 3QNYA 3L5XH 1VFUA 2NY4D 4WEUD 1D9KD 3DARA 5CWSA 2ZOKB 1CFBA 1IL1A 2Y6SC 3HC0B 2YRLA 2FLRT 5JO5B 5E5RB 1H0DA 2APVA 3O2VL 1RV6X 5KVEL 2DS4A 4G6FB 5DJCB 4LKXB 2ADIB 3LS5L 4BYHA 4OCRL 3LH2L 3TEUA 3P0YH 3NCMA 4ZOAA 5BZDB 2X1PA 1Q72H 3W9DA 2EDFA 2IAND 4QXUL 4PGDA 2A73B 1LE9B 1IGCL 5FYKU 4UNVA 4YXHH 4PJ5D 4OKVB 1AC6A 3VFRA 1CLOL 4NKQB 3UTSA 2DI7A 1CFSB 4D8PA 5GISH 2JELH 4KKBD 3SBWC 3V6ZB 4JFDB 3GSRB 3KYNB 2WMPA 3U48A 1ZVHA 5CJOH 1MHCA 3MXWH 3WEXB 3GSNH 1I8IA 5GSVB 4X0KA 4DKEH 5SWZB 3RWIA 4G8IA 3WL9B 1X5KA 2NX5B 4YPGB 1RHFA 2EC8A 2FH8A 4TVPH 4BSJA 4PBVC 1JE6A 3LQZB 1RZGA 5CJXC 2R0KL 1FL3A 1LNUB 2H6PB 1PD6A 4GRWF 2XY1A 4NYLA 5EZOL 3U0TA 4ODXB 3OSKA 2IC2A 2X40A 1BFSA 1YC8A 5CGMA 1N64H 2FYYB 2NY7H 3I6GA 2FZ3B 2YEZA 1B0RA 1JF6A 3DMMD 2ICEB 5FA3B 3X14A 4AMKL 3MLRL 5C08D 3QWOA 2J4WH 4I48B 5CZVL 2YHGA 1P7QD 2BOCA 4R97B 1I8LC 3GM0A 4S11A 1ROWA 1JN6B 2JK5B 1X5GA 1LE5A 4OBSA 1NMCC 1KUMA 3OF6D 1HK6A 2YD8A 4YE4L 4Y2DC 5MEOA 4OZGB 1UXSA 4FP8H 3LIZL 3IDJA 2R0ZH 3GB7B 3GNML 3QRGH 3HKFA 4XP1H 3LB6C 4GLRI 5CBEA 4ZNEA 3KLDA 2J7LA 5CILL 2MQ3A 5KVDH 1PZ5B 4BFGA 3AGVA 4L3EE 2F58H 3U4EB 5I16A 3QH3A 4OF0A 3NFSH 2IPKA 1QZ1A 4PJ7A 2FO4A 3RWDB 1E4WL 3F62A 4KROC 4RISH 4WO4C 4PJCB 3TCLA 3U9UB 5AG8A 1AI1L 1G6RH 5CEXB 2HAZA 3WFBL 2EDRA 3OKLB 4KRLB 1JF1A 3C60A 4U1LA 1AQDB 1DBAL 1D5ZB 2XICA 3TH3T 2GCYA 3VW3L 2VXQH 1CGYA 4M48L 4PY7B 4UNTA 1GC1C 4NQCE 4JAMA 1XR9A 3RDTD 1U91B 3WIHH 3GSVA 3WJLA 1U8NA 2XTJC 1B0GB 4P4KC 4OLWL 3U4BL 4L4TD 1FFNA 3LZFL 3CLFL 1WFUA 1BVKB 5KW9H 1KCKA 3B3IB 3JVGC 3U7WH 1JJUA 3O2WL 2CR6A 4P5TB 1I9RL 4KTDH 4GRWH 1FPTH 1J0IA 1OY3B 1T22B 5T1DH 1TZHA 5D1ZB 5J12C 4XNYH 3CDFA 4PRAB 3S98A 1FZJB 2OXGA 1HKFA 3K4DA 1LEGB 3FONA 32C2B 4GAJL 3CPLA 1VFAA 3S6CA 3BO8B 1GGCL 1NAKL 5I19L 4WEBH 4WFGD 5H2BB 3FHAA 1MQKL 4F2MA 5C2BL 5J1AA 1QSFD 1FAIH 3G08B 4DUWA 1NKRA 2FSEA 3UBXB 3MGOB 4XX1G 5ADPL 4G8GA 2GJ6B 3MV8E 5KN5A 3L6FB 5IBUG 2G2RA 1A6UH 1FIEA 3HNSL 3O6FD 2KPNA 2HVKB 3BDBA 3VFPB 4UILH 3BIAX 4YHIA 4XRCB 1FN4A 4DN3H 3B9KC 4WI3A 1XF1A 1Z3GH 1S9XA 3DX7B 3QUXA 1N7ML 4HLZH 4Q0XL 5C92A 1ZT4B 2COQA 4HAFA 4R0LA 5J13B 1YEFL 3HC3H 4Y4FA 1P2CB 4P3CH 1MH5B 4RAUB 3TA3D 4QY8B 1T1WB 5EUKA 3QG6A 2HKHH 2VKXA 3G5VB 3E1F1 3MUZ1 2VC2L 3HUJA 4DVRL 3T0EE 5IHLB 4JY6B 3CDYA 4OKDA 1QFWM 1LO5A 1OHQA 5DRWA 3OXRA 4XPHL 1RK0B 3GDBA 1GGTA 1UWEL 2C1PB 2NY0B 4LSQH 1JF5A 4YO0B 1KULA 4UDTB 5CJ8A 4PRHB 2GAZA 5I17B 3NAAH 3FOLA 4XCNA 1NGXB 3E6FB 3CZFA 2GK0A 3WN5C 3RIAK 3DGCR 4OGAC 3KVQA 4K3HA 3QIWB 5DFVC 4Z7WE 1H9VA 4N5UA 2R8SL 3WIIH 3FHQA 1T7YA 4RFOH 4HG4J 4NC0B 5I74C 3MREB 1V3MA 2PYED 3VRLF 1ORSA 5DJ2A 3X13B 4JPWL 5L7XH 2XN9E 4J2XA 3RWGA 1ITBB 3UPRB 2AV7A 1OTUD 2R1YB 1YMMA 2HJKB 2GUOA 1Q9WB 3KGRA 3GSXB 1CLZL 3CH1A 2EDDA 2ESVB 4JFZL 4W4NA 5GGSY 2CLVA 3P9LA 1T89A 1K4CA 4C56A 3HPJB 3REVB 4FXGA 4G5ZH 4KVCH 4P2QD 3DJ9A 2ICWJ 3T3PE 1U8LB 1HOCB 1Q9KA 1U93A 4Q6YA 4L8DA 4XMKL 2J8UA 1LEIA 5E8PA 1FNGB 1KGCD 3RGVB 4RFEB 3O3BB 1LILA 4JG1L 4WI6A 5FCSH 1IBGH 5ITFA 2YBRA 4TSCH 2N56A 1EX0A 1SYSB 3C2SA 4OTXH 4Z95H 3AREA 4FN0A 5EB9A 5F7EH 4X6CB 5A3ID 5IW3A 2R23A 4JY5L 4MSWA 1OWRM 5DA4A 5LQBH 4P2RE 4PRIE 3D85D 3WFCL 4K07A 3H9HB 3KPSA 1JPTL 4JFFA 1F8TL 1WBYA 5J7CC 1YDPB 2IBGA 3DWTA 5DJYA 5I8EA 1DFBH 4GBXB 1E4KC 2GIYA 5KS9B 4LAQL 4WW2A 4GG6B 2XRAH 3M8OL 2H2SD 2Q3AA 2CIIB 4OIBA 5JXEA 1NCCL 3QQ4B 4NNYB 5INDA 1BECA 3EFFA 3QWRD 3S36H 3H9SA 5D2LF 2A6KA 3OB8A 3QPQC 4JM2C 4G8EB 4MS8C 4M6NL 3TBVA 3OB0K 4MNHA 5DJDB 1U9KA 2WP3T 4HUXB 2GKIA 3RA7H 2CLZB 3OXSA 1BM3H 1UA6H 3KPQA 1T7WA 4EI6A 3MV7B 3C09B 1NL0H 4XMPH 3T8XB 1QFOA 1JNLL 2GT9B 1VPOH 4UB0L 1FG2B 3V7MA 1E4XH 25C8L 3S3SA 1HZHL 2D4FA 5IFHH 3BD4A 1CDIA 1U8KB 5DGQA 1UH4A 1ZWIA 3TGXA 2CLRB 1A1MB 3T1FA 2AJUH 5ICZA 3MLXL 5MENB 2H32A 5B38B 1KV3A 2P8PA 5E9DD 1MF2L 2X1XR 2P42B 4LGPB 1BBJA 1Y18B 4G7VH 1U36A 2NXYB 3W9EB 3E8UL 1YZZA 1IM3B 5J06A 3HZMA 2C26A 1QFWI 3ZYJA 4Y5XA 4JFED 3BP6A 1CGWA 3V5DA 4IRSD 4NQVB 1AFVH 3K4ZA 4HKZB 2CPCA 2ZSVB 3PL6D 1CS6A 3L5WA 4Z7OF 4HD9A 4KMLB 1T20A 4QTIL 1P69B 2N7BA 3WNLA 3CFCL 4F8QA 1BMGA 5CSGA 5T3XD 4HPYH 3MRJA 4JO1L 5MI0B 5TQ0L 1AR1D 3BP7B 3KJ4C 4UQ3A 4HS8L 4YHNA 1RSFA 1C08A 1JYNA 4XPBL 3ALWA 4GG8B 5ESAA 3LV3B 3DTXA 2F8XC 2IH3B 2NW2B 2VLLA 3M1BA 2H45A 2IALB 1SJXA 3MMEA 2XWBA 2W65B 3L1OL 3OKOA 2MTPA 4UZGA 4RNRA 2NXZD 5D7IE 1AHWB 2VQ1B 5FHAH 1GC1H 4NNXA 1HHGB 2BNQA 5HDLA 3IF1A 4PREB 5DLMH 2GJZB 5IKCB 4JPVH 1PFCA 2OR9H 5GGUA 4YR6A 3VFVB 2IADA 1ZS8B 4RCAA 4LLUA 2OR7A 2IQ9L 3FQUA 4M7JL 5C09D 4MJID 3K7UA 4YUEH 1RJLB 4F8TA 3ARGA 4POZC 5FYKL 3RPIA 2NY1C 4ETYA 2VITA 3QHZH 4R96A 1TQCB 3ARSA 4NSKB 4MAYD 4YGAB 1KIUA 5C86A 4HK0B 1UEYA 3WMSA 2H8PA 3OKMA 4E5XB 1FVEB 1LD9A 2EO9A 3NA9L 2CDEA 4Y5VB 5HD8D 2F15A 1UEMA 4KJQD 3PXHA 1RUQL 3WFHB 3SDCC 2AQ1A 5HBBA 3BD5A 4N90E 3BFOA 5B3NA 5A2KH 1XGPA 3TVMC 1M05B 2VDNH 3UX9B 3PUCA 5GZND 3RL2A 1L7TL 2VN4A 3VGFA 1R5VB 5TFSH 3HB3D 3R06B 4NGHL 3WHXB 1EAPB 5D8JL 1I4FB 2E6JA 1FSKB 4PJIA 2LU3A 2VB5A 4LBEA 3T3ME 4P49A 2ZUQC 1CXIA 3IDXH 2BVEA 1NFDB 2XXMB 1DVFB 1BGXL 1MWAB 1DUZA 1G1YA 4WFED 4J8RB 4MQ7B 1C16A 5GS3A 3IU3B 4LDEB 5DK3A 5IVOA 3IAGC 3MNVA 4AH2B 1RZJL 3G04A 3WS3B 4K3JL 2NPLX 1SVZA 5DVLA 3TO4A 2R2HB 1BFVL 1XIWD 2WBJC 5J6GA 2I60H 3CVHH 3T08A 5D6DC 1ZEAL 4K94C 4TSBL 1I3GL 1BFOB 4Y1AB 5EFIB 5MEPB 1NBVL 1AD9B 4WW1A 2RAMA 4WCYL 5GGTH 3L3GB 1P6FA 2FECI 4OZIA 4NM8H 1NAMB 4PJHB 3U36A 1H3WM 5IFJA 3HZVB 3QJHA 3PWPA 2Q8BL 5FCUL 4G9FA 3QO1B 4LCUB 5FKAA 2Q7YA 1CZ8L 5EBMB 1MI5D 3TT1H 4P9ML 3U0PB 1AGBB 4NJAL 4KTEL 4EQ2A 5DJXA 3K8LA 3CSYB 1I1FB 1XR8B 3MV01 2VZ1A 4MQSB 1CK0H 4MD0B 1BQHA 1W8NA 5I6XC 4LLAA 4WI2A 3RUGB 2WBWB 3QDMA 4P9HC 1FJ1A 5CP7B 3WKML 4HBQA 2J88H 3FQTB 1M71B 1WZMA 4X80L 1I7ZA 4GS7B 2DIBA 5F1NB 3UTTA 4RMVA 2AEQH 3PHQB 3DRQA 4F7MB 4FZEH 3NN8A 1MREH 1EO8L 3QEGL 5JZ7C 1QQDA 1KC5H 1QR4A 2JJTA 3F7VB 1IFHH 3K74B 1CXKA 3VXSD 2DLHA 1B2WH 2XY2A 1CL7I 2E7LC 2UV3A 4FQJH 5EH1A 2JE8A 4P46D 3O3UN 5IV2A 1IAIH 1FV1A 5H35A 4ZNCD 5IW1A 4NN7B 4NFCA 3NIDE 2GI7A 4JG0H 4QHKI 1SBSL 3EOTL 5DEGA 4HBCH 3TV3H 2OJZH 5HHQB 3T2OA 3BWAA 4LSTH 3SDXA 2IFGA 4CW1A 3V6OA 5IBUB 3MRPA 1FGVH 5DS8B 4KFZC 2K9UA 4XH2B 4MAUL 1DBJL 3PDOA 1Q9LA 2VXUH 3BKYL 1C5CH 4Z7WF 4JZOB 1JGVH 1SJVA 5DVOA 4XCCL 2ZPKH 1XGQB 1Q38A 2FHBA 1IGTA 1S7VA 4UIMA 1A0QH 2VWEC 2BNRD 5JHDE 2YZ1A 2BJML 3H0TA 4ZG1A 3ZKNC 2ATPA 4AEIL 1KJ3L 3OBAA 4ESKA 5JXAL 5DUBA 5ITBL 4U0QB 1EAJA 1IGML 3GMRB 1LMKA 2B1AH 2EXWD 5DQ9A 3C87A 1KLGA 2ILLA 5J3HC 5DHVA 4PJFE 3JWNC 3TIDA 5I1CL 3HE6D 1JYXA 3RY4A 2RIKA 3VFMB 1WBXB 4HUUA 3FRUB 4RMUA 4KI5F 1Q0XL 4H5SA 5I8OH 1YYLH 3G6JE 1DJSA 1G9NL 3ARXA 1CICA 2Z92A 4BSVB 2DM7A 5IBLC 1F3RB 4OFYD 4TUKH 1NANI 5F1IA 5C0EB 3HZKB 3LKPB 3NFNB 4WVRA 5SWQA 3TYFA 3N85L 1NC4A 1VB9A 4Q74A 4WWKC 1CTOA 4H8WL 3TBSA 3QPXL 4LVNB 4FQXD 1CN4A 3QDGE 4ZSOA 4JRWA 2WV3A 3TBTB 5EC2A 43CAB 5FGCB 1YEHL 5DD6B 1R5IA 2FX8L 5GGRA 5D1XD 4P2OA 4NO2B 1QO3A 4M6OL 4XPFH 5HYJA 4D9LH 1G0DA 1LDSA 1G0XA 1H3PH 4LFHD 4S1DC 3QUZD 4O4YL 2HT2C 2QL1A 3IETB 4WU7A 1ZLVK 5I1GL 4NDMA 1JNNL 1UM6H 4N8VA 3VJ6B 3RIFF 5ENWB 5DSCA 3C8DA 4JPKL 2A6DA 4Z8FL 6FABL 1N3NB 3EO0B 3KXFE 5E8NA 3JV4B 5DJ0A 2VZSA 5BQ7A 4NQDA 4Z7UE 3V2AR 5SX5K 4EI5D 3MCLH 2IMMA 3WFEL 2RBLA 2FRGP 1GSMA 2JLLA 1DEEB 1LK3L 2R4SH 1PG7H 5HI4C 3VE0B 1J1OH 5BXFB 1UB5A 3UTQA 5HI3C 3V0WL 5FOJA 3O4LB 2WLYA 3KS0J 1JGLL 5H94A 4ZXBB 1ZA3B 3BAEL 4I0PA 4JQIL 3S3JA 4JKMA 5FUZH 1E27B 1T66C 1IL1B 3CU7A 3RI5F 3LRGA 1T0NB 1EEYB 1H0DB 1MIEL 5A1AA 5F89A 1INEH 3GI8L 4PG9A 4RRPA 5ABDE 4XP6H 3QP3A 5L2KA 3TP4A 4M61A 1D6EA 1DP0A 3FCTA 3OG4B 4R4FH 3W9DB 2NNAB 2D7OA 4LSPH 3BE1H 1BD2D 3RVWD 1KTLA 1U3JA 4PGDB 5FAAA 3CFBA 5J6HB 1A3RL 3VXME 4J1UB 1DTUA 4CN1A 4Y8DC 3VFRB 4R4NC 3UTSB 3PGCA 3FFCD 5FGSA 5IHZB 1HIMH 1A1OB 4GRMB 4ELME 4CMMB 2HH0H 5D2NA 1AQKL 1BOGA 1YNTA 2FB4H 3TPUA 1D9KB 1HINH 3F58L 3AAZA 2EO1A 2E7BA 3IVKA 3NPZB 4G8IB 2OMNA 3BESR 1F58L 1AC0A 3HRPA 3P3YA 2OLDA 1CFNA 4CN4A 3BP4B 1KENL 1FL3B 3MRGA 2BHUA 2UWEE 2CKNA 2I9TB 3WBDA 1CI5A 2E9JA 5ESVB 1MNUH 1DDHB 2DRUA 3BZFB 1I7TB 1IGYA 3IRPX 3VGBA 1NBYB 4LHJB 4JFQB 3X14B 3U30B 1A47A 1HYRC 5F3HB 3LSOA 3MBEC 4P5KA 4LOUC 1Q9OB 3EOBA 3BKJH 2BOCB 3GEWB 2ITDB 3LPFA 2OL3H 3V7AE 1I85A 2Q3ZA 1QR1A 5IVXA 1MOEA 5D93C 5CGTA 5D1ZC 4HFUH 4ZS7L 2F54D 4K94H 4M9OA 3P0YL 3QQ3A 4K9EH 5TPWH 4QWWC 1UXSB 1CVRA 4MA7L 3VI4E 5KG9A 3IDJB 5FGBC 4FQ1L 2WUCH 4JZJC 2OI9C 1T7XA 5DJ6A 4C83B 1JRHL 2AW2A 4RWYL 5C7XH 5AD0B 3CMGA 2LAAA 4M5YH 1JGDB 2HFFB 2MPAL 3DMMB 4YHPA 1J0HA 1JI1A 2K3TA 5ID1A 4K7FA 1LGVA 5ACZA 1J0ZA 1PQZA 5C08B 1UCBL 3BP5A 2KL6A 1W0VB 2Q1EA 3QH3B 3VXRE 5CJOL 1P7QB 4PJ7B 3DV6A 4J23A 4E42B 2FO4B 5C0GA 2VDPH 2JB6B 5MP6H 3TCLB 4XBPA 3UDWC 5JMOC 2CK0H 1CU4H 1NUNB 4P9HH 1WC7B 1GIGL 4HMCA 1HHKB 1JF1B 4JN2A 3MLYL 4TVPD 1U8PB 4YX2L 4F58L 3VXUA 1BQHG 2CJUH 3NCCB 2GCYB 2YPLA 1IEBA 2Y9RT 2RB8A 3A6CH 3MPCA 1XR9B 2H3NB 4ERSL 3GSVB 2VYRE 1MJJB 1U8NB 4BFIB 1RIHH 2CGRH 1IGFH 2OQJA 4TPRH 4JKLA 2BOBA 1ZHNB 3T3MF 4F7CA 1ZGLA 1F97A 4MNQA 4DKFH 3IT8D 4CKVX 4M7KL 4LASH 2R29H 2XZAH 4Q9BA 1S7SB 4Y89A 3G6AA 2YD1A 4ZUVA 1A7BA 4H1LH 4F9LC 3NGBB 3O6KL 4LLQB 4HT1H 1KNOA 1WT5C 3BKCH 3KR3H 1BQLL 1LP9A 1PY4A 4NKIH 2W92A 1W72L 2YK1H 2NR6C 3KS0H 2R1WA 4F2MB 2XTLA 2R0ZL 3VG9B 4CU8A 3RDTB 2FSEB 1JWUB 1R3IH 5I0ZA 2DTMH 4JHWH 1NCTA 4L4TB 1SVCP 4I13B 4JJHA 1D6VH 1T0PB 3IDMA 3WIFA 3HAEH 4O5LH 1QP1A 4BK4A 1FN4B 5FV2A 1CR9L 3NFSL 1S9XB 3KYMA 1D5MA 4ZQKA 1BQUA 1VESA 5DD0H 1T6VN 4L5FH 2E6PA 1K4DA 4V2CB 4HPOH 4RISL 1AXTH 1AO7E 5JW4M 1AKJD 5F7WC 1G6RL 1JPGB 3O4OB 1KCVH 1YEDB 1I7RA 2CR3A 2ZKHL 3EYSL 5ISZA 5EUKB 1W72A 1T5WA 3P9MB 4JRXD 4PJ8C 1HSAA 5JTWA 1NFIA 5DHYA 3RGVC 1LO5B 2WWKT 2IJ0C 4PJ9D 4APQA 2XZQH 1KCRL 3REWB 4MQXD 5GS0C 1J8HA 2NY6C 4R26L 4HUWA 3WFDL 4P4RA 5FYJE 2IEPA 3MGAA 1KB5B 2DQJH 2VOTA 5E4EC 4MA8L 3U7WL 4OBRA 4BH8A 1YPZF 3FOLB 3ROOA 4KTDL 1FPTL 4TQEL 5T1DL 5IMMA 4DVBB 2EYTA 1OCWL 1K8DA 1N4XH 2MKWA 3RKPA 3BKMH 2AKRB 2E7HA 5IEHA 1G6RA 4JHAH 4LU5L 3TA3B 4HC1L