4QOKE

Structural basis for ineffective t-cell responses to mhc anchor residue improved heteroclitic peptides
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
244
structure length
244
Chain Sequence
SQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSVGIGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWSETGLGTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for ineffective T-cell responses to MHC anchor residue-improved "heteroclitic" peptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 46
structure length 244
sequence length 244
ec nomenclature
pdb deposition date 2014-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qokE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qokE01
5JNYB 3D3VE 3FFCE 3MFFA 2CXGA 4R4BA 3U6RB 3IU3B 3O6KH 2X6MA 4OGYL 4XPAH 4Q6IC 1GZQA 1OP3H 5T3ZL 5ALCH 2IADB 3MGTA 3U82B 4NO3B 4ZXBC 4NRYB 5AG9A 2ZNXA 3Q6GH 4L8DA 3MFFB 4NFBA 1YECH 3LKNB 2VZ3A 5FK9A 4YE4H 4HUMB 4MA3A 4ISVA 1QBMH 4YXHH 5FDYA 4UAOC 1KJ2A 1U3HD 3TJEL 1SJXA 1WV7T 3EIFA 2MTPA 4KTDH 4PG2C 5TDPB 4GSDL 4OFPA 1WIUA 4Y1AA 1MFCH 1U8JA 4U31A 1CDIA 4LPWA 3CXHK 5C0AA 5KSAA 1CBVH 1TNMA 2FGWH 4ESKA 1F2QA 3RU8L 4NQCA 4O02H 2WLZA 5BS0E 3WEXB 1TJGL 4JQIL 3RZWA 3U30C 1MCPL 2FWOA 2EIBA 2ZCLL 3M45A 5L7XL 3WBDA 4OF5A 2VQTA 3PQYB 3H42H 4NFCA 3CFDA 4FQ1L 2FX9L 1HKLL 2DQDH 4P59H 5D2NE 1VSCA 5F9WB 5JHDE 3MROB 2ESVD 5HI5C 3O6KL 3GB7A 2BERA 5H2BB 2UZIL 3FZUC 4WFHE 5EZIL 3C9NB 3FO9A 1QPPA 2IWGA 3EYVA 2PN5A 3TH4T 5EC2B 3VG9C 3S97C 4HS3A 1ZLUH 4O2CB 4PJ9D 4W6WB 2YOCA 1N8ZB 4P4RA 5AWNL 3LSOB 3ABZA 1KCUH 3LH2H 1J8HD 5H2BA 5HDQH 5ALBL 5JXEC 2OL3L 1H3TA 4KVCL 3P4NA 3N1FC 2QQKH 2B39A 1AHWA 3UTSA 1OWRM 2X4SB 5B39A 5DEZA 5H94B 3LIZL 4O4YL 4XWOD 2AQ2A 3PL6B 1NJ9B 5DUPH 2RFXB 4J1UA 3QO0B 4LVOC 1FBIH 5GGSA 3LEYH 3MV9B 4YUEL 1YEFH 3ZLQC 1HCVA 1FC1A 4FOMA 4Z7VB 1ZTXH 3FJTA 3PWVB 5DJAB 3VXRE 2IANB 3F7PC 3LRGA 3MLXH 2F5AL 1WTLA 5D2LA 5I15H 4PJAB 1U6AH 1WZLA 4P57A 5IOPA 3V7MA 1EEZB 1PSKH 1NLDL 4XC1H 2QQKL 1QHOA 1AQKH 3PF2A 1AIFB 2CDEB 1LE5B 1X7QA 5MERB 3O2VH 2ITCB 4KHTH 3VGFA 3QFDB 3P9WB 4HWEH 4FXKA 1P5VA 3MOAH 3WFBL 2HWZL 2XQBH 3RIAK 4IRJC 1L0XA 3CMGA 4DKFH 3OKKB 4LCUB 3SKUD 2R56L 4NN6B 4F9LA 5FB8B 5CEYA 4G8FA 3MRJA 3KPPA 4PJXE 3FT2A 4DKEH 5D71H 1MAJA 1N64L 4UUJA 4D9LH 3PWPA 2DKMA 3JV6B 3B9VA 5FA3B 1JP5A 3TLRA 1QKZH 5EU5B 5E2WH 5B8CC 5HJ3B 4PJ9A 2OTWB 3TBYB 3CMOH 5DRXA 1OAUL 2IG2L 3PV6A 5F93C 1OAXL 3TBWB 4I18C 1D6VH 3T0ED 2R9HD 2XIDA 4HGKC 3RU8H 2C3GA 1YY9D 3LZFH 3FO0H 4H5SB 4UT6H 4XPTH 3DROA 4UBDC 5JLZB 2D31B 1S78D 5IF0B 5JIHA 1JL8A 4OIIL 5D7JB 2HT2D 4QOKE 1MSPA 4UOJA 4QRUA 4KK8C 2O61B 1Y0LB 4JRYE 1UADC 5EU6B 3BKYH 1JPGB 4HD9A 2VITB 4LAQL 4MVBD 2VDPL 4I9WD 4U1JA 1T04A 2UWEA 3N9GL 5EZOH 2XRAH 4NGHH 2H45A 4RMRA 4C55A 4ONOA 4Z7NE 5I1IH 5K59E 4JRXD 3I6KA 4FFWC 3P0GB 3RY6C 1DP0A 2XWBB 3NZ8B 4QXWA 1R3KB 4YGVA 4L9LC 3DIFB 1XGTA 3KLHC 3ZKND 2H1PH 4PTUB 1N5YL 3BN9D 3MRNA 1DBJL 3BQUA 2AJUL 5IMKA 3DV4B 3BHBB 2B0SH 5D7SH 1E4WH 5EUKA 4P46D 4S10A 2FSEA 1EIBA 3UO1H 4WW2A 5CJBA 4OQTL 3V7AE 2P5EE 5JO5A 4NZRL 2WW8A 3I02A 3LMJH 5FO9A 2X4RB 4PTTA 3WIFB 4N1CA 3O41A 4R7NB 1BWMA 3M8OH 5LGKA 1X5GA 4KTEH 2A0LC 4X6DB 3BPOB 5E8NA 2VLLA 3BSZL 3FCTB 1UEMA 4K9EL 3ULUF 1FZOB 5E8EB 1NL0L 1JK8B 4WTZA 1CXHA 3ARTA 3U36A 4MJ6B 4GRWF 5GISH 4QTIL 4PJEE 4I3SL 4U7MA 4JAMB 4LCWD 1VERA 1BX2B 1D9KC 4OZHE 4JFDE 5CGMA 1F02I 2J2ZA 5JHLL 4EI6B 1KENL 3IKCA 5CD3B 2DWDB 3ULUH 3LKQB 1BOGB 5IMMB 3PV7A 1JZ4A 4HIXL 5KANI 1KG0B 2HTLD 3DSFL 3K2UL 3AS3A 2UWEE 2GK0A 3T0WA 4YO0A 5FM4A 2NMSA 3T4YB 5ANMB 5DJ0A 4KI1A 1TETL 4HZLA 1NMCC 4PJFE 4YHOL 5IIEA 4NQUA 3TNMA 5EA0H 3U9PL 4U1LB 2YA0A 3NCJH 4HBCH 1JMZA 3OKKA 1BJ1J 2HLAB 4G6JL 4JREB 5IT2L 4LSUL 3FFDA 1UVQA 4N9GA 4PJCF 4XMPL 1YQVH 3WD5H 1XF4A 1LP9B 1KACB 3IFPB 3ULSB 3BZDA 3T0DA 4CW1A 3T2OA 2X7LA 3C5ZA 1Y18B 3OAZK 4M7ZB 3QR2A 5AYUH 3A6OA 4X6CB 4C54A 1VEPA 1QFWH 3QI9C 3CPLB 1YEEH 4I8DA 4PBXA 1F45A 2CXKA 4WTXA 5E7BA 4F7EB 2Q76A 3VFVB 1W0VB 3KPLB 4Z7VE 3U0TB 1PW3A 4M1CC 1MI5E 2R0ZH 3D5OF 3QDJD 5MEPB 3D0VB 3EGSB 4EI5C 3ARFC 2VWEC 1URLA 3MFGB 4ZTOL 1O5DT 2V9QA 2Q6WB 3UAJD 2X1WL 2F15A 1MF2H 1A7OL 3TPUA 2FATH 2X1OA 1TJHL 2P49B 1ZVSB 5J9PA 4HS6B 1MRFL 2QSCL 4L4TE 1T89C 1VDGA 4U3XA 3AGVA 3PG2A 3SE9L 2VQ1B 5DD3L 5IHZB 4F33A 4JJHA 4HWZA 3GI9H 4J3VA 3MLRL 3X11B 4HS6A 4RAUA 4WNQA 1U8KB 1ORQA 4QY8A 3BP5B 3ELAT 1AQDB 2BNQE 1MCQA 3RTQB 1FO0B 4CBPA 1ED3B 4I0PB 4L29A 3U46B 4HIHA 3UDWA 1MJ7L 1KTLA 3VJ6B 4WWKA 2VDRL 1AI1H 4FS0A 5DFVC 3K2UH 1AGDB 4PTUA 2BNUB 1CGTA 2AS5M 1NGQL 3ECBA 3QPQD 2OX5A 2R15A 4Q2ZB 3ILPB 1FO0A 4LVHB 5IMKB 2JF1A 1JTTA 1A1MA 4HIHB 2VB5A 1DEEA 4H88H 3MJ8B 3UTSD 3SY0A 4JFED 5C7XL 1ZT4A 3PHSA 3CFBB 1NCDL 1LO0H 1PDKA 4OBRA 1CFNA 5IHUH 4IDLA 1NC4D 1RULH 3NFNB 5D6DC 2KQNA 5EO0B 1IAII 5KN5A 2DF3A 2F54E 4RZCA 5I1LA 1QSEB 1FORH 4RRPG 3EBAA 4LBEB 4NQCE 2C4FT 2F53D 1FORL 1LO5B 4V1DB 3FTGB 4ENED 3D39B 1C5DA 3ARGA 3S3PA 3TO4C 1RHHA 3HZYB 5LQBL 1J9CT 4OJFL 1DUYB 3QIUC 2YPLE 3LKRA 5HHPA 3VRIB 1K6QL 1QVOB 2OMNA 3F7QA 3S5LG 2HMIC 2EZ0D 4D9LL 3LN5A 1IAIH 2VE6A 4BA8A 3QXVA 1WZ1H 4EN3D 1U8PA 1CL7L 3MMEB 5DJYA 2W65A 1SY6H 1NEZG 2DIAA 5D7SL 5D96B 3CFKB 4PJBF 3QNYA 4LHUG 1OF2A 4HUUB 2VLME 4QRRE 3W0WA 1QSED 1W0YT 3T2QA 4ZO6A 4NN7B 1LO2H 3F7YB 1L9MA 1MHPL 3ULVC 4KJWC 3RVUC 3BEWA 4FZ8L 5GRXG 5ANMA 3KYNB 4NCC1 5DJ0B 1GGCL 1JN6A 3Q3GB 3KYAA 3MACL 5I1AA 2IQAB 1X44A 2OSLA 3B9KD 2VZSA 4HXAL 5AYQA 3C2AH 2F74B 3QHZL 1JGVH 5C8JA 3PABA 4LCIL 2VDPH 4I13B 4HLJA 1IGTB 3W9EB 4Y4FB 3BRDA 3KYNA 2ZSWB 3TA3D 3RGVB 4K8RD 3I9GH 3D2UD 2H32H 4YFEA 1FBIL 3MOBL 4WFGD 2CUMA 1K8IB 4GQPH 4HUVB 5CBEA 2ATKA 1NCTA 4I4WB 3BUYB 5D70L 3HN3A 5KSAD 3HA0A 4NQXB 2NY6B 4Q6IA 5AYUL 1EAPB 1JJUA 2FX8H 1FFOB 4M7KL 3RIAF 4L8CA 3G6JB 2NXYB 2QKIA 5L8LB 3P9LB 3IVKA 1ZHBB 3HZVB 3WD5L 2W9EH 5A43C 1E6JH 4JHWH 3GSWB 2EYRA 4PJFB 4JFFD 4LLUB 1IM9D 3ULVL 2NXYC 2ICEA 2O26U 2C7UB 1RUAL 5GHWH 3QI9D 3WHE0 3QUZD 1WAAF 3FQWB 3MLVH 5J4MA 4I0KA 1INQB 3QG6B 4MJ2A 1F90H 4IRSA 2I60L 4TUOB 2ADJB 3O4OB 1IAKA 2R0LL 4LFHD 4XP1H 4OLYL 5JW5B 3O11A 5CHNB 4ZSOB 1RZJL 1R3HB 3FQXB 3KPNB 5DJCA 5DC0A 5F21B 4R0LC 5TGBB 2HH0L 1JE6A 4KHTL 1LEGA 1OAQH 3KYOB 4L4VE 4Y5VA 1GGTA 4WU5B 1FZJB 4LP5A 3K1DA 3OX8B 4UINH 5MEQA 3O6FD 3GJEA 4FQIH 1AGDA 3JTSA 1SJHA 3PIQA 4P46B 4ZO8A 4Z0BH 4HIIB 1IKNC 3AC0A 1V7NL 2HFFB 4Q9RL 2EKJA 1ZLVK 1KJVA 1RIUH 1UCBH 3QSKB 1GPOH 2NY3C 3OHXB 1YEFL 1I7TB 4PJEB 1F8TL 2J7LA 4KDTA 2JK5B 2XTJC 3V79C 5IB2A 1C16A 5CP7B 3KPSE 4FQXD 4GRLA 5F7MC 3V8CA 1AJ7L 1MHCA 5EUOB 1NBVH 4NM4H 3GEWB 3FN0H 4JHAH 4MX7A 3ZE1E 2HJFA 4J8RA 5J1AB 1G7MB 4MGXA 1BREA 4NNXB 2XQYG 4S11A 1P2CB 2P47B 3LN5B 4YEFA 4EQ3A 2X4NA 4LQFL 1DBJH 2R4RL 3D3VB 3FFCB 3VWJC 4LVEA 3SO3B 2QBWA 4KRMB 1FN4A 1N26A 1MJ8H 3MBXL 1KCVH 5T5NG 3W0WE 1DJSA 2HLFC 3H42L 4KRPD 3NA4A 1Z0MA 3D3VA 3FFCA 1EBAA 5DFWH 1HINL 3SDAB 1R3IL 4PJDB 5ANME 2NTFB 1BQHB 1FNLA 2WBJC 3FOMA 4QYOA 4ZXBD 4MYWB 1CLZL 3BKYL 4C83A 1PAMA 4JPWL 3QHZH 1QYGL 2R2HB 1SYVA 3PJSB 5JNYA 1JPFA 5FCUH 2Y9RT 3MRHA 1FP5A 3LKSA 2A6JA 4MAYC 4QOKD 5F7KC 3TZVD 2BXZA 5M95B 5EIQA 2AK4E 2DTMH 5C0CE 2D7TH 3CSGA 2DQEH 3CJJA 2PXYD 4Y1AE 5CEZL 3EYUH 4YQXH 3CMOL 5J6GA 3EHBC 4C58B 4NUJA 3ARBD 5B8CB 1NCAL 2WBJD 2NY4D 4ZAKD 4KKBD 2A6KA 2MQ3A 2EDXA 3T4AA 3IS0X 4ZFOB 1Q0YL 1HHIA 5HGBB 4PIRF 3VD3A 4N8VA 4ZUVB 1U41A 3MV8A 3NCCB 5L88H 1DANU 3F12A 5CJXC 1U8QB 4OTXH 1H15B 3Q5OA 3FHAA 3IJSA 2Z35A 4M7KH 3OB0K 3G5VB 4MQSB 2EH7L 1AXIB 2H2PD 4ZAKA 3GKWH 2FX7L 3GHBL 1AXSB 1WAAE 5CHNA 4X4MA 4PBWD 4D0BA 3F6LA 1M7DB 1T1WA 3FQXA 5I75B 3NCFB 1OAZH 4JY5H 4OM0L 3CCHB 3QUMA 3L3HA 3SDDB 4Y4KB 5DZLA 1XIWD 4Y8AA 2NY4B 4ZAKB 5GSRB 1U3HB 1HOCB 3JV4A 3EYVB 1J8HA 2JJSC 1CDJA 1Q9WA 2JTDA 2AJXL 3S3SA 3KPSB 1REIA 4MHHG 3LIZH 4HCRH 3BX7C 5ETUA 1U8MA 1XZ0B 2W0FB 5T1LD 3VU2A 1H5BC 3L5XH 3TVMA 4TRPH 1IQDB 4ONHA 5E6ID 4Z7UB 3CFJB 3IETA 2YPLA 1AR1C 1HN1A 3RQ3A 4Y16D 5AZ2L 3ARFB 4JANB 3S88L 4DUVA 2GCYB 5ID1A 3MLZH 3GSUB 1I1CA 4C56E 1DTUA 4P2RA 3C87A 1U2HA 1B0RB 2Z4QA 3ARBA 1EHLL 4OCSH 3PWNA 1ITBB 2BSSA 1T21B 3BPOC 4Y16B 3V4UH 5BZDB 5CZVL 4TVPE 4WU7A 4XP9H 2IBZY 1NBQA 3ZKSD 3BVNB 1P2CA 2L0DA 2B1AH 1FGVH 5ADPH 1M6OB 4OLXH 4R4FL 4DWHA 4OJFH 1MPAH 1QRNE 4KWUA 3DUHA 3O3BA 4B53A 2R23A 5FKPA 2HJKA 3BO8B 3U30B 4KKAD 5CD5D 5CSBA 1BAFH 4Z76B 3ZSSA 4OZHB 3ESUF 1Y6NR 3CH8A 2FB4H 1Z9MA 2CKBA 4DKDC 2EKSA 1H3VA 3QCVH 4LSUH 2BJMH 5EORH 3HZKB 3MRJB 2D7PA 4BZYA 4ZNEA 1UM6H 3LV3A 3Q1SH 3GMQA 5EZJA 1VADB 5KG9A 4D0CA 2YK1L 4PLJC 2IADA 4MAYD 5DMKB 1BZ7A 1KJ2L 1NDMB 4RISH 4QF1A 5KVMC 1UZ6F 1LK2A 3QDMB 1HSBB 1AKJD 1CFVH 1BD2A 2NY1D 2ZCKH 1I3GH 4G6AC 2IF7A 4I77H 3SQBA 4QHLB 5ID0A 1QTYT 1YEDB 1JUFA 2KH2B 4NQSB 1UB5B 5T3ZH 3V5HB 4XPBH 4PJ8D 1QLEH 4LCWA 1TVDA 3QNXB 3SE4C 5B38A 4I48A 5HGHA 2ERJB 1BD2B 5L8JB 4MXWL 1F11A 5DS8B 4PRBA 2OXGA 3ZMRA 1RUPH 4FABH 5I1HL 2HKHH 4JFZH 4PY8J 1F97A 3DX9A 2ZCHL 4L4TB 1HHJA 4PJHF 1BFOA 1QBLH 1W72H 3MV8B 4YBLB 4QHNB 2V5YA 4MNQB 3CK0L 1DE4B 5I1GL 4JFEB 1BFOB 4NKMB 2DM2A 4P3CH 4WHCA 1ORSA 3B5HA 4ONGL 4CU7A 1JZ6A 1QRKA 1MRDL 4J3WA 2GFBA 4YHKH 1YEKH 1ADQH 3L5IA 5IW1B 3TFKC 5FV1L 3FQRA 2G60H 4WW1A 4NQVA 1MRCH 2CLZA 2DBLH 3IDGB 5IB5A 3QQ3A 3MRPB 1MLCA 2BCKB 2QLVB 5D7KE 1HHHB 3RL1B 1QQDA 2BVPB 5D2LE 4K94C 2EEDA 4HQQL 1HQ4A 3WUWA 3GSOA 4L8BA 2A9ML 1YY8B 2YS4A 4POZD 2BK8A 2BVYA 5DT1H 4EXKA 3S35X 3JWDL 1ZK9A 5DVNA 5GS3A 2AV7B 2IPKB 1BAFL 1WWWX 3TO4A 4OZIB 1QFPA 5ESVA 4JM4H 5DUBA 3KJ6L 4ZPVA 4DOHB 3V6BR 4D3CL 2H9GA 1T66C 4PJAA 4UIMB 5J57B 1CZ8L 3HNSL 4UTAH 4YR6B 2Z8VC 2Y1VA 1C1EL 5IV2B 4EUPA 4PB0L 4PJDF 2AV7A 2IPKA 4G9FA 2AXJA 1UC6A 4XP9L 5E08H 1CF8L 4FFZH 1FYTD 5F96H 5GISL 3TIEB 5I66B 1QHPA 1LK3H 3S6CA 2WWMD 4ZOBA 4CGTA 4DCQB 4Z7VF 2IALB 1IAIM 4WGWB 1ZLWK 1EH9A 1IZKA 3KLAB 1YN7A 4ZMAT 3HG1A 1KCSL 3LN4A 2CRMA 1A8JH 4YHNA 4EBQL 4JGUA 5F88B 1NGYA 5D1XA 2CKBB 5CBAB 4WI3A 5CSZA 2UYLB 1LE5A 2VZTA 5DQDL 3SKJH 4M1CD 1M7IA 2XTLA 5MHSE 1U3ZA 1I4FA 4QCIA 2BHUA 1P4BH 2FLBT 4EZMA 2P5EB 1ZHLB 1QG3A 1A6AB 5D7IB 1NDMA 5K9JL 5EPMB 1EMTL 2P24A 5DK0A 3KPRA 2KL6A 3ARPA 1DANT 4NBYB 3MNZA 1BF2A 4JQXC 4OZFH 4MWFA 3WN5B 5IESL 5SX4H 4X6BB 2F5AH 5E9DE 3PP4H 5TH2A 3OJDA 2V5MA 5T3XH 4CDGC 5DD5L 1NC2D 2PTTA 4HJGB 4I48B 4XCNA 3UTPD 4HLZH 4XCFH 1HQRA 2NPLX 3I3BA 1MWAL 5F8RC 1MUJA 5DS8A 3RTQD 1MAKA 3OJDB 2NY0D 4M7LL 4MJ4A 5F9DC 5IHZA 4JFHD 4ONFH 2D31A 4OIBA 4Z7NF 2R69L 3QISA 1LO3H 1C7SA 2P8MA 4WNQB 3IFOA 1KXTB 4NNYA 3HRPA 5FM5M 2C1PA 5AAWA 3BP5A 3EKCA 2FJGA 5E2VH 1UWGL 1A3QA 1JRHL 4ERSL 1BGXL 3VXQA 2VITA 4MNQA 5JIPA 4Z95H 1T04B 5DD6A 4Z95L 3UROR 1T7YA 4JPKH 4L4VB 5I18H 3B9KB 3QO1A 3S98A 4U1MB 1V5JA 4BK4A 5CP3A 1ZT7A 4G7YL 4XBPB 1XGTB 2A74B 2HT4D 4JQVA 2ID5A 2VXQL 2V5RA 3UBXB 2VN7A 2R56H 1NFDB 4FQCL 4KMTL 1VHPA 4LLMB 1OVZA 5TE7L 1EEYA 1XH3A 3GJFH 4XPHL 1S5HA 1FJ1B 4P4RB 3GMRA 3MV7D 4QT5A 3O4LA 2C3VA 1FNFA 2BX5A 1FNGB 2AJYL 3IFLH 4H0IA 3RBGA 2X4QA 4G6ML 4ZFGH 1NLDH 3KG5A 4GRLC 5C0NC 4OV6F 5FOJA 4NM8H 32C2A 4GAFB 2ADIB 2X4SA 3OAYH 5DF0A 3LKQA 3QI9A 3O9WD 4U6YB 1OTSD 4XCEB 5BV7B 1JYXA 5DJYB 3QNZA 4LMQE 3NCYP 3G6JE 4YO0B 1T89A 1ZEAH 4HH8A 1OL0A 2NXZB 2O5YH 1A1OB 3OKEA 4BK5A 4AH2A 4U6YA 1PKQA 5D93C 3QIBD 5DI8A 5IVXE 3TYFA 4LSTH 2CR6A 3WSQL 2DDQH 5IOPB 5IIEB 2VDKL 3G5ZA 3WIHA 2CQVA 2ZKHH 1XR8B 1TTGA 2OQJA 2D9CA 4NFDA 3E2HB 4PV9B 5DI8B 4OLVH 1KG0A 3G6AB 1U3HC 4JRWA 3ARYA 5SWZE 4FQQB 3FB6B 3NFSL 2WBJA 4XNYH 5E2JA 2DJ4A 5C6PB 1INDH 5FYLD 3MREA 1TQCB 2ZUUA 5HPMA 1RUMH 1Z0NA 3HC4H 5KANG 4ZDHB 3THMH 2R9HC 4FZEL 4PJXF 4R2GC 3A0OA 2A6DA 4LU5H 7CGTA 1CLYL 2XICA 4K3GA 3ROLA 2PYED 5F3HB 4F8TA 4PY7A 5LGJA 2ERJC 3NAAH 4HK3J 4KPHH 5M7QA 2GJ6D 3OXSA 5CEXB 4I3GA 1EAPA 1BM3H 1IC5H 3U2SB 1DUZB 3ME0A 4BSVA 4MSWA 3TBVB 4GW5B 5DRXB 2NX5E 5EBWB 5HGDA 4AY0A 3BKMH 1JHLH 4XVUD 3JWDH 4G80A 4PJFA 1ZS8B 2RQ8A 3TIDB 5CCKH 2AQ1A 3OXSB 2NY2D 4KVNH 3BRGC 1CD1A 1FRGL 4WWKD 4WY7L 4AT6A 2Q8BH 1B0GA 3RWEB 5IF0A 3UJTL 3WIIH 4WRLA 1I85A 4Z0XA 5HY9B 3IJYA 3RTQA 4YBLC 5EU7C 3O3EB 3X12A 4JO4H 1B0GB 2Q6WA 2DTSA 3HMXH 1KEGH 1H0DB 3G9AB 1LEGB 3IJYB 4MNQE 3PHQA 3VXNA 1BVZA 4CVXA 3OR7A 4MD5A 2FDBP 2DOCA 3OAUL 4LSRL 1MIEH 5HVWA 3U48A 1RIVH 3BP6B 3JWNC 4O5LL 5FYLL 5GGVH 4YIQB 3KR3H 3FT3A 4ZSOE 5DJZB 1G7IB 1T83C 4L9LB 3ZDXE 1HHGB 3AY4A 3BXNB 1F6LL 5E5RB 4PGEB 5IW6B 5DRNA 2VXTL 5FHAL 2GT9A 3L95B 1VACA 1CLOH 1T2JA 4WEUD 4XMKH 3OHXA 2OP4H 4ZYKA 3WNPA 4TPRH 4IOIB 1TENA 5C0FA 5IB3B 5IFHL 1NDGA 2C5DC 3SJVE 1N7MH 3IJHB 4PJ7A 4A6YL 5FGSA 1G9MC 2ZOKA 4LHJB 3BYTA 4CJ1A 1V3LA 3C6LB 2YD5A 4M7ZC 1YEIH 3WV0A 1FNEA 1ZWIA 2H26B 3C08H 1IEAB 2JELH 4OCMC 3IDIA 3HR5B 4HMCA 4BQ8A 1MHPH 1F4HA 2EDHA 5ESAA 5I1LB 2BZDA 2DI9A 4HUWA 2GSIA 3G08A 4YZFE 4YBQC 3H0TA 4K7PH 32C2B 5IB4A 2YN5A 1EGJH 1FCCA 4CKVX 5ESAB 4MVBC 5DSCA 1RU9H 5HHPB 4J3SA 4QRQB 1BX2A 5DD1H 3G08B 3SDCA 4BH7A 3TA3A 1HI6A 1A7NL 1KIUA 1A3RL 1NMAH 2WIIB 3RAJH 5HYJD 1WFNA 1WBXB 2YD4A 3UPRA 3BZFA 4XCCH 3IDXL 5KVDL 4XAKD 1ZGLP 2XFXA 4L5FL 3INUL 4OKVB 4ZUSB 1RIHH 1D5MA 1JRHH 4ERSH 4LCCB 5DFTA 1OGAE 1OARH 3OGCA 3PDOA 5JDSB 4XGZA 1W72B 4M5YH 3OAZH 4WCYH 1UH4A 2DYPB 4JG0L 2XKSA 5HYJA 4NQXA 2J8UE 3T0AA 4XWGL 1JGDB 4GLRH 5E03A 4DJMA 1KLUA 2JCCF 4NJAH 3C8HA 5AD0A 4QRTB 1VPOL 1VFOA 4NC2B 5CZVH 2JIXA 3V4UL 4JZOB 3UTTB 1EPFA 5DT1L 3WS6C 2CUHA 1JF1B 4Z5RA 3VFSA 2ZZUT 3MRIB 1RFDL 4NNPL 3TBVA 3QEQD 4X6CA 3FQWA 2G5RA 4M5ZH 3QAZB 1N5AB 5HGDB 4F7EA 1IC4H 1CK0L 1UWXH 4G80B 4PRHE 2BDNL 5LBSL 2CDFB 4FQJH 1YNKH 5JW5A 1KPVB 2PR4H 2G9HB 3HTLX 3MRCA 4XXCA 4AT6B 2APTA 1R3HA 4L8CB 4U6TA 3MLYL 5ENWB 2E7HA 5ITBH 4LLVB 4M9OA 5B3JF 1YEKL 3MLYH 4QHMB 4OZIE 5I16A 1YMME 2NYYD 3SKJL 4UV4H 4ZTOH 5DA0B 4AQ1B 5F1NB 1MCFA 5I1KL 4P2OD 1CK0H 3WFDL 1J18A 5F6IC 5T1KB 4OCXL 5TE6H 3S36L 4P5KB 4WFFE 2DQJL 2QSCH 1HE7A 2VDOH 2A38A 4M00A 4ZSOA 5ACZB 4JFQA 1K3IA 5CKGA 4JFPB 1XIWC 3VGDA 2XWTB 3OB0H 1H3PH 1H3PL 4IRJB 2CO6B 1MCJA 4XH2A 2G75A 4R3SA 1T1ZA 4ORGA 5INCB 4Q0XL 1QNZH 2BY2A 5GRZA 4M03A 2G5BA 4M6ML 3GRWH 1A4KA 5JORB 2XG4A 1FV1B 1NC4B 3CX2A 1X5KA 4OFDA 4QRRD 3WN5C 4D3CH 3FB5B 2G75B 4LSRH 4HKXA 1J88A 4NHCH 4EUPH 4NIKB 4M43L 1IM3A 5I0DA 4YHML 1G7MA 1RZKH 2YD9A 3STZA 1JWUA 4P2RB 1WZKA 5C0BB 1CCZA 4NO5B 4KQ3L 1I7TA 1QEWA 3MA9L 1B3JA 2H26A 3IDJA 1ZOXA 1NH6A 3H3BC 1IJ9A 2DQEL 3CLEL 1M4KA 5D4QA 1CT8B 1S7SA 1QVOA 3QEQA 4IJ3B 3GMLA 5LJYH 4YK4C 4PS4L 5IWLC 4R26L 1D5BB 5DD1L 1M6OA 4M1GH 3DRQB 3U9UA 3LS4L 1U8PB 2CIKA 5CEZE 4X4XB 1S7XA 4MJIB 1HI6B 3P73B 3VXRA 3HUJB 2AI0L 2I9LB 1KIQA 2J12B 2B8OT 1OF2B 4QO1A 4N0UA 5E6ZA 1EA9C 1QO3A 3BIKA 4ONGH 2FO4B 4RMSA 2X4PB 4OUOA 1P84J 5JHLH 1KNOB 5JOEA 3CX5J 4Z77A 3ARED 4JJ5A 2Y4SA 2EXWD 2HG5B 4XAWH 4X5WA 5BZWB 3NAAL 1MCBA 2NW3A 3VG0H 1SYSB 3F6IA 3TN0D 1BQSA 1IILE 5DMKA 3IU4L 4MB4A 5JDSA 1AO7D 1CFBA 1D6EB 3UO1L 1JWMA 3DV6B 1KC5H 3BPCB 4OD1H 3BUTA 3NFSH 4XNYL 5FHAH 3RVVD 4KJQC 5D7LE 1HH9A 5GS0D 3IAQA 4WDIA 4M3JA 4MXWH 3SBWA 3M8OL 3WHXB 3VMPA 4LCWB 1UA6H 1JV5B 3ZHLA 4ZFOA 4O5LH 1J12A 4JFEE 4YH6A 5B38B 1BFTA 3QQ4A 1DN0A 2GITB 4CNIA 1RZIB 1S7QA 3MRIA 5BV7C 4G9FD 2EEAA 3EO0A 1V3JA 1I8MB 3P9LA 3QULA 5EOTB 5SWZA 3F12B 1DQJA 3BMWA 3W11D 2XRAL 4K07A 1YEJH 2XA8H 3OGOE 3U1SH 4L8SC 2Y6SC 2C9AA 1CDUA 3EOTL 3I6GB 1N6QL 3D85A 4APQA 1N5YH 3CXHJ 4D0BB 3EFFA 3MBEB 1EK3A 2VLKB 4JRYA 1YMMA 2FHBA 2HVKA 3FHQA 2I27N 3T4AB 3GDBA 4L1HA 2AK4A 3R8BB 3H9SE 1Z3GL 2XT1B 1RUKL 2C3HA 3SKOB 1QOKA 2FHFA 4YHPA 1MFAL 4ZFZA 3FO0L 5BV7H 4HHAA 2Z93B 4TTGA 2VLKD 3IJSB 4QXGH 5TE7H 4DOHE 2IC2A 4KUCF 1CDYA 4CVZA 1PX3A 5MENB 3CVHB 5KSVA 1N2RA 5CWSA 5HYSA 1NMCB 1IQDA 5ABDE 4FNLL 3DVFA 3HE7D 2Z93A 5LCVL 1D5XB 2ITDB 3DX8B 2D7NA 1PY9A 2WBWB 4M5YL 3DURA 5J6HA 3D3VD 3FFCD 1JI1A 5DYOB 3SDDA 1T5WA 1OGTB 3OXRB 3V6ZB 2FEDC 1OHQA 1NPUA 4JY4B 3V5DA 3QRGH 3QH3B 4LLAA 3SGEH 2CLVA 4JZJA 2IG2H 3AU1B 3WNNA 1U8LA 5GRJL 3TO4B 1A0QL 3SE4A 3BRFA 1IM3B 1PZ5B 4ZPVB 3QO0A 3ILQD 1AFVH 1BQUA 5SWSB 1QD0A 4UIMA 2EXYC 3STZB 1X5HA 1C5BH 5D71L 4JZJB 4OZHF 3GBLA 3DMMC 2FR4A 2JKXA 1BHGA 2GUOB 4DKFL 1BECA 4JPWH 4PRAB 5JPMB 1JHKL 2VXVL 1UB6A 2GJ6A 4BSWA 4R6UA 4P5TB 5DJXB 1Q72L 2YD1A 3SE3C 1GC1C 3UBXI 3WO4C 4RFOH 3QEUB 1T21A 3B4NA 2IPTH 4R97B 4N68A 4L3ED 1ZLSL 4NKQB 4GG6E 3VGEA 1JZ5A 4NOFA 4PJBB 4WO4D 4W81A 4XBEL 3S34L 3MBEC 3TT3L 3OMZA 1N7ML 3EYFA 4PR5A 4YPGA 4K7PX 4G8FB 4KROD 2GK2A 1KNOA 1BLNB 2R4RH 3GSQB 4PRNA 4QRRA 3MXVH 3HI6L 4K23L 4LARH 2Z31A 1WTGT 3L3GA 3L6FB 1S9XA 3QDHA 4KI5F 4U7SA 1RMFL 3BD5A 3RVVC 3REVB 4NSKB 1QSFD 3EYFB 4PR5B 4FFVC 5IVZB 4YWGH 3UP1A 1IFHL 2EYSB 5FAAA 5IJKA 1BBDL 4YNYA 2IPUK 3KPRB 1A6ZB 3RP1A 2WBKA 4K71B 3BJ91 3MV9E 5DK3A 2Z31B 1LDPL 4QEGA 2Y07L 1MWAB 3T8XB 4AG4L 1F11B 1BZ7B 2XTJE 2I26N 4WDIB 5FGCB 3RWGA 1KJ2B 3ZZ1A 4D9QE 1MFBH 3GKZA 3OR6A 3PP3H 1F8TH 3UCRA 1ZHNB 4X5XA 4L1DA 2NTSP 3WUWG 4O02L 1A14H 3QDJA 2O61A 5E2VL 1RJLB 2EDEA 1E28B 5IBLC 5GGUA 1U92A 3V5HA 5KSAB 1I8MA 3TCLB 1O7SA 2A6KB 2ZJSL 1JWSA 4DFIA 5BO1L 3VXMB 5C0ND 5T1DH 3RNQA 1IGCH 2NY3D 4K3EH 3S4SA 5HGHB 1KELH 3LRSA 2ENYA 3SPVB 4M7LH 3VMOA 1IBGL 1QYGH 5KTEH 3HE6D 5IBUG 5KVGL 4LIQE 4WJ5B 1OAQL 1UKQA 4XTRD 1XIWB 5FYKL 4LIQL 1NGQH 4UDUB 2HH0H 4G8GE 1I1AB 5TDPA 3CDCA 4IHOA 3STBA 2DQFB 5MEOA 1IKFH 4F37F 2CJUH 3TT1H 1EO8L 4MCZA 2R0LH 3T1WA 5AUMA 3G6DH 4RCAA 4JPIB 4OGYH 4Z7WF 4AENB 1X3DA 2GJZB 4FZEH 1T83A 3THML 2EO1A 3GSOB 3VFPB 5I9QC 4NCC2 2DBLL 1MFDL 1N2RB 2LTQC 3R1GL 1TCMA 5K33A 5CKAA 3ZTNL 5GZOC 3UZEA 1ZANH 3U0WH 5KZCD 1LD9A 2HFGL 3B43A 1D5XA 3QEGH 3FQRB 4ZS6C 4CN4A 1OSPL 1JMXA 1RZGB 5D9SA 3V5DB 3RX5A 2W0FA 2H9GB 2R2CA 1ZLUK 1FZOA 3CFJA 1DL7L 3PWPE 4ZO7A 3VW3H 3L5HA 1LP9F 4MD0B 1KT2A 3PWVA 3DRTB 1GGBL 3T0XA 4XCEA 2DLEA 2H32B 4JAMA 5F7HA 4XNXL 1QBLL 5D2LF 5C0CD 3I9GL 3QAZC 1OP3K 4YPJA 4HFWB 2GY7B 4TUJA 4U0QB 3GIZH 3P4LA 4NRZB 4X4ZA 1ES0A 5F96L 2HFEB 4FABL 4P4KC 3DO3A 3GMNA 5EBMB 5C0BD 2YD6A 4HPYL 3E3QC 1K5NA 5F6IB 3PGDB 4PJHA 5H35B 2X1QA 3KJ6H 2NQCA 3SDAD 1WFOA 1YA5A 3W39B 2B1HL 1WC7B 1EEZA 2IH1A 5F3BB 3U83A 4QCIB 3QPXH 1G6RL 1AY1L 3VXUB 2UZYB 3ZDYE 1HXYB 3MJ7A 2NX5A 43C9A 5D1QA 3RZCD 1UXSA 4XVUC 4E41A 4GXUM 4HQQH 4HUXB 3VDAA 5T3XE 5JR1L 3QEQE 4LSSL 3DUSB 3D1MC 2B4CL 4V1DE 3ULSA 5GJSH 3CLEH 4MDIB 4ODWA 4M62H 5EORL 3ALWA 1K4DA 4YNYB 2CMRH 3VDBA 4Q9QL 1N59B 3HMWL 2BMKB 2YPKB 3SKNA 3VXSB 2VUYA 4YHMH 4KY1H 2OI9B 5IMOB 4CMHC 2P5EA 1X5LA 1LK3L 3KAAA 3ARUA 4NJAL 4F58L 4LDEB 5E08L 2WAHA 5KW9H 3QNXA 2EC9U 4UV7L 3UJIH 2UWEB 2V17H 5JW4R 4GRMA 3QCUH 3KS0J 4MA3B 2H6PB 3EHBD 1E6OH 1G7QA 1W72L 4CJ0A 4M48L 1Y6MR 2P1YA 2APVA 4KHXH 4XRCA 3TZVA 2D7OA 5EFIB 3N85H 4CMMB 5MENE 2Z0BA 1S3KH 1FNAA 3NCYS 3IDXH 1LGVA 3BQUB 2AEPL 4U1MA 4P49A 4W6XB 1C12B 3WXVH 1TZIB 5E5MA 4QNPF 2WMPA 1A1NA 3QUYA 3O9WC 4FZ8H 4YIQA 1K8DB 3QJHA 1OTSC 1TZHA 5HDOA 1KF9B 2DQFA 5MEOB 4UV4L 3F62A 3VFRB 3I6KB 1FVCA 2VWEE 1KOAA 1MFNA 4P9HC 5DHVB 4MA1C 2YWZA 1X4YA 2DYPD 2GT9B 1A1MB 5E99L 3RHWK 3B9KC 1K3ZA 5I1IL 4JPIA 1DVFC 4OD2B 3QJHB 2AJVH 2GJZA 4MAYB 1CFNB 3O4LB 3TO2B 1ONQB 2HT3C 5HXMA 4N8VG 3U4EA 1LD9B 1UA6L 5I9QB 4HEPG 2ADIA 3NABH 4O9HH 3RGVC 1NKOA 1OW0C 4LCYB 4ETYA 5BVPH 3QNZB 1NFDA 5DZNA 3HAEB 3I75A 3N85L 3AAZB 3ZDYF 3B6SA 4JM2D 1TDQA 3U7WL 5D7LB 2VE6B 1UZ8B 1HSAB 3QDGA 4J1UB 1IM9A 4PB0H 3QQNA 2W65B 3N1GC 4QRPD 1I85C 1I1FB 3OKLA 4XHJD 2L7UA 3EJJX 4DVBA 1BD2D 5I76B 4LEOB 4DKEL 3BW9B 4H1LG 5JW4N 1GOGA 3BDXA 4M7JL 1F4YH 4NUGL 4JCLA 3PHOA 1K2DB 3FRPA 4LPXA 3HI1B 4XP4H 2DLHA 4M6OL 3NN8A 3G9VA 5JOFA 1I3RB 1GL4B 2FZ3A 3QXAB 2ZPKH 4XNUL 1K4CA 3HZMA 5IB1B 3MLRH 4XC1L 5GZNC 1RURH 4ODXB 2EDFA 5JR1H 2EH8H 4N1EA 3MJ7B 5I74B 4HPYH 3ISWA 1SVCP 5E8DH 2Q8BL 1JGEB 3SDAC 2RAMA 1T20B 4ODVH 3TO4D 3GI8H 3OKNA 2KDGA 2V2XB 4KI5E 1YPZE 1KULA 6FABH 2B1HH 2WBJB 3U0TA 1MVUB 4RFNB 4Q6IB 3U4BL 4PJXB 5KVFH 3F5WA 1EZVY 2YUWA 4PJIA 4MLIA 2DIBA 2A73A 2DLGA 1N5AA 4S1DD 1N59A 2QKIB 5I1GH 3IVKB 5I8KL 1ZVSA 4XVJL 1SBBA 4I3RH 5CMAA 4A6YH 4GRLD 1HH6A 2VKWA 4Q0XH 3U2SA 2Z92A 4J6RL 2UVEA 4X98A 4Q9BA 5ICYB 2CDGA 5GGSY 3X11A 1W0VA 3KPLA 3QEGL 3IT8D 4U0RC 5IGXL 1MQKH 3T65B 1DQQA 2AJ3B 1F42A 1T6VN 2DQJH 4X7DC 3QA3A 3NZHH 1WCQA 5AZ2H 1DL7H 1F3DJ 1IGJB 4ZS6D 1HKLH 4P59L 5IHLB 2BHYA 5B22A 3ZDZE 4DTGH 4OAWA 3TA3C 3W2DL 1HXMB 2QQLH 4PGCB 3QA3B 3HG1E 2NXZC 2ZCKL 3S9DB 2NY5C 2AJXH 2EDBA 3UPAA 4FQHA 3N9GH 4I5BA 1P7KB 4QOKB 5IHBA 4TOYL 3R06A 1JIBA 3VA6A 2YK1H 5E00B 3RUGA 2WUCL 1FV1A 1NGWB 5TF1L 5FOBA 4QOKA 3GHEH 4PJGA 4TULH 4PRHB 3VFWA 4ZXBB 4NO2A 2EH7H 4K8RH 2W07A 2W38A 2YN3A 4LLMA 4LIQH 5F7EH 5DTFB 2MQ0A 2VYRE 2UUDH 3FONB 1S9YB 4MX7B 4TVSa 1IQWH 1PQZB 2IAMB 4XXCC 1Q9OA 1KCVL 4JDVA 1Q0YH 4XX1E 2OR9L 3EYSH 4KKBC 1XF5A 4RQQA 2A6IA 1P7HL 1IEAA 3ARGB 3IDMA 3RFZC 3FB8A 2VDQL 2GAZB 3FN3A 5J12C 4YXKH 2YC1A 4EVNB 2K7PA 4M8VA 1Q94B 2IH3B 2CIIA 5C09A 3IRZA 2X70A 4S1QL 2QTEA 4P5TD 2AXFB 2ESVB 1Z9OA 3FB8B 1UG9A 1J5OL 1ACYL 1HCFX 1NBVL 4LCCC 4JFHE 2ZKHL 3REWA 5KJRL 4OLEA 4E41E 3RDTA 4WV1B 3O4LE 3SCMD 1QBBA 2ESVA 3VRLF 2IPTL 1U42A 2XTJD 2PKDA 3MR9A 2VR9A 3QUZB 3DV6A 1TZGH 1GRWA 4LRNL 4YLQT 5HI4D 1D5MB 4AEEA 3LEYL 3VFTA 4P9HH 1H8OA 4LPUA 1T20A 5GRUH 3OTTA 1T7ZA 4X0KB 3BOVA 1AHWC 5HYJB 3HC0A 5LGJB 3RZCC 4H0HB 2JLLA 2ZSWA 2F54A 4UT6L 3QIBA 4WHDA 5FYKD 3D39E 4RIRB 5B8CA 4DGIH 3HI5H 5SWQB 4D2NA 3OPZH 2OP4L 2ATKB 3BN3B 1P4BL 4S1QH 4I18A 3QJFB 1G7HA 4ZOEA 1WUNT 1Q9LB 3WFCL 1IAKB 4F15C 4RMWA 4FQXA 5IJVB 3OKDB 5J13C 4N0YL 1AGCA 2X89D 2YD2A 2CDGB 1OP9A 4JLRA 2OR9H 3EYSL 5ICZB 4L3EA 1OD9A 2FL5A 3VXOB 5TQ2L 5IQ7H 2HFTA 4UI2A 1MEXL 1WITA 1NBYB 4MJ5A 5ELIA 3SQOH 5DZOA 3D48R 4HWUA 4L3AA 4ZFOL 2VXUH 2Q3AA 5CEZH 3VWJD 4IRJA 4TSBL 4JG1H 2X40A 1GIGL 5CJQL 4R3SB 5DLML 2K7QA 5DRWA 1CQYA 5EO9A 4OAWB 5C08A 1C08A 5CWSB 3WIIL 1T2QH 3BZEA 2G5BB 3NCMA 2VL4A 3VFGH 3UYRH 4AEIL 4LLDA 4WEMB 4I5BB 4LAJH 1Q9WB 1CGYA 2DQTH 1HHGA 1MWAH 2J8HA 2MQCA 2C26A 4LLWB 1KB5B 4AM0B 4HS8H 4IS6B 1MNUH 1EGJA 1S8DA 1A7PH 4MD4A 3SY0B 5HYIA 3SGKA 2VERN 5FOBB 3N1PC 4ZUWB 5I6XB 4KK5C 4O58H 4WUUE 4XH2B 4QRPA 2IAMD 2F5BH 2F53B 3QDGD 2Y36H 1J1XL 3ZSTA 1JF6A 3ULVE 3OF6D 4KVCH 1B0RA 4PRIB 3JVGA 1KTDB 3CGTA 3D39A 5BOZG 3GI9L 4U1IA 2E9WA 2AGJL 4MA8L 4ENEC 3HZYA 1UQSA 3BEVB 1W0WB 1J1PL 3RWJA 1NGZB 3C6SA 2PTUA 1CVRA 4YFDB 2DJUA 3VXRB 3KLDA 4NWTH 1KB5H 5FGBC 3WCYA 4JHWL 4P5MB 1QACA 3CZFA 2PYEA 1INEH 1KIQB 4GQ9L 2OCFD 5HHMB 4ETQB 1MHHB 2ATPB 2WV3A 2WM0A 4QHUB 1U8NB 3MJGX 4NZUL 4P0DA 4F7CA 1GSMA 1QRND 1BZQK 3RVWD 1YPZF 4CU8A 3OZ9H 3PWLA 3IDNA 1VGKB 3R0NA 3CZFB 3FMGH 4HF5H 1WBXA 1M71A 3VXSE 2ADGA 3QXTA 5SV3A 4G42B 1DVFD 2XQYK 3S36X 4X4XA 1X4XA 2B7DT 4JPVH 1AH1A 4J4PD 4Y4KC 4JEGB 3O3UN 3GMQB 1IGFH 1KN2H 4XNQB 3LKSB 3LY6A 5E4IA 1SBSH 2P45B 1HIML 5B38G 3QFJB 5EZLB 3GSVA 3BP7B 3QDJE 2APFA 3NCJL 4HBCL 3HAEG 2J6EA 4F7PA 1KIRB 3L7EB 4JZJC 1F58L 4HUVA 4OIAA 1N6VA 3WLBB 4P46C 4I4WA 4NBXB 1I3GL 4I77L 4Y19A 4KRPB 3HPJB 4PLOB 4HT1L 1RZJH 3PWUB 3KPRE 4MNHA 4P23C 3ULVF 2I5YH 2OYPA 4BJLA 1FZKB 3SJVD 5C07D 3T77A 3DMMA 4P3DA 1U8IA 4HCRA 4PJCE 3PWUA 4MNHB 4OGXH 4Y1AB 4EI5A 1T80A 1G84A 4IRSC 4DUWA 1GAFL 1E6JL 3VI4F 2MMXA 5IBTH 1SJEB 3RJQB 2FATL 1XGRA 4MXQD 4QHMA 1RD6A 4XTRC 3C60A 4JFEA 3DMMD 2BSRA 1Z5LA 2PF6A 1LO3L 2FEEI 3MBEA 2V5TA 3MJ9L 2J6EH 3QBTB 2BVOB 4GAJH 4KRNA 1PEWA 3RPIB 3OZ9L 3SDXF 2W9DL 2P46B 2CUIA 1RUQL 4UNTA 1AXSA 2CK0L 2CLZB 2Z31C 4JB9H 5E0QA 4OZFG 3V8OA 3UDWC 3WLWD 2VNCA 2FYYA 3D18A 1ZT1A 1AI1L 1MREL 3OKMA 4LCIH 1HHHA 5FM8A 5IROC 3MRBA 3C2AL 1IAOA 4X8XA 2OTPA 1T1ZB 4ORGB 5INCA 3IRPX 4HIIA 2X05A 3GJFB 2G2RB 3LB6C 3JTTA 4L8BB 5IESH 3S36H 1SJVA 2GCYA 2QV2A 3MRLA 2HN7A 1NCUA 2DIJA 4XNUH 4P4KD 3M1BA 4PJEA 4WI8A 3HE7B 4HC1L 4NO0A 3DRTA 1S9WB 3DJ9A 2JK5A 3WFEL 5D6DA 3HB3C 1HILA 1LO4L 2O93L 1ZHKB 1S7WA 4WU7B 1WBZA 3HUJF 3P4OB 5ILTL 2HRLA 4YC2B 3SGDI 1R0AH 2OJZL 5TPWL 1QLRA 3IETB 1QRNB 1VGEL 2XY1A 3IYLW 3SJVA 4JY6B 3O4OC 1NBZA 1ES0B 3NIDE 1L0YA 3RPKA 2BVQB 3C6SB 4S2SB 1WBZB 3VWJA 1G1CA 4MMZC 4XWGH 2NYYC 5JIKA 1K6QH 1MHHA 2ATPA 2V2WA 1BQLL 3RWHB 4F58H 4GBXD 2VSCA 5I1CL 5B4MD 4PRAA 4LOUC 1WC7A 4EKXA 4N9OB 4MDJA 3H9SA 1UB6B 1O0VA 4NSKA 2V2WB 5L88L 2X4PA 2UYLA 2EYSA 4IBLT 5D93B 3NPSC 1FGVL 4UTAL 3K74B 1NEZB 2XKNA 3EZJB 4YHOH 3LMJL 1XGUB 2MWCA 1A6AA 5D7IA 5EU5A 3Q2CA 4NQSA 1K4DB 3BGMB 3KXFB 3Q6FB 2X5PA 5DJ6B 1MJUH 4QHKJ 5FF6A 2ICWI 2E9IA 4D0DB 2VH5H 5ILTH 5E99H 1W8OA 4MWFB 5FCSH 1TQCC 2GTWB 5D1ZA 2EE3A 1HKFA 1HHKB 5DD0H 1RVFL 3BN9C 2DI8A 3N06B 3O6ML 2BVTA 4G6KL 1CR9H 5C0EA 5KS9A 1OTUC 4QRUB 1YZZA 3K80A 1U6AL 2XOTA 1U8JB 3GBNL 3T8XA 5FECA 1YEGL 2EE6A 5F7DA 4L8DB 2D03L 1ADQL 4W4OC 1FDLL 3UTSE 3GK8H 4FTVE 3LKNA 1P9MA 4U0RB 1RK1A 1JF5A 3ARZA 4JPVL 1GGYA 5KSUA 2YWYA 4DQOL 4MCZB 5KS9F 2WP3T 1ZA6B 4IMLB 2DKUA 5BQ7B 1YMMB 2MNUA 2E3VA 3S4SG 4IOFC 3T2NH 5KBNC 4F9PC 1A1NB 3QUYB 1WAAA 4AENA 4FQ2H 2UWEF 4HGWB 4UZGA 2OL3H 1TFHA 2WUBL 3QQ3B 5HDQL 5F44A 5DHVA 4OTXL 5BQ7A 1FE8L 4LL9A 5C0CA 3H3KA 2OK0L 4JR9H 3VE0B 1B6UA 1CIUA 4P2QA 5L2KA 2CMRL 1I7ZA 3MX0A 4DK3A 3CXDL 2VDMH 4QXUL 5KSVB 1X5XA 3V0VB 3ZE2F 4X7EC 1A6UH 1YY8A 2UZIH 4MA7L 4OZFA 1UACL 2OZ4A 2YR3A 4KDWA 5A2IH 5FYLH 5GGVL 4G8IA 4HV8A 4OI8A 3P11L 3D25B 1CFTA 2Y5TB 3EJZC 4LSQH 3GMRB 1NCAH 3RWFA 5ESVB 4B0MM 3MO1A 1ETZA 3ETBF 5GGSB 5IB5B 3WIHL 5I17A 1KEGL 4YHYC 1FFPB 3RDTD 1UYWL 1FCGA 4HS3B 4XC3L 1DLFL 2DLFH 5HYFA 3Q0HA 4JFFA 3PQYE 2GEEA 4KK6D 4P2OC 1MFCL 2NY2C 4YDKH 3Q1SL 3MA7A 3QWOB 5FUCC 3VFNB 1U8OA 4XZUA 4LPVA 4JE4B 4YDKL 5I15L 2NZIA 4LEOA 1AIFA 4I3SH 5CCKL 5C9JB 2ARJQ 1AGEA 3B9EA 4M1DL 4U05A 5JPMA 4Q58C 3H9HB 2DM3A 12E8H 2VXUL 1NEUA 1MFBL 5ISZA 3ARRA 3LQZB 4Y5VC 3KPPB 5E2WL 1I3RA 4X8JB 2VAAA 4H8WC 1JGLL 5H37H 5TDNB 3H9SD 1ZVHA 3DGCR 1DQLH 1CXEA 2CKNA 3B3IB 3DO7B 3NZHL 2YMXL 4NRXA 4BUHA 1DEDA 1OGAA 4JRXA 4P2QE 5L2KE 4KQ4L 1TTFA 3KJ4C 3L6FA 4Z78B 4GXVL 4BQBA 4JHAL 1NGYB 1J1PH 3R1GH 4ZOAA 2X7LB 3C5ZB 5IM7A 3VD7A 3SKMB 5BS0D 3GJFK 1P1ZA 4FQ2L 4I1NB 1I8IB 4TRPL 3EOBB 1BQHG 1FFRA 3JV6A 3H9ZA 4J2XA 5ID0B 1YPZB 2F8VA 5FV2A 4AK1A 3X3GH 2MHAA 5DMGC 2LABA 1P4IH 1U3YA 2XZAH 1Q72H 1ZHNA 4X5XB 4OT1L 3GM8A 5KS9B 5DR5L 3VWKD 4XPHH 3DBXB 1RJYA 1FDLH 3KDMA 4AZ8A 4Y89A 2D03H 1F3JA 1WT5A 1R3JA 4EDWL 3MLSL 4O4YH 1KELL 3V6OC 1TZIA 2VRAA 4BZ2H 1T1YB 2LE9A 4JKPL 4UT7H 4M7LT 2VL5A 3V6FB 1ZE3C 5KAQF 3SEPA 1H0DA 4XX1G 3GGWB 3Q5YA 1MUJB 1MCLA 2NY6D 1U9KA 4HFUL 1J5OH 5CUSL 4K3DH 5EWIH 5JW3L 4QLRA 4NOBA 1P6AB 1DBBL 3OAYK 4YDVB 5LGHL 3DOSA 4GMTL 4LSDA 1G9MH 1Q38A 3DHMA 4WO4B 4IHOB 2X9WA 3BGFC 3P0VL 3QWRA 4LSVL 4M93B 2NY4C 4ZAKC 3OL2A 4WEBL 5FO9B 5JMOC 4JM2A 1CICB 1M05B 3VXQB 1XMWA 5IW1A 3ZT7A 4E42B 3B2UD 3P0YL 3VXRD 4PJ8B 2CD0A 4A2LA 1VKXB 1IFHH 5C0FB 4WHYH 1S7VB 3I6LD 1MCHA 2B5IB 4N0FA 4GG8A 3PL6D 1NANI 5TE4H 1FVDA 1NLBH 1BGXH 3SGKC 4NDMB 3TESA 2CGRL 2DTML 4V1DA 3S96B 4DGIL 3QDGB 2ZG3A 3EDJA 1BVKA 3MYJA 4JFOB 3QRFM 5E8PB 2K3TA 1G0YR 1A2YB 1UT9A 2HKFH 5IG7A 2OR8A 4GKSB 3QDAA 4OFIA 2VLLB 4XPGH 5DK2B 5IQ9A 1A6TB 5IMLA 1BJ8A 2BNQD 2X4TA 2CIIB 5C09B 3CNKA 2XZAL 1JGVL 1R3IH 4GFTB 5DUPL 3MACH 5DUML 1H3XA 4MMXC 4RGOH 3REWB 3BZ4A 4XVSH 4ZFFA 4UILL 2DQCH 3E2HC 3KPQB 5JXAL 4PJDE 4OKVA 4PJHB 3I85A 1G9NC 3UYOD 3BW9A 3LQZA 3DYMA 4I2XE 5HD8C 3RA7L 3RKDD 1NAMA 5MI0C 3MRQB 5I75C 2VH5L 3ROLB 2GTZB 1HXYA 3MC0A 1CL7H 5JOFB 2HTLC 1Y18A 1VCAA 4OB5L 4GW5A 3G6AA 5F7WC 2YXMA 1I4FB 1G7PB 4EBQH 1K4CB 3HZMB 3SDYL 4FQQA 3VFVA 4LGRB 4Y2DD 1NAKH 3D0VA 3HE7C 3FQTB 1R5WB 4G3YH 2CO7B 4ZDHA 2XN9D 3IS1X 2HLAA 2ZCLH 1UGNA 4RNRA 4X98B 2MCPH 5C09D 3O0RL 3SGJC 2R4SH 2OJEB 1T2XA 1FLRL 2B5IC 1G7HB 2R0KL 5DVKA 4POYA 5FYJE 3H6JA 1RUKH 3G04B 1GXEA 4F33B 4GSDH 5F9AC 3LS4H 4YZFF 3EW3B 4PUBH 3B8YA 4LLVA 2ARJA 2OJEA 4KQ3H 2FL5B 2GIYA 1RJYB 4POZC 5C0DA 3NACL 4KUCD 3A6BH 2WZPD 3HB3D 1QBML 3OR7B 1TETH 1NBYA 4MJ5B 4YE4L 4ZD3L 5E2UL 1IC1A 4HJJL 3AXLA 1BWWA 2H2SC 2P43B 1EEQA 3EJZD 3KPNA 1CGUA 4FQHB 3HFML 2A9MH 4NNYB 3V6OE 3ECBB 4YHKL 3W2DH 2ICCA 4JFDD 5DJ8B 2KKQA 4AQOA 3O3EA 3X12B 3SO3C 1QR1B 5CS7A 2PO6D 4BKLB 1MHEA 1TVHB 4LVNB 1UACH 2QEJA 7FABL 3JTSB 1A64A 2PXYC 3QWRD 4WI2A 1FL6A 4N5UA 5EDXA 1ORQB 4WTWA 5GZND 2DQGL 1HXMA 3PHQB 3VXNB 3V2AR 4CVXB 1LE9A 3VJ6A 4GG6B 1G9EA 4LPTA 1BF8A 4U6HB 1UENA 5IROA 4C56D 5E24E 2X89A 4J6RH 2FX8L 1KB9K 4DGYL 5CILH 1H8SA 1P84K 2GI7A 1TTUA 3UBXA 5BVPL 3ILPA 5GZOD 2VTFA 4MB5A 4N0FB 1VFBB 3QIBC 4GBXB 2R2BB 4N0RA 3KS0H 4NDMA 1YYLL 4R2GB 3BH8A 3MJ9H 5GS2H 4DQOH 1EO5A 2ZOLB 4P2RD 3KXFE 4PGDB 2YUZA 1CVSC 4PRHD 4QRQA 1BVLA 1BMGA 1QLFB 2IH3A 3T0EC 3WFHA 1ZXQA 3CFEA 1RUPL 4ODVL 3V4VH 3GUTB 3BZFB 1U8NA 4LPCA 1YJDL 3X13B 4HUWB 2DQIL 1BVLB 1QLFA 1EFQA 1S9KC 3B2VH 4NJ9L 1G0XA 2BNRA 1QLEL 4JDVB 5DD0L 1H3WM 3RWDA 3IDMB 3VD9A 2AEPH 1VA9A 3MLWL 1ZMYA 4PJDA 1W72A 2CJUL 4RMQA 2EZ0C 3TA3B 1ACZA 2VLRE 4ZD3H 2IPUG 4HK0B 4MAUH 4C83B 1MNUL 1NAML 4JFDA 3BPNB 3QXAA 5HHOA 3MJ9A 1MCEA 4Q74A 5EU4A 1JWMB 5TQ0L 5F9WC 5LVEA 5HPMB 4H1LH 2ED9A 2A6JB 4DN4L 4LHUB 1MCDA 5TJWK 2PW1B 5F89B 4N8CH 2P7TA 3FFDB 4XGZB 4PRPB 3MV8D 3X14B 1G7PA 5FO7B 4I18B 5I1CH 4JKWA 4L5FH 1RULL 3NA9H 5L6YH 5BXFB 4WENB 1FG2A 1TCRB 5DFVD 4X0KA 3ARVA 2WP3O 4OCXH 3HC0B 1LDPH 2E7BA 4K71C 4XP5H 1A3RH 1NMAL 1G9NH 3ILQC 5CMAB 4X4YA 5I19L 4ACPA 5C86A 4HCRL 4W68A 4YWGL 3JVGC 3PWJA 4GMSH 5IBUB 2ENSA 5J11B 1KBGH 4P5KA 2AP2A 4YDJA 3ZE1F 3OPZL 3QUKB 1XR9B 3VRLE 3DTXB 3HI5L 2G9HA 3IAGC 2BNRD 1E4KC 3BZEB 2QJDA 2H1PL 4JFPA 4BFGA 3W81A 3TC9A 4NYLA 1CFSB 3QUXD 4XBEH 3S34H 3T3MF 1YEIL 1C7TA 1OAZL 4FQLL 4Y4KA 1DQDL 5GGRA 1S3KL 3O11B 4MD5B 2BRRL 3BJLA 4F8QA 2BSTB 3AY4C 2FYYB 3EOAB 1MCRA 1BFVL 5DJZA 5D2NA 4F3FB 1QSFB 3BWAB 4QRPB 2C4XA 4D94A 5HHOE 5IB2B 1T03H 2NY3B 1XGQB 3KYOA 5CIPB 5T1MA 4O2EB 3QCUL 4JFQB 1FZJA 2J8UA 1QUNA 4ONHB 1YN6A 4MJIE 2JJTC 3KR3L 2YPLB 3WXWL 4P46A 3WNLA 3GKWL 3GO1L 1S7WB 1FYTE 4JKLA 5F7LB 4DGVH 3UC0L 1OSPH 3L3IA 3MCKA 5DHVH 2WLYA 1X4ZA 4P5MA 4ETQA 4G9FE 5I30H 4JY6A 4U2YA 5KVDH 3HMXL 1OY3B 2Z9TA 1X5ZA 5J06A 3QFJE 3BP4A 2W60B 5HYQA 3P73A 3C8DA 4NKIL 2IAMA 4TNWF 5LCVH 5JIIA 1XF5B 4RQQB 3WKML 5K9OB 4XI5D 5A2FA 3KLSA 2GAZA 4HGMA 2P5ED 4HIJB 2NTFA 5T1LB 2AJSL 1MCPH 2R2EB 4Z77B 3DSNA 3C60C 4FG6D 4UDTB 2MOVA 2CH8A 4L3EE 4CADB 1S7RB 1TJIH 4QTHA 3BKML 4APQD 5CUSH 2D0HA 4QHUA 1QSZA 1YMHA 1B4RA 1KENH 1IBGH 4RA3A 4PJ7F 3GHEL 3EJYD 1S7XB 1CD0A 1Q9KB 3TV3L 4J4PC 4Y4KD 3EDKA 3JV5A 4F2MA 5I0ZA 4PREB 1IMHC 1JPTL 4EDWH 5C07A 3WO3B 4NWUH 4E5XB 5K9KA 5DC4B 3O8XB 4B7IA 4JO3L 4JFDB 1XF3A 5F1KC 3E1F1 1ZTXL 1FHGA 1NL0H 4Q6YA 4HZAA 2R8SL 1X5YA 1EHXA 1YEJL 4OT1H 5IVXF 4NC1E 1GOHA 3OKOB 4FFVD 3ROOA 5BJTA 3SHSA 4WHYG 4GRWB 3TBSB 4E5XA 1E4XL 2PW2A 4YAQA 2Q7YA 2P7TB 3CFIC 5GRVK 3VMNA 2I9TB 1GYAA 3DMMB 4P3DB 1CD9B 2NY0C 3WDIA 2Z8WC 1JFQL 1MCWM 3TJHC 3VGAB 1VFUA 1PX4A 4DFHA 3AS0A 5L9DL 4EI5B 1FYTA 3MRRB 5JPNA 4YHZL 3EJYC 2E6JA 4JFYA 1BBJA 2V7NA 5AWNH 3QXDA 3ZKMC 5GRYA 2ORBH 3BYYA 4KJPC 1CI5A 3JBG7 3MXVL 1SHMA 3QIUD 3V9FA 1DSFL 1YDPB 2Q86A 4YDIL 4BYHA 5IJVA 3T77B 1M7DA 3DX7B 3WJJC 3MRFA 3V6OA 4R90L 4U2ZA 4MQXC 3G6DL 4UOW1 1FZMA 4JVWA 2AEWA 4KZDH 4IRSB 4O2FA 3SN6N 3TV3H 2NY5L 3HE6C 3RTQC 2D3VA 4Y4FD 3EYOA 1U3HA 3JV4B 2J3SA 4G8EB 1T0NA 1XAUA 2HVKB 2EC9T 3D69A 3T09A 5IR1B 2VXVH 2ZUQB 5TGBA 4K3JL 3D87B 1M1SA 5GGRB 1T3FB 1J0ZA 3BE1L 5BMFH 5FHBH 1J0KA 1FFQA 2B2XL 2BSTA 5EC2A 4LLDB 3TH3T 3MCLL 2C1OA 1S5IH 2XPGB 5C6TL 4LU5L 5FA4B 4WW2F 2ADFH 4HKJA 4Z8FL 1PZ5A 4RMTA 5CIPA 5ERWA 1A14L 3P4OA 4KROB 1RZ8B 1FL5B 2COQA 1YECL 5D1ZC 5I17B 1OAXH 1D5IH 3ULVH 1J8HB 1MAML 4PJ5A 4F7MA 1OQXA 4OM1H 3KJ4B 1ZT1B 4KGJA 4KKLD 4ZOCA 4DGVL 1N6UA 4HKJB 3NIGE 4DTGL 2G2RA 5IQ7L 5SWZD 4S2SA 3V0AC 3MV9A 2Y72A 2H8PB 2XZZA 4XVTL 1YQ2A 3O6FA 3U7YH 1KPRA 3VFNA 3GFUA 1KTDA 4OCWL 3QCTH 4XPFH 4PYGA 3KYKL 4NRZA 1OSZA 2I07B 2EIZA 1P9MC 2LVEA 4IIQB 5SWSA 2QHRL 3ZT5A 1K5NB 1X5AA 1XGPB 3PXJA 4OZHA 3O6LL 4Y16C 4ODUB 2FJFB 1U93A 5B39G 4Y2DA 4W4OA 4K94H 2CDEA 4UB0L 4DVRH 5D1ZD 4BH8A 2NX5D 3K46A 1GGCH 1MFEH 3SDCC 4YHNB 1F4XL 5TE6L 3O2DL 4QNPE 1B90A 4KZEH 4U1SB 3EYQC 5F88A 1NFIB 3ALXA 2Y7QA 1KCLA 4YDLB 3MOBH 4ZUUA 5EIIA 3HMXA 3BGMA 3KXFA 5FYJL 5FYJU 4CU6A 1TZGL 3FT4B 5MI0B 3NTCH 5BZWA 3VFOA 4WFHD 1MWAA 3PWPB 4FQCH 2PXYB 4TN9A 1MLBB 4PG9A 3RY5A 1ZGLA 4JO1H 4V1DD 3BISA 3ES6B 1YNLH 1F3DH 2P24B 5DK0B 1LP9E 2OTWA 1FAIL 1WZ1L 3FT4A 3PV6B 1J8HE 1I8IA 3DXAE 1VADA 1UM5L 1WWAX 5HI4C 1S9XB 2LU3A 3L7EA 4RDQF 2PW2B 4G6FD 1YPZA 4MHHI 3ES6A 3K3QA 3TCLA 4HWNA 2VQUA 4XCYB 1A7QL 4LGPB 8CGTA 5E94A 2VLRA 3BPLB 5IKCA 4P2OA 3IDYC 5D1ZB 5JPNB 2P8PA 4GAGL 5JQ6H 1G7QB 4NRYA 3TCXA 4MNQD 5C0IB 4Q97A 1CDGA 5EFIA 1WJ3A 1NCDH 3VG0L 1PVHA 5C92A 2R1WA 2EDWA 4UV7H 5KVEH 3I6GA 1MI5D 2QADD 5FECB 4LLQB 5T5FL 5C3TA 5SWSE 4PG2A 1DZBA 3N1MC 1BIHA 2NLJB 4FFYH 1TJGH 3U7WH 4JRYB 1FL3A 1XGRB 2AEIT 2AK4B 4KY1L 4R8WL 2Z35B 1CBVL 3S4SB 5BV7L 1ND0B 3MQIA 3SKOA 3ULUE 4S1SH 1CXLA 3PP4L 4U6VH 1BIIA 3A6CH 2CKBH 3MRKA 4OZ4B 3W9DA 4OZFB 3NABL 1KEML 3BHBA 5TF1H 3LHPH 4PJGF 5BVJB 1QQDB 2F58H 1RZ7H 1ND0A 1C5CL 1EFXB 1PYWB 2P5WE 1VKXA 4OZGB 4XBGA 1RU9L 1MELA 1JBJA 1EJOL 1E0OB 1HOCA 1OCWL 2X4RA 3SDDC 4PTTB 1F4WH 3VXTA 1AHWB 1MRFH 4RGNC 3RBSA 3ESVF 2XPGA 5B39B 5F1SA 4Y4HA 3WS6A 4PY8I 1QA9A 3RX8A 4M4RA 1IVLA 5ERWB 4HC1H 3DVGA 4HH9B 1I3VA 2D7QA 2D7MA 2HN7B 4HC1A 4G8IB 1YUHA 4HV8B 4ODHH 1A2YA 3L3KB 1PKQE 1A4JA 1A5FL 4I2XB 3JUYA 3GRWL 5CSGA 1GZPB 3KWWB 1I8LA 2LAAA 3MRDB 1FNSL 4LCWE 1Z9LA 3GSXA 3WL9B 1YC8A 1V3MA 3PGDA 4DCQA 4XAKE 2KUTA 2FR4B 1FH5L 3VXPB 1AR2A 5I76A 2AJZB 5IMMA 1CF8H 4I9WE 2I07A 2KQMA 3ZT6A 3LN4B 4F7TA 1G7LB 2EE2A 4HFWA 2A1WH 3ARDA 4R0LB 4AEFA 4ELME 4TUJB 5JDJA 1MIEL 1HK6A 3LKPA 2W0LA 3OJVC 1WF5A 4XXDB 4QHKI 3FN9A 1A22B 1UCTA 3U4BH 5HHNA 4WWKC 3UMTA 3O3AB 1OP5K 4M6NL 1II4E 4OM1L 5CJ5A 5FA3A 4PRDB 5D72H 5C9KA 2EDNA 3T1FB 4PV8A 4YGAB 1I3UA 3MRGA 2C3WA 4UIKH 2F58L 5EG6C 3EOBA 2HJLA 1YEHL 3FRPG 3O45B 4TSCL 3CVHH 4KI5D 3LHPL 4ZQKB 2A77L 5IJKC 5FHBL 4MQ7A 1MQ8A 2WK2A 4PRPE 5C71A 5LWYH 2V6HA 5BW7A 2I5YL 3QCVL 4XP4L 4P48A 5LXGH 3U6RA 4D0DA 1CXKA 3T3PF 3IAPA 1JRHI 2VABA 4LRIA 1HYSD 4JM2F 3QIUA 1SMOA 5JOPD 1EBPA 2Y06H 2EE9A 3HNTL 2A1WL 1XCTA 5T1DL 5HDBF 2FLRT 4IOFD 1T4KB 3DUUA 4XHQA 2E7LA 4TVPH 1E28A 1SBSL 4E0RA 2BY3A 2H3NB 3LS5L 4ZTPH 5I8CA 1C12A 1BD2E 5DEFB 4OCSL 1HZHH 3VXMA 4HUNB 2DI7A 4ODBD 1FGNL 4GRMB 4XNXH 3KDMB 1A7QH 3RA7H 3VFRA 3S88H 1QFUL 3QO1B 2EDLA 4NZTL 4XCCL 4NPYA 4H25A 1OP5H 1ZT7B 3VW3L 3CH1A 4GG6F 4H0GA 3LQAH 2VAJA 3BQUC 5I1KH 1BZ9B 4K8RC 2FSEB 1AXTH 4GO6B 1NKRA 4WW2B 2JCCB 4L9LA 3WSQH 2F8OA 2IGFL 1QR4A 1DBKL 1CFVL 1NMBH 1R3KA 2HFGH 4DZBA 5CINH 2DB8A 3SOBH 1DEEB 4HWBA 4U6HA 5ITBL 1F4WL 1BZ9A 3CFBA 3NFNA 2VC2H 1PZUB 3I2CL 4RFNC 4LEXL 5HPOA 4PB9H 5GPRA 4FTVA 1NCNA 4O2CA 3WHE1 4L4JA 2JJTA 3D25A 1NUDA 4UMGA 5DTFA 1M7XA 3BKJH 1D5ZA 4O58L 2YA1A 1IGMH 1CLCA 1FLTX 1CYGA 1PQZA 3O6LH 1A3LH 1GHFL 2QQNL 1JHKH 1MOEA 5FYKH 4GS7B 5GIRB 4DVBB 4FFYL 1EVTC 3GSRA 5KVGH 1V05A 4UBDD 4X80H 1R5IB 4LCYA 1LEIB 2VLJE 5JHDB 1MPAL 2H32A 2QR0B 1BVKB 2FJHB 4OLXL 4R4FH 1CTNA 1OPGL 4WIQA 1JNLL 1P4LB 4OZGE 3AAZA 4CUCA 1DQMH 3QQ9D 4OF3A 3KPSD 4XPTL 2OQJB 4NQDE 2LU4A 3DX6B 4G9FB 1OOAA 5IG7B 1AFVL 1KGCE 2HAZA 5DLMH 5D2LB 1LQSR 1AGEB 3GBML 1BJ1H 2EDDA 4TSBH 1NCBH 3FB6A 3TNMB 3VD4A 4YQXL 2OL3A 1U36A 1MAMH 2DWDA 5B3NA 4HDIB 4DW2H 3MOAL 3WFBH 5DGQA 4AH2B 2YD8A 3OGCB 2Z8RA 4NT6A 3QFDA 4JGJA 1EUTA 2QL1A 4NQEB 1N4XH 4QWWC 4U1HB 3PABB 5DHYB 1PG7W 5D1QC 3KPQA 4D9RD 4LCUA 1LP9A 2B2XH 3FQTA 1BBDH 1RJCA 4B41A 5CBAA 4LHUA 4GOSA 1EXUA 5EC1A 4NRXB 1F5WA 4G43B 5EBLA 5MP6L 1OLLA 3RUGF 4AMKH 4Z78A 3MGAA 1HH6B 2R0WL 3K0WA 3EOYG 4H8WL 2JELL 4OD3L 3MPCA 3G6JA 5A2LH 1AP2B 4ODSH 4OF8A 3RWCB 8FABB 2YPKA 4UNVA 3OF6A 5HHME 4PY7B 1WFTA 3C5JB 1OT2A 5HY9A 5TH2B 1L9NA 4POUB 3RVXD 5JUEH 5F9OH 3TBTB 4N1HB 4OFKA 4LQFH 2A9NL 4OSUL 4AMKL 2PTTB 4HJGA 4XCNB 4JZNB 4RAUB 3C8KB 2VLKE 5IEHA 5E95B 2ZSVA 5DQDH 2PNDA 2VZ1A 1U91A 2M8XA 4WWKB 5I73C 2Z91B 4N90E 1H3UA 4BFIA 2P8MB 3IFOB 2FX9H 1LWRA 5C0AD 5HGAA 3UPCA 3BXNA 3A67L 4PGBA 4FQPA 4KK6C 3AREC 3IXTA 2SEBB 5DO2D 1BFSA 1FC2D 4J3TA 1MFDH 5HGAB 5JZ7C 3B9KA 4F9LC 5DXWA 4OFYD 4JO3H 4RZCB 3P30L 3IU4H 5HBBA 3DV4A 5IFJA 3EFDL 3BGFB 1VFBA 4GBXA 2MFNA 2AVGA 1YN6B 2MKLC 3CC5B 4FQ1H 4M4PA 4UQ3A 4AEHH 1FRGH 4OCNC 4PRIE 2FIRT 3RVTC 2QHLA 1KLFA 3CDGA 1ULVA 5T33L 3QIWA 1FVDB 5C0BA 5GS1C 2EXWC 3S8WA 3WDHA 4XB7A 1BM3L 1IC5L 3C6LC 1UQSB 1TQBC 4KJYA 4LKXA 3SCMC 2YC1B 4EVNA 5DSCB 5DMYA 2GJ6E 3W11C 1R5VA 5LAXB 2X70B 3TJEH 4PLNC 1RZFH 5D5MA 3IGAA 15C8L 1ZWIB 4IDJH 1LEIA 3UPRB 3HR5A 1DSFH 1HSAA 2XNAB 4RWYH 4TQEL 1N6QH 1YJDH 4WHTA 4GKZA 4QXUH 2YKLH 5DMIL 3E3QE 2R2EA 25C8L 1I1AC 2ICWA 3CFEB 1L0QA 2DMBA 2UY6A 3IGAB 4HK0A 1KCRL 1XFPA 3Q6GL 3QUMH 5I1AB 2IQAA 2OSLB 4NCDA 2NR6C 4OCLC 1CGVA 5HHOB 5DWUL 4P3CL 4M8QA 4K7PY 3VH8G 3SDCB 4BH7B 5GXBB 3UTQA 1GC1L 4V2BA 3S5LA 5KZCB 1HYSC 2BHZA 4HDIA 1G7JA 2PW1A 3W0WB 3MODL 2E5EA 3GMOA 3ET9F 2DICA 3F7YA 5DJ2B 5DHYA 1NAMB 4X83A 4XCFL 5KSBB 2D0FA 1RIUL 1UCBL 5F9OL 3S5LB 3VA2C 4WV1A 1OD7A 5B4MC 1G7JB 4RIRA 4YAQB 5GJTH 3RUGE 2VDOL 5D7IE 1S7UA 5D2NC 3GBNH 4XVJH 4O51A 3V4PH 5EU4B 3MLTA 5C0RL 3HNTH 1UXWA 4PJHE 1KIPA 5DQ9B 1J11A 4L3CB 1ZAGA 2R29H 5IEKB 4OFVA 5K9JH 1A9EA 3OKDA 1L6XA 3F7VA 4X9IA 4YFLI 1KPUB 3J8F7 1GOFA 4LDOB 4NQEE 1ZS8A 5I16B 2UY7A 2N7AA 3NVQA 2K9UA 3QUYD 1KFAL 3VDCA 3U0PA 3NFPB 3VFSB 4Z5RB 4P4KB 2Z92B 2JB6B 3D85B 1I9RL 3CLFH 5I1JH 2VLKA 4Y2OA 2L7JA 5J12B 4KUZL 4UIKL 2FHCA 1L4IA 3MGOB 5I18L 2IAMC 3MRCB 2CKBL 3LCYA 3R4DA 4UOW0 3RRQA 5A16B 3BKCH 5GGTH 3RI5K 2W9EL 1NCBL 4YX2H 3IB4A 4X9GA 1AO7E 3CCHA 3JWOH 3QUMB 3ZKXC 5EU3A 3QRGL 3DVNB 4M7JH 1QSFA 1WEJH 2IANE 5CFHA 3UTZB 1XGQA 1VESA 1T3FA 4I0PA 4L29B 1EEUA 1BQLH 1PKOA 5FKAB 2DM7A 2YHGA 5C08D 3U4AA 5ADPL 5L0QC 3QZWA 4CVUA 2WWKT 1L6ZA 4HKXB 2P4AB 1T03L 2V9TA 3KPOB 4JHBA 2UZXB 2F53A 2LTQB 1H3GA 4Z7QE 1FL5A 4KDTC 4MAUL 1KJ3L 3ZE0F 2XI9A 4OBSA 4AL8H 1PEZA 3M1BB 4MB3A 3VFWB 2OMBA 1TITA 4FQLH 1ZHKA 1CIDA 4O2EA 2HMID 1IT9L 1L7IH 1D5BA 3SJVB 5I1JL 2QADB 4J3XA 2VC2L 1OW0A 1AKJB 4U6XA 3GRWA 1S9YA 4JFFE 1EGJL 3V4VL 4LKCA 3VWJB 5I73B 2P44B 3WS3B 2A0LD 1NMBL 2I9LA 3IFNH 4BM7A 4BSWB 5I1EL 3I3EA 4P5TA 5DJXA 3MMEA 4GRWE 4WHTB 5I19H 1AE6H 2D4FA 2BDNH 2HJKB 5EOQL 1G9NL 1WBYB 3AROA 1MY7A 5J1AA 4NNXA 2XWJA 4PJCA 1A6WH 1CICD 3HAEH 1F00I 1KEMH 4JY5L 3V4PL 4HUUA 1QFUH 4NZTH 3DRQA 2JJUA 1D9KD 5K9KB 1CD8A 4U6VL 3GIVA 5EIIB 4PJ7E 4OCRH 2YEZB 2VUOA 3E8UL 1XT5A 3HRZA 3LOWA 1S7RA 4QTHB 2CPCA 5HGGS 1KLGB 5T5FH 1X5JA 4LQ1A 5DVLA 3HCVB 2YEZA 2J5LB 3QIWD 3CUPA 3MR9B 5JOPE 2DD8L 3IU3A 4X5WB 1T22B 4XNQA 1F6AA 1KLUB 4CRPA 4JRXE 5F89A 1OARL 3DGGB 4Q9CA 5BW7C 1JUFB 4IRZL 2CR3A 3EO0B 4LSVH 5KSBF 3AMLA 4X9BA 4RGND 3ARFD 2DS4A 1FIGH 3QDJB 3ARGC 3LKOA 1I7UB 4M61A 3DSFH 4ZUVA 1N3NB 1MCIA 3WHXA 1JWSB 1JV5A 1G6RB 5D8JH 3QQ4B 4DN3L 1I9RH 35C8L 3HNVH 1EO7A 1I7UA 4M61B 1I1YA 2G60L 3CD4A 1AGCB 2VOTA 1P69B 3OKYA 2R0KH 5SWZB 5T3ZD 1G6RA 3RPIA 1DE4A 1A7OH 4W6YB 5T33H 4X6CE 4TUOA 3UAJC 4NHCL 4K9EH 1CXFA 5CJXA 1YDPA 1PFCA 2FEEL 4APQB 4PJIE 1NCCL 5BRZD 3CFDB 4A6YA 5T1KA 5TF0A 1PG7L 1YEEL 3RJDA 4PGJA 3NPSB 1FO0H 4O2FB 4NP4L 1PYWA 3OSKA 5IFHH 5C08B 4XNMA 4P3WA 4Y5VB 2BSRB 4M3KB 4NZDA 4HSQA 3ARWA 3OX8A 3OJ2C 1DFBH 3LQMA 2XWTA 4GXVH 3D69B 3ZHDA 2HKHL 4JFZL 2E6QA 3MZTA 4D9QD 3QUXC 3BWAA 3RWFB 4JREC 4S1RH 1RHFA 4IS6A 3IXAB 2WIMA 4MA1B 4NKOA 3O6FB 3D18B 2DLIA 5DJDA 4ZUWA 1GJIA 4YHIA 4DZ8A 4F15B 2V2TA 3GJFA 4Y19E 3V6ZA 2FIKB 2BSED 1MCNA 2FBJH 1Z6JT 1JWUB 1WICA 5FYKU 1GPOL 3ZTNH 2A9NH 4OSUH 1EJOH 5JHDD 3ZYIA 1YNKL 3VCLB 3NACH 2HKFL 3GSUA 4OF6A 3MNVA 3LEVH 3AVEA 4KH2A 2IFGA 3L9RA 3PWNB 3DECA 3KLAA 1T2QL 4QTIH 1IKFL 3VWKB 2EIZB 2XXCB 3UTOA 3V5KB 1ZSDB 4X99A 3QUZC 2XWJB 2XZCL 4PJCB 5EZJB 5FUOL 3IDNB 5KG9B 1DLFH 3B83A 1UH3A 2XKNB 5MP6H 4PG9B 3CDFA 5C0JA 1IE5A 1YMHB 4G42A 4HBQA 2GJJA 2DQHH 4LVHC 4BH8B 1QKZL 4XWOC 2CRZA 5MHSD 4JRXB 5I71B 4U1SA 3O45A 4FG6C 3RDTC 2GTWA 3U7AA 4NZRH 2BNQB 2IFFH 2CRIA 3K81A 3QFJA 2EC8A 1AGFA 5I8OL 4PJ9B 3GSVB 1P1ZB 3FQUA 1CDHA 3VFOB 2EDJA 5M94B 5HYJE 1KIRA 2OK0H 5GS2D 1XGUA 4KXZH 5L2JA 3FB7B 5FDWB 4Y4HC 4PD4K 4YFLF 5I1DB 1YYML 3HPJA 5CP3H 1XEDA 3RZCA 3DBXA 4L4TA 3NIDF 1I8LC 1YNLL 1V7ML 3UTPE 1E4XH 1S7QB 4E0RB 4M02A 4QHNA 3FB7A 5FDWA 4LNRB 5ITFB 4K7PL 1YNTB 5D5MF 1KV3A 2AEQL 3GK8L 3GGWA 4L4VD 4YUEH 3TJHD 1MJJB 2ZUXA 4GW1B 4ELKA 1U92B 4HMDA 1DQDH 4L8SB 3RNKA 1IGIH 4HW6A 1WCBA 1U8QA 2ZG2A 1FZMB 4H1LB 3RNQB 3MROA 2ILLA 4P2QB 3RIFF 5L2KB 1MJ8L 1A9BA 3MBXH 1WWCA 3T0EE 3LZFL 5HI3D 1DVFB 2X44D 4N0CC 2DQUL 3H3PH 1YY9C 1P7QD 4G8EA 3PDGA 1I7RA 5TE4L 5F1IB 4KQ4H 1N8ZA 5L0QB 1T7XA 1DBKH 3MO1B 1S7VA 3MRKB 1PY4A 3W9DB 1J05A 3Q48A 1U8HA 3UTSB 1U0QA 1N4XL 3VGAC 4BFBD 4JFFB 2XN9A 5KAQG 1FNGA 5L6YL 3C9NA 1UFUA 1S7TB 2OZ4L 3FO9B 3O2WL 3QUXB 3MRLB 2V7HB 4LRIC 1PLGH 4E41D 3B6SB 5EB9A 3IF1A 2YPVH 4JN1L 4M1DH 4EN3A 4KROC 1A6VH 2HFEA 2J4WL 2IANA 3MSPA 3AM8A 4GAYA 3TEUA 1DN2A 2EIEA 3W0WD 3DNKA 1RK0B 2HT2C 5KOVC 2HRPH 4G5ZL 1P4LA 2XZQH 3AMKA 5HHVH 3ARDB 5A3ID 4EI6A 5FCUL 3ZL4H 5HHQB 1TPXC 1CZ8H 3HNSH 5DMGD 3SDCD 4EN3B 3OKEB 1BOGA 3FO2B 3KVQA 3UX9B 5MERA 1NJ9A 2XKUA 3BPLC 2ARWA 3HG1B 4K3JH 5HHNB 1BEYH 3SDDD 1GH7A 1XGYL 5FGBA 4YR6A 1VGEH 3T4YA 1MIML 4OI9A 4PRDA 2VDRH 1IGML 2OJZH 3VXPA 4OZIF 4PV8B 3FO2A 5FB8A 3FOLB 2R23B 5FKPB 4HZLB 4KPHL 5IK3A 2QQLL 2EDTA 1B2WH 1OGAB 4LSQL 3MRQA 1T1XA 5IB1A 4M93C 1V8HA 4U1LA 1L7TL 5D1XD 1NFIA 2A2QT 3I2CH 4HPOL 2X4OA 1AGBB 5ALBH 5HD8D 3EOTH 1EFXD 1KCUL 2EYTA 3GSNH 5DURB 1INDL 2Q8AH 4P99A 1I9EA 4OGAC 1B9ZA 2MPAH 4J23A 3P4MB 3E6HA 3T1FA 1UJTA 1ERNA 2VZVA 1H5BA 1A6ZA 3VFUB 3P9MA 3UTTD 2XG5A 5