4QOZC

Crystal structure of the histone mrna stem-loop, stem-loop binding protein (phosphorylated), and 3'hexo ternary complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
73
structure length
72
Chain Sequence
DFETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPKPNKFKKYSRRSWDQQIKLWKVALHFWDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords histone mRNA stem-loop
publication title Molecular mechanisms for the regulation of histone mRNA stem-loop-binding protein by phosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna/hydrolase/rna binding protein
total genus 22
structure length 72
sequence length 73
ec nomenclature
pdb deposition date 2014-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15247 SLBP_RNA_bind Histone RNA hairpin-binding protein RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1120 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4qozC00
4TUWA 4QOZC 4L8RC
chains in the Genus database with same CATH superfamily
1N36M 2V1CA 5EP1A 1PM5A 3HZJA 3QYEA 3RGSA 3V76A 4LF6M 3RGPA 4GKJM 4LRTA 4AKGA 4LG2A 2KNZA 2C99A 2V1UA 3NWLA 3T6PA 2M60A 2ZAMA 4R71A 3QYBA 1Q39A 5FTLA 2R0IA 1OAIA 2KXEA 3U61A 1PJJA 1HT1E 3KFUG 3B7NA 3L28A 4KODA 3SARA 2LVOC 4ITQA 3AOEA 1QZMA 3MHVC 1PJIA 4L78A 4NXNM 3KW6A 1L1TA 4JI1M 4LJ9A 1XXHB 2CP8A 3VK8A 2J5YA 2G3QA 4BB9A 4XBOA 2AHMA 3FYDA 2DZOB 3C3DA 4L16A 2YFQA 3KS4A 4LY6A 2O5RA 3MJ5A 2R44A 3SAVA 1UM8A 4GIPA 2FNAA 2JY6B 1TF0B 2LNHC 1YLAA 4DUZM 2QBYB 2KDLA 5FTNA 1TH3A 3B9PA 3RE8A 3FUTA 1IY0A 3T15A 2UUAM 4LFCM 3GLGE 3SBJA 4Y28F 3GLHA 2YR0A 4G4OA 3GLGA 2DWLA 2FE8A 4M0WA 1G8PA 2LVPC 3KSXA 4G4RA 2CWBA 5JI2E 2F5PA 1GKIA 4FCWA 4DV4M 2KNVA 3FTDA 2UXBM 4LF4M 1IY2A 3BBZA 2DZNB 3ILKA 1Y8GA 3C58A 2L4FA 4CJ6A 3BXWA 4IJFA 2L2DA 3SAUA 3U6EA 3D8LA 1W5SA 2Y20A 3LQRA 3SC3A 4LJ5A 3FTEA 3FUVA 3HKPA 4RF0A 2VF7A 4QOSA 1OAOC 1A5TA 1NJFA 2R18A 1DGFA 1WHCA 3GO8A 4LZZA 3HJSA 1EIJA 1OJLA 3E4RA 1J5EM 3B7QA 2Y0TA 1MU5A 3U61B 2JA2A 4LJ8A 2DWNA 1E9RA 3EIEA 2N35A 1KSFX 2UUCM 3LQQA 4IBKA 2BJWA 3L2AA 4W5WA 1XXHE 4RF1A 2CHQA 3SASA 2LTUA 2Y21A 3JR4A 1XXHA 2GQFA 1WIVA 4AW4A 3H4MA 3K9PA 4HLQA 2JY8A 4LGMA 1YSYA 3GLFA 4XGIA 5EQTA 1J7KA 5C1BA 2EO2A 4I4LA 1DGHA 2L7HA 3SFZA 3VK7A 1FJGM 3KSJA 4MGHA 5FTKA 3HJ8A 3SYKA 2KRUA 3LVVA 4DR4M 1XNQM 1PJSA 2QHOB 1E94E 1JR3E 2KZUA 3AV0A 3SAWA 4YHHM 1NO1A 2QBYA 2DWZB 5FSWA 1NHGC 4LGYA 1L1ZA 2QZ4A 2ZTCA 2D7HA 1DO0A 1ZQ9A 5EP2A 4DV1M 2QSFX 3FTCA 3EIHA 4L6V6 4DR3M 4AQYM 1GJSA 3R9XB 1ZMVA 3TQSA 2F5NA 2K0BX 2VDBB 3VKGA 2L09A 2O25A 3J81S 3U6DA 2DAIA 4P16A 4BBAA 8CATA 1QZEA 4OU7A 4LF9M 1NNJA 2JY5A 1D2NA 2JUJA 3LCVB 1K3XA 4LF8M 2B3TA 4LJ7A 4II7A 5IT9S 5DNYA 4JI8M 4DR7M 3TE6A 2LVQD 3GQ3A 2G5GX 4MGIE 3B7ZA 3GRRA 1Z5BA 4B08A 3VKHA 4B3SM 2FH0A 4OVZB 2KW0A 2JWSA 4PD2A 3C9PA 5KQDA 2I7PA 2XSZD 4L4UA 2DI0A 4R7GA 5EXXA 1IXZA 1V92A 4MB7A 1OKSA 5GKNA 3THGA 5ITTA 1Z6TA 3NBIA 2L6OA 2QNJA 3I04M 3GLIA 3W67A 4KO8A 4GC9A 1JR3D 5JI3E 4DR1M 3CF0A 3VDUA 2CHGA 2LHCA 4M9SA 4NSOB 4MH0E 4XK8F 4B3TM 2MGWA 3Q8XA 5BPVA 1G71A 2UUBM 2C9OA 1VDDA 2MJ5B 2JP7A 3KXEC 1I4WA 3DFZA 3I4YA 1XMOM 1R2YA 3DZDA 1NV9A 4L8RC 1TH2A 2YNMD 4GKKM 1VEJA 1ZV1A 1VDLA 5LMUM 1H6UA 3C3EA 1N77A 5DFLA 4JXJA 2KRKA 1EFUB 2XLJA 3U6MA 4X62M 5ITXE 1K82A 4JI5M 3MMPA 5IZ7D 1AUAA 2C5RA 4F2LA 1QQWA 3HU2A 5ITXA 2E5LM 4DUYM 3GPUA 3A42A 3FKEA 1Z59A 1KYIA 2C9CA 3CGWA 4I8OA 3T38A 2XZUA 3LCUA 2NQ8C 2Z7JA 2HAKA 4LRSA 1R2ZA 2DWMA 4NL4H 2CV1A 1Q3BA 1NHWC 2QP9X 1XC8A 4KHPM 3W68A 1VG5A 3U5ZA 4M9ZA 2CFOA 4QHSA 1SXJC 3ZC7B 4CISA 3U6CA 1NY6A 4LJ6A 4JI0M 2XF3A 3FTFA 3HWSA 2J7NA 4MGYE 1R6BX 1C1KA 4GEWA 4LJ4A 2ZTDA 4WP2A 3CF2A 3U6LA 1VEGA 5EP3A 4GC5A 1G4AE 1YUBA 2K6BA 2LVAA 3OTOM 2VQEM 2W82A 4IBGA 5L8RF 3UJNA 1LTMA 1KFVA 3LVWA 1L2BA 2DHRA 3TPZA 4EIWA 2RRUA 4PDGA 4CGYB 2QPAA 1PJQA 3KDSE 4QOZC 1TR8A 4QNMA 3KOZE 3F92A 3I51A 3ZCBB 3ZQJA 4DV0M 4JYAM 3QAUA 3HHWA 3PFIA 1Z5CA 3VDPA 2VQFM 1YE9A 2CE7A 1X37A 3KP1E 5DYIA 2A5YB 4I81A 2HWJA 4FCVA 3LMMA 1XMQM 1IFYA 2EUCA 1WJ7A 5FLXS 2VF8A 4UN2B 3LW5F 1D0MA 3L25A 1QVRA 3H4JA 1ORYB 1QUSA 2HKJA 3E46A 3UK6A 1QUTA 2DAEA 2RGOA 1GL6A 2ERCA 4CIZA 4TUWA 2OPFA 1XHBA 2WSFF 3E9SA 2XZFA 4AKHA 3M6AA 2HCBA 4G6ZA 3FYCA 1QAQA 1E32A 4PCZA 3NBXX 3PXGA 2J7OA 1R7RA 5EXPA 1ZMUA 3QWLA 3A45A 5FTMA 3U6QA 2XH9A 4OX9M 3CF6E 4FWGA 2DAMA 1G41A 2DHYA 1CUKA 4QNRA 3E21A 4G4NA 4DR6M 1IN8A 3K92A 2CEAA 4IBEA 1OTRA 2ZAOA 1QANA 4LCBA 1DV0A 4B7GA 3HU1A 1K3WA 4B7FA 3HHZA 1SXJE 2Z8YM 3ZH9B 4IBFA 2DZLA 5ITRA 2Y0QA 5FTJA 1HNZM 3UMMA 4GH9A 3TL4X 1MJGM 1HNXM 3J7AS 2EKFA 2ZBKB 5EJCA 1QYRA 1JR3A 3L29A 1OIPA 4X66M 1WGNA 3VFDA 2DENA 1TTEA 2DKLA 4GMQA 3DOAA 4F1IA 2K9DA 1G59A 1N33M 4DV6M 4AG5A 3GPYA 3Q8GA 2LVNC 2XEPA 4NRWA 5C18A 3SMSA 3UZUA 2Z4SA 1J09A 3W0FA 2DNAA 3HY5A 5IREB 3HHYA 2CV0A 4DR2M 5EXSA 2EKKA 4LF7M 2EJSA 3AOGA 3HJQA 1QDRA 4FW9A 4AI6A 2C98A 1PGYA 4ZPXA 4B3MM 3I01M 4G3OA 4LFBM 3UGJA 4MGKE 3KS8A 2JZ1A 2UXDM 1JQJC 2DAKA 2L7IA 4FWHA 2D7EA 1QAMA 2FOIC 2OO9A 3AFHA 3FRIA 3FUUA 2YQZA 1Q3CA 1Z5AA 2BWBA 4MGZE 4L15A 2KHHA 1N34M 2KNAA 1SXJD 1D0KA 2BJVA 1PJTA 2V6ZM 4LFAM 3JAMS 5A2QS 3T1YM 4PT5A 2R65A 2QENA 2OOBA 1VQ1A 1HT2E 3KOXE 4QHTA 4CHTB 4HL4A 3HU3A 3MK6A 5E26A 1N32M 2RKOA 3GRUA 4IBJA 3GQ5A 2UU9M 1PRBA 1NVMA 4IBIA 5KQ8A 1GLNA 1TDHA 1IN5A 3CTWB 1IN4A 4NC6A 1LV7A 5KPZA 3IECA 3IHPA 4FVMA 1XNRM 2O01F 2QCUA 2H1RA 3SATA 4FCTA 2R4EA 3W0LB 4I5SA 2ZANA 1IXRC 2MR9A 4D80A 1N75A 1IY1A 2UXCM 4OW0A 1IBLM 4FD2A 4NOOB 5ITYA 1GVNA 3GPPA 3KOWE 1OFIA 5EXTA 3HHXA 2KA6B 4GRIA 1L2DA 1HQYE 2XFSA 1IM2A 1OQYA 5H37D 3KP0E 5F3WA 1SXJB 3FE3A 1DGGA 3K1JA 1HNWM 2KZSA 1L8QA 1T6OA 3U60B 2XFTA 4DBGB 4YY3M 1VEKA 4DV7M 2WZJA 1IBKM 4BLCA 3M7GA 1XB2B 5IWAM 1XWIA 3HX3A 4Q7JA 4ANRA 5E6JA 4JV5M 3KVWA 4IJEA 1S3SA 2F5SA 3SMPA 1R5LA 2CHVA 2C96A 4OVZA 2OQ4A 4B7HA 5LMNM 1IN7A 1DO2A 1ZMWA 2LH0A 4P17A 1IXSB 3WHKA 3GLFB 4JI4M 2R6FA 1DGHB 1TGUA 1T3TA 5BR8M 3TWLA 4AG6A 4PDIA 1UFZA 2I7NA 5KO3A 1L2CA 1NY5A 1V33A 2JY7A 2RGHA 4S12A 1JB0F 2R4JA 3R8FA 4D82A 4RNAA 1TDZA 4M0DA 1MN3A 3GLHE 1RU3A 3HGIA 4KLNA 3K8ZA 1T43A 3J80S 3U6PA 1OIZA 1WR1B 4JN6A 4WW0A 4Z6YA 1NNUC 2X4AA 3FRHA 2F5OA 2K47A 2BWEA 4B3RM 3J7BA 4IBBA 3AKZA 3I4VA 4LJAA 2R62A 5DYGA 2ZM6M 2CRUA 1W5TA 1G3IA 1WGLA 3L27A 3TWKA 2QQ8A 4M9XA 2JZ0A 3SYLA 3M0EA 2G8LA 4Z8XA 4DV2M 2XSZA 1SXJA 3VLFB 3DA1A 1MX0A 2FFJA 2LHGA 3SHFA 3U60A 7CATA 2APLA 3GP1A 1P3QQ 1ZAEA 3GLIB 1GABA 2EA0A 1C7YA 2KEBA 4MM3B 3T1HM 2MH8A 4RKUF 1EE8A 1TH4A 3BOSA 3SHGB 4X64M 3GLFE 3U6SA 2Q2EB 2D7GA 2WSCF 2DXIA 2DVWB 2LBCA 2HHHM 1IXSA 4AZFA 1NJGA 3TWMA 2L4EA 1D0LA 4X65M 4NXMM 2X49A 4AKIA 4NRVA 2WSEF 5KPRA 2H5XA 4JI2M 1GO5A 4DV3M 2GNOA 4IBDA 2X8AA 4REZA 3JR5A 4GHLA 1E9SA 1NV8A 2JNHA 4K0KM 2CUZA 3U6OA 3B89A 4FWDA 2Z3XA 4GITA 2MROB 3AOEC 3A98B 1OFHA 4JI7M 1FNNA 3KOYE 1F4IA 2LWXA 2P5TA 4R3DA 3PVSA 2F5QA 4A3VB 2JXNA 1AIPC 1WXQA 5EP4A 2XGNA 3D8BA 4IIWA 1I94M 5KPTA 3U5ZB 4D81A 3FUXA 1IBMM 4WURA 3AJIB 4JI3M 4KT0F 3WHLA 3GQ4A 3PNVA 3B74A 1HR0M 4DR5M 3FUWA 4HEOA 2OOAA 3A46A 1HJPA 1NSFA 5ITUA 4LF5M 3RFWA 4G4QA 3J2PB 1IN6A 2FS1A 1SG9A 1R4GA 2R46A 2Z4RA 1IQPA 1DGBA 1QDTA 3GLHB 3IG8A 3IG5A 3J27B 4NSRA 3GLGB 3FD9A 2HL7A 2VIIA 2DAGA 2M5ZA 3GLIE 3L26A 1QAOA 3K9OA 2BNKA 2R45A 3GRYA 1GL7A 4GHAA 4IBCA 3K2LA 4JI6M 3GPXA 2LXEA 1BVSA 4DV5M 4LZJA 5ITQA 1N78A 2F4VM 1HQCA 1V34A 3GRVA 2CV2A 3PNYA 1GJTA 3AL0C 1Q02A
chains in the Genus database with same CATH topology
1N36M 2V1CA 5EP1A 1PM5A 3RGSA 4LF6M 3RGPA 4GKJM 4LRTA 4AKGA 4LG2A 2C99A 2V1UA 3NWLA 2M60A 2ZAMA 1Q39A 5FTLA 2KXEA 1PJJA 1HT1E 3KFUG 3L28A 4KODA 3SARA 4ITQA 3AOEA 1QZMA 3MHVC 1PJIA 4L78A 4NXNM 3KW6A 1L1TA 4JI1M 4LJ9A 1XXHB 3VK8A 4BB9A 4XBOA 2AHMA 3FYDA 2DZOB 4L16A 2YFQA 3KS4A 4LY6A 2O5RA 3MJ5A 3SAVA 1UM8A 4GIPA 2FNAA 2LNHC 4DUZM 2QBYB 5FTNA 3RE8A 1TH3A 3B9PA 3T15A 3FUTA 1IY0A 4LFCM 2UUAM 3SBJA 3GLHA 2YR0A 4G4OA 3GLGA 2DWLA 2FE8A 4M0WA 1G8PA 3KSXA 4G4RA 5JI2E 2F5PA 1GKIA 4FCWA 4DV4M 3FTDA 2UXBM 4LF4M 1IY2A 3ILKA 2DZNB 3C58A 4IJFA 3SAUA 3U6EA 3D8LA 1W5SA 2Y20A 3LQRA 3SC3A 4LJ5A 3FTEA 3FUVA 3HKPA 4RF0A 4QOSA 1NJFA 2R18A 1DGFA 3GO8A 4LZZA 3HJSA 1OJLA 3E4RA 1J5EM 2DWNA 2Y0TA 1MU5A 3U61B 2JA2A 4LJ8A 1E9RA 3EIEA 1KSFX 2UUCM 3LQQA 4IBKA 2BJWA 3L2AA 4W5WA 4RF1A 2CHQA 3SASA 2Y21A 3JR4A 1XXHA 4AW4A 3H4MA 4HLQA 4LGMA 1YSYA 3GLFA 4XGIA 5EQTA 1J7KA 5C1BA 2EO2A 4I4LA 1DGHA 2L7HA 3SFZA 3VK7A 1FJGM 3KSJA 4MGHA 5FTKA 3HJ8A 3SYKA 2KRUA 3LVVA 4DR4M 1XNQM 1E94E 2KZUA 3AV0A 3SAWA 4YHHM 2QBYA 2DWZB 5FSWA 1NHGC 4LGYA 1L1ZA 2QZ4A 2D7HA 1DO0A 1ZQ9A 5EP2A 4DV1M 3FTCA 3EIHA 4DR3M 4AQYM 3R9XB 3TQSA 2F5NA 3VKGA 2L09A 3J81S 3U6DA 4P16A 4BBAA 8CATA 4OU7A 4LF9M 1NNJA 1D2NA 1K3XA 4LF8M 4LJ7A 4II7A 5IT9S 5DNYA 4JI8M 4DR7M 3TE6A 3GQ3A 2G5GX 4MGIE 3GRRA 1Z5BA 4B08A 3VKHA 4B3SM 4OVZB 2KW0A 4PD2A 5KQDA 2I7PA 2XSZD 4L4UA 4R7GA 5EXXA 3THGA 1IXZA 4MB7A 5GKNA 5ITTA 3U61A 3GLIA 1Z6TA 3NBIA 2L6OA 4KO8A 4GC9A 1JR3D 5JI3E 4DR1M 3CF0A 3VDUA 2CHGA 4M9SA 4NSOB 4MH0E 4B3TM 5BPVA 3Q8XA 2UUBM 2C9OA 1VDDA 3KXEC 1I4WA 3DFZA 3I4YA 1XMOM 1R2YA 3DZDA 4L8RC 1TH2A 2YNMD 4GKKM 5LMUM 1H6UA 1N77A 4JXJA 2KRKA 2XLJA 3U6MA 4X62M 5ITXE 1K82A 4JI5M 5IZ7D 2C5RA 1QQWA 3HU2A 5ITXA 2E5LM 4DUYM 3GPUA 3A42A 3FKEA 1Z59A 1KYIA 2C9CA 3T38A 4I8OA 2XZUA 2NQ8C 2Z7JA 4LRSA 1R2ZA 4NL4H 2CV1A 1Q3BA 1NHWC 2QP9X 1XC8A 4KHPM 3U5ZA 4M9ZA 2CFOA 4QHSA 1SXJC 3ZC7B 4CISA 3U6CA 1NY6A 4LJ6A 4JI0M 2XF3A 3FTFA 3HWSA 2J7NA 4MGYE 1R6BX 1C1KA 4LJ4A 3U6LA 3CF2A 5EP3A 4GC5A 1G4AE 1YUBA 3OTOM 2VQEM 2W82A 4IBGA 3UJNA 1KFVA 3LVWA 1L2BA 2DHRA 3TPZA 4EIWA 4PDGA 4CGYB 2QPAA 3KDSE 4QOZC 4QNMA 3KOZE 3I51A 3ZCBB 4DV0M 4JYAM 3QAUA 3HHWA 3PFIA 1Z5CA 3VDPA 2VQFM 1YE9A 2CE7A 1X37A 3KP1E 5DYIA 2A5YB 4I81A 4FCVA 3LMMA 1XMQM 2EUCA 5FLXS 3L25A 1QVRA 1ORYB 2HKJA 3UK6A 2RGOA 1GL6A 2ERCA 4TUWA 2OPFA 1XHBA 2XZFA 3E9SA 4AKHA 3M6AA 2HCBA 4G6ZA 3FYCA 1QAQA 1E32A 4PCZA 3PXGA 2J7OA 1R7RA 5EXPA 3QWLA 3A45A 5FTMA 3U6QA 2XH9A 4OX9M 3CF6E 4FWGA 1G41A 4DR6M 4QNRA 4G4NA 1IN8A 3K92A 2CEAA 4IBEA 2ZAOA 1QANA 4LCBA 4B7GA 3HU1A 1K3WA 4B7FA 3HHZA 1SXJE 3ZH9B 4IBFA 2DWMA 5ITRA 2Y0QA 5FTJA 1HNZM 3UMMA 4GH9A 3TL4X 1HNXM 3J7AS 2ZBKB 5EJCA 1QYRA 1JR3A 3L29A 4X66M 3VFDA 4GMQA 1N33M 3DOAA 1G59A 4DV6M 4AG5A 3GPYA 2XEPA 4NRWA 5C18A 3SMSA 3UZUA 2Z4SA 1J09A 3W0FA 5IREB 3HHYA 2CV0A 4DR2M 5EXSA 4LF7M 3AOGA 3HJQA 4FW9A 4AI6A 2C98A 4ZPXA 4B3MM 4LFBM 3UGJA 4MGKE 3KS8A 2UXDM 1JQJC 2L7IA 4FWHA 2D7EA 1QAMA 2FOIC 3AFHA 3FUUA 2YQZA 1Q3CA 1Z5AA 4MGZE 4L15A 1N34M 1SXJD 2BJVA 2V6ZM 4LFAM 3JAMS 5A2QS 3T1YM 4PT5A 2R65A 2QENA 1HT2E 3KOXE 4QHTA 4CHTB 4HL4A 3HU3A 3MK6A 5E26A 1N32M 2RKOA 3GRUA 4IBJA 3GQ5A 2UU9M 1NVMA 4IBIA 5KQ8A 1GLNA 1TDHA 1IN5A 3CTWB 1IN4A 1LV7A 5KPZA 1XNRM 4FVMA 2QCUA 2H1RA 3SATA 4FCTA 2R4EA 3W0LB 4I5SA 2ZANA 1IXRC 4D80A 1N75A 1IY1A 2UXCM 4OW0A 1IBLM 4FD2A 4NOOB 5ITYA 1GVNA 3GPPA 3KOWE 1OFIA 5EXTA 3HHXA 2KA6B 4GRIA 1L2DA 1HQYE 2XFSA 1IM2A 5H37D 3KP0E 5F3WA 1SXJB 1DGGA 3K1JA 1HNWM 2KZSA 1L8QA 3U60B 2XFTA 4YY3M 4DV7M 1IBKM 4BLCA 3M7GA 5IWAM 1XWIA 5E6JA 4JV5M 3KVWA 4IJEA 1S3SA 2F5SA 3SMPA 2CHVA 4OVZA 2C96A 2OQ4A 4B7HA 5LMNM 1IN7A 1DO2A 2LH0A 1IXSB 3WHKA 3GLFB 4JI4M 1DGHB 1TGUA 1T3TA 5BR8M 3TWLA 4AG6A 4PDIA 2I7NA 5KO3A 1L2CA 1NY5A 4S12A 2RGHA 2R4JA 3R8FA 4D82A 4RNAA 1TDZA 4M0DA 3HGIA 4KLNA 3K8ZA 3J80S 3U6PA 4JN6A 4WW0A 4Z6YA 1NNUC 2X4AA 2F5OA 2K47A 4B3RM 3J7BA 4IBBA 3AKZA 3I4VA 4LJAA 2R62A 5DYGA 2ZM6M 1W5TA 1G3IA 3L27A 3TWKA 4M9XA 3SYLA 3M0EA 2G8LA 4Z8XA 4DV2M 2XSZA 1SXJA 3VLFB 3DA1A 1MX0A 2FFJA 3SHFA 3U60A 7CATA 3GP1A 1ZAEA 3GLIB 2EA0A 2KEBA 4MM3B 3T1HM 1EE8A 1TH4A 3BOSA 3SHGB 4X64M 3U6SA 2Q2EB 2D7GA 2DXIA 2DVWB 2HHHM 4AZFA 1NJGA 3TWMA 4X65M 4NXMM 2X49A 4AKIA 4NRVA 5KPRA 4JI2M 4DV3M 3JR5A 4IBDA 2X8AA 4REZA 4GHLA 1E9SA 4K0KM 2CUZA 3U6OA 4FWDA 2Z3XA 4GITA 3AOEC 3A98B 1OFHA 4JI7M 1FNNA 3KOYE 2LWXA 2P5TA 4R3DA 3PVSA 2F5QA 4A3VB 5EP4A 1WXQA 2XGNA 3D8BA 4IIWA 1I94M 5KPTA 3U5ZB 4D81A 3FUXA 1IBMM 4WURA 3AJIB 4JI3M 3WHLA 3GQ4A 3PNVA 1HR0M 4DR5M 3FUWA 3A46A 1NSFA 5ITUA 4LF5M 3RFWA 3J2PB 1IN6A 4G4QA 2R46A 3IG5A 2Z4RA 1IQPA 1DGBA 3GLHB 3IG8A 3J27B 4NSRA 3GLGB 3FD9A 2HL7A 2VIIA 2M5ZA 4GHAA 3L26A 1QAOA 2BNKA 2R45A 3GRYA 1GL7A 4IBCA 3K2LA 4JI6M 3GPXA 2LXEA 4DV5M 4LZJA 5ITQA 1N78A 2F4VM 1HQCA 2CV2A 3GRVA 3PNYA 3AL0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TUW A;  4QOZ C;  4L8R C; 
#chains in the Genus database with same CATH topology
 1N36 M;  2V1C A;  5EP1 A;  1PM5 A;  3HZJ A;  3QYE A;  3RGS A;  3V76 A;  4LF6 M;  3RGP A;  4GKJ M;  4LRT A;  4AKG A;  4LG2 A;  2KNZ A;  2C99 A;  2V1U A;  3NWL A;  3T6P A;  2M60 A;  2ZAM A;  4R71 A;  3QYB A;  1Q39 A;  5FTL A;  2R0I A;  1OAI A;  2KXE A;  3U61 A;  1PJJ A;  1HT1 E;  3KFU G;  3B7N A;  3L28 A;  4KOD A;  3SAR A;  2LVO C;  4ITQ A;  3AOE A;  1QZM A;  3MHV C;  1PJI A;  4L78 A;  4NXN M;  3KW6 A;  1L1T A;  4JI1 M;  4LJ9 A;  1XXH B;  2CP8 A;  3VK8 A;  2J5Y A;  2G3Q A;  4BB9 A;  4XBO A;  2AHM A;  3FYD A;  2DZO B;  3C3D A;  4L16 A;  2YFQ A;  3KS4 A;  4LY6 A;  2O5R A;  3MJ5 A;  2R44 A;  3SAV A;  1UM8 A;  4GIP A;  2FNA A;  2JY6 B;  1TF0 B;  2LNH C;  1YLA A;  4DUZ M;  2QBY B;  2KDL A;  5FTN A;  1TH3 A;  3B9P A;  3RE8 A;  3FUT A;  1IY0 A;  3T15 A;  2UUA M;  4LFC M;  3GLG E;  3SBJ A;  4Y28 F;  3GLH A;  2YR0 A;  4G4O A;  3GLG A;  2DWL A;  2FE8 A;  4M0W A;  1G8P A;  2LVP C;  3KSX A;  4G4R A;  2CWB A;  5JI2 E;  2F5P A;  1GKI A;  4FCW A;  4DV4 M;  2KNV A;  3FTD A;  2UXB M;  4LF4 M;  1IY2 A;  3BBZ A;  2DZN B;  3ILK A;  1Y8G A;  3C58 A;  2L4F A;  4CJ6 A;  3BXW A;  4IJF A;  2L2D A;  3SAU A;  3U6E A;  3D8L A;  1W5S A;  2Y20 A;  3LQR A;  3SC3 A;  4LJ5 A;  3FTE A;  3FUV A;  3HKP A;  4RF0 A;  2VF7 A;  4QOS A;  1OAO C;  1A5T A;  1NJF A;  2R18 A;  1DGF A;  1WHC A;  3GO8 A;  4LZZ A;  3HJS A;  1EIJ A;  1OJL A;  3E4R A;  1J5E M;  3B7Q A;  2Y0T A;  1MU5 A;  3U61 B;  2JA2 A;  4LJ8 A;  2DWN A;  1E9R A;  3EIE A;  2N35 A;  1KSF X;  2UUC M;  3LQQ A;  4IBK A;  2BJW A;  3L2A A;  4W5W A;  1XXH E;  4RF1 A;  2CHQ A;  3SAS A;  2LTU A;  2Y21 A;  3JR4 A;  1XXH A;  2GQF A;  1WIV A;  4AW4 A;  3H4M A;  3K9P A;  4HLQ A;  2JY8 A;  4LGM A;  1YSY A;  3GLF A;  4XGI A;  5EQT A;  1J7K A;  5C1B A;  2EO2 A;  4I4L A;  1DGH A;  2L7H A;  3SFZ A;  3VK7 A;  1FJG M;  3KSJ A;  4MGH A;  5FTK A;  3HJ8 A;  3SYK A;  2KRU A;  3LVV A;  4DR4 M;  1XNQ M;  1PJS A;  2QHO B;  1E94 E;  1JR3 E;  2KZU A;  3AV0 A;  3SAW A;  4YHH M;  1NO1 A;  2QBY A;  2DWZ B;  5FSW A;  1NHG C;  4LGY A;  1L1Z A;  2QZ4 A;  2ZTC A;  2D7H A;  1DO0 A;  1ZQ9 A;  5EP2 A;  4DV1 M;  2QSF X;  3FTC A;  3EIH A;  4L6V 6;  4DR3 M;  4AQY M;  1GJS A;  3R9X B;  1ZMV A;  3TQS A;  2F5N A;  2K0B X;  2VDB B;  3VKG A;  2L09 A;  2O25 A;  3J81 S;  3U6D A;  2DAI A;  4P16 A;  4BBA A;  8CAT A;  1QZE A;  4OU7 A;  4LF9 M;  1NNJ A;  2JY5 A;  1D2N A;  2JUJ A;  3LCV B;  1K3X A;  4LF8 M;  2B3T A;  4LJ7 A;  4II7 A;  5IT9 S;  5DNY A;  4JI8 M;  4DR7 M;  3TE6 A;  2LVQ D;  3GQ3 A;  2G5G X;  4MGI E;  3B7Z A;  3GRR A;  1Z5B A;  4B08 A;  3VKH A;  4B3S M;  2FH0 A;  4OVZ B;  2KW0 A;  2JWS A;  4PD2 A;  3C9P A;  5KQD A;  2I7P A;  2XSZ D;  4L4U A;  2DI0 A;  4R7G A;  5EXX A;  1IXZ A;  1V92 A;  4MB7 A;  1OKS A;  5GKN A;  3THG A;  5ITT A;  1Z6T A;  3NBI A;  2L6O A;  2QNJ A;  3I04 M;  3GLI A;  3W67 A;  4KO8 A;  4GC9 A;  1JR3 D;  5JI3 E;  4DR1 M;  3CF0 A;  3VDU A;  2CHG A;  2LHC A;  4M9S A;  4NSO B;  4MH0 E;  4XK8 F;  4B3T M;  2MGW A;  3Q8X A;  5BPV A;  1G71 A;  2UUB M;  2C9O A;  1VDD A;  2MJ5 B;  2JP7 A;  3KXE C;  1I4W A;  3DFZ A;  3I4Y A;  1XMO M;  1R2Y A;  3DZD A;  1NV9 A;  4L8R C;  1TH2 A;  2YNM D;  4GKK M;  1VEJ A;  1ZV1 A;  1VDL A;  5LMU M;  1H6U A;  3C3E A;  1N77 A;  5DFL A;  4JXJ A;  2KRK A;  1EFU B;  2XLJ A;  3U6M A;  4X62 M;  5ITX E;  1K82 A;  4JI5 M;  3MMP A;  5IZ7 D;  1AUA A;  2C5R A;  4F2L A;  1QQW A;  3HU2 A;  5ITX A;  2E5L M;  4DUY M;  3GPU A;  3A42 A;  3FKE A;  1Z59 A;  1KYI A;  2C9C A;  3CGW A;  4I8O A;  3T38 A;  2XZU A;  3LCU A;  2NQ8 C;  2Z7J A;  2HAK A;  4LRS A;  1R2Z A;  2DWM A;  4NL4 H;  2CV1 A;  1Q3B A;  1NHW C;  2QP9 X;  1XC8 A;  4KHP M;  3W68 A;  1VG5 A;  3U5Z A;  4M9Z A;  2CFO A;  4QHS A;  1SXJ C;  3ZC7 B;  4CIS A;  3U6C A;  1NY6 A;  4LJ6 A;  4JI0 M;  2XF3 A;  3FTF A;  3HWS A;  2J7N A;  4MGY E;  1R6B X;  1C1K A;  4GEW A;  4LJ4 A;  2ZTD A;  4WP2 A;  3CF2 A;  3U6L A;  1VEG A;  5EP3 A;  4GC5 A;  1G4A E;  1YUB A;  2K6B A;  2LVA A;  3OTO M;  2VQE M;  2W82 A;  4IBG A;  5L8R F;  3UJN A;  1LTM A;  1KFV A;  3LVW A;  1L2B A;  2DHR A;  3TPZ A;  4EIW A;  2RRU A;  4PDG A;  4CGY B;  2QPA A;  1PJQ A;  3KDS E;  4QOZ C;  1TR8 A;  4QNM A;  3KOZ E;  3F92 A;  3I51 A;  3ZCB B;  3ZQJ A;  4DV0 M;  4JYA M;  3QAU A;  3HHW A;  3PFI A;  1Z5C A;  3VDP A;  2VQF M;  1YE9 A;  2CE7 A;  1X37 A;  3KP1 E;  5DYI A;  2A5Y B;  4I81 A;  2HWJ A;  4FCV A;  3LMM A;  1XMQ M;  1IFY A;  2EUC A;  1WJ7 A;  5FLX S;  2VF8 A;  4UN2 B;  3LW5 F;  1D0M A;  3L25 A;  1QVR A;  3H4J A;  1ORY B;  1QUS A;  2HKJ A;  3E46 A;  3UK6 A;  1QUT A;  2DAE A;  2RGO A;  1GL6 A;  2ERC A;  4CIZ A;  4TUW A;  2OPF A;  1XHB A;  2WSF F;  3E9S A;  2XZF A;  4AKH A;  3M6A A;  2HCB A;  4G6Z A;  3FYC A;  1QAQ A;  1E32 A;  4PCZ A;  3NBX X;  3PXG A;  2J7O A;  1R7R A;  5EXP A;  1ZMU A;  3QWL A;  3A45 A;  5FTM A;  3U6Q A;  2XH9 A;  4OX9 M;  3CF6 E;  4FWG A;  2DAM A;  1G41 A;  2DHY A;  1CUK A;  4QNR A;  3E21 A;  4G4N A;  4DR6 M;  1IN8 A;  3K92 A;  2CEA A;  4IBE A;  1OTR A;  2ZAO A;  1QAN A;  4LCB A;  1DV0 A;  4B7G A;  3HU1 A;  1K3W A;  4B7F A;  3HHZ A;  1SXJ E;  2Z8Y M;  3ZH9 B;  4IBF A;  2DZL A;  5ITR A;  2Y0Q A;  5FTJ A;  1HNZ M;  3UMM A;  4GH9 A;  3TL4 X;  1MJG M;  1HNX M;  3J7A S;  2EKF A;  2ZBK B;  5EJC A;  1QYR A;  1JR3 A;  3L29 A;  1OIP A;  4X66 M;  1WGN A;  3VFD A;  2DEN A;  1TTE A;  2DKL A;  4GMQ A;  3DOA A;  4F1I A;  2K9D A;  1G59 A;  1N33 M;  4DV6 M;  4AG5 A;  3GPY A;  3Q8G A;  2LVN C;  2XEP A;  4NRW A;  5C18 A;  3SMS A;  3UZU A;  2Z4S A;  1J09 A;  3W0F A;  2DNA A;  3HY5 A;  5IRE B;  3HHY A;  2CV0 A;  4DR2 M;  5EXS A;  2EKK A;  4LF7 M;  2EJS A;  3AOG A;  3HJQ A;  1QDR A;  4FW9 A;  4AI6 A;  2C98 A;  1PGY A;  4ZPX A;  4B3M M;  3I01 M;  4G3O A;  4LFB M;  3UGJ A;  4MGK E;  3KS8 A;  2JZ1 A;  2UXD M;  1JQJ C;  2DAK A;  2L7I A;  4FWH A;  2D7E A;  1QAM A;  2FOI C;  2OO9 A;  3AFH A;  3FRI A;  3FUU A;  2YQZ A;  1Q3C A;  1Z5A A;  2BWB A;  4MGZ E;  4L15 A;  2KHH A;  1N34 M;  2KNA A;  1SXJ D;  1D0K A;  2BJV A;  1PJT A;  2V6Z M;  4LFA M;  3JAM S;  5A2Q S;  3T1Y M;  4PT5 A;  2R65 A;  2QEN A;  2OOB A;  1VQ1 A;  1HT2 E;  3KOX E;  4QHT A;  4CHT B;  4HL4 A;  3HU3 A;  3MK6 A;  5E26 A;  1N32 M;  2RKO A;  3GRU A;  4IBJ A;  3GQ5 A;  2UU9 M;  1PRB A;  1NVM A;  4IBI A;  5KQ8 A;  1GLN A;  1TDH A;  1IN5 A;  3CTW B;  1IN4 A;  4NC6 A;  1LV7 A;  5KPZ A;  3IEC A;  3IHP A;  4FVM A;  1XNR M;  2O01 F;  2QCU A;  2H1R A;  3SAT A;  4FCT A;  2R4E A;  3W0L B;  4I5S A;  2ZAN A;  1IXR C;  2MR9 A;  4D80 A;  1N75 A;  1IY1 A;  2UXC M;  4OW0 A;  1IBL M;  4FD2 A;  4NOO B;  5ITY A;  1GVN A;  3GPP A;  3KOW E;  1OFI A;  5EXT A;  3HHX A;  2KA6 B;  4GRI A;  1L2D A;  1HQY E;  2XFS A;  1IM2 A;  1OQY A;  5H37 D;  3KP0 E;  5F3W A;  1SXJ B;  3FE3 A;  1DGG A;  3K1J A;  1HNW M;  2KZS A;  1L8Q A;  1T6O A;  3U60 B;  2XFT A;  4DBG B;  4YY3 M;  1VEK A;  4DV7 M;  2WZJ A;  1IBK M;  4BLC A;  3M7G A;  1XB2 B;  5IWA M;  1XWI A;  3HX3 A;  4Q7J A;  4ANR A;  5E6J A;  4JV5 M;  3KVW A;  4IJE A;  1S3S A;  2F5S A;  3SMP A;  1R5L A;  2CHV A;  2C96 A;  4OVZ A;  2OQ4 A;  4B7H A;  5LMN M;  1IN7 A;  1DO2 A;  1ZMW A;  2LH0 A;  4P17 A;  1IXS B;  3WHK A;  3GLF B;  4JI4 M;  2R6F A;  1DGH B;  1TGU A;  1T3T A;  5BR8 M;  3TWL A;  4AG6 A;  4PDI A;  1UFZ A;  2I7N A;  5KO3 A;  1L2C A;  1NY5 A;  1V33 A;  2JY7 A;  2RGH A;  4S12 A;  1JB0 F;  2R4J A;  3R8F A;  4D82 A;  4RNA A;  1TDZ A;  4M0D A;  1MN3 A;  3GLH E;  1RU3 A;  3HGI A;  4KLN A;  3K8Z A;  1T43 A;  3J80 S;  3U6P A;  1OIZ A;  1WR1 B;  4JN6 A;  4WW0 A;  4Z6Y A;  1NNU C;  2X4A A;  3FRH A;  2F5O A;  2K47 A;  2BWE A;  4B3R M;  3J7B A;  4IBB A;  3AKZ A;  3I4V A;  4LJA A;  2R62 A;  5DYG A;  2ZM6 M;  2CRU A;  1W5T A;  1G3I A;  1WGL A;  3L27 A;  3TWK A;  2QQ8 A;  4M9X A;  2JZ0 A;  3SYL A;  3M0E A;  2G8L A;  4Z8X A;  4DV2 M;  2XSZ A;  1SXJ A;  3VLF B;  3DA1 A;  1MX0 A;  2FFJ A;  2LHG A;  3SHF A;  3U60 A;  7CAT A;  2APL A;  3GP1 A;  1P3Q Q;  1ZAE A;  3GLI B;  1GAB A;  2EA0 A;  1C7Y A;  2KEB A;  4MM3 B;  3T1H M;  2MH8 A;  4RKU F;  1EE8 A;  1TH4 A;  3BOS A;  3SHG B;  4X64 M;  3GLF E;  3U6S A;  2Q2E B;  2D7G A;  2WSC F;  2DXI A;  2DVW B;  2LBC A;  2HHH M;  1IXS A;  4AZF A;  1NJG A;  3TWM A;  2L4E A;  1D0L A;  4X65 M;  4NXM M;  2X49 A;  4AKI A;  4NRV A;  2WSE F;  5KPR A;  2H5X A;  4JI2 M;  1GO5 A;  4DV3 M;  2GNO A;  4IBD A;  2X8A A;  4REZ A;  3JR5 A;  4GHL A;  1E9S A;  1NV8 A;  2JNH A;  4K0K M;  2CUZ A;  3U6O A;  3B89 A;  4FWD A;  2Z3X A;  4GIT A;  2MRO B;  3AOE C;  3A98 B;  1OFH A;  4JI7 M;  1FNN A;  3KOY E;  1F4I A;  2LWX A;  2P5T A;  4R3D A;  3PVS A;  2F5Q A;  4A3V B;  2JXN A;  1AIP C;  1WXQ A;  5EP4 A;  2XGN A;  3D8B A;  4IIW A;  1I94 M;  5KPT A;  3U5Z B;  4D81 A;  3FUX A;  1IBM M;  4WUR A;  3AJI B;  4JI3 M;  4KT0 F;  3WHL A;  3GQ4 A;  3PNV A;  3B74 A;  1HR0 M;  4DR5 M;  3FUW A;  4HEO A;  2OOA A;  3A46 A;  1HJP A;  1NSF A;  5ITU A;  4LF5 M;  3RFW A;  4G4Q A;  3J2P B;  1IN6 A;  2FS1 A;  1SG9 A;  1R4G A;  2R46 A;  2Z4R A;  1IQP A;  1DGB A;  1QDT A;  3GLH B;  3IG8 A;  3IG5 A;  3J27 B;  4NSR A;  3GLG B;  3FD9 A;  2HL7 A;  2VII A;  2DAG A;  2M5Z A;  3GLI E;  3L26 A;  1QAO A;  3K9O A;  2BNK A;  2R45 A;  3GRY A;  1GL7 A;  4GHA A;  4IBC A;  3K2L A;  4JI6 M;  3GPX A;  2LXE A;  1BVS A;  4DV5 M;  4LZJ A;  5ITQ A;  1N78 A;  2F4V M;  1HQC A;  1V34 A;  3GRV A;  2CV2 A;  3PNY A;  1GJT A;  3AL0 C;  1Q02 A; 
#chains in the Genus database with same CATH homology
 1N36 M;  2V1C A;  5EP1 A;  1PM5 A;  3RGS A;  4LF6 M;  3RGP A;  4GKJ M;  4LRT A;  4AKG A;  4LG2 A;  2C99 A;  2V1U A;  3NWL A;  2M60 A;  2ZAM A;  1Q39 A;  5FTL A;  2KXE A;  1PJJ A;  1HT1 E;  3KFU G;  3L28 A;  4KOD A;  3SAR A;  4ITQ A;  3AOE A;  1QZM A;  3MHV C;  1PJI A;  4L78 A;  4NXN M;  3KW6 A;  1L1T A;  4JI1 M;  4LJ9 A;  1XXH B;  3VK8 A;  4BB9 A;  4XBO A;  2AHM A;  3FYD A;  2DZO B;  4L16 A;  2YFQ A;  3KS4 A;  4LY6 A;  2O5R A;  3MJ5 A;  3SAV A;  1UM8 A;  4GIP A;  2FNA A;  2LNH C;  4DUZ M;  2QBY B;  5FTN A;  3RE8 A;  1TH3 A;  3B9P A;  3T15 A;  3FUT A;  1IY0 A;  4LFC M;  2UUA M;  3SBJ A;  3GLH A;  2YR0 A;  4G4O A;  3GLG A;  2DWL A;  2FE8 A;  4M0W A;  1G8P A;  3KSX A;  4G4R A;  5JI2 E;  2F5P A;  1GKI A;  4FCW A;  4DV4 M;  3FTD A;  2UXB M;  4LF4 M;  1IY2 A;  3ILK A;  2DZN B;  3C58 A;  4IJF A;  3SAU A;  3U6E A;  3D8L A;  1W5S A;  2Y20 A;  3LQR A;  3SC3 A;  4LJ5 A;  3FTE A;  3FUV A;  3HKP A;  4RF0 A;  4QOS A;  1NJF A;  2R18 A;  1DGF A;  3GO8 A;  4LZZ A;  3HJS A;  1OJL A;  3E4R A;  1J5E M;  2DWN A;  2Y0T A;  1MU5 A;  3U61 B;  2JA2 A;  4LJ8 A;  1E9R A;  3EIE A;  1KSF X;  2UUC M;  3LQQ A;  4IBK A;  2BJW A;  3L2A A;  4W5W A;  4RF1 A;  2CHQ A;  3SAS A;  2Y21 A;  3JR4 A;  1XXH A;  4AW4 A;  3H4M A;  4HLQ A;  4LGM A;  1YSY A;  3GLF A;  4XGI A;  5EQT A;  1J7K A;  5C1B A;  2EO2 A;  4I4L A;  1DGH A;  2L7H A;  3SFZ A;  3VK7 A;  1FJG M;  3KSJ A;  4MGH A;  5FTK A;  3HJ8 A;  3SYK A;  2KRU A;  3LVV A;  4DR4 M;  1XNQ M;  1E94 E;  2KZU A;  3AV0 A;  3SAW A;  4YHH M;  2QBY A;  2DWZ B;  5FSW A;  1NHG C;  4LGY A;  1L1Z A;  2QZ4 A;  2D7H A;  1DO0 A;  1ZQ9 A;  5EP2 A;  4DV1 M;  3FTC A;  3EIH A;  4DR3 M;  4AQY M;  3R9X B;  3TQS A;  2F5N A;  3VKG A;  2L09 A;  3J81 S;  3U6D A;  4P16 A;  4BBA A;  8CAT A;  4OU7 A;  4LF9 M;  1NNJ A;  1D2N A;  1K3X A;  4LF8 M;  4LJ7 A;  4II7 A;  5IT9 S;  5DNY A;  4JI8 M;  4DR7 M;  3TE6 A;  3GQ3 A;  2G5G X;  4MGI E;  3GRR A;  1Z5B A;  4B08 A;  3VKH A;  4B3S M;  4OVZ B;  2KW0 A;  4PD2 A;  5KQD A;  2I7P A;  2XSZ D;  4L4U A;  4R7G A;  5EXX A;  3THG A;  1IXZ A;  4MB7 A;  5GKN A;  5ITT A;  3U61 A;  3GLI A;  1Z6T A;  3NBI A;  2L6O A;  4KO8 A;  4GC9 A;  1JR3 D;  5JI3 E;  4DR1 M;  3CF0 A;  3VDU A;  2CHG A;  4M9S A;  4NSO B;  4MH0 E;  4B3T M;  5BPV A;  3Q8X A;  2UUB M;  2C9O A;  1VDD A;  3KXE C;  1I4W A;  3DFZ A;  3I4Y A;  1XMO M;  1R2Y A;  3DZD A;  4L8R C;  1TH2 A;  2YNM D;  4GKK M;  5LMU M;  1H6U A;  1N77 A;  4JXJ A;  2KRK A;  2XLJ A;  3U6M A;  4X62 M;  5ITX E;  1K82 A;  4JI5 M;  5IZ7 D;  2C5R A;  1QQW A;  3HU2 A;  5ITX A;  2E5L M;  4DUY M;  3GPU A;  3A42 A;  3FKE A;  1Z59 A;  1KYI A;  2C9C A;  3T38 A;  4I8O A;  2XZU A;  2NQ8 C;  2Z7J A;  4LRS A;  1R2Z A;  4NL4 H;  2CV1 A;  1Q3B A;  1NHW C;  2QP9 X;  1XC8 A;  4KHP M;  3U5Z A;  4M9Z A;  2CFO A;  4QHS A;  1SXJ C;  3ZC7 B;  4CIS A;  3U6C A;  1NY6 A;  4LJ6 A;  4JI0 M;  2XF3 A;  3FTF A;  3HWS A;  2J7N A;  4MGY E;  1R6B X;  1C1K A;  4LJ4 A;  3U6L A;  3CF2 A;  5EP3 A;  4GC5 A;  1G4A E;  1YUB A;  3OTO M;  2VQE M;  2W82 A;  4IBG A;  3UJN A;  1KFV A;  3LVW A;  1L2B A;  2DHR A;  3TPZ A;  4EIW A;  4PDG A;  4CGY B;  2QPA A;  3KDS E;  4QOZ C;  4QNM A;  3KOZ E;  3I51 A;  3ZCB B;  4DV0 M;  4JYA M;  3QAU A;  3HHW A;  3PFI A;  1Z5C A;  3VDP A;  2VQF M;  1YE9 A;  2CE7 A;  1X37 A;  3KP1 E;  5DYI A;  2A5Y B;  4I81 A;  4FCV A;  3LMM A;  1XMQ M;  2EUC A;  5FLX S;  3L25 A;  1QVR A;  1ORY B;  2HKJ A;  3UK6 A;  2RGO A;  1GL6 A;  2ERC A;  4TUW A;  2OPF A;  1XHB A;  2XZF A;  3E9S A;  4AKH A;  3M6A A;  2HCB A;  4G6Z A;  3FYC A;  1QAQ A;  1E32 A;  4PCZ A;  3PXG A;  2J7O A;  1R7R A;  5EXP A;  3QWL A;  3A45 A;  5FTM A;  3U6Q A;  2XH9 A;  4OX9 M;  3CF6 E;  4FWG A;  1G41 A;  4DR6 M;  4QNR A;  4G4N A;  1IN8 A;  3K92 A;  2CEA A;  4IBE A;  2ZAO A;  1QAN A;  4LCB A;  4B7G A;  3HU1 A;  1K3W A;  4B7F A;  3HHZ A;  1SXJ E;  3ZH9 B;  4IBF A;  2DWM A;  5ITR A;  2Y0Q A;  5FTJ A;  1HNZ M;  3UMM A;  4GH9 A;  3TL4 X;  1HNX M;  3J7A S;  2ZBK B;  5EJC A;  1QYR A;  1JR3 A;  3L29 A;  4X66 M;  3VFD A;  4GMQ A;  1N33 M;  3DOA A;  1G59 A;  4DV6 M;  4AG5 A;  3GPY A;  2XEP A;  4NRW A;  5C18 A;  3SMS A;  3UZU A;  2Z4S A;  1J09 A;  3W0F A;  5IRE B;  3HHY A;  2CV0 A;  4DR2 M;  5EXS A;  4LF7 M;  3AOG A;  3HJQ A;  4FW9 A;  4AI6 A;  2C98 A;  4ZPX A;  4B3M M;  4LFB M;  3UGJ A;  4MGK E;  3KS8 A;  2UXD M;  1JQJ C;  2L7I A;  4FWH A;  2D7E A;  1QAM A;  2FOI C;  3AFH A;  3FUU A;  2YQZ A;  1Q3C A;  1Z5A A;  4MGZ E;  4L15 A;  1N34 M;  1SXJ D;  2BJV A;  2V6Z M;  4LFA M;  3JAM S;  5A2Q S;  3T1Y M;  4PT5 A;  2R65 A;  2QEN A;  1HT2 E;  3KOX E;  4QHT A;  4CHT B;  4HL4 A;  3HU3 A;  3MK6 A;  5E26 A;  1N32 M;  2RKO A;  3GRU A;  4IBJ A;  3GQ5 A;  2UU9 M;  1NVM A;  4IBI A;  5KQ8 A;  1GLN A;  1TDH A;  1IN5 A;  3CTW B;  1IN4 A;  1LV7 A;  5KPZ A;  1XNR M;  4FVM A;  2QCU A;  2H1R A;  3SAT A;  4FCT A;  2R4E A;  3W0L B;  4I5S A;  2ZAN A;  1IXR C;  4D80 A;  1N75 A;  1IY1 A;  2UXC M;  4OW0 A;  1IBL M;  4FD2 A;  4NOO B;  5ITY A;  1GVN A;  3GPP A;  3KOW E;  1OFI A;  5EXT A;  3HHX A;  2KA6 B;  4GRI A;  1L2D A;  1HQY E;  2XFS A;  1IM2 A;  5H37 D;  3KP0 E;  5F3W A;  1SXJ B;  1DGG A;  3K1J A;  1HNW M;  2KZS A;  1L8Q A;  3U60 B;  2XFT A;  4YY3 M;  4DV7 M;  1IBK M;  4BLC A;  3M7G A;  5IWA M;  1XWI A;  5E6J A;  4JV5 M;  3KVW A;  4IJE A;  1S3S A;  2F5S A;  3SMP A;  2CHV A;  4OVZ A;  2C96 A;  2OQ4 A;  4B7H A;  5LMN M;  1IN7 A;  1DO2 A;  2LH0 A;  1IXS B;  3WHK A;  3GLF B;  4JI4 M;  1DGH B;  1TGU A;  1T3T A;  5BR8 M;  3TWL A;  4AG6 A;  4PDI A;  2I7N A;  5KO3 A;  1L2C A;  1NY5 A;  4S12 A;  2RGH A;  2R4J A;  3R8F A;  4D82 A;  4RNA A;  1TDZ A;  4M0D A;  3HGI A;  4KLN A;  3K8Z A;  3J80 S;  3U6P A;  4JN6 A;  4WW0 A;  4Z6Y A;  1NNU C;  2X4A A;  2F5O A;  2K47 A;  4B3R M;  3J7B A;  4IBB A;  3AKZ A;  3I4V A;  4LJA A;  2R62 A;  5DYG A;  2ZM6 M;  1W5T A;  1G3I A;  3L27 A;  3TWK A;  4M9X A;  3SYL A;  3M0E A;  2G8L A;  4Z8X A;  4DV2 M;  2XSZ A;  1SXJ A;  3VLF B;  3DA1 A;  1MX0 A;  2FFJ A;  3SHF A;  3U60 A;  7CAT A;  3GP1 A;  1ZAE A;  3GLI B;  2EA0 A;  2KEB A;  4MM3 B;  3T1H M;  1EE8 A;  1TH4 A;  3BOS A;  3SHG B;  4X64 M;  3U6S A;  2Q2E B;  2D7G A;  2DXI A;  2DVW B;  2HHH M;  4AZF A;  1NJG A;  3TWM A;  4X65 M;  4NXM M;  2X49 A;  4AKI A;  4NRV A;  5KPR A;  4JI2 M;  4DV3 M;  3JR5 A;  4IBD A;  2X8A A;  4REZ A;  4GHL A;  1E9S A;  4K0K M;  2CUZ A;  3U6O A;  4FWD A;  2Z3X A;  4GIT A;  3AOE C;  3A98 B;  1OFH A;  4JI7 M;  1FNN A;  3KOY E;  2LWX A;  2P5T A;  4R3D A;  3PVS A;  2F5Q A;  4A3V B;  5EP4 A;  1WXQ A;  2XGN A;  3D8B A;  4IIW A;  1I94 M;  5KPT A;  3U5Z B;  4D81 A;  3FUX A;  1IBM M;  4WUR A;  3AJI B;  4JI3 M;  3WHL A;  3GQ4 A;  3PNV A;  1HR0 M;  4DR5 M;  3FUW A;  3A46 A;  1NSF A;  5ITU A;  4LF5 M;  3RFW A;  3J2P B;  1IN6 A;  4G4Q A;  2R46 A;  3IG5 A;  2Z4R A;  1IQP A;  1DGB A;  3GLH B;  3IG8 A;  3J27 B;  4NSR A;  3GLG B;  3FD9 A;  2HL7 A;  2VII A;  2M5Z A;  4GHA A;  3L26 A;  1QAO A;  2BNK A;  2R45 A;  3GRY A;  1GL7 A;  4IBC A;  3K2L A;  4JI6 M;  3GPX A;  2LXE A;  4DV5 M;  4LZJ A;  5ITQ A;  1N78 A;  2F4V M;  1HQC A;  2CV2 A;  3GRV A;  3PNY A;  3AL0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...