4QOZC

Crystal structure of the histone mrna stem-loop, stem-loop binding protein (phosphorylated), and 3'hexo ternary complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
73
structure length
72
Chain Sequence
DFETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPKPNKFKKYSRRSWDQQIKLWKVALHFWDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords histone mRNA stem-loop
publication title Molecular mechanisms for the regulation of histone mRNA stem-loop-binding protein by phosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna/hydrolase/rna binding protein
total genus 22
structure length 72
sequence length 73
ec nomenclature
pdb deposition date 2014-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15247 SLBP_RNA_bind Histone RNA hairpin-binding protein RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1120 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4qozC00
4TUWA 4QOZC 4L8RC
chains in the Genus database with same CATH superfamily
2O25A 5IZ7D 1J5EM 3MHVC 1HNXM 2HHHM 1DGHB 1IY1A 1QANA 3I4YA 1WHCA 4PT5A 1T43A 3C58A 4LFBM 4D82A 1F4IA 2QSFX 4XBOA 3QYBA 5ITXA 2F5SA 4NSOB 5F3WA 2VF7A 1XMOM 3C9PA 4I81A 4FWGA 2L09A 2HKJA 3PXGA 4IBDA 4FWDA 3K1JA 2JZ1A 4RKUF 1IN4A 3GLFE 2L7IA 1XNRM 3DOAA 3IHPA 3SHFA 3KDSE 3MMPA 3GLIB 1W5SA 3BXWA 5ITYA 3SASA 4LRTA 3HU2A 3KOXE 3RGPA 3AOGA 3LW5F 2ZAOA 4MH0E 3GPXA 1ZAEA 1SG9A 2R65A 2ZANA 4B3MM 3SAVA 1MU5A 3LQQA 2D7HA 3LCVB 4R7GA 5L8RF 3VFDA 4JV5M 3KS8A 1DGFA 3VDPA 3T1YM 1N75A 4G4OA 2QPAA 2DWLA 2L4FA 2EA0A 1VG5A 2KZUA 4W5WA 2EO2A 1IN7A 3U6EA 3VK8A 4MM3B 2EJSA 4ANRA 2LBCA 2F5NA 1S3SA 4WW0A 3U6DA 2RKOA 4EIWA 4LF8M 5DNYA 3KXEC 3LVWA 4X64M 2H5XA 3HWSA 4L8RC 2M5ZA 3RE8A 1NNJA 1Q39A 3SC3A 1OAOC 1C7YA 1VDLA 5IWAM 1NJFA 1VQ1A 2C9CA 2MH8A 3B7ZA 5FTJA 3GLHE 3I4VA 4R3DA 4FW9A 1IY0A 1QQWA 2DXIA 1UFZA 2CHQA 3NBIA 3B7NA 2G5GX 2I7NA 5KPZA 1UM8A 3FTCA 5EP2A 3CGWA 2Z4RA 3SMSA 2H1RA 2M60A 2YQZA 4DUZM 2C99A 3GLFA 2UUBM 1AUAA 2OOBA 1SXJB 5EP1A 3A42A 2D7GA 5IREB 4DV7M 3MK6A 2VQFM 1GL7A 2UUCM 2J7NA 3IECA 1D0LA 4X66M 3T6PA 2R46A 3SHGB 2DHYA 3HY5A 4LJ5A 2BNKA 1OFIA 1QUTA 2JY8A 5E26A 2OQ4A 1WXQA 3FRIA 4QOSA 3TE6A 2LVQD 1TH3A 3UGJA 2VQEM 2R4JA 5EXXA 4FCTA 3AFHA 2X49A 3BBZA 5FTNA 2CRUA 2K0BX 3GLIE 3PNVA 1R5LA 2EUCA 4AKIA 4FD2A 1WGNA 1QUSA 4YY3M 1HT1E 1G4AE 2DWZB 4K0KM 4MGKE 1TDZA 2RRUA 3L26A 2F5OA 4DR2M 2CV1A 1V33A 1G3IA 2ZTCA 3ZH9B 4QOZC 4XK8F 5BPVA 1NJGA 4WP2A 4LF9M 5ITUA 1NSFA 3EIEA 2X8AA 1QDRA 2MJ5B 1K3XA 4B3SM 1NO1A 2NQ8C 4DR1M 1PJIA 1GL6A 2LVPC 1LTMA 2JY7A 3I51A 1TGUA 2JP7A 2DZLA 3GLHA 3T38A 3GPYA 1HNWM 2Y20A 4GMQA 3SAWA 3SMPA 2QENA 3KP1E 2UXBM 1IQPA 3TWLA 4GC9A 1R2ZA 4CJ6A 5KO3A 1R2YA 4M9ZA 2V1CA 2FH0A 5EXTA 2JZ0A 2F5QA 3JAMS 3C3EA 2F4VM 3FTDA 1IN6A 4KODA 1PJJA 2L4EA 4BBAA 1N33M 3GQ3A 1XMQM 4I4LA 3SBJA 2WZJA 4LJAA 3UZUA 2Z3XA 3LMMA 5EP4A 1N78A 4CISA 3KOZE 3HKPA 4IBBA 5EXSA 4QNMA 4QHTA 1IM2A 4G4QA 4Z6YA 5FSWA 2F5PA 2XH9A 4L78A 1XC8A 1J7KA 1L1TA 1OTRA 2B3TA 1OQYA 4G6ZA 1Z6TA 4JXJA 3IG5A 4YHHM 4B3TM 1EE8A 4NOOB 3K2LA 1EFUB 5FTMA 3WHKA 2K6BA 4DR7M 4LZJA 1SXJE 1NY5A 4LJ9A 4B7GA 3NWLA 1QAOA 3GRRA 3GLIA 4LF4M 3Q8GA 5KQDA 1L2DA 2JXNA 4IBJA 2GNOA 3L28A 3GPPA 4AI6A 3A45A 5LMUM 3U6OA 3SFZA 2FE8A 3U6MA 1QYRA 3GPUA 3E46A 4R71A 4LG2A 3F92A 3L2AA 1SXJD 4LY6A 3GRVA 1IBKM 1DV0A 2QBYA 1JB0F 3LQRA 3I04M 2UU9M 4AKHA 2X4AA 4QHSA 2ZBKB 3FUWA 1I4WA 3A98B 4PDGA 1N34M 4GHLA 3SAUA 4NXNM 3FYDA 3M7GA 3U61A 4AG6A 3H4JA 2UXDM 2XFTA 4DV0M 2QBYB 1IXZA 3KP0E 5LMNM 2W82A 2ERCA 3E21A 1SXJC 2Y0QA 4LJ4A 3T15A 3KSJA 4OW0A 3U6PA 1KSFX 3U61B 1D2NA 3TL4X 1XB2B 2KA6B 2R45A 2MGWA 4RF0A 1N32M 3SYLA 2WSCF 1DO2A 5EXPA 4GH9A 1NV9A 3RFWA 3TQSA 1KFVA 4I8OA 3GQ5A 1MJGM 1J09A 2J7OA 3AJIB 2QQ8A 7CATA 1V92A 2LHCA 2XEPA 3K92A 4MGZE 2OO9A 3AOEA 4JI0M 3GO8A 1QVRA 2CE7A 3FUXA 1OIPA 5DYIA 2LVNC 3GLGE 3THGA 4RNAA 2RGHA 3D8BA 1IN5A 2K47A 1IFYA 2DI0A 4LJ6A 2GQFA 2HAKA 4L4UA 5A2QS 1G71A 1SXJA 2YNMD 3KW6A 4KO8A 1HQYE 3DZDA 4LJ8A 2R4EA 2KRKA 4DV2M 4NXMM 3L27A 4MGHA 4IJFA 3L25A 1ORYB 2KNZA 1IXSB 2LHGA 2L2DA 4LCBA 4LZZA 3VKHA 1YUBA 2C9OA 3AL0C 4DR6M 2DENA 3FKEA 1Z5BA 1VEKA 1XXHA 4LRSA 4CGYB 2QZ4A 4AG5A 3ZQJA 5KPTA 2C96A 4IBEA 3VDUA 2BWBA 1ZMUA 3I01M 4MB7A 4PDIA 3V76A 3J80S 1PGYA 1XXHB 3D8LA 2XLJA 2XZUA 1XNQM 1L1ZA 2UUAM 3WHLA 1QAMA 4DR5M 4A3VB 4M9XA 1CUKA 2ZAMA 4B08A 2VF8A 3W67A 2CV0A 1TDHA 1G8PA 2C5RA 3W0FA 1QZEA 1X37A 4GC5A 3MJ5A 5EJCA 2G3QA 2KRUA 3QAUA 4NRVA 2LVAA 1W5TA 3SARA 4D81A 1N36M 2I7PA 3L29A 4KT0F 3SYKA 3LCUA 2DHRA 3B89A 4II7A 3U6SA 2QCUA 1NV8A 2FOIC 3Q8XA 1OJLA 4M0WA 4QNRA 3GP1A 3VLFB 3UJNA 3KFUG 5H37D 3GLGA 3ZCBB 3A46A 4L6V6 2EKKA 3U5ZA 2LWXA 1TH2A 2DAKA 3HJQA 1OKSA 4M9SA 4B7HA 1FNNA 1VEGA 3B7QA 3LVVA 4LF6M 1GVNA 4GKJM 2KXEA 4HL4A 4JI3M 3GLGB 4DV6M 4NRWA 3HJ8A 1DO0A 4X65M 3U5ZB 1JQJC 2DAIA 2ZM6M 4JI1M 1G59A 2ZTDA 4GRIA 4P17A 2QP9X 1GLNA 3HX3A 2Z7JA 2FFJA 2N35A 4LFCM 3U60A 4JI4M 3W0LB 2WSEF 5ITRA 3BOSA 3ILKA 5JI2E 1GJSA 4AQYM 4BLCA 1JR3E 2HCBA 1A5TA 3FD9A 3PNYA 5FTKA 4DBGB 1DGGA 1L2BA 2HWJA 1PJSA 3FTEA 3U60B 4IJEA 3HZJA 1D0KA 8CATA 3K9PA 4CHTB 1IY2A 2Z4SA 3J7BA 4FCVA 1D0MA 1PM5A 2C98A 2KHHA 1IXRC 2CHVA 3M6AA 4PCZA 1WGLA 3VK7A 1JR3D 1P3QQ 1XHBA 2UXCM 1GKIA 1YE9A 2AHMA 2O5RA 5E6JA 2V6ZM 1K82A 2L7HA 3HHYA 3HU3A 1MN3A 1LV7A 4JI6M 2Y21A 1HJPA 1FJGM 1XXHE 4Q7JA 4S12A 3TPZA 2XF3A 2R6FA 2VDBB 3OTOM 3ZC7B 2APLA 2BJWA 3AOEC 4G3OA 3AV0A 4DV3M 3UK6A 3TWKA 1OFHA 1G41A 2YR0A 4NC6A 2E5LM 1R4GA 3FE3A 2DWNA 2FS1A 2DVWB 3J81S 5KPRA 2CUZA 1E9RA 4NL4H 4HLQA 1L8QA 3HU1A 4UN2B 1VDDA 2R44A 3CF0A 1YSYA 1NVMA 2XSZD 4JYAM 2JWSA 2JY5A 2XGNA 2J5YA 1IBLM 4LF7M 2CP8A 4F1IA 1NNUC 3CTWB 4DR4M 3GQ4A 1KYIA 1WJ7A 5DYGA 3JR5A 2DAGA 4WURA 1NY6A 1I94M 1JR3A 1RU3A 1N77A 1Z5AA 4B7FA 3U6CA 2RGOA 2OOAA 4X62M 3FTFA 1Q3BA 4DV5M 2P5TA 3H4MA 2V1UA 2R62A 1OAIA 2L6OA 1HT2E 2YFQA 1E94E 1Q3CA 2CWBA 4IIWA 1GJTA 2HL7A 4JI2M 5IT9S 2JY6B 3FYCA 3R8FA 1VEJA 1IXSA 2KNAA 2KNVA 3HHWA 3U6LA 3KS4A 4D80A 2OPFA 4ZPXA 1QDTA 2LNHC 4LFAM 2MROB 4AKGA 1ZV1A 1ZQ9A 3K9OA 3J2PB 3J7AS 1T6OA 1Z59A 2FNAA 1Z5CA 2MR9A 3TWMA 4OVZA 1H6UA 2KW0A 3RGSA 5C18A 4OX9M 4IBKA 4XGIA 4ITQA 2QHOB 4MGYE 2CV2A 3CF6E 4LGYA 4OVZB 2XSZA 2A5YB 5GKNA 2QNJA 4OU7A 2Y0TA 2Z8YM 3PVSA 4NSRA 1BVSA 2BWEA 2CEAA 3CF2A 3KSXA 1T3TA 3M0EA 2EKFA 4HEOA 4IBIA 4Y28F 5JI3E 3HJSA 3AKZA 1ZMVA 3FRHA 3GRUA 3K8ZA 1DGBA 5ITTA 4JI7M 2BJVA 1QAQA 2JNHA 2DAEA 2DKLA 3IG8A 2JUJA 3GLFB 1E32A 3HHZA 4TUWA 3T1HM 3QYEA 2CHGA 1PJQA 3KVWA 4GKKM 2DZOB 2Q2EB 4FVMA 4F2LA 5KQ8A 1L2CA 3HHXA 5FTLA 5ITXE 1QZMA 4DUYM 1C1KA 4Z8XA 1K3WA 2LTUA 2XZFA 4GITA 4P16A 4MGIE 3E4RA 1TH4A 3E9SA 1Y8GA 4CIZA 4FCWA 3B74A 2LVOC 4IBGA 1HNZM 3SATA 1EIJA 1Q02A 4GIPA 1V34A 5DFLA 4KHPM 1TTEA 4GEWA 1MX0A 1YLAA 4BB9A 4FWHA 4PD2A 4JN6A 5ITQA 1HR0M 4M0DA 1GO5A 3J27B 2K9DA 3W68A 1R7RA 2KZSA 4LGMA 4DV4M 3JR4A 2WSFF 4LF5M 5EP3A 3KOYE 3UMMA 1IN8A 3B9PA 4B3RM 1NHWC 5EQTA 1IBMM 1ZMWA 2DZNB 4LJ7A 3R9XB 3EIHA 4AZFA 1PJTA 4G4NA 3U6QA 1OIZA 1PRBA 4KLNA 2R0IA 4REZA 4JI8M 1NHGC 4I5SA 5BR8M 2D7EA 2O01F 2KEBA 1AIPC 1E9SA 2DAMA 3PFIA 1WIVA 2LH0A 3HGIA 3GLHB 5FLXS 3GRYA 3FUVA 3C3DA 2R18A 4DV1M 3FUUA 3FUTA 2DWMA 3KOWE 2XFSA 2DNAA 4IBCA 3DA1A 4JI5M 4RF1A 1WR1B 2G8LA 1GABA 3QWLA 1XWIA 2VIIA 4L15A 2LXEA 1TR8A 1DGHA 3NBXX 3VKGA 5C1BA 1TF0B 2CFOA 2KDLA 3DFZA 1R6BX 2JA2A 4IBFA 4L16A 4G4RA 4DR3M 4GHAA 4AW4A 1HQCA
chains in the Genus database with same CATH topology
5IZ7D 1J5EM 2HHHM 3MHVC 1HNXM 1DGHB 1IY1A 1QANA 3I4YA 4PT5A 3C58A 4LFBM 4D82A 4XBOA 5ITXA 2F5SA 4NSOB 5F3WA 1XMOM 4I81A 4FWGA 2L09A 2HKJA 3PXGA 4IBDA 4FWDA 3K1JA 1IN4A 2L7IA 1XNRM 3DOAA 3SHFA 3KDSE 3GLIB 1W5SA 5ITYA 3SASA 4LRTA 3HU2A 3KOXE 3RGPA 3AOGA 2ZAOA 4MH0E 3GPXA 1ZAEA 2R65A 2ZANA 4B3MM 3SAVA 1MU5A 3LQQA 2D7HA 4R7GA 3VFDA 4JV5M 3KS8A 1DGFA 3VDPA 3T1YM 1N75A 4G4OA 2QPAA 2DWLA 2EA0A 2KZUA 4W5WA 2EO2A 1IN7A 3U6EA 3VK8A 4MM3B 2F5NA 1S3SA 4WW0A 3U6DA 2RKOA 4EIWA 4LF8M 5DNYA 3KXEC 3LVWA 4X64M 3HWSA 4L8RC 2M5ZA 3RE8A 1NNJA 1Q39A 3SC3A 5IWAM 1NJFA 2C9CA 5FTJA 3I4VA 4R3DA 4FW9A 1IY0A 1QQWA 2DXIA 2CHQA 3NBIA 2G5GX 2I7NA 5KPZA 1UM8A 3FTCA 5EP2A 2Z4RA 3SMSA 2H1RA 2M60A 2YQZA 4DUZM 2C99A 3GLFA 2UUBM 1SXJB 5EP1A 3A42A 2D7GA 5IREB 4DV7M 3MK6A 2VQFM 1GL7A 2UUCM 2J7NA 4X66M 2R46A 3SHGB 4LJ5A 2BNKA 1OFIA 5E26A 2OQ4A 1WXQA 4QOSA 2VQEM 3TE6A 1TH3A 3UGJA 2R4JA 5EXXA 4FCTA 3AFHA 2X49A 5FTNA 3PNVA 2EUCA 4AKIA 4FD2A 4YY3M 1HT1E 1G4AE 2DWZB 4K0KM 4MGKE 1TDZA 3L26A 2F5OA 4DR2M 2CV1A 1G3IA 3ZH9B 4QOZC 5BPVA 1NJGA 4LF9M 5ITUA 1NSFA 3EIEA 2X8AA 4B3SM 1K3XA 2NQ8C 4DR1M 1PJIA 1GL6A 3I51A 1TGUA 3T38A 3GLHA 3GPYA 1HNWM 2Y20A 4GMQA 3SAWA 3SMPA 2QENA 3KP1E 2UXBM 1IQPA 3TWLA 4GC9A 1R2ZA 5KO3A 1R2YA 4M9ZA 2V1CA 5EXTA 2F5QA 3JAMS 2F4VM 3FTDA 1IN6A 4KODA 1PJJA 4BBAA 1N33M 3GQ3A 1XMQM 4I4LA 3SBJA 4LJAA 3UZUA 2Z3XA 3LMMA 5EP4A 1N78A 4CISA 3KOZE 3HKPA 4IBBA 5EXSA 4QNMA 4QHTA 1IM2A 4G4QA 4Z6YA 5FSWA 2F5PA 2XH9A 4L78A 1XC8A 1J7KA 1L1TA 4B3TM 4G6ZA 4YHHM 4JXJA 1Z6TA 3IG5A 1EE8A 4NOOB 3K2LA 3WHKA 5FTMA 4DR7M 4LZJA 1SXJE 1NY5A 4LJ9A 4B7GA 3NWLA 1QAOA 3GRRA 3GLIA 4LF4M 5KQDA 4IBJA 3L28A 3GPPA 4AI6A 3A45A 5LMUM 3U6OA 3SFZA 2FE8A 3U6MA 1QYRA 3GPUA 4LG2A 3L2AA 4LY6A 1SXJD 3GRVA 1IBKM 2QBYA 3LQRA 2UU9M 4AKHA 2X4AA 4QHSA 2ZBKB 3FUWA 1I4WA 3A98B 4PDGA 1N34M 4GHLA 3SAUA 4NXNM 3FYDA 3M7GA 3U61A 4AG6A 2UXDM 2XFTA 4DV0M 2QBYB 1IXZA 3KP0E 5LMNM 2W82A 2ERCA 1SXJC 2Y0QA 4LJ4A 3T15A 3KSJA 4OW0A 3U6PA 1KSFX 3U61B 1D2NA 3TL4X 2KA6B 2R45A 4RF0A 1N32M 3SYLA 1DO2A 5EXPA 4GH9A 3RFWA 3TQSA 1KFVA 4I8OA 3AJIB 1J09A 2J7OA 7CATA 4JI0M 2XEPA 3K92A 4MGZE 3AOEA 3GO8A 1QVRA 2CE7A 3FUXA 5DYIA 3THGA 4RNAA 2RGHA 3D8BA 1IN5A 2K47A 4LJ6A 4L4UA 5A2QS 1SXJA 2YNMD 3KW6A 4KO8A 1HQYE 3DZDA 4LJ8A 2R4EA 2KRKA 4DV2M 4NXMM 3L27A 4MGHA 4IJFA 3L25A 1ORYB 4LCBA 1IXSB 3VKHA 4LZZA 1YUBA 2C9OA 3AL0C 4DR6M 3FKEA 1Z5BA 1XXHA 4LRSA 4CGYB 2QZ4A 4AG5A 5KPTA 2C96A 4IBEA 3VDUA 4MB7A 4PDIA 3J80S 1XXHB 3D8LA 2XLJA 2XZUA 1XNQM 1L1ZA 2UUAM 3WHLA 1QAMA 4DR5M 4A3VB 4M9XA 2ZAMA 4B08A 2CV0A 1TDHA 1G8PA 2C5RA 3W0FA 1X37A 4GC5A 3MJ5A 5EJCA 2KRUA 3QAUA 4NRVA 1W5TA 3SARA 4D81A 1N36M 2I7PA 3L29A 3SYKA 2DHRA 4II7A 3U6SA 2QCUA 2FOIC 3Q8XA 1OJLA 4M0WA 4QNRA 3GP1A 3VLFB 3UJNA 3KFUG 5H37D 3GLGA 3ZCBB 3A46A 3U5ZA 2LWXA 1TH2A 3HJQA 4M9SA 4B7HA 1FNNA 4LF6M 3LVVA 1GVNA 4GKJM 2KXEA 4HL4A 4JI3M 3GLGB 4DV6M 4NRWA 3HJ8A 1DO0A 4X65M 3U5ZB 1JQJC 2ZM6M 4JI1M 1G59A 4GRIA 2QP9X 1GLNA 4LFCM 2Z7JA 2FFJA 3U60A 4JI4M 3W0LB 5ITRA 3BOSA 3ILKA 5JI2E 4AQYM 4BLCA 2HCBA 3PNYA 5FTKA 1DGGA 1L2BA 3FTEA 3U60B 4IJEA 8CATA 4CHTB 1IY2A 2Z4SA 3J7BA 4FCVA 1PM5A 2C98A 1IXRC 2CHVA 3M6AA 4PCZA 3VK7A 1JR3D 1XHBA 2UXCM 1GKIA 1YE9A 2AHMA 2O5RA 5E6JA 2V6ZM 1K82A 2L7HA 3HHYA 3HU3A 1LV7A 4JI6M 2Y21A 1FJGM 4S12A 3TPZA 2XF3A 1HQCA 3OTOM 3ZC7B 2BJWA 3AOEC 4DV3M 3AV0A 3UK6A 3TWKA 1OFHA 1G41A 2YR0A 2E5LM 2DWNA 2DVWB 3J81S 5KPRA 2CUZA 1E9RA 4NL4H 4HLQA 3HU1A 1L8QA 1VDDA 3CF0A 1YSYA 1NVMA 2XSZD 4JYAM 2XGNA 1IBLM 4LF7M 1NNUC 3CTWB 4DR4M 3GQ4A 1KYIA 5DYGA 3JR5A 4WURA 1NY6A 1I94M 1JR3A 1N77A 1Z5AA 4B7FA 3U6CA 2RGOA 4X62M 3FTFA 1Q3BA 4DV5M 2P5TA 3H4MA 2V1UA 2R62A 2L6OA 1HT2E 2YFQA 1E94E 1Q3CA 4IIWA 2HL7A 4JI2M 5IT9S 3FYCA 3R8FA 3HHWA 3U6LA 3KS4A 4D80A 2OPFA 4ZPXA 2LNHC 4LFAM 4AKGA 1ZQ9A 3J2PB 3J7AS 2FNAA 1Z59A 3TWMA 1Z5CA 4OVZA 1H6UA 2KW0A 3RGSA 5C18A 4OX9M 4IBKA 4XGIA 4ITQA 4MGYE 2CV2A 3CF6E 4LGYA 4OVZB 2XSZA 2A5YB 5GKNA 4OU7A 2Y0TA 3PVSA 4NSRA 3CF2A 3GQ5A 2CEAA 3M0EA 3KSXA 1T3TA 5JI3E 1L2DA 4IBIA 3AKZA 3HJSA 3GRUA 3K8ZA 1DGBA 5ITTA 4JI7M 2BJVA 1QAQA 3IG8A 3GLFB 1E32A 3HHZA 4TUWA 3T1HM 2CHGA 3KVWA 4GKKM 2DZOB 2Q2EB 4FVMA 5KQ8A 1L2CA 3HHXA 5FTLA 5ITXE 1QZMA 4DUYM 1C1KA 4Z8XA 1K3WA 2XZFA 4GITA 4P16A 4MGIE 3E4RA 1TH4A 3E9SA 4FCWA 4IBGA 1HNZM 3SATA 4GIPA 4KHPM 1MX0A 1HR0M 4BB9A 4FWHA 4PD2A 4JN6A 5ITQA 4M0DA 3J27B 1R7RA 2KZSA 4LGMA 4DV4M 3JR4A 4LF5M 5EP3A 3KOYE 3UMMA 1IN8A 3B9PA 4B3RM 1NHWC 5EQTA 1IBMM 2DZNB 4LJ7A 3R9XB 3EIHA 4AZFA 4G4NA 3U6QA 4REZA 4JI8M 4KLNA 1NHGC 4I5SA 5BR8M 2D7EA 2KEBA 1E9SA 3PFIA 2LH0A 3HGIA 3GLHB 5FLXS 3GRYA 3FUVA 2R18A 4DV1M 3FUUA 3FUTA 2DWMA 3KOWE 2XFSA 4IBCA 3DA1A 4JI5M 4RF1A 2G8LA 3QWLA 1XWIA 2VIIA 4L15A 2LXEA 1DGHA 3VKGA 5C1BA 4IBFA 2CFOA 3DFZA 4L16A 1R6BX 2JA2A 4G4RA 4DR3M 4GHAA 4AW4A 3FD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TUW A;  4QOZ C;  4L8R C; 
#chains in the Genus database with same CATH topology
 2O25 A;  5IZ7 D;  1J5E M;  3MHV C;  1HNX M;  2HHH M;  1DGH B;  1IY1 A;  1QAN A;  3I4Y A;  1WHC A;  4PT5 A;  1T43 A;  3C58 A;  4LFB M;  4D82 A;  1F4I A;  2QSF X;  4XBO A;  3QYB A;  5ITX A;  2F5S A;  4NSO B;  5F3W A;  2VF7 A;  1XMO M;  3C9P A;  4I81 A;  4FWG A;  2L09 A;  2HKJ A;  3PXG A;  4IBD A;  4FWD A;  3K1J A;  2JZ1 A;  4RKU F;  1IN4 A;  3GLF E;  2L7I A;  1XNR M;  3DOA A;  3IHP A;  3SHF A;  3KDS E;  3MMP A;  3GLI B;  1W5S A;  3BXW A;  5ITY A;  3SAS A;  4LRT A;  3HU2 A;  3KOX E;  3RGP A;  3AOG A;  3LW5 F;  2ZAO A;  4MH0 E;  3GPX A;  1ZAE A;  1SG9 A;  2R65 A;  2ZAN A;  4B3M M;  3SAV A;  1MU5 A;  3LQQ A;  2D7H A;  3LCV B;  4R7G A;  5L8R F;  3VFD A;  4JV5 M;  3KS8 A;  1DGF A;  3VDP A;  3T1Y M;  1N75 A;  4G4O A;  2QPA A;  2DWL A;  2L4F A;  2EA0 A;  1VG5 A;  2KZU A;  4W5W A;  2EO2 A;  1IN7 A;  3U6E A;  3VK8 A;  4MM3 B;  2EJS A;  4ANR A;  2LBC A;  2F5N A;  1S3S A;  4WW0 A;  3U6D A;  2RKO A;  4EIW A;  4LF8 M;  5DNY A;  3KXE C;  3LVW A;  4X64 M;  2H5X A;  3HWS A;  4L8R C;  2M5Z A;  3RE8 A;  1NNJ A;  1Q39 A;  3SC3 A;  1OAO C;  1C7Y A;  1VDL A;  5IWA M;  1NJF A;  1VQ1 A;  2C9C A;  2MH8 A;  3B7Z A;  5FTJ A;  3GLH E;  3I4V A;  4R3D A;  4FW9 A;  1IY0 A;  1QQW A;  2DXI A;  1UFZ A;  2CHQ A;  3NBI A;  3B7N A;  2G5G X;  2I7N A;  5KPZ A;  1UM8 A;  3FTC A;  5EP2 A;  3CGW A;  2Z4R A;  3SMS A;  2H1R A;  2M60 A;  2YQZ A;  4DUZ M;  2C99 A;  3GLF A;  2UUB M;  1AUA A;  2OOB A;  1SXJ B;  5EP1 A;  3A42 A;  2D7G A;  5IRE B;  4DV7 M;  3MK6 A;  2VQF M;  1GL7 A;  2UUC M;  2J7N A;  3IEC A;  1D0L A;  4X66 M;  3T6P A;  2R46 A;  3SHG B;  2DHY A;  3HY5 A;  4LJ5 A;  2BNK A;  1OFI A;  1QUT A;  2JY8 A;  5E26 A;  2OQ4 A;  1WXQ A;  3FRI A;  4QOS A;  3TE6 A;  2LVQ D;  1TH3 A;  3UGJ A;  2VQE M;  2R4J A;  5EXX A;  4FCT A;  3AFH A;  2X49 A;  3BBZ A;  5FTN A;  2CRU A;  2K0B X;  3GLI E;  3PNV A;  1R5L A;  2EUC A;  4AKI A;  4FD2 A;  1WGN A;  1QUS A;  4YY3 M;  1HT1 E;  1G4A E;  2DWZ B;  4K0K M;  4MGK E;  1TDZ A;  2RRU A;  3L26 A;  2F5O A;  4DR2 M;  2CV1 A;  1V33 A;  1G3I A;  2ZTC A;  3ZH9 B;  4QOZ C;  4XK8 F;  5BPV A;  1NJG A;  4WP2 A;  4LF9 M;  5ITU A;  1NSF A;  3EIE A;  2X8A A;  1QDR A;  2MJ5 B;  1K3X A;  4B3S M;  1NO1 A;  2NQ8 C;  4DR1 M;  1PJI A;  1GL6 A;  2LVP C;  1LTM A;  2JY7 A;  3I51 A;  1TGU A;  2JP7 A;  2DZL A;  3GLH A;  3T38 A;  3GPY A;  1HNW M;  2Y20 A;  4GMQ A;  3SAW A;  3SMP A;  2QEN A;  3KP1 E;  2UXB M;  1IQP A;  3TWL A;  4GC9 A;  1R2Z A;  4CJ6 A;  5KO3 A;  1R2Y A;  4M9Z A;  2V1C A;  2FH0 A;  5EXT A;  2JZ0 A;  2F5Q A;  3JAM S;  3C3E A;  2F4V M;  3FTD A;  1IN6 A;  4KOD A;  1PJJ A;  2L4E A;  4BBA A;  1N33 M;  3GQ3 A;  1XMQ M;  4I4L A;  3SBJ A;  2WZJ A;  4LJA A;  3UZU A;  2Z3X A;  3LMM A;  5EP4 A;  1N78 A;  4CIS A;  3KOZ E;  3HKP A;  4IBB A;  5EXS A;  4QNM A;  4QHT A;  1IM2 A;  4G4Q A;  4Z6Y A;  5FSW A;  2F5P A;  2XH9 A;  4L78 A;  1XC8 A;  1J7K A;  1L1T A;  1OTR A;  2B3T A;  1OQY A;  4G6Z A;  1Z6T A;  4JXJ A;  3IG5 A;  4YHH M;  4B3T M;  1EE8 A;  4NOO B;  3K2L A;  1EFU B;  5FTM A;  3WHK A;  2K6B A;  4DR7 M;  4LZJ A;  1SXJ E;  1NY5 A;  4LJ9 A;  4B7G A;  3NWL A;  1QAO A;  3GRR A;  3GLI A;  4LF4 M;  3Q8G A;  5KQD A;  1L2D A;  2JXN A;  4IBJ A;  2GNO A;  3L28 A;  3GPP A;  4AI6 A;  3A45 A;  5LMU M;  3U6O A;  3SFZ A;  2FE8 A;  3U6M A;  1QYR A;  3GPU A;  3E46 A;  4R71 A;  4LG2 A;  3F92 A;  3L2A A;  1SXJ D;  4LY6 A;  3GRV A;  1IBK M;  1DV0 A;  2QBY A;  1JB0 F;  3LQR A;  3I04 M;  2UU9 M;  4AKH A;  2X4A A;  4QHS A;  2ZBK B;  3FUW A;  1I4W A;  3A98 B;  4PDG A;  1N34 M;  4GHL A;  3SAU A;  4NXN M;  3FYD A;  3M7G A;  3U61 A;  4AG6 A;  3H4J A;  2UXD M;  2XFT A;  4DV0 M;  2QBY B;  1IXZ A;  3KP0 E;  5LMN M;  2W82 A;  2ERC A;  3E21 A;  1SXJ C;  2Y0Q A;  4LJ4 A;  3T15 A;  3KSJ A;  4OW0 A;  3U6P A;  1KSF X;  3U61 B;  1D2N A;  3TL4 X;  1XB2 B;  2KA6 B;  2R45 A;  2MGW A;  4RF0 A;  1N32 M;  3SYL A;  2WSC F;  1DO2 A;  5EXP A;  4GH9 A;  1NV9 A;  3RFW A;  3TQS A;  1KFV A;  4I8O A;  3GQ5 A;  1MJG M;  1J09 A;  2J7O A;  3AJI B;  2QQ8 A;  7CAT A;  1V92 A;  2LHC A;  2XEP A;  3K92 A;  4MGZ E;  2OO9 A;  3AOE A;  4JI0 M;  3GO8 A;  1QVR A;  2CE7 A;  3FUX A;  1OIP A;  5DYI A;  2LVN C;  3GLG E;  3THG A;  4RNA A;  2RGH A;  3D8B A;  1IN5 A;  2K47 A;  1IFY A;  2DI0 A;  4LJ6 A;  2GQF A;  2HAK A;  4L4U A;  5A2Q S;  1G71 A;  1SXJ A;  2YNM D;  3KW6 A;  4KO8 A;  1HQY E;  3DZD A;  4LJ8 A;  2R4E A;  2KRK A;  4DV2 M;  4NXM M;  3L27 A;  4MGH A;  4IJF A;  3L25 A;  1ORY B;  2KNZ A;  1IXS B;  2LHG A;  2L2D A;  4LCB A;  4LZZ A;  3VKH A;  1YUB A;  2C9O A;  3AL0 C;  4DR6 M;  2DEN A;  3FKE A;  1Z5B A;  1VEK A;  1XXH A;  4LRS A;  4CGY B;  2QZ4 A;  4AG5 A;  3ZQJ A;  5KPT A;  2C96 A;  4IBE A;  3VDU A;  2BWB A;  1ZMU A;  3I01 M;  4MB7 A;  4PDI A;  3V76 A;  3J80 S;  1PGY A;  1XXH B;  3D8L A;  2XLJ A;  2XZU A;  1XNQ M;  1L1Z A;  2UUA M;  3WHL A;  1QAM A;  4DR5 M;  4A3V B;  4M9X A;  1CUK A;  2ZAM A;  4B08 A;  2VF8 A;  3W67 A;  2CV0 A;  1TDH A;  1G8P A;  2C5R A;  3W0F A;  1QZE A;  1X37 A;  4GC5 A;  3MJ5 A;  5EJC A;  2G3Q A;  2KRU A;  3QAU A;  4NRV A;  2LVA A;  1W5T A;  3SAR A;  4D81 A;  1N36 M;  2I7P A;  3L29 A;  4KT0 F;  3SYK A;  3LCU A;  2DHR A;  3B89 A;  4II7 A;  3U6S A;  2QCU A;  1NV8 A;  2FOI C;  3Q8X A;  1OJL A;  4M0W A;  4QNR A;  3GP1 A;  3VLF B;  3UJN A;  3KFU G;  5H37 D;  3GLG A;  3ZCB B;  3A46 A;  4L6V 6;  2EKK A;  3U5Z A;  2LWX A;  1TH2 A;  2DAK A;  3HJQ A;  1OKS A;  4M9S A;  4B7H A;  1FNN A;  1VEG A;  3B7Q A;  3LVV A;  4LF6 M;  1GVN A;  4GKJ M;  2KXE A;  4HL4 A;  4JI3 M;  3GLG B;  4DV6 M;  4NRW A;  3HJ8 A;  1DO0 A;  4X65 M;  3U5Z B;  1JQJ C;  2DAI A;  2ZM6 M;  4JI1 M;  1G59 A;  2ZTD A;  4GRI A;  4P17 A;  2QP9 X;  1GLN A;  3HX3 A;  2Z7J A;  2FFJ A;  2N35 A;  4LFC M;  3U60 A;  4JI4 M;  3W0L B;  2WSE F;  5ITR A;  3BOS A;  3ILK A;  5JI2 E;  1GJS A;  4AQY M;  4BLC A;  1JR3 E;  2HCB A;  1A5T A;  3FD9 A;  3PNY A;  5FTK A;  4DBG B;  1DGG A;  1L2B A;  2HWJ A;  1PJS A;  3FTE A;  3U60 B;  4IJE A;  3HZJ A;  1D0K A;  8CAT A;  3K9P A;  4CHT B;  1IY2 A;  2Z4S A;  3J7B A;  4FCV A;  1D0M A;  1PM5 A;  2C98 A;  2KHH A;  1IXR C;  2CHV A;  3M6A A;  4PCZ A;  1WGL A;  3VK7 A;  1JR3 D;  1P3Q Q;  1XHB A;  2UXC M;  1GKI A;  1YE9 A;  2AHM A;  2O5R A;  5E6J A;  2V6Z M;  1K82 A;  2L7H A;  3HHY A;  3HU3 A;  1MN3 A;  1LV7 A;  4JI6 M;  2Y21 A;  1HJP A;  1FJG M;  1XXH E;  4Q7J A;  4S12 A;  3TPZ A;  2XF3 A;  2R6F A;  2VDB B;  3OTO M;  3ZC7 B;  2APL A;  2BJW A;  3AOE C;  4G3O A;  3AV0 A;  4DV3 M;  3UK6 A;  3TWK A;  1OFH A;  1G41 A;  2YR0 A;  4NC6 A;  2E5L M;  1R4G A;  3FE3 A;  2DWN A;  2FS1 A;  2DVW B;  3J81 S;  5KPR A;  2CUZ A;  1E9R A;  4NL4 H;  4HLQ A;  1L8Q A;  3HU1 A;  4UN2 B;  1VDD A;  2R44 A;  3CF0 A;  1YSY A;  1NVM A;  2XSZ D;  4JYA M;  2JWS A;  2JY5 A;  2XGN A;  2J5Y A;  1IBL M;  4LF7 M;  2CP8 A;  4F1I A;  1NNU C;  3CTW B;  4DR4 M;  3GQ4 A;  1KYI A;  1WJ7 A;  5DYG A;  3JR5 A;  2DAG A;  4WUR A;  1NY6 A;  1I94 M;  1JR3 A;  1RU3 A;  1N77 A;  1Z5A A;  4B7F A;  3U6C A;  2RGO A;  2OOA A;  4X62 M;  3FTF A;  1Q3B A;  4DV5 M;  2P5T A;  3H4M A;  2V1U A;  2R62 A;  1OAI A;  2L6O A;  1HT2 E;  2YFQ A;  1E94 E;  1Q3C A;  2CWB A;  4IIW A;  1GJT A;  2HL7 A;  4JI2 M;  5IT9 S;  2JY6 B;  3FYC A;  3R8F A;  1VEJ A;  1IXS A;  2KNA A;  2KNV A;  3HHW A;  3U6L A;  3KS4 A;  4D80 A;  2OPF A;  4ZPX A;  1QDT A;  2LNH C;  4LFA M;  2MRO B;  4AKG A;  1ZV1 A;  1ZQ9 A;  3K9O A;  3J2P B;  3J7A S;  1T6O A;  1Z59 A;  2FNA A;  1Z5C A;  2MR9 A;  3TWM A;  4OVZ A;  1H6U A;  2KW0 A;  3RGS A;  5C18 A;  4OX9 M;  4IBK A;  4XGI A;  4ITQ A;  2QHO B;  4MGY E;  2CV2 A;  3CF6 E;  4LGY A;  4OVZ B;  2XSZ A;  2A5Y B;  5GKN A;  2QNJ A;  4OU7 A;  2Y0T A;  2Z8Y M;  3PVS A;  4NSR A;  1BVS A;  2BWE A;  2CEA A;  3CF2 A;  3KSX A;  1T3T A;  3M0E A;  2EKF A;  4HEO A;  4IBI A;  4Y28 F;  5JI3 E;  3HJS A;  3AKZ A;  1ZMV A;  3FRH A;  3GRU A;  3K8Z A;  1DGB A;  5ITT A;  4JI7 M;  2BJV A;  1QAQ A;  2JNH A;  2DAE A;  2DKL A;  3IG8 A;  2JUJ A;  3GLF B;  1E32 A;  3HHZ A;  4TUW A;  3T1H M;  3QYE A;  2CHG A;  1PJQ A;  3KVW A;  4GKK M;  2DZO B;  2Q2E B;  4FVM A;  4F2L A;  5KQ8 A;  1L2C A;  3HHX A;  5FTL A;  5ITX E;  1QZM A;  4DUY M;  1C1K A;  4Z8X A;  1K3W A;  2LTU A;  2XZF A;  4GIT A;  4P16 A;  4MGI E;  3E4R A;  1TH4 A;  3E9S A;  1Y8G A;  4CIZ A;  4FCW A;  3B74 A;  2LVO C;  4IBG A;  1HNZ M;  3SAT A;  1EIJ A;  1Q02 A;  4GIP A;  1V34 A;  5DFL A;  4KHP M;  1TTE A;  4GEW A;  1MX0 A;  1YLA A;  4BB9 A;  4FWH A;  4PD2 A;  4JN6 A;  5ITQ A;  1HR0 M;  4M0D A;  1GO5 A;  3J27 B;  2K9D A;  3W68 A;  1R7R A;  2KZS A;  4LGM A;  4DV4 M;  3JR4 A;  2WSF F;  4LF5 M;  5EP3 A;  3KOY E;  3UMM A;  1IN8 A;  3B9P A;  4B3R M;  1NHW C;  5EQT A;  1IBM M;  1ZMW A;  2DZN B;  4LJ7 A;  3R9X B;  3EIH A;  4AZF A;  1PJT A;  4G4N A;  3U6Q A;  1OIZ A;  1PRB A;  4KLN A;  2R0I A;  4REZ A;  4JI8 M;  1NHG C;  4I5S A;  5BR8 M;  2D7E A;  2O01 F;  2KEB A;  1AIP C;  1E9S A;  2DAM A;  3PFI A;  1WIV A;  2LH0 A;  3HGI A;  3GLH B;  5FLX S;  3GRY A;  3FUV A;  3C3D A;  2R18 A;  4DV1 M;  3FUU A;  3FUT A;  2DWM A;  3KOW E;  2XFS A;  2DNA A;  4IBC A;  3DA1 A;  4JI5 M;  4RF1 A;  1WR1 B;  2G8L A;  1GAB A;  3QWL A;  1XWI A;  2VII A;  4L15 A;  2LXE A;  1TR8 A;  1DGH A;  3NBX X;  3VKG A;  5C1B A;  1TF0 B;  2CFO A;  2KDL A;  3DFZ A;  1R6B X;  2JA2 A;  4IBF A;  4L16 A;  4G4R A;  4DR3 M;  4GHA A;  4AW4 A;  1HQC A; 
#chains in the Genus database with same CATH homology
 5IZ7 D;  1J5E M;  2HHH M;  3MHV C;  1HNX M;  1DGH B;  1IY1 A;  1QAN A;  3I4Y A;  4PT5 A;  3C58 A;  4LFB M;  4D82 A;  4XBO A;  5ITX A;  2F5S A;  4NSO B;  5F3W A;  1XMO M;  4I81 A;  4FWG A;  2L09 A;  2HKJ A;  3PXG A;  4IBD A;  4FWD A;  3K1J A;  1IN4 A;  2L7I A;  1XNR M;  3DOA A;  3SHF A;  3KDS E;  3GLI B;  1W5S A;  5ITY A;  3SAS A;  4LRT A;  3HU2 A;  3KOX E;  3RGP A;  3AOG A;  2ZAO A;  4MH0 E;  3GPX A;  1ZAE A;  2R65 A;  2ZAN A;  4B3M M;  3SAV A;  1MU5 A;  3LQQ A;  2D7H A;  4R7G A;  3VFD A;  4JV5 M;  3KS8 A;  1DGF A;  3VDP A;  3T1Y M;  1N75 A;  4G4O A;  2QPA A;  2DWL A;  2EA0 A;  2KZU A;  4W5W A;  2EO2 A;  1IN7 A;  3U6E A;  3VK8 A;  4MM3 B;  2F5N A;  1S3S A;  4WW0 A;  3U6D A;  2RKO A;  4EIW A;  4LF8 M;  5DNY A;  3KXE C;  3LVW A;  4X64 M;  3HWS A;  4L8R C;  2M5Z A;  3RE8 A;  1NNJ A;  1Q39 A;  3SC3 A;  5IWA M;  1NJF A;  2C9C A;  5FTJ A;  3I4V A;  4R3D A;  4FW9 A;  1IY0 A;  1QQW A;  2DXI A;  2CHQ A;  3NBI A;  2G5G X;  2I7N A;  5KPZ A;  1UM8 A;  3FTC A;  5EP2 A;  2Z4R A;  3SMS A;  2H1R A;  2M60 A;  2YQZ A;  4DUZ M;  2C99 A;  3GLF A;  2UUB M;  1SXJ B;  5EP1 A;  3A42 A;  2D7G A;  5IRE B;  4DV7 M;  3MK6 A;  2VQF M;  1GL7 A;  2UUC M;  2J7N A;  4X66 M;  2R46 A;  3SHG B;  4LJ5 A;  2BNK A;  1OFI A;  5E26 A;  2OQ4 A;  1WXQ A;  4QOS A;  2VQE M;  3TE6 A;  1TH3 A;  3UGJ A;  2R4J A;  5EXX A;  4FCT A;  3AFH A;  2X49 A;  5FTN A;  3PNV A;  2EUC A;  4AKI A;  4FD2 A;  4YY3 M;  1HT1 E;  1G4A E;  2DWZ B;  4K0K M;  4MGK E;  1TDZ A;  3L26 A;  2F5O A;  4DR2 M;  2CV1 A;  1G3I A;  3ZH9 B;  4QOZ C;  5BPV A;  1NJG A;  4LF9 M;  5ITU A;  1NSF A;  3EIE A;  2X8A A;  4B3S M;  1K3X A;  2NQ8 C;  4DR1 M;  1PJI A;  1GL6 A;  3I51 A;  1TGU A;  3T38 A;  3GLH A;  3GPY A;  1HNW M;  2Y20 A;  4GMQ A;  3SAW A;  3SMP A;  2QEN A;  3KP1 E;  2UXB M;  1IQP A;  3TWL A;  4GC9 A;  1R2Z A;  5KO3 A;  1R2Y A;  4M9Z A;  2V1C A;  5EXT A;  2F5Q A;  3JAM S;  2F4V M;  3FTD A;  1IN6 A;  4KOD A;  1PJJ A;  4BBA A;  1N33 M;  3GQ3 A;  1XMQ M;  4I4L A;  3SBJ A;  4LJA A;  3UZU A;  2Z3X A;  3LMM A;  5EP4 A;  1N78 A;  4CIS A;  3KOZ E;  3HKP A;  4IBB A;  5EXS A;  4QNM A;  4QHT A;  1IM2 A;  4G4Q A;  4Z6Y A;  5FSW A;  2F5P A;  2XH9 A;  4L78 A;  1XC8 A;  1J7K A;  1L1T A;  4B3T M;  4G6Z A;  4YHH M;  4JXJ A;  1Z6T A;  3IG5 A;  1EE8 A;  4NOO B;  3K2L A;  3WHK A;  5FTM A;  4DR7 M;  4LZJ A;  1SXJ E;  1NY5 A;  4LJ9 A;  4B7G A;  3NWL A;  1QAO A;  3GRR A;  3GLI A;  4LF4 M;  5KQD A;  4IBJ A;  3L28 A;  3GPP A;  4AI6 A;  3A45 A;  5LMU M;  3U6O A;  3SFZ A;  2FE8 A;  3U6M A;  1QYR A;  3GPU A;  4LG2 A;  3L2A A;  4LY6 A;  1SXJ D;  3GRV A;  1IBK M;  2QBY A;  3LQR A;  2UU9 M;  4AKH A;  2X4A A;  4QHS A;  2ZBK B;  3FUW A;  1I4W A;  3A98 B;  4PDG A;  1N34 M;  4GHL A;  3SAU A;  4NXN M;  3FYD A;  3M7G A;  3U61 A;  4AG6 A;  2UXD M;  2XFT A;  4DV0 M;  2QBY B;  1IXZ A;  3KP0 E;  5LMN M;  2W82 A;  2ERC A;  1SXJ C;  2Y0Q A;  4LJ4 A;  3T15 A;  3KSJ A;  4OW0 A;  3U6P A;  1KSF X;  3U61 B;  1D2N A;  3TL4 X;  2KA6 B;  2R45 A;  4RF0 A;  1N32 M;  3SYL A;  1DO2 A;  5EXP A;  4GH9 A;  3RFW A;  3TQS A;  1KFV A;  4I8O A;  3AJI B;  1J09 A;  2J7O A;  7CAT A;  4JI0 M;  2XEP A;  3K92 A;  4MGZ E;  3AOE A;  3GO8 A;  1QVR A;  2CE7 A;  3FUX A;  5DYI A;  3THG A;  4RNA A;  2RGH A;  3D8B A;  1IN5 A;  2K47 A;  4LJ6 A;  4L4U A;  5A2Q S;  1SXJ A;  2YNM D;  3KW6 A;  4KO8 A;  1HQY E;  3DZD A;  4LJ8 A;  2R4E A;  2KRK A;  4DV2 M;  4NXM M;  3L27 A;  4MGH A;  4IJF A;  3L25 A;  1ORY B;  4LCB A;  1IXS B;  3VKH A;  4LZZ A;  1YUB A;  2C9O A;  3AL0 C;  4DR6 M;  3FKE A;  1Z5B A;  1XXH A;  4LRS A;  4CGY B;  2QZ4 A;  4AG5 A;  5KPT A;  2C96 A;  4IBE A;  3VDU A;  4MB7 A;  4PDI A;  3J80 S;  1XXH B;  3D8L A;  2XLJ A;  2XZU A;  1XNQ M;  1L1Z A;  2UUA M;  3WHL A;  1QAM A;  4DR5 M;  4A3V B;  4M9X A;  2ZAM A;  4B08 A;  2CV0 A;  1TDH A;  1G8P A;  2C5R A;  3W0F A;  1X37 A;  4GC5 A;  3MJ5 A;  5EJC A;  2KRU A;  3QAU A;  4NRV A;  1W5T A;  3SAR A;  4D81 A;  1N36 M;  2I7P A;  3L29 A;  3SYK A;  2DHR A;  4II7 A;  3U6S A;  2QCU A;  2FOI C;  3Q8X A;  1OJL A;  4M0W A;  4QNR A;  3GP1 A;  3VLF B;  3UJN A;  3KFU G;  5H37 D;  3GLG A;  3ZCB B;  3A46 A;  3U5Z A;  2LWX A;  1TH2 A;  3HJQ A;  4M9S A;  4B7H A;  1FNN A;  4LF6 M;  3LVV A;  1GVN A;  4GKJ M;  2KXE A;  4HL4 A;  4JI3 M;  3GLG B;  4DV6 M;  4NRW A;  3HJ8 A;  1DO0 A;  4X65 M;  3U5Z B;  1JQJ C;  2ZM6 M;  4JI1 M;  1G59 A;  4GRI A;  2QP9 X;  1GLN A;  4LFC M;  2Z7J A;  2FFJ A;  3U60 A;  4JI4 M;  3W0L B;  5ITR A;  3BOS A;  3ILK A;  5JI2 E;  4AQY M;  4BLC A;  2HCB A;  3PNY A;  5FTK A;  1DGG A;  1L2B A;  3FTE A;  3U60 B;  4IJE A;  8CAT A;  4CHT B;  1IY2 A;  2Z4S A;  3J7B A;  4FCV A;  1PM5 A;  2C98 A;  1IXR C;  2CHV A;  3M6A A;  4PCZ A;  3VK7 A;  1JR3 D;  1XHB A;  2UXC M;  1GKI A;  1YE9 A;  2AHM A;  2O5R A;  5E6J A;  2V6Z M;  1K82 A;  2L7H A;  3HHY A;  3HU3 A;  1LV7 A;  4JI6 M;  2Y21 A;  1FJG M;  4S12 A;  3TPZ A;  2XF3 A;  1HQC A;  3OTO M;  3ZC7 B;  2BJW A;  3AOE C;  4DV3 M;  3AV0 A;  3UK6 A;  3TWK A;  1OFH A;  1G41 A;  2YR0 A;  2E5L M;  2DWN A;  2DVW B;  3J81 S;  5KPR A;  2CUZ A;  1E9R A;  4NL4 H;  4HLQ A;  3HU1 A;  1L8Q A;  1VDD A;  3CF0 A;  1YSY A;  1NVM A;  2XSZ D;  4JYA M;  2XGN A;  1IBL M;  4LF7 M;  1NNU C;  3CTW B;  4DR4 M;  3GQ4 A;  1KYI A;  5DYG A;  3JR5 A;  4WUR A;  1NY6 A;  1I94 M;  1JR3 A;  1N77 A;  1Z5A A;  4B7F A;  3U6C A;  2RGO A;  4X62 M;  3FTF A;  1Q3B A;  4DV5 M;  2P5T A;  3H4M A;  2V1U A;  2R62 A;  2L6O A;  1HT2 E;  2YFQ A;  1E94 E;  1Q3C A;  4IIW A;  2HL7 A;  4JI2 M;  5IT9 S;  3FYC A;  3R8F A;  3HHW A;  3U6L A;  3KS4 A;  4D80 A;  2OPF A;  4ZPX A;  2LNH C;  4LFA M;  4AKG A;  1ZQ9 A;  3J2P B;  3J7A S;  2FNA A;  1Z59 A;  3TWM A;  1Z5C A;  4OVZ A;  1H6U A;  2KW0 A;  3RGS A;  5C18 A;  4OX9 M;  4IBK A;  4XGI A;  4ITQ A;  4MGY E;  2CV2 A;  3CF6 E;  4LGY A;  4OVZ B;  2XSZ A;  2A5Y B;  5GKN A;  4OU7 A;  2Y0T A;  3PVS A;  4NSR A;  3CF2 A;  3GQ5 A;  2CEA A;  3M0E A;  3KSX A;  1T3T A;  5JI3 E;  1L2D A;  4IBI A;  3AKZ A;  3HJS A;  3GRU A;  3K8Z A;  1DGB A;  5ITT A;  4JI7 M;  2BJV A;  1QAQ A;  3IG8 A;  3GLF B;  1E32 A;  3HHZ A;  4TUW A;  3T1H M;  2CHG A;  3KVW A;  4GKK M;  2DZO B;  2Q2E B;  4FVM A;  5KQ8 A;  1L2C A;  3HHX A;  5FTL A;  5ITX E;  1QZM A;  4DUY M;  1C1K A;  4Z8X A;  1K3W A;  2XZF A;  4GIT A;  4P16 A;  4MGI E;  3E4R A;  1TH4 A;  3E9S A;  4FCW A;  4IBG A;  1HNZ M;  3SAT A;  4GIP A;  4KHP M;  1MX0 A;  1HR0 M;  4BB9 A;  4FWH A;  4PD2 A;  4JN6 A;  5ITQ A;  4M0D A;  3J27 B;  1R7R A;  2KZS A;  4LGM A;  4DV4 M;  3JR4 A;  4LF5 M;  5EP3 A;  3KOY E;  3UMM A;  1IN8 A;  3B9P A;  4B3R M;  1NHW C;  5EQT A;  1IBM M;  2DZN B;  4LJ7 A;  3R9X B;  3EIH A;  4AZF A;  4G4N A;  3U6Q A;  4REZ A;  4JI8 M;  4KLN A;  1NHG C;  4I5S A;  5BR8 M;  2D7E A;  2KEB A;  1E9S A;  3PFI A;  2LH0 A;  3HGI A;  3GLH B;  5FLX S;  3GRY A;  3FUV A;  2R18 A;  4DV1 M;  3FUU A;  3FUT A;  2DWM A;  3KOW E;  2XFS A;  4IBC A;  3DA1 A;  4JI5 M;  4RF1 A;  2G8L A;  3QWL A;  1XWI A;  2VII A;  4L15 A;  2LXE A;  1DGH A;  3VKG A;  5C1B A;  4IBF A;  2CFO A;  3DFZ A;  4L16 A;  1R6B X;  2JA2 A;  4G4R A;  4DR3 M;  4GHA A;  4AW4 A;  3FD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...