4QOZC

Crystal structure of the histone mrna stem-loop, stem-loop binding protein (phosphorylated), and 3'hexo ternary complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
73
structure length
72
Chain Sequence
b'DFETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPKPNKFKKYSRRSWDQQIKLWKVALHFWDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords histone mRNA stem-loop
publication title Molecular mechanisms for the regulation of histone mRNA stem-loop-binding protein by phosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna/hydrolase/rna binding protein
total genus 22
structure length 72
sequence length 73
ec nomenclature
pdb deposition date 2014-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15247 SLBP_RNA_bind Histone RNA hairpin-binding protein RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1120 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4qozC00
4QOZC 4L8RC 4TUWA
chains in the Genus database with same CATH superfamily
1R4GA 4I8OA 1JQJC 2J7OA 4P16A 4WURA 3FTFA 3RGSA 2OPFA 1Z59A 1J09A 2CHGA 2X49A 1Q3BA 3FRIA 2UUBM 3GLIA 1N34M 4OVZB 1QAMA 3DA1A 2UU9M 2K0BX 1V92A 4NSRA 3HU3A 1L2DA 1QDTA 1CUKA 5FTLA 1Q3CA 2ERCA 2CV1A 2DKLA 4G3OA 3KXEC 1AIPC 4PDGA 3U6QA 3H4JA 1MJGM 2D7HA 2F4VM 1V33A 2G8LA 3PNYA 4FWGA 2JY7A 2DAIA 2YFQA 1DGBA 3W68A 3BBZA 2FE8A 1TDHA 1D2NA 4JI1M 4TUWA 1Q02A 2OO9A 4DR4M 1OFIA 1E32A 3GQ3A 2RGOA 3KW6A 4QHTA 3B7NA 2JZ0A 4K0KM 1XXHB 4AZFA 5EP3A 1IBMM 3KS4A 4XK8F 2KNZA 4GMQA 5JI3E 3HU1A 2LVOC 3GRRA 1F4IA 4JI2M 1PJSA 1SXJE 4LRTA 2RGHA 3MK6A 4BB9A 2F5SA 4DUYM 2KHHA 2Z7JA 2R18A 3E4RA 3VK8A 3PNVA 4B7FA 1YE9A 5BR8M 3TQSA 3LW5F 4DV0M 4PCZA 1ZMUA 2LVNC 3L28A 3GPUA 1R2ZA 2F5NA 3E46A 1PJQA 1OKSA 1PJIA 1A5TA 2MJ5B 4GKJM 3GLFA 3J7BA 2EUCA 3SAVA 3DOAA 1FNNA 4L15A 4NRVA 2Z4SA 3CTWB 3FTCA 1FJGM 2LTUA 4AKGA 5LMUM 1IN5A 3L2AA 4G6ZA 4LGMA 4RF1A 4Y28F 3L25A 5JI2E 1W5TA 5EJCA 3SAWA 1WIVA 2WSFF 4KLNA 1XMQM 2C99A 2QPAA 4BLCA 3LQQA 2UUCM 3D8BA 3HZJA 4I81A 2CV0A 3I01M 3GLHB 3U60A 4FW9A 5H37D 5KO3A 4LJ4A 3KS8A 3M6AA 3HHXA 1HNXM 1TH4A 2D7EA 1XWIA 4KODA 4DBGB 4Q7JA 1XXHE 3R9XB 1E9RA 1ZQ9A 2VIIA 1TH3A 1T3TA 3C9PA 1N77A 4UN2B 4B3TM 1IN8A 1L8QA 3HJ8A 8CATA 1Y8GA 5ITXA 4A3VB 1KYIA 1DGGA 2R46A 2X4AA 3EIHA 5EXSA 2JWSA 3TPZA 3D8LA 2ZTCA 3CGWA 1HNZM 3SFZA 4LF9M 1GL7A 4LZZA 1JB0F 1Z6TA 3K9PA 4PT5A 3SYLA 2F5OA 3C3EA 4YY3M 1EIJA 2C96A 3AJIB 1V34A 4KHPM 1TDZA 1X37A 4LJAA 5DYGA 2Z3XA 2F5QA 1K3XA 1WR1B 1XNRM 3BXWA 2Y0QA 1NHWC 3IG5A 4LRSA 1NJFA 4S12A 4G4NA 4PD2A 2J7NA 5ITUA 1R6BX 3GPYA 1K82A 2UUAM 2VDBB 1K3WA 1PJJA 2GQFA 2BJVA 3T6PA 2QZ4A 2OOAA 5DFLA 2QP9X 2CWBA 2HL7A 2EKFA 3K1JA 4REZA 5DYIA 3VKGA 3C3DA 3GRUA 4NXMM 2L4EA 1EE8A 4LJ5A 2R45A 1IY0A 1MN3A 2KEBA 2KRUA 3V76A 1N75A 2Q2EB 3T1HM 1Z5AA 2K6BA 2DWZB 2EO2A 1VQ1A 1WJ7A 5EXXA 3L27A 3HHWA 1IBKM 3U61B 3HJQA 4B3SM 2APLA 2XEPA 1OAIA 3SASA 2LHGA 2KW0A 2DAGA 4NSOB 1R7RA 3ILKA 4LJ7A 3GRVA 2XSZA 3B9PA 3A45A 5EXTA 1SG9A 5E6JA 3UMMA 2R0IA 1J5EM 2QHOB 1IBLM 2M5ZA 3Q8GA 3FUVA 1NV8A 5KPZA 4JI6M 2V1CA 4II7A 3GLIE 3KVWA 4LFAM 2MH8A 5ITQA 2I7NA 1QZMA 2LVAA 1PGYA 2VF7A 1VG5A 3JAMS 1Z5BA 4JI0M 1HQYE 2H5XA 3CF2A 4MM3B 5FTJA 4DR3M 1D0KA 3SMSA 4DV6M 4QNRA 3CF6E 3HU2A 1LTMA 3K2LA 3FTEA 4LF4M 2DI0A 3U60B 5EXPA 1NY5A 3TWMA 3SBJA 4CIZA 3I04M 4JI5M 2KZSA 4WW0A 3WHKA 4MGIE 2DVWB 2R6FA 2FS1A 3AOEC 4FCTA 2KZUA 3W67A 5ITYA 4M9XA 5BPVA 1NHGC 3U5ZA 4LJ6A 1G3IA 4L8RC 2V1UA 3JR5A 4I4LA 3VKHA 1T6OA 1ZMWA 2Y21A 3LCVB 4HLQA 2MR9A 3GPPA 3KOZE 2FNAA 3MMPA 4LCBA 1C7YA 1JR3A 2DENA 4L4UA 2KA6B 1XMOM 3ZCBB 2BWEA 4MGZE 4GC9A 4G4QA 2YNMD 3GLFE 2O5RA 2EJSA 3KOYE 2LVQD 1L2CA 1IXSB 2WSCF 2BWBA 4OU7A 2XSZD 2HCBA 3PFIA 2LBCA 3SC3A 3T38A 4X66M 4AG6A 3UJNA 4X62M 1GJTA 1OQYA 3BOSA 3FUXA 4FWHA 3T1YM 2L2DA 2EA0A 1MU5A 2G3QA 3DZDA 3NBXX 2LVPC 2VQEM 4JI3M 2XZFA 4LG2A 1GJSA 3B89A 4BBAA 4LY6A 4IBIA 3HY5A 2OQ4A 1J7KA 4AKHA 2K47A 1QAQA 2Y20A 2G5GX 4NOOB 3PVSA 1WGNA 1NVMA 3WHLA 4MH0E 1QUTA 3MJ5A 2H1RA 1MX0A 2KXEA 3KOWE 3UK6A 2QNJA 5FSWA 2DAKA 3U6LA 3QAUA 4IBGA 2XF3A 4CHTB 2CRUA 5ITXE 1G4AE 4OW0A 3IHPA 4M0WA 4I5SA 2M60A 4D81A 4M0DA 5IT9S 4LF8M 3DFZA 3NBIA 1AUAA 4PDIA 4JI4M 1QUSA 2JP7A 3K92A 4FCWA 4P17A 2ZM6M 1NJGA 1GLNA 1YSYA 4HL4A 2LXEA 4R71A 1GL6A 3VDPA 4DR1M 3SAUA 1GO5A 4GITA 2MROB 2KNAA 1VDLA 3LVVA 5KQDA 1IXZA 2O01F 3EIEA 3KOXE 3JR4A 1JR3D 3GLIB 3U6MA 4XBOA 3T15A 4L6V6 2JZ1A 2QBYA 4OX9M 2CP8A 2N35A 1LV7A 3GP1A 2HHHM 1D0LA 4IBBA 5A2QS 3KSXA 2DNAA 2L7IA 4JXJA 4R3DA 2BNKA 4MGYE 3J80S 3AOGA 2JY5A 1Z5CA 3I4VA 4CGYB 4KO8A 1NO1A 1OIPA 1Q39A 3UGJA 5EQTA 3U5ZB 3LCUA 3KFUG 4RF0A 4F1IA 2DWNA 5C1BA 1T43A 3AOEA 3B7QA 2XLJA 1C1KA 2JXNA 4IBJA 2QCUA 3HHYA 2I7PA 2YR0A 1HNWM 2Y0TA 4CJ6A 1XB2B 5KPTA 4RNAA 3PXGA 3GQ5A 1KFVA 3THGA 4R7GA 2A5YB 1G8PA 3SYKA 3AL0C 3Q8XA 5ITTA 1L2BA 2DZNB 4LF7M 4DV2M 2QENA 1QQWA 3E9SA 3FUWA 4X65M 2DZOB 3U6DA 2UXDM 4IJEA 2DAMA 2R4EA 1L1TA 2E5LM 3HWSA 3GLFB 1TTEA 1L1ZA 1NNUC 2LH0A 1ORYB 7CATA 2DWLA 3VLFB 3QYBA 3GLGA 4GHAA 2JUJA 4F2LA 4MGKE 2DHYA 4FD2A 5FTKA 3ZC7B 3J81S 2R4JA 3SHFA 2V6ZM 2O25A 1YLAA 1NSFA 3NWLA 4IIWA 3K9OA 3IECA 4LFBM 4GC5A 5IZ7D 3SMPA 3U6SA 4JI8M 3M7GA 3FD9A 4AKIA 2XGNA 4M9ZA 1VDDA 3GPXA 4G4RA 2JNHA 2ZANA 3M0EA 1I4WA 1NY6A 2AHMA 2GNOA 1R2YA 3U6PA 3AV0A 1ZV1A 4QNMA 3KP1E 2UXBM 3LVWA 5DNYA 1GKIA 3MHVC 4LF6M 1JR3E 1VEKA 1DGHA 5C18A 4B3MM 4LGYA 2JA2A 3U6CA 2JY6B 2L6OA 4DR2M 4IBCA 2KRKA 4B7GA 1IN6A 5LMNM 4FCVA 5KQ8A 3IG8A 2LNHC 5KPRA 2JY8A 3C58A 4DV1M 2QBYB 4NRWA 4DV4M 4LJ8A 2HWJA 3ZH9B 3GQ4A 5GKNA 3OTOM 3I51A 1OFHA 4IBKA 4ANRA 2C9CA 2EKKA 4QOSA 2OOBA 5FTMA 2CE7A 3LQRA 5E26A 5IWAM 1HQCA 4GKKM 5F3WA 1VEJA 1IY1A 3H4MA 1XC8A 4QOZC 3FUTA 1I94M 2XFTA 3TE6A 4CISA 5IREB 1ZMVA 4FWDA 4DV3M 2P5TA 3TL4X 4AQYM 3AFHA 3TWLA 3SARA 2C98A 5ITRA 2UXCM 1N33M 4AG5A 1HT1E 3HX3A 2LWXA 2MGWA 2VQFM 2XFSA 4JV5M 5EP1A 2C9OA 4D82A 2CV2A 3U61A 4JN6A 4B7HA 2CUZA 4DR5M 4DR6M 4Z8XA 1KSFX 2DAEA 1S3SA 3LMMA 1IQPA 1OIZA 1DGFA 1SXJA 3B7ZA 4IBEA 2HKJA 4IBDA 2RRUA 1WGLA 2XH9A 1NNJA 3RFWA 3FYDA 3FE3A 4JYAM 3F92A 1OAOC 1PRBA 1TGUA 2VF8A 3GLGB 4Z6YA 2DXIA 2J5YA 2R62A 4GHLA 3TWKA 1RU3A 4GRIA 1TF0B 3J27B 3HKPA 1NV9A 4OVZA 4QHSA 1G59A 3L29A 4LFCM 4WP2A 1IN4A 4LZJA 1VEGA 1XNQM 1G71A 1OJLA 1XHBA 2ZAMA 2K9DA 1IM2A 2DZLA 1UFZA 3RE8A 3FKEA 3HGIA 3HJSA 1DO0A 1QANA 3FUUA 2KDLA 1QYRA 1IXRC 3A42A 2FFJA 3GRYA 4GH9A 4NXNM 3FRHA 4HEOA 3W0LB 3ZQJA 1E9SA 4AW4A 1QVRA 1IY2A 4RKUF 1HT2E 2Z8YM 1WHCA 2FOIC 5L8RF 1DGHB 3AKZA 3RGPA 3HHZA 2C5RA 2L09A 2NQ8C 1HR0M 2R65A 1QDRA 2XZUA 2CHVA 1N36M 3E21A 3KSJA 1UM8A 4NL4H 3UZUA 3B74A 1XXHA 5FLXS 4AI6A 1H6UA 5EP4A 2D7GA 1OTRA 2ZBKB 2WZJA 4GEWA 3K8ZA 4DR7M 3I4YA 3A98B 4D80A 4ZPXA 3L26A 2L4FA 3A46A 3KP0E 2LHCA 1DO2A 4W5WA 3QWLA 3W0FA 1IXSA 1IN7A 4DUZM 1SXJC 4DV5M 3QYEA 2WSEF 2X8AA 4FVMA 4L78A 2B3TA 1P3QQ 4B08A 1D0MA 3SATA 4LJ9A 1N32M 4KT0F 4M9SA 3GLGE 1SXJD 3FYCA 3VDUA 1WXQA 2KNVA 3KDSE 1YUBA 3J2PB 2W82A 1QAOA 4XGIA 3GLHE 1GABA 3R8FA 5FTNA 4MGHA 3U6EA 1TH2A 1BVSA 2QQ8A 4NC6A 1TR8A 4DV7M 4L16A 5EP2A 2BJWA 1HJPA 1QZEA 3J7AS 3VFDA 2YQZA 1G41A 3FTDA 1PJTA 2CEAA 3CF0A 1E94E 4X64M 1IFYA 1DV0A 2R44A 4JI7M 3GLHA 3U6OA 2DHRA 1GVNA 2HAKA 4EIWA 1ZAEA 2FH0A 4B3RM 4IJFA 4ITQA 2F5PA 4MB7A 2DWMA 1W5SA 4IBFA 1PM5A 4LF5M 1N78A 2CFOA 2L7HA 3SHGB 1SXJB 2QSFX 4G4OA 2ZTDA 2RKOA 2Z4RA 2ZAOA 2CHQA 3VK7A 1EFUB 4GIPA 1R5LA 3GO8A 4YHHM
chains in the Genus database with same CATH topology
4I8OA 4P16A 1JQJC 2J7OA 4WURA 3FTFA 3RGSA 2OPFA 1Z59A 1J09A 2CHGA 2X49A 1Q3BA 2UUBM 3GLIA 1N34M 4OVZB 1QAMA 3DA1A 2UU9M 4NSRA 3HU3A 1L2DA 5FTLA 1Q3CA 2ERCA 2CV1A 3KXEC 4PDGA 3U6QA 2D7HA 2F4VM 3PNYA 2G8LA 4FWGA 2YFQA 1DGBA 2FE8A 1TDHA 1D2NA 4JI1M 4TUWA 4DR4M 1OFIA 1E32A 3GQ3A 2RGOA 3KW6A 4QHTA 4K0KM 1XXHB 4AZFA 5EP3A 1IBMM 3KS4A 4GMQA 5JI3E 3HU1A 3GRRA 4JI2M 1SXJE 4LRTA 2RGHA 3MK6A 4BB9A 2F5SA 4DUYM 2Z7JA 2R18A 3E4RA 3VK8A 3PNVA 4B7FA 1YE9A 5BR8M 3TQSA 4DV0M 4PCZA 3L28A 2F5NA 1R2ZA 3GPUA 1PJIA 4GKJM 3GLFA 3J7BA 2EUCA 3SAVA 3DOAA 1FNNA 4L15A 4NRVA 2Z4SA 3CTWB 3FTCA 1FJGM 4AKGA 5LMUM 1IN5A 3L2AA 4G6ZA 4LGMA 4RF1A 3L25A 5JI2E 1W5TA 5EJCA 3SAWA 4KLNA 1XMQM 2C99A 2QPAA 4BLCA 3LQQA 2UUCM 3D8BA 4I81A 2CV0A 3GLHB 3U60A 4FW9A 5H37D 5KO3A 4LJ4A 3KS8A 3M6AA 3HHXA 1HNXM 1TH4A 2D7EA 1XWIA 4KODA 3R9XB 1E9RA 1ZQ9A 2VIIA 1TH3A 1T3TA 1N77A 4B3TM 1IN8A 1L8QA 3HJ8A 8CATA 5ITXA 4A3VB 1KYIA 1DGGA 2R46A 2X4AA 3EIHA 5EXSA 3TPZA 3D8LA 1HNZM 4LF9M 3SFZA 1GL7A 4LZZA 1Z6TA 4PT5A 3SYLA 2F5OA 4YY3M 2C96A 3AJIB 4KHPM 1TDZA 1X37A 4LJAA 5DYGA 2Z3XA 2F5QA 1K3XA 1XNRM 2Y0QA 1NHWC 3IG5A 4LRSA 1NJFA 4S12A 4G4NA 4PD2A 2J7NA 5ITUA 1R6BX 3GPYA 1K82A 2UUAM 1K3WA 1PJJA 2BJVA 2QZ4A 2QP9X 2HL7A 3K1JA 4REZA 5DYIA 3VKGA 3GRUA 4NXMM 1EE8A 4LJ5A 2R45A 1IY0A 2KEBA 2KRUA 3T1HM 1N75A 2Q2EB 1Z5AA 2DWZB 2EO2A 5EXXA 1IBKM 3L27A 3HHWA 3U61B 3HJQA 4B3SM 2XEPA 3SASA 2KW0A 4NSOB 1R7RA 3ILKA 4LJ7A 3GRVA 2XSZA 3B9PA 3A45A 5EXTA 3UMMA 5E6JA 1J5EM 2DWNA 1XNQM 1IBLM 1N32M 2M5ZA 5KPZA 3FUVA 4JI6M 2V1CA 4II7A 3KVWA 4LFAM 5ITQA 2I7NA 1QZMA 3JAMS 1Z5BA 4JI0M 1HQYE 3CF2A 4MM3B 5FTJA 4DR3M 3SMSA 4DV6M 4QNRA 3CF6E 3HU2A 3K2LA 3FTEA 4LF4M 3U60B 5EXPA 1NY5A 3TWMA 3SBJA 4JI5M 2KZSA 4WW0A 3WHKA 4MGIE 2DVWB 3AOEC 4FCTA 2KZUA 5ITYA 4M9XA 5BPVA 1NHGC 3U5ZA 4LJ6A 1G3IA 4L8RC 2V1UA 3JR5A 4I4LA 3VKHA 3GPPA 2Y21A 4HLQA 3KOZE 2FNAA 4LCBA 1JR3A 4L4UA 2KA6B 1XMOM 3ZCBB 4MGZE 4GC9A 4G4QA 2YNMD 2O5RA 1L2CA 3KOYE 1IXSB 4OU7A 2XSZD 2HCBA 3PFIA 3SC3A 3T38A 4X66M 4AG6A 3UJNA 4X62M 3T1YM 3BOSA 4FWHA 3FUXA 2EA0A 1MU5A 3DZDA 2VQEM 2XZFA 4LG2A 4JI3M 4BBAA 4LY6A 4IBIA 2OQ4A 1J7KA 4AKHA 2K47A 1QAQA 2Y20A 2G5GX 4NOOB 3PVSA 1NVMA 3WHLA 4MH0E 3MJ5A 2H1RA 1MX0A 2KXEA 3KOWE 3UK6A 5FSWA 3U6LA 3QAUA 4IBGA 2XF3A 4CHTB 5ITXE 1G4AE 4OW0A 4M0WA 4I5SA 2M60A 4D81A 4M0DA 5IT9S 4LF8M 3DFZA 3NBIA 4PDIA 4JI4M 3K92A 4FCWA 2ZM6M 1NJGA 1GLNA 1YSYA 4HL4A 2LXEA 1GL6A 3VDPA 4DR1M 3SAUA 4GITA 3LVVA 5KQDA 1IXZA 3EIEA 3JR4A 3KOXE 1JR3D 3GLIB 3U6MA 4XBOA 3T15A 2QBYA 4OX9M 3GP1A 1LV7A 2HHHM 4IBBA 5A2QS 3KSXA 2L7IA 4JXJA 4R3DA 2BNKA 4MGYE 3J80S 3AOGA 1Z5CA 3I4VA 4CGYB 4KO8A 1Q39A 3UGJA 5EQTA 3U5ZB 3KFUG 4RF0A 5C1BA 3AOEA 2XLJA 1C1KA 4IBJA 2QCUA 3HHYA 2I7PA 2YR0A 1HNWM 2Y0TA 3GQ5A 1KFVA 5KPTA 4RNAA 3PXGA 3THGA 4R7GA 2A5YB 1G8PA 3SYKA 3AL0C 3Q8XA 5ITTA 1L2BA 2DZNB 4LF7M 4DV2M 2QENA 1QQWA 3E9SA 3FUWA 4X65M 2DZOB 3U6DA 2UXDM 4IJEA 1L1TA 2R4EA 2E5LM 3HWSA 3GLFB 1L1ZA 1NNUC 2LH0A 1ORYB 7CATA 2DWLA 3VLFB 3GLGA 4GHAA 4MGKE 5FTKA 4FD2A 3ZC7B 3J81S 2R4JA 3SHFA 2V6ZM 4IIWA 1NSFA 3NWLA 4LFBM 4GC5A 5IZ7D 3SMPA 3U6SA 4JI8M 3M7GA 3FD9A 4AKIA 2XGNA 4M9ZA 1VDDA 3GPXA 4G4RA 2ZANA 3M0EA 1I4WA 1NY6A 2AHMA 1R2YA 3U6PA 3AV0A 4QNMA 3KP1E 2UXBM 3LVWA 5DNYA 1GKIA 3MHVC 4LF6M 1DGHA 5C18A 4B3MM 4LGYA 2JA2A 3U6CA 2L6OA 4DR2M 4IBCA 2KRKA 4B7GA 1IN6A 5LMNM 4FCVA 5KQ8A 3IG8A 2LNHC 5KPRA 3C58A 4DV1M 4NRWA 2QBYB 4DV4M 4LJ8A 3ZH9B 3GQ4A 5GKNA 3OTOM 3I51A 1OFHA 4IBKA 2C9CA 4QOSA 5FTMA 2CE7A 3LQRA 5E26A 5IWAM 1HQCA 4GKKM 5F3WA 1IY1A 3H4MA 1XC8A 4QOZC 3FUTA 1I94M 2XFTA 3TE6A 4CISA 5IREB 4DV3M 4FWDA 4AQYM 2P5TA 3TL4X 3SARA 3AFHA 3TWLA 2UXCM 2C98A 5ITRA 1N33M 4AG5A 1HT1E 2LWXA 2VQFM 2XFSA 4JV5M 5EP1A 2C9OA 4D82A 2CV2A 3U61A 4JN6A 4B7HA 2CUZA 4DR5M 4DR6M 4Z8XA 1KSFX 1S3SA 3LMMA 1IQPA 1DGFA 1SXJA 4IBEA 2HKJA 4IBDA 2XH9A 1NNJA 3RFWA 3FYDA 4JYAM 1TGUA 3GLGB 4Z6YA 2DXIA 2R62A 4GHLA 3TWKA 4GRIA 4QHSA 3J27B 3HKPA 1G59A 4OVZA 4LFCM 3L29A 1IN4A 4LZJA 1OJLA 1XHBA 2ZAMA 1IM2A 3RE8A 3FKEA 3HGIA 3HJSA 1DO0A 1QANA 3FUUA 1QYRA 1IXRC 3A42A 2FFJA 3GRYA 4GH9A 4NXNM 3W0LB 1E9SA 4AW4A 1QVRA 1IY2A 1HT2E 2FOIC 2C5RA 1DGHB 3AKZA 3RGPA 3HHZA 1HR0M 2L09A 2NQ8C 2R65A 2XZUA 1N36M 2CHVA 3KSJA 4NL4H 1UM8A 3UZUA 1XXHA 5FLXS 4AI6A 1H6UA 5EP4A 2D7GA 2ZBKB 4DR7M 3K8ZA 3I4YA 3A98B 4D80A 4ZPXA 3L26A 3A46A 3KP0E 1DO2A 4W5WA 3QWLA 3W0FA 1IN7A 4DUZM 1SXJC 4DV5M 4FVMA 2X8AA 4L78A 4B08A 3SATA 4LJ9A 4M9SA 1SXJD 3FYCA 3VDUA 1WXQA 3KDSE 1YUBA 3J2PB 2W82A 1QAOA 4XGIA 3R8FA 5FTNA 4MGHA 3U6EA 1TH2A 4DV7M 5EP2A 2BJWA 3J7AS 3VFDA 2YQZA 1G41A 3FTDA 2CEAA 3CF0A 1E94E 4X64M 4JI7M 3GLHA 3U6OA 2DHRA 1GVNA 4EIWA 1ZAEA 4B3RM 4IJFA 4ITQA 2F5PA 4MB7A 2DWMA 1W5SA 4IBFA 1PM5A 4LF5M 1N78A 2CFOA 2L7HA 3SHGB 1SXJB 4G4OA 2RKOA 2Z4RA 2ZAOA 2CHQA 3VK7A 4GIPA 4L16A 3GO8A 4YHHM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QOZ C;  4L8R C;  4TUW A; 
#chains in the Genus database with same CATH topology
 1R4G A;  4I8O A;  1JQJ C;  2J7O A;  4P16 A;  4WUR A;  3FTF A;  3RGS A;  2OPF A;  1Z59 A;  1J09 A;  2CHG A;  2X49 A;  1Q3B A;  3FRI A;  2UUB M;  3GLI A;  1N34 M;  4OVZ B;  1QAM A;  3DA1 A;  2UU9 M;  2K0B X;  1V92 A;  4NSR A;  3HU3 A;  1L2D A;  1QDT A;  1CUK A;  5FTL A;  1Q3C A;  2ERC A;  2CV1 A;  2DKL A;  4G3O A;  3KXE C;  1AIP C;  4PDG A;  3U6Q A;  3H4J A;  1MJG M;  2D7H A;  2F4V M;  1V33 A;  2G8L A;  3PNY A;  4FWG A;  2JY7 A;  2DAI A;  2YFQ A;  1DGB A;  3W68 A;  3BBZ A;  2FE8 A;  1TDH A;  1D2N A;  4JI1 M;  4TUW A;  1Q02 A;  2OO9 A;  4DR4 M;  1OFI A;  1E32 A;  3GQ3 A;  2RGO A;  3KW6 A;  4QHT A;  3B7N A;  2JZ0 A;  4K0K M;  1XXH B;  4AZF A;  5EP3 A;  1IBM M;  3KS4 A;  4XK8 F;  2KNZ A;  4GMQ A;  5JI3 E;  3HU1 A;  2LVO C;  3GRR A;  1F4I A;  4JI2 M;  1PJS A;  1SXJ E;  4LRT A;  2RGH A;  3MK6 A;  4BB9 A;  2F5S A;  4DUY M;  2KHH A;  2Z7J A;  2R18 A;  3E4R A;  3VK8 A;  3PNV A;  4B7F A;  1YE9 A;  5BR8 M;  3TQS A;  3LW5 F;  4DV0 M;  4PCZ A;  1ZMU A;  2LVN C;  3L28 A;  3GPU A;  1R2Z A;  2F5N A;  3E46 A;  1PJQ A;  1OKS A;  1PJI A;  1A5T A;  2MJ5 B;  4GKJ M;  3GLF A;  3J7B A;  2EUC A;  3SAV A;  3DOA A;  1FNN A;  4L15 A;  4NRV A;  2Z4S A;  3CTW B;  3FTC A;  1FJG M;  2LTU A;  4AKG A;  5LMU M;  1IN5 A;  3L2A A;  4G6Z A;  4LGM A;  4RF1 A;  4Y28 F;  3L25 A;  5JI2 E;  1W5T A;  5EJC A;  3SAW A;  1WIV A;  2WSF F;  4KLN A;  1XMQ M;  2C99 A;  2QPA A;  4BLC A;  3LQQ A;  2UUC M;  3D8B A;  3HZJ A;  4I81 A;  2CV0 A;  3I01 M;  3GLH B;  3U60 A;  4FW9 A;  5H37 D;  5KO3 A;  4LJ4 A;  3KS8 A;  3M6A A;  3HHX A;  1HNX M;  1TH4 A;  2D7E A;  1XWI A;  4KOD A;  4DBG B;  4Q7J A;  1XXH E;  3R9X B;  1E9R A;  1ZQ9 A;  2VII A;  1TH3 A;  1T3T A;  3C9P A;  1N77 A;  4UN2 B;  4B3T M;  1IN8 A;  1L8Q A;  3HJ8 A;  8CAT A;  1Y8G A;  5ITX A;  4A3V B;  1KYI A;  1DGG A;  2R46 A;  2X4A A;  3EIH A;  5EXS A;  2JWS A;  3TPZ A;  3D8L A;  2ZTC A;  3CGW A;  1HNZ M;  3SFZ A;  4LF9 M;  1GL7 A;  4LZZ A;  1JB0 F;  1Z6T A;  3K9P A;  4PT5 A;  3SYL A;  2F5O A;  3C3E A;  4YY3 M;  1EIJ A;  2C96 A;  3AJI B;  1V34 A;  4KHP M;  1TDZ A;  1X37 A;  4LJA A;  5DYG A;  2Z3X A;  2F5Q A;  1K3X A;  1WR1 B;  1XNR M;  3BXW A;  2Y0Q A;  1NHW C;  3IG5 A;  4LRS A;  1NJF A;  4S12 A;  4G4N A;  4PD2 A;  2J7N A;  5ITU A;  1R6B X;  3GPY A;  1K82 A;  2UUA M;  2VDB B;  1K3W A;  1PJJ A;  2GQF A;  2BJV A;  3T6P A;  2QZ4 A;  2OOA A;  5DFL A;  2QP9 X;  2CWB A;  2HL7 A;  2EKF A;  3K1J A;  4REZ A;  5DYI A;  3VKG A;  3C3D A;  3GRU A;  4NXM M;  2L4E A;  1EE8 A;  4LJ5 A;  2R45 A;  1IY0 A;  1MN3 A;  2KEB A;  2KRU A;  3V76 A;  1N75 A;  2Q2E B;  3T1H M;  1Z5A A;  2K6B A;  2DWZ B;  2EO2 A;  1VQ1 A;  1WJ7 A;  5EXX A;  3L27 A;  3HHW A;  1IBK M;  3U61 B;  3HJQ A;  4B3S M;  2APL A;  2XEP A;  1OAI A;  3SAS A;  2LHG A;  2KW0 A;  2DAG A;  4NSO B;  1R7R A;  3ILK A;  4LJ7 A;  3GRV A;  2XSZ A;  3B9P A;  3A45 A;  5EXT A;  1SG9 A;  5E6J A;  3UMM A;  2R0I A;  1J5E M;  2QHO B;  1IBL M;  2M5Z A;  3Q8G A;  3FUV A;  1NV8 A;  5KPZ A;  4JI6 M;  2V1C A;  4II7 A;  3GLI E;  3KVW A;  4LFA M;  2MH8 A;  5ITQ A;  2I7N A;  1QZM A;  2LVA A;  1PGY A;  2VF7 A;  1VG5 A;  3JAM S;  1Z5B A;  4JI0 M;  1HQY E;  2H5X A;  3CF2 A;  4MM3 B;  5FTJ A;  4DR3 M;  1D0K A;  3SMS A;  4DV6 M;  4QNR A;  3CF6 E;  3HU2 A;  1LTM A;  3K2L A;  3FTE A;  4LF4 M;  2DI0 A;  3U60 B;  5EXP A;  1NY5 A;  3TWM A;  3SBJ A;  4CIZ A;  3I04 M;  4JI5 M;  2KZS A;  4WW0 A;  3WHK A;  4MGI E;  2DVW B;  2R6F A;  2FS1 A;  3AOE C;  4FCT A;  2KZU A;  3W67 A;  5ITY A;  4M9X A;  5BPV A;  1NHG C;  3U5Z A;  4LJ6 A;  1G3I A;  4L8R C;  2V1U A;  3JR5 A;  4I4L A;  3VKH A;  1T6O A;  1ZMW A;  2Y21 A;  3LCV B;  4HLQ A;  2MR9 A;  3GPP A;  3KOZ E;  2FNA A;  3MMP A;  4LCB A;  1C7Y A;  1JR3 A;  2DEN A;  4L4U A;  2KA6 B;  1XMO M;  3ZCB B;  2BWE A;  4MGZ E;  4GC9 A;  4G4Q A;  2YNM D;  3GLF E;  2O5R A;  2EJS A;  3KOY E;  2LVQ D;  1L2C A;  1IXS B;  2WSC F;  2BWB A;  4OU7 A;  2XSZ D;  2HCB A;  3PFI A;  2LBC A;  3SC3 A;  3T38 A;  4X66 M;  4AG6 A;  3UJN A;  4X62 M;  1GJT A;  1OQY A;  3BOS A;  3FUX A;  4FWH A;  3T1Y M;  2L2D A;  2EA0 A;  1MU5 A;  2G3Q A;  3DZD A;  3NBX X;  2LVP C;  2VQE M;  4JI3 M;  2XZF A;  4LG2 A;  1GJS A;  3B89 A;  4BBA A;  4LY6 A;  4IBI A;  3HY5 A;  2OQ4 A;  1J7K A;  4AKH A;  2K47 A;  1QAQ A;  2Y20 A;  2G5G X;  4NOO B;  3PVS A;  1WGN A;  1NVM A;  3WHL A;  4MH0 E;  1QUT A;  3MJ5 A;  2H1R A;  1MX0 A;  2KXE A;  3KOW E;  3UK6 A;  2QNJ A;  5FSW A;  2DAK A;  3U6L A;  3QAU A;  4IBG A;  2XF3 A;  4CHT B;  2CRU A;  5ITX E;  1G4A E;  4OW0 A;  3IHP A;  4M0W A;  4I5S A;  2M60 A;  4D81 A;  4M0D A;  5IT9 S;  4LF8 M;  3DFZ A;  3NBI A;  1AUA A;  4PDI A;  4JI4 M;  1QUS A;  2JP7 A;  3K92 A;  4FCW A;  4P17 A;  2ZM6 M;  1NJG A;  1GLN A;  1YSY A;  4HL4 A;  2LXE A;  4R71 A;  1GL6 A;  3VDP A;  4DR1 M;  3SAU A;  1GO5 A;  4GIT A;  2MRO B;  2KNA A;  1VDL A;  3LVV A;  5KQD A;  1IXZ A;  2O01 F;  3EIE A;  3KOX E;  3JR4 A;  1JR3 D;  3GLI B;  3U6M A;  4XBO A;  3T15 A;  4L6V 6;  2JZ1 A;  2QBY A;  4OX9 M;  2CP8 A;  2N35 A;  1LV7 A;  3GP1 A;  2HHH M;  1D0L A;  4IBB A;  5A2Q S;  3KSX A;  2DNA A;  2L7I A;  4JXJ A;  4R3D A;  2BNK A;  4MGY E;  3J80 S;  3AOG A;  2JY5 A;  1Z5C A;  3I4V A;  4CGY B;  4KO8 A;  1NO1 A;  1OIP A;  1Q39 A;  3UGJ A;  5EQT A;  3U5Z B;  3LCU A;  3KFU G;  4RF0 A;  4F1I A;  2DWN A;  5C1B A;  1T43 A;  3AOE A;  3B7Q A;  2XLJ A;  1C1K A;  2JXN A;  4IBJ A;  2QCU A;  3HHY A;  2I7P A;  2YR0 A;  1HNW M;  2Y0T A;  4CJ6 A;  1XB2 B;  5KPT A;  4RNA A;  3PXG A;  3GQ5 A;  1KFV A;  3THG A;  4R7G A;  2A5Y B;  1G8P A;  3SYK A;  3AL0 C;  3Q8X A;  5ITT A;  1L2B A;  2DZN B;  4LF7 M;  4DV2 M;  2QEN A;  1QQW A;  3E9S A;  3FUW A;  4X65 M;  2DZO B;  3U6D A;  2UXD M;  4IJE A;  2DAM A;  2R4E A;  1L1T A;  2E5L M;  3HWS A;  3GLF B;  1TTE A;  1L1Z A;  1NNU C;  2LH0 A;  1ORY B;  7CAT A;  2DWL A;  3VLF B;  3QYB A;  3GLG A;  4GHA A;  2JUJ A;  4F2L A;  4MGK E;  2DHY A;  4FD2 A;  5FTK A;  3ZC7 B;  3J81 S;  2R4J A;  3SHF A;  2V6Z M;  2O25 A;  1YLA A;  1NSF A;  3NWL A;  4IIW A;  3K9O A;  3IEC A;  4LFB M;  4GC5 A;  5IZ7 D;  3SMP A;  3U6S A;  4JI8 M;  3M7G A;  3FD9 A;  4AKI A;  2XGN A;  4M9Z A;  1VDD A;  3GPX A;  4G4R A;  2JNH A;  2ZAN A;  3M0E A;  1I4W A;  1NY6 A;  2AHM A;  2GNO A;  1R2Y A;  3U6P A;  3AV0 A;  1ZV1 A;  4QNM A;  3KP1 E;  2UXB M;  3LVW A;  5DNY A;  1GKI A;  3MHV C;  4LF6 M;  1JR3 E;  1VEK A;  1DGH A;  5C18 A;  4B3M M;  4LGY A;  2JA2 A;  3U6C A;  2JY6 B;  2L6O A;  4DR2 M;  4IBC A;  2KRK A;  4B7G A;  1IN6 A;  5LMN M;  4FCV A;  5KQ8 A;  3IG8 A;  2LNH C;  5KPR A;  2JY8 A;  3C58 A;  4DV1 M;  2QBY B;  4NRW A;  4DV4 M;  4LJ8 A;  2HWJ A;  3ZH9 B;  3GQ4 A;  5GKN A;  3OTO M;  3I51 A;  1OFH A;  4IBK A;  4ANR A;  2C9C A;  2EKK A;  4QOS A;  2OOB A;  5FTM A;  2CE7 A;  3LQR A;  5E26 A;  5IWA M;  1HQC A;  4GKK M;  5F3W A;  1VEJ A;  1IY1 A;  3H4M A;  1XC8 A;  4QOZ C;  3FUT A;  1I94 M;  2XFT A;  3TE6 A;  4CIS A;  5IRE B;  1ZMV A;  4FWD A;  4DV3 M;  2P5T A;  3TL4 X;  4AQY M;  3AFH A;  3TWL A;  3SAR A;  2C98 A;  5ITR A;  2UXC M;  1N33 M;  4AG5 A;  1HT1 E;  3HX3 A;  2LWX A;  2MGW A;  2VQF M;  2XFS A;  4JV5 M;  5EP1 A;  2C9O A;  4D82 A;  2CV2 A;  3U61 A;  4JN6 A;  4B7H A;  2CUZ A;  4DR5 M;  4DR6 M;  4Z8X A;  1KSF X;  2DAE A;  1S3S A;  3LMM A;  1IQP A;  1OIZ A;  1DGF A;  1SXJ A;  3B7Z A;  4IBE A;  2HKJ A;  4IBD A;  2RRU A;  1WGL A;  2XH9 A;  1NNJ A;  3RFW A;  3FYD A;  3FE3 A;  4JYA M;  3F92 A;  1OAO C;  1PRB A;  1TGU A;  2VF8 A;  3GLG B;  4Z6Y A;  2DXI A;  2J5Y A;  2R62 A;  4GHL A;  3TWK A;  1RU3 A;  4GRI A;  1TF0 B;  3J27 B;  3HKP A;  1NV9 A;  4OVZ A;  4QHS A;  1G59 A;  3L29 A;  4LFC M;  4WP2 A;  1IN4 A;  4LZJ A;  1VEG A;  1XNQ M;  1G71 A;  1OJL A;  1XHB A;  2ZAM A;  2K9D A;  1IM2 A;  2DZL A;  1UFZ A;  3RE8 A;  3FKE A;  3HGI A;  3HJS A;  1DO0 A;  1QAN A;  3FUU A;  2KDL A;  1QYR A;  1IXR C;  3A42 A;  2FFJ A;  3GRY A;  4GH9 A;  4NXN M;  3FRH A;  4HEO A;  3W0L B;  3ZQJ A;  1E9S A;  4AW4 A;  1QVR A;  1IY2 A;  4RKU F;  1HT2 E;  2Z8Y M;  1WHC A;  2FOI C;  5L8R F;  1DGH B;  3AKZ A;  3RGP A;  3HHZ A;  2C5R A;  2L09 A;  2NQ8 C;  1HR0 M;  2R65 A;  1QDR A;  2XZU A;  2CHV A;  1N36 M;  3E21 A;  3KSJ A;  1UM8 A;  4NL4 H;  3UZU A;  3B74 A;  1XXH A;  5FLX S;  4AI6 A;  1H6U A;  5EP4 A;  2D7G A;  1OTR A;  2ZBK B;  2WZJ A;  4GEW A;  3K8Z A;  4DR7 M;  3I4Y A;  3A98 B;  4D80 A;  4ZPX A;  3L26 A;  2L4F A;  3A46 A;  3KP0 E;  2LHC A;  1DO2 A;  4W5W A;  3QWL A;  3W0F A;  1IXS A;  1IN7 A;  4DUZ M;  1SXJ C;  4DV5 M;  3QYE A;  2WSE F;  2X8A A;  4FVM A;  4L78 A;  2B3T A;  1P3Q Q;  4B08 A;  1D0M A;  3SAT A;  4LJ9 A;  1N32 M;  4KT0 F;  4M9S A;  3GLG E;  1SXJ D;  3FYC A;  3VDU A;  1WXQ A;  2KNV A;  3KDS E;  1YUB A;  3J2P B;  2W82 A;  1QAO A;  4XGI A;  3GLH E;  1GAB A;  3R8F A;  5FTN A;  4MGH A;  3U6E A;  1TH2 A;  1BVS A;  2QQ8 A;  4NC6 A;  1TR8 A;  4DV7 M;  4L16 A;  5EP2 A;  2BJW A;  1HJP A;  1QZE A;  3J7A S;  3VFD A;  2YQZ A;  1G41 A;  3FTD A;  1PJT A;  2CEA A;  3CF0 A;  1E94 E;  4X64 M;  1IFY A;  1DV0 A;  2R44 A;  4JI7 M;  3GLH A;  3U6O A;  2DHR A;  1GVN A;  2HAK A;  4EIW A;  1ZAE A;  2FH0 A;  4B3R M;  4IJF A;  4ITQ A;  2F5P A;  4MB7 A;  2DWM A;  1W5S A;  4IBF A;  1PM5 A;  4LF5 M;  1N78 A;  2CFO A;  2L7H A;  3SHG B;  1SXJ B;  2QSF X;  4G4O A;  2ZTD A;  2RKO A;  2Z4R A;  2ZAO A;  2CHQ A;  3VK7 A;  1EFU B;  4GIP A;  1R5L A;  3GO8 A;  4YHH M; 
#chains in the Genus database with same CATH homology
 4I8O A;  4P16 A;  1JQJ C;  2J7O A;  4WUR A;  3FTF A;  3RGS A;  2OPF A;  1Z59 A;  1J09 A;  2CHG A;  2X49 A;  1Q3B A;  2UUB M;  3GLI A;  1N34 M;  4OVZ B;  1QAM A;  3DA1 A;  2UU9 M;  4NSR A;  3HU3 A;  1L2D A;  5FTL A;  1Q3C A;  2ERC A;  2CV1 A;  3KXE C;  4PDG A;  3U6Q A;  2D7H A;  2F4V M;  3PNY A;  2G8L A;  4FWG A;  2YFQ A;  1DGB A;  2FE8 A;  1TDH A;  1D2N A;  4JI1 M;  4TUW A;  4DR4 M;  1OFI A;  1E32 A;  3GQ3 A;  2RGO A;  3KW6 A;  4QHT A;  4K0K M;  1XXH B;  4AZF A;  5EP3 A;  1IBM M;  3KS4 A;  4GMQ A;  5JI3 E;  3HU1 A;  3GRR A;  4JI2 M;  1SXJ E;  4LRT A;  2RGH A;  3MK6 A;  4BB9 A;  2F5S A;  4DUY M;  2Z7J A;  2R18 A;  3E4R A;  3VK8 A;  3PNV A;  4B7F A;  1YE9 A;  5BR8 M;  3TQS A;  4DV0 M;  4PCZ A;  3L28 A;  2F5N A;  1R2Z A;  3GPU A;  1PJI A;  4GKJ M;  3GLF A;  3J7B A;  2EUC A;  3SAV A;  3DOA A;  1FNN A;  4L15 A;  4NRV A;  2Z4S A;  3CTW B;  3FTC A;  1FJG M;  4AKG A;  5LMU M;  1IN5 A;  3L2A A;  4G6Z A;  4LGM A;  4RF1 A;  3L25 A;  5JI2 E;  1W5T A;  5EJC A;  3SAW A;  4KLN A;  1XMQ M;  2C99 A;  2QPA A;  4BLC A;  3LQQ A;  2UUC M;  3D8B A;  4I81 A;  2CV0 A;  3GLH B;  3U60 A;  4FW9 A;  5H37 D;  5KO3 A;  4LJ4 A;  3KS8 A;  3M6A A;  3HHX A;  1HNX M;  1TH4 A;  2D7E A;  1XWI A;  4KOD A;  3R9X B;  1E9R A;  1ZQ9 A;  2VII A;  1TH3 A;  1T3T A;  1N77 A;  4B3T M;  1IN8 A;  1L8Q A;  3HJ8 A;  8CAT A;  5ITX A;  4A3V B;  1KYI A;  1DGG A;  2R46 A;  2X4A A;  3EIH A;  5EXS A;  3TPZ A;  3D8L A;  1HNZ M;  4LF9 M;  3SFZ A;  1GL7 A;  4LZZ A;  1Z6T A;  4PT5 A;  3SYL A;  2F5O A;  4YY3 M;  2C96 A;  3AJI B;  4KHP M;  1TDZ A;  1X37 A;  4LJA A;  5DYG A;  2Z3X A;  2F5Q A;  1K3X A;  1XNR M;  2Y0Q A;  1NHW C;  3IG5 A;  4LRS A;  1NJF A;  4S12 A;  4G4N A;  4PD2 A;  2J7N A;  5ITU A;  1R6B X;  3GPY A;  1K82 A;  2UUA M;  1K3W A;  1PJJ A;  2BJV A;  2QZ4 A;  2QP9 X;  2HL7 A;  3K1J A;  4REZ A;  5DYI A;  3VKG A;  3GRU A;  4NXM M;  1EE8 A;  4LJ5 A;  2R45 A;  1IY0 A;  2KEB A;  2KRU A;  3T1H M;  1N75 A;  2Q2E B;  1Z5A A;  2DWZ B;  2EO2 A;  5EXX A;  1IBK M;  3L27 A;  3HHW A;  3U61 B;  3HJQ A;  4B3S M;  2XEP A;  3SAS A;  2KW0 A;  4NSO B;  1R7R A;  3ILK A;  4LJ7 A;  3GRV A;  2XSZ A;  3B9P A;  3A45 A;  5EXT A;  3UMM A;  5E6J A;  1J5E M;  2DWN A;  1XNQ M;  1IBL M;  1N32 M;  2M5Z A;  5KPZ A;  3FUV A;  4JI6 M;  2V1C A;  4II7 A;  3KVW A;  4LFA M;  5ITQ A;  2I7N A;  1QZM A;  3JAM S;  1Z5B A;  4JI0 M;  1HQY E;  3CF2 A;  4MM3 B;  5FTJ A;  4DR3 M;  3SMS A;  4DV6 M;  4QNR A;  3CF6 E;  3HU2 A;  3K2L A;  3FTE A;  4LF4 M;  3U60 B;  5EXP A;  1NY5 A;  3TWM A;  3SBJ A;  4JI5 M;  2KZS A;  4WW0 A;  3WHK A;  4MGI E;  2DVW B;  3AOE C;  4FCT A;  2KZU A;  5ITY A;  4M9X A;  5BPV A;  1NHG C;  3U5Z A;  4LJ6 A;  1G3I A;  4L8R C;  2V1U A;  3JR5 A;  4I4L A;  3VKH A;  3GPP A;  2Y21 A;  4HLQ A;  3KOZ E;  2FNA A;  4LCB A;  1JR3 A;  4L4U A;  2KA6 B;  1XMO M;  3ZCB B;  4MGZ E;  4GC9 A;  4G4Q A;  2YNM D;  2O5R A;  1L2C A;  3KOY E;  1IXS B;  4OU7 A;  2XSZ D;  2HCB A;  3PFI A;  3SC3 A;  3T38 A;  4X66 M;  4AG6 A;  3UJN A;  4X62 M;  3T1Y M;  3BOS A;  4FWH A;  3FUX A;  2EA0 A;  1MU5 A;  3DZD A;  2VQE M;  2XZF A;  4LG2 A;  4JI3 M;  4BBA A;  4LY6 A;  4IBI A;  2OQ4 A;  1J7K A;  4AKH A;  2K47 A;  1QAQ A;  2Y20 A;  2G5G X;  4NOO B;  3PVS A;  1NVM A;  3WHL A;  4MH0 E;  3MJ5 A;  2H1R A;  1MX0 A;  2KXE A;  3KOW E;  3UK6 A;  5FSW A;  3U6L A;  3QAU A;  4IBG A;  2XF3 A;  4CHT B;  5ITX E;  1G4A E;  4OW0 A;  4M0W A;  4I5S A;  2M60 A;  4D81 A;  4M0D A;  5IT9 S;  4LF8 M;  3DFZ A;  3NBI A;  4PDI A;  4JI4 M;  3K92 A;  4FCW A;  2ZM6 M;  1NJG A;  1GLN A;  1YSY A;  4HL4 A;  2LXE A;  1GL6 A;  3VDP A;  4DR1 M;  3SAU A;  4GIT A;  3LVV A;  5KQD A;  1IXZ A;  3EIE A;  3JR4 A;  3KOX E;  1JR3 D;  3GLI B;  3U6M A;  4XBO A;  3T15 A;  2QBY A;  4OX9 M;  3GP1 A;  1LV7 A;  2HHH M;  4IBB A;  5A2Q S;  3KSX A;  2L7I A;  4JXJ A;  4R3D A;  2BNK A;  4MGY E;  3J80 S;  3AOG A;  1Z5C A;  3I4V A;  4CGY B;  4KO8 A;  1Q39 A;  3UGJ A;  5EQT A;  3U5Z B;  3KFU G;  4RF0 A;  5C1B A;  3AOE A;  2XLJ A;  1C1K A;  4IBJ A;  2QCU A;  3HHY A;  2I7P A;  2YR0 A;  1HNW M;  2Y0T A;  3GQ5 A;  1KFV A;  5KPT A;  4RNA A;  3PXG A;  3THG A;  4R7G A;  2A5Y B;  1G8P A;  3SYK A;  3AL0 C;  3Q8X A;  5ITT A;  1L2B A;  2DZN B;  4LF7 M;  4DV2 M;  2QEN A;  1QQW A;  3E9S A;  3FUW A;  4X65 M;  2DZO B;  3U6D A;  2UXD M;  4IJE A;  1L1T A;  2R4E A;  2E5L M;  3HWS A;  3GLF B;  1L1Z A;  1NNU C;  2LH0 A;  1ORY B;  7CAT A;  2DWL A;  3VLF B;  3GLG A;  4GHA A;  4MGK E;  5FTK A;  4FD2 A;  3ZC7 B;  3J81 S;  2R4J A;  3SHF A;  2V6Z M;  4IIW A;  1NSF A;  3NWL A;  4LFB M;  4GC5 A;  5IZ7 D;  3SMP A;  3U6S A;  4JI8 M;  3M7G A;  3FD9 A;  4AKI A;  2XGN A;  4M9Z A;  1VDD A;  3GPX A;  4G4R A;  2ZAN A;  3M0E A;  1I4W A;  1NY6 A;  2AHM A;  1R2Y A;  3U6P A;  3AV0 A;  4QNM A;  3KP1 E;  2UXB M;  3LVW A;  5DNY A;  1GKI A;  3MHV C;  4LF6 M;  1DGH A;  5C18 A;  4B3M M;  4LGY A;  2JA2 A;  3U6C A;  2L6O A;  4DR2 M;  4IBC A;  2KRK A;  4B7G A;  1IN6 A;  5LMN M;  4FCV A;  5KQ8 A;  3IG8 A;  2LNH C;  5KPR A;  3C58 A;  4DV1 M;  4NRW A;  2QBY B;  4DV4 M;  4LJ8 A;  3ZH9 B;  3GQ4 A;  5GKN A;  3OTO M;  3I51 A;  1OFH A;  4IBK A;  2C9C A;  4QOS A;  5FTM A;  2CE7 A;  3LQR A;  5E26 A;  5IWA M;  1HQC A;  4GKK M;  5F3W A;  1IY1 A;  3H4M A;  1XC8 A;  4QOZ C;  3FUT A;  1I94 M;  2XFT A;  3TE6 A;  4CIS A;  5IRE B;  4DV3 M;  4FWD A;  4AQY M;  2P5T A;  3TL4 X;  3SAR A;  3AFH A;  3TWL A;  2UXC M;  2C98 A;  5ITR A;  1N33 M;  4AG5 A;  1HT1 E;  2LWX A;  2VQF M;  2XFS A;  4JV5 M;  5EP1 A;  2C9O A;  4D82 A;  2CV2 A;  3U61 A;  4JN6 A;  4B7H A;  2CUZ A;  4DR5 M;  4DR6 M;  4Z8X A;  1KSF X;  1S3S A;  3LMM A;  1IQP A;  1DGF A;  1SXJ A;  4IBE A;  2HKJ A;  4IBD A;  2XH9 A;  1NNJ A;  3RFW A;  3FYD A;  4JYA M;  1TGU A;  3GLG B;  4Z6Y A;  2DXI A;  2R62 A;  4GHL A;  3TWK A;  4GRI A;  4QHS A;  3J27 B;  3HKP A;  1G59 A;  4OVZ A;  4LFC M;  3L29 A;  1IN4 A;  4LZJ A;  1OJL A;  1XHB A;  2ZAM A;  1IM2 A;  3RE8 A;  3FKE A;  3HGI A;  3HJS A;  1DO0 A;  1QAN A;  3FUU A;  1QYR A;  1IXR C;  3A42 A;  2FFJ A;  3GRY A;  4GH9 A;  4NXN M;  3W0L B;  1E9S A;  4AW4 A;  1QVR A;  1IY2 A;  1HT2 E;  2FOI C;  2C5R A;  1DGH B;  3AKZ A;  3RGP A;  3HHZ A;  1HR0 M;  2L09 A;  2NQ8 C;  2R65 A;  2XZU A;  1N36 M;  2CHV A;  3KSJ A;  4NL4 H;  1UM8 A;  3UZU A;  1XXH A;  5FLX S;  4AI6 A;  1H6U A;  5EP4 A;  2D7G A;  2ZBK B;  4DR7 M;  3K8Z A;  3I4Y A;  3A98 B;  4D80 A;  4ZPX A;  3L26 A;  3A46 A;  3KP0 E;  1DO2 A;  4W5W A;  3QWL A;  3W0F A;  1IN7 A;  4DUZ M;  1SXJ C;  4DV5 M;  4FVM A;  2X8A A;  4L78 A;  4B08 A;  3SAT A;  4LJ9 A;  4M9S A;  1SXJ D;  3FYC A;  3VDU A;  1WXQ A;  3KDS E;  1YUB A;  3J2P B;  2W82 A;  1QAO A;  4XGI A;  3R8F A;  5FTN A;  4MGH A;  3U6E A;  1TH2 A;  4DV7 M;  5EP2 A;  2BJW A;  3J7A S;  3VFD A;  2YQZ A;  1G41 A;  3FTD A;  2CEA A;  3CF0 A;  1E94 E;  4X64 M;  4JI7 M;  3GLH A;  3U6O A;  2DHR A;  1GVN A;  4EIW A;  1ZAE A;  4B3R M;  4IJF A;  4ITQ A;  2F5P A;  4MB7 A;  2DWM A;  1W5S A;  4IBF A;  1PM5 A;  4LF5 M;  1N78 A;  2CFO A;  2L7H A;  3SHG B;  1SXJ B;  4G4O A;  2RKO A;  2Z4R A;  2ZAO A;  2CHQ A;  3VK7 A;  4GIP A;  4L16 A;  3GO8 A;  4YHH M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...