4QPCA

Crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase (y200a) from zebrafish
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
308
structure length
308
Chain Sequence
MKIAVIGQSLFGQEVYKELKNEGHMIVGVFTIPDKDGKVDPLAIEAEKDGVPVFKFPRWRLKGKAITEVVDQYKAVGAELNVLPFCSQFIPMEVIDHPKHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFTVFWADDGLDTGPILLQRECDVEPNDNVNSIYKRFLFPEGVKGMVEAVRLIATGKAPRIKQPEEGATAECIQKKENSKIDWNQPAEAIHNWIRGNDRVPGAWAEIDGKSVSFYGSTLLENDHFSSNGQPLEIPGASRAALVTKNGLVLFGNDGKMLLVKNLQFEDGKMIPGSQYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the hydrolase domain of zebrafish 10-formyltetrahydrofolate dehydrogenase and its complexes reveal a complete set of key residues for hydrolysis and product inhibition
doi rcsb
source organism Danio rerio
molecule tags Oxidoreductase
molecule keywords 10-formyltetrahydrofolate dehydrogenase
total genus 91
structure length 308
sequence length 308
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
A PF02911 Formyl_trans_C Formyl transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.10 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Formyl transferase, C-terminal domain 4qpcA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4qpcA01
3P9XA 1JKXA 3TQQA 5CJJA 4ZYYA 4ZYUA 4ZZ3A 4TTSA 3KCQA 1MENA 1CDEA 1GARA 2BW0A 1RBQA 4EW2A 4ZYZA 4QPCA 1RBYA 4EW3A 3TQRA 4ZZ2A 3AUFA 4ZZ0A 3DCJA 4ZYWA 2GARA 1ZGHA 4S1NA 5J9FA 3AV3A 1ZLYA 4DS3A 1C3EA 3DA8A 1C2TA 4EW1A 1FMTA 4ZYVA 4ZZ1A 4Q12A 4TS4A 1RBZA 4R8VA 1S3IA 2FMTA 3Q0IA 1NJSA 4QPDA 1MEOA 3R8XA 3N0VA 4NV1A 4PZUA 3LOUA 3NRBA 2CFIA 4TT8A 5J63A 1YRWA 1MEJA 4YFVA 4ZYTA 4ZYXA 3OBIA 1RC0A 1CDDA 3W7BA 1GRCA 2BLNA 1RC1A 1ZLXA 4IQFA 2YWRA 3GARA 4YFYA 3O1LA 1RBMA
chains in the Genus database with same CATH superfamily
1E3JA 1KI2A 2B8EA 3NJRA 4ZO9A 4NZMA 3OIVA 4PS1A 4Q9LA 5AI4A 4HH3C 3VR3A 3AUTA 4K5QA 1TT5A 3ZIUA 5AW3A 3TH5A 3WY9A 1RLJA 3GIWA 2HN9A 4Q4HB 2HGZA 5L6MB 2JFNA 4KRFA 1OLUB 5IN4A 3LHDA 4NYIR 2QM8A 2MINB 4RKYA 2OD9A 1QGYA 1J24A 4H7HA 3MWEA 3EZGA 4X9XA 4B4UA 5EQJB 3W5UA 2HXSA 2QROA 4AB1A 5BOSA 1U6IA 3G0DA 4PICA 3AXTA 2A14A 1LRJA 2HA3A 3C3KA 3C85A 2WJAA 5B12A 3D1VA 1YHYA 3Q6IA 3UWKA 3LRPA 2HCJB 2NVOA 3V4RA 5AIAA 1KMHB 4BKMA 2PQ0A 4PG4A 1NBEA 2FPGB 1BE0A 4I55B 2YYZA 4OHVA 4P5EA 3SOPA 5EXEA 5I8PA 5JECA 4FLMA 2HIMA 4RTNA 3P9KA 1NVVR 4C7OA 3KZOA 4OLFA 5A1JA 4HFNA 3TZLA 3SPXA 1ISGA 4ZJYA 3ISTA 3EFHA 4OH1A 1G1MA 4K6HA 5EIXA 1Y1SA 1BGVA 1N2CA 3CT4A 3FPLA 3DPIA 4KLAA 2O48X 1IUNA 1U1CA 2PSEA 4MZDA 5KYYA 4DCCA 1R2QA 3RK4A 1LY1A 2PMFA 3AQIA 1C3XA 4CV0A 3B2QA 5DYYA 3T7RA 3PDCA 4F9EA 3FSGD 3NKVA 4GXTA 1KMMA 1XMVA 1Y8QA 3S27A 3DMFA 4WW0A 3UHJA 2Y6VA 1ADBA 1O95A 1Z5VA 2DMRA 3OKCA 1CULC 3ENKA 2VWQA 2XY4A 4XWAA 1UANA 5DI3A 1II8B 3CIFA 4W9MC 3INNA 5D1NA 3E9ZA 3D7RA 4G4SP 4TQGA 4OYRA 1HEIA 1WTAA 2V7QA 2ZBUA 4RD3A 4LE2A 3SEFA 5ELMA 5BN4A 3DO8A 4G0OA 1YDEA 3QBEA 3NBKA 4FZ3A 5FWYB 4KI0A 2WSYB 3F8WA 3KB1A 3K0FA 3KKEA 4E2XA 4ECEA 5JRZA 3EZ9A 2J08A 5HDBB 1DX6A 3O90A 2BEUA 3JYQA 2IUFA 4G1UC 4MRMB 3K6RA 4QUDA 4XD2A 3KZKA 1F5NA 3S8EA 2HSJA 3I8OA 1RIFA 2H2GA 1OV6A 4HAIA 4ZZ3A 4BPRA 1NFFA 2WKRA 3EGOA 4MQEA 3VO2A 3BE4A 4MA0A 4NYJR 4D6XA 5CA1A 4D8YA 3B9PA 4RM2A 1G0NA 2LXNA 4UNNA 4ZT5A 2J5KA 3EISA 5CVVA 4CLDA 1HDEA 3IH5A 5BWLA 3SF8A 3AR5A 4OMCA 4Y7CA 3KSMA 3UV7A 1GCUA 2MWMA 3E9DA 3B1ZA 4PAGA 1M8PA 2ANBA 2CK3D 3DV9A 3JATB 5IMBA 5LP6A 3CVWA 1LVHA 3K8ZA 1DAEA 4ID9A 4KQWA 5AVTA 1KK3A 1SCJA 1UK6A 4IKPA 3V80A 1TMYA 3JQAD 5ILOA 5TB5A 1A7AA 1U0GA 2GN8A 4Z99A 3DMDA 1OXVA 1FW6A 4J75A 3QU2A 5DNAA 5HIAA 4IQFA 2JA2A 3C3AA 3EMBA 4ZOCA 5JDCA 3J7AC 3BICA 2CJYA 1JA1A 1T35A 1EGHA 1YOVB 1AHNA 3DMNA 2CB9A 3EY4A 4QKQA 1QU3A 1ZD8A 1OFHA 1NY5A 2W8BA 3LQKA 2GN6A 3OQHA 4MARA 2IV2X 2R6JA 5G0WA 4B8ZA 2DXIA 5F7ZA 3KOOA 1QC5B 1KDYA 4I3GA 2XMGA 1YQTA 1K63A 5JFGA 2X4LA 1NDUA 2JAOA 4QFBA 4YI5A 3IR7A 5CA1B 4S3MA 4D98A 4DBVO 3S81A 5DHRA 5L53A 2DR0A 3B1XA 1NUTA 2BMWA 3KQHA 1XOIA 2D1FA 3V3TA 2OESA 1SVMA 3L7MA 2RAPA 2FWIA 3DKRA 3PYXA 4FGKA 3L6CA 3OKPA 1BQEA 3P0RA 1K7YA 2JBAB 4YRRA 1BEZA 4B4OA 3U4QA 2KHZA 4QGAA 5DHTA 5AVXA 2QL6A 2WA2A 2J7KA 2ZJZA 5SYMA 1WP4A 4ZI7F 5KTSA 2UZIR 5ALIA 3VR2D 3QE9Y 4R1SA 4LJ6A 3NWOA 4G1VA 2H5IA 5DK6A 2X0EA 4E5VA 1U63A 4DG5A 2C9YA 4R7ZA 4C7MA 1X80A 2D5AA 4AF6A 4Q15A 3T5BA 4QWMA 3DVLA 1II8A 1PS0A 1EK5A 1R9MA 4W7HA 4WFIA 4X54A 4H2DA 3UJDA 5KTTA 2IIVA 4OHRA 3G2NA 3WAKA 2FLVA 3FPJA 2QPLA 5DYTA 5EUBA 4B8YA 1U81A 1Z6PA 2F43A 3A4NA 1H2EA 3JQQA 5E7QA 2MMGA 3AILA 1X1EA 4G6ZA 1PG0A 5HEKA 1CDEA 1PJSA 2GYWA 3V97A 1PV4A 5HYVA 4CEIB 4C4XA 4LDQA 2A9KA 2HR1A 2W6NA 1E64A 2GD1O 4X93A 3ODGA 3KFXA 1WY5A 2P4UA 2PIAA 4E5KA 2QENA 1CZHA 1LNZA 1UINA 2XIQA 1TCUA 3BXEA 3IJ5A 2BMFA 3OEWA 3PGMA 1GQOA 1QP7A 1UMDA 3BDVA 5IKOA 3HXKA 1YRAA 6ADHA 1M76A 1U2ZA 2HO5A 1MZVA 5MDHA 2Q4OA 5F9HA 1AGYA 4MYDA 1NXQA 1XK7A 4MRPA 4O08A 3OC6A 1UFRA 2P4EA 3DC2A 1NW8A 1PGOA 3PXGA 3G89A 3KR1A 3IPAA 3OTOB 1SVUA 2R96A 5EIHA 2Z2XA 5F64A 2QLJA 1C7QA 4MW7A 4R1PA 4F4CA 4RKRA 1EWYA 2BUBA 5BOSB 4ENRA 1XPOA 3VOSA 5T64A 1A76A 5BQ5A 4O4LF 3NUQA 4WUVA 4A2PA 4QUAA 4KWHA 3ESAA 2F17A 1G3QA 3BK2A 3DCIA 2MINA 5I9BA 4IKOA 2JI7A 3GFGA 1RRVA 2QKYA 4XX0A 4UNQA 1A98A 1XFAA 4JMPA 3KUDA 4WL0A 3EZXA 2IHYA 1H2BA 5ELXA 3R7BA 1H93A 1QQ5A 1EI9A 1GDHA 2DQ4A 1I6MA 1EFHA 3TG8A 3DNMA 1ZU5A 1DMSA 3VA7A 2CZQA 2RHMA 3ZVMA 4WEQA 5FEMA 4H9GA 4BZPA 1KYVA 1H4VB 2V7PA 1I4WA 2XQJA 1IWBB 1PJTA 2IY9A 2J48A 3NANA 4KKVA 3A1FA 4EELA 4ISCA 2IOYA 1BCSB 4MUAA 3G8YA 8ABPA 4RHYA 5IVKA 1D9XA 4UNIA 1G5FA 1VHDA 2GEDA 3NWJA 4V0LA 3ZH2A 1E79D 5CYPA 4D0LB 1WETA 5P8WA 1XQ6A 1R16A 1ARZA 1XKQA 2QTAA 4KSCA 5C9ZA 2O8DA 4ARAA 2ZAMA 3DZCA 4BC1A 2HT1A 4QWWA 3BH6A 4WBNF 2XYPA 4FDMA 2DECA 1DJMA 4AKGA 1Z63A 3LQ2A 3F6SA 3LCMA 1FXWF 1C7JA 1M1XB 3UB2A 1MV5A 1RRMA 2NQ2C 4CG1A 2O54A 1DWPA 2D2FA 2F67A 2W90A 3LKDA 1UMCA 4GPBA 2QM0A 5EZ5A 5AK3A 4FINA 4JVOA 2PU7A 3SSMA 1QG4A 2V7BA 4F9GA 3M6FA 5GQSA 4AJKA 3FFTA 4CM1A 1LPMA 4CQLB 5DGTA 4OA8A 1BE8A 1IB0A 1RKUA 2C0PA 5EIWA 4Y18A 3N76A 1N8SA 2CHGA 3R0JA 2WC1A 3VZRA 1BXRA 3CC8A 2RIPA 5BYAA 2EFYA 2R00A 2V7UA 4JOBA 2OTCA 3RTGA 1VKHA 1XN1A 2WM9B 3SR0A 5CBPA 1KRXA 1K5GA 1OT5A 3B3GA 3KQUA 2O7NA 3QVMA 4TLCA 3Q3HA 4GZLA 4EYSA 5FD8A 2H1CA 1JSZA 1M6VA 1V48A 1XB2A 4R3UC 4OLBA 1EVLA 1UBLS 2NO4A 1KBQA 1SPBS 5A3JA 4TZ0A 4EYQA 3WIEA 4RANA 4TSRA 2CVHA 3VYVA 3TOZA 1XQ9A 4RY0A 1TYCA 3F96A 1JR3D 3LF2A 3Q1KA 4Y2HA 1JJ7A 4AY5A 1ZQ1A 4EFLA 5BYKA 1C7EA 3UH1A 3VPCA 1NXTA 2JLSA 3CFYA 1F4PA 3DNPA 5AHWA 4G63A 4OI1A 2X13A 3DMPA 4PLFA 2XDWA 3TSYA 2PO7A 1P5RA 3ZCTA 4C22A 4OXQA 4EHHA 2F1JA 4LHVA 4C08A 3SQXA 3GD5A 3K15A 1RKXA 2WFMA 4WKNA 4IZIA 2H65A 4KH0A 5C81A 3G0IA 3QJYA 5LD2B 1EDDA 4H4DA 2NUTA 5J5VA 4G24A 1CFJA 3CVOA 2FKNA 3DE6X 2JKZA 2XUHA 3CH7A 2J07A 3L4SO 4JT2A 2QPAA 2XIJA 1R5NA 2C5AA 2FZKA 1H6BA 4TL6A 3W90A 4E5YA 3GRYA 3I9FA 2ZRDA 4P3YA 2E4XA 2JD1A 3OCZA 1OJ7A 4FUTA 4HMQA 4HWOA 4P83A 4Z8XA 1IZ7A 4CIAA 4E1BA 4PGMA 2OGZA 1G2OA 2QM7A 1WABA 1UFVA 1RC0A 2FOIA 1LF0A 4UQOA 1JFFB 3PIRA 4OSOA 1CR1A 4IRUB 3KG2A 1CUBA 1P2TA 3D2AA 3RYHB 1FFGA 1E9EA 1N2JA 3AU8A 4OYHA 1H2FA 2E48A 1NR1A 4W7SA 3VGJA 1RKBA 4C43A 2EWWA 4I46A 2QIOA 2IS4A 3ROGA 1FQWA 4UMDA 5B3LA 1S2GA 3GUVA 3K0CC 1EJ6A 3C4JA 3RTAA 4B7AA 4G0YA 4J9UE 3I72A 2XCOA 3VTAA 3IIMA 4M1TA 1I1QB 4MP6A 3CM0A 4QXMA 1A2QA 2A88A 2QBYB 3BMOA 3GV0A 1GNSA 3BJZA 3F3MA 2CXOA 3G7UA 1Z4NA 4UCFA 4B6JA 1UKVY 4D4LA 3MTIA 4GC5A 3WK9A 1GZ7A 2OV6A 3DL0A 4KRYA 3HR4A 3GLIA 1PNOA 1M3SA 3H19A 3OEYA 4KIWA 4MR8B 5B30A 3VSEA 3RH0A 5DZSA 5JAIA 3QWAA 4J1QA 4AY6A 3AVOA 4WXMA 2QSUA 1KIFA 3IERA 3DOUA 4LHZA 4EOGA 2FN7A 5HM8A 3HV2A 4IIJF 1HR0B 3L8DA 1GHTA 1P2UA 1CD5A 4R8MA 2ZIVB 4E08A 3W3AD 5DGCA 2Q3MA 4FFSA 1E94E 1PLLA 1QRRA 4K9DA 2VLIA 1H3NA 4J7AA 3ZHYA 2VF5X 3K92A 1F48A 4UEJA 3VNUA 1ABBA 3X2FA 1KKLA 3ROMA 3HNPA 3KLBA 3O3CA 5ARCA 3RREA 5HF6A 3L0IB 5HTKA 3Q7TA 3L1IA 4BFCA 3HCRA 3HL0A 3ZGLA 5GAJA 4LMRA 1BFUA 1M6NA 4A36A 1WX1A 2Z8ZA 2ZJYA 4GEGA 1D6SA 1KETA 2XGGA 4Q66C 4ZPJA 5EMNA 3IDOA 4G67A 4C9BA 5EPEA 1VJ0A 4L5YA 3QX3A 1AJEA 4M0DA 4NCNA 4QUGA 4WK4B 5ES3A 5TGZA 4CHTA 1YL7A 3OPMA 4N12A 5H81A 4CIWA 2Q1YA 2VZ0A 1JSLA 3I0MA 4YP1A 4RF4A 1OI4A 1XE3A 1BJTA 1WZIA 3IBYA 4FBMA 4MWSA 1O94C 4XXHA 3L8GA 3OQBA 4CMAA 3N8HA 3AIMA 1IN4A 2G1UA 4ZMRA 4FXPA 3VSCA 5HRCA 1Q0PA 1KSJA 5C8XA 1OH7A 2XTAA 2FF7A 3NG1A 4YO8A 1QFZA 2Q2OA 3OAAD 3QYPA 1PX0A 1VBKA 3OZIA 1W36B 2X9NA 3BCRA 1P73A 5EY5B 1YK0A 2P1RA 3DF9A 2ZAYA 4M9CA 1W1IA 3ADOA 4LOIA 1G8FA 4YI3A 3G82C 2Y9MB 3NRCA 1EWKA 2ST1A 3G68A 1XJCA 1BHQ1 1KF0A 2VF8A 1NE7A 3BWMA 3TIVA 3VR1A 1WXQA 2XZPA 2YHUA 2XXAB 4RF3A 1AXRA 1YCDA 2XA1A 3CGGA 4JP5A 1JALA 4Z0HO 5EJ5A 4ZVSA 1C1XA 2C54A 3OFND 1M2VB 5BV1A 3MYYA 2E2WA 2XA9A 4LC9A 4NG5A 4DLWA 2H2IA 2BI4A 3HKBB 4P3OA 1DINA 1PT7A 2I6XA 4I2NA 4TOIA 4Y1FA 4RIIA 4YIKA 3UGTA 3L5OA 1DC4A 1L1QA 1M1ZA 3G49A 2HC9A 2Q49A 3OHMA 3QYFA 4AZ3A 4UZFA 2OBXA 4PX9A 5CPBA 4RHTA 2I76A 2EFGA 1YFZA 2IA5A 2VHTA 3RGGA 4MS4B 1XXLA 4NU8X 2RC5A 4NZPA 3OX4A 1ODTC 3PNSA 1MFZA 1Z16A 3CZAA 3QUAA 4H7EA 5I7AA 4EY6A 4DV6B 3E84A 4C88A 4ZOEA 4QOEA 4KQ6A 1LEHA 2KJQA 3KD2A 4XYMA 5DMHA 1GGNA 1LBSA 3GEEA 2JJ2A 3T7IA 3VVCA 3ZDZB 2AHOA 4D9NA 2GJ8A 4Q4CA 3UK2A 2FMTA 1RWOA 4DYVA 4L28A 4WZ6A 1VSTA 4EZEA 5JS7A 4GOND 3B1VA 2ZW9A 4KXFB 5KQRA 2G0NA 3GJ4A 2Q29A 3N6XA 2ZGVA 3F67A 3TRIA 1H8EA 3M6XA 10MHA 1E2NA 3ESQA 3EEIA 3OLQA 1SC4A 4OHUA 4J2HA 5DCWA 1Q1BA 2XNCA 4YGXB 3QE4A 1TGVA 1RYYA 5CA0A 1IHUA 4BWFB 4CTNA 2RMKA 3SHWA 4B6FA 5BR1A 1NTRA 1JLMA 1TCCA 3EHDA 3FM9A 4NF2A 5E7MA 4BMPB 3AM1A 2BGIA 3WRXA 4N9QA 2QSZA 2RKOA 4DCGA 1OXMA 3S3TA 5KYKA 1U31A 3G2QA 1YCGA 4UBKA 4YMLA 2G8NA 5K0JA 1RRGA 1VE9A 2L19A 3FHOA 4FHGA 3BEOA 2IYYA 1XZJA 4P53A 5K3OA 2C97A 2C8LA 2OAEA 2P3SA 4NV3A 3DXZA 4AY3A 1TJ3A 3X1MA 3CO5A 4BX3A 5LZ4A 2YQ4A 1RXVA 1K6EA 3TCKA 2EL7A 3L1HA 4RD6A 1OX6A 1U2GA 3WGMA 4L4XA 3GFVA 1OROA 1XQYA 2GTIA 1JEYB 1SK8A 1ZL0A 4QASA 4DRXB 3WNCA 2OBFA 2VCHA 2ODWA 4QXQA 1OI3A 2VSYA 1GZ3A 4TV9A 5ILQA 4UM5A 1O6ZA 2XECA 3LG2A 4YCJA 3T0FA 3UVEA 1XWFA 1K06A 1ECLA 2Q1UA 3ZD7A 4D96A 4MPTA 4PLVA 5DULA 1UPFA 4E5MA 5KOHB 4TYWA 1T10A 2I99A 4NZOA 3W3AH 4DUPA 3PNPA 4H0FA 5DWVA 2VI5A 5FL3A 4US2R 1LTHR 3IPRA 1V5FA 1OC2A 1IVNA 2WWGA 3KIPA 3GXOA 1EFDN 4NFHA 5ULLA 1LTKA 3F78A 4I7EA 2EQ5A 4YV0A 5I3CA 2C5GA 2G70A 2XUAA 4C4YA 4JMLA 4G1BA 4MUEA 2DSTA 3UNXA 1OX5A 4US0R 4YJ3A 5EI5A 2EYUA 2ZT8A 3MUNA 2R25B 5J4KA 4U0KA 1R15A 5A0FA 1NLUA 1TVMA 5FWAA 1QKKA 4GX1A 3A4YA 4AXBA 5JWOA 2AFHA 2EJWA 2WE8A 3WGOA 2YV3A 3X1ZA 1VFNA 1M7GA 4FGSA 1UDWA 3EQZA 3WK5A 4W63A 4DEYA 4IH4A 3VR0A 5AXCA 4DNQA 2XYQA 1EPUA 1QX3A 2FMUA 3AFGA 1H8HA 2VRCA 3G0OA 3LDAA 3NBAA 3SM3A 1YIDA 4IHJA 2VZLA 2WG0A 1S2MA 3B9RA 4MR7A 5CGQB 1IWOA 3RSGA 1CZRA 1PFGA 2AMVA 2Z43A 2ZANA 3BFPA 4X66B 1DAPA 2N3ZA 4GL2A 3UCFA 2REQA 1NVWQ 3D8UA 2Q8QA 3EOZA 4W1SA 3FI9A 4JQSA 4MRSA 3WLKX 5CVTA 2DH6A 1KWKA 2DFKB 3B6MA 4RHUA 4V3CA 4MUJA 1GGFA 1XCMA 1XTUA 1N0UA 1PJ8A 5E3JA 3IS3A 4MWTA 2ZS9A 2OC4A 3NM6B 3B5EA 1SB9A 2HJVA 2QSYA 4I9FA 4F92B 3TOSA 3GPBA 3DGEC 4AMYA 3NBQA 3EAQA 4BWYA 4N03A 4OB6A 4P80A 3AVTA 4H18A 4BX9A 1BE6A 1P1JA 1UK8A 2AA3A 2C9CA 4HV4A 1EZ1A 1NUPA 1S3FA 5LZ7A 1QYVA 2B3TA 3KPWA 4KO8A 2VJQA 2W2VA 4E2ZA 3IEPA 3QW4B 3AB3A 4LV8B 3ILYA 1B7GO 1HE8B 3L7LA 4KGZA 4DQUA 3SDBA 3LK7A 2P6RA 1JG1A 2G5CA 2H29A 3B38A 3KSDO 3N05A 4ICIA 4FR0A 4KKXB 1HQKA 3Q8XB 4L8GA 3MGCA 3WHIA 3WVNA 5B6IA 5TPZA 4I1PA 3DS8A 2QRUA 1QR6A 1NUSA 2WYVA 3QE2A 2H4FA 2ANCA 3CLRC 1KO5A 1FDWA 4YRPA 1VB3A 3VHXA 4NCKA 4N0QA 1G1AA 3BWEA 1ZVMA 4DXAA 1FP4A 1OBVA 1OTXA 3KU1A 2BT4A 3CKYA 5JNLA 2ZJ8A 4C2UA 5F98A 1CIVA 2UXCB 2G04A 2DSNA 1CC1S 4YAEA 3LP5A 4HTFA 1ZCJA 2B1JA 2HMAA 2FJ0A 1FYDA 4OF4A 2IC5A 1L5ZA 1Z8FA 2QYOA 4I9HA 2C4VA 2E37A 3CCFA 3ICOA 3ENVA 3QKTA 2OYRA 4CCYB 2IYWA 5HK9A 2RHRA 5FNVB 3I32A 4FIDA 2FQ1A 3E82A 3OLVA 3DHNA 4AI6A 1GPAA 2P9ZA 3JQ8B 3KQKA 4B7XA 1C3OB 1UWCA 1TF2A 3ENQA 5KI6A 1V1JA 3HJNA 1WW2A 4KXVA 2RHTA 3K2IA 2DOKA 1WMBA 1A8UA 2EIXA 1JG3A 1RSZA 4C30A 2SHKA 4FOPA 2HNAA 1P31A 1KI9A 2C95A 3A1CA 2JARA 3TTUA 2QVBA 3PKZA 1JHQA 2QTZA 1FS4A 3PQ5A 3R09A 1XMJA 1IE3A 3GEPA 4WOCA 3I37X 4PX5A 1ZVKA 5CITA 4AJIA 4FJ0A 4L95C 4W5NA 2P0EA 4E7PA 4OUDB 1ZOSA 2ZQZA 5THXA 3Q98A 1UEIA 3ZGOA 4NVRA 5FAKA 4Z2AA 3ABQB 3H6KA 1Y4UA 5ENDA 3EEQA 4R1UA 1Q2UA 4X5OA 4J9VA 3UPUA 1IG0A 4Q34A 2O6LA 4Q1AA 1PF7E 2HHAA 3LUJA 3ILVA 1D2HA 1NOKA 3WGYA 3Q40A 3UK7A 1I0ZA 2H31A 2Q07A 1FMLA 5C31A 1G6KA 2L17A 3JQAA 4FGJA 1QVAA 3KBOA 4IF6A 5TJ9A 4I5GA 2GF2A 1RHRA 2WOOA 4J7CA 1W9MA 3IC5A 4P4SA 3U3MA 4MR9A 5CFNA 1LI5A 4JC5A 4ACBA 1IM8A 1R4NA 1D0VA 1FDUA 2GPNA 1X92A 4HFRA 4UHFA 4JT8A 2GFHA 4AJJA 3U48A 5JRJA 1ZZEA 1MEJA 4RD0A 1GXSA 2GPAA 2BLLA 1L8AA 2GZMA 1FOEB 2QUIA 2V6GA 3C8UA 1P7ZA 3LX4A 3OTHA 3PYMA 4BECA 5LP6B 2PMCA 4D56A 2H8GA 1CR6A 4RPLA 3PPVA 3U4HA 1SU7A 2JVIA 5I5GA 4D0RA 3WB9A 3PHCA 2D6FA 2JHGA 4KI7A 5ALPA 1NQUA 1V7CA 5JCOC 2D3WA 4DMRA 1JDBB 2D06A 2VNIA 3ET5A 1J5EB 1IY0A 3SVLA 3ICVA 3JX9A 4P2GA 3KK0A 3WMFA 2IZ7A 1KQPA 1S0UA 2AN5A 4ZVMA 3SYKA 2CNKA 5AKHA 1KVSA 3EH1A 3FF4A 4Q1BA 5FL7A 2FZGA 4EVSA 2Q21A 1U4NA 1CEQA 2J4FA 4R9NA 1NFRA 2BSXA 1JYSA 1FUYB 4KQFA 1S89A 4WXEA 4AWXA 3EG5A 3FROA 3PQ3A 1C8LA 4J1TA 4NQRA 3CRZA 3OY2A 5JFOA 3F46A 3FMVA 4EA6A 5DBGA 6PFKA 4BXOA 2VJYA 5F52A 3ZNPA 1F7VA 3KV3O 4U02A 3BXXA 2NU6A 1DFIA 4X20B 1N6PA 2XDAA 3EJ6A 3H8SA 1G3RA 4G9BA 4U9IS 2WM2A 4IIFA 1LW6E 4YMUA 3D5TA 2GK3A 2ORED 2R6AA 4KWTA 4WN9B 2JHAA 5AVUA 2VHZA 3UYKA 1NHGA 1KQFA 2HWUA 2A0YA 2FLKA 2XRYA 2UZAA 2C7GA 4AURA 1X1RA 1XZAA 4Z9BA 3TM4A 3I12A 3ZW7A 3PD1A 1RMQA 3HKEA 4UBNA 5EQFA 1SIUA 4TRNA 4BMZA 4FEGA 3SGLA 1XPRA 2FXIA 4MIOA 4UCWA 1YBFA 2I2CA 1HZJA 2H9AA 3T9DA 4UQPA 1CBUA 1AS0A 3AG5A 4ZN6A 3BILA 4HLQB 3U1BA 3RVBA 3IKTA 3DLTA 4EFNA 1QBKC 5FUWA 3PQ4A 4DLKA 3O8OA 2OXFA 4FMDF 3RTBA 4RZIA 3FKSA 1ODJA 1E2EA 3MRSA 1Z36A 4WBSA 2BISA 2LBPA 1V9SA 1VSQA 3H05A 5AJYA 2LIVA 1Y1LA 2QZSA 4V2IA 3UTDA 4G41A 1Q19A 2ZJ1A 3A6HA 1W25A 1H2AS 1CY2A 4JLUA 5LVAA 1GKKA 1V3TA 4N3NA 1FJXA 3QPVA 1DG3A 1BAPA 4QNNA 1M9NA 1Q21A 1OHHA 5CG1A 3FLMA 3UJ9A 2Z5LA 3Q12A 1KEEA 3VR3D 1E7QA 3FDZA 1Q1ZA 4MKGA 1FXUA 3SIXA 2X23A 1Q83A 4LQLA 3NOOA 1QVZA 1CV2A 2UZ3A 3ZYCA 4CQMB 1IXZA 4PYQA 5JXGA 2E6UX 3NHUA 2Z9DA 3TM5A 4ZO8A 5EIEA 1VL5A 1LQTA 4WAUA 1O5IA 2AFIA 1NBAA 2FJUA 5HILA 5BSRA 5BVGB 3TZKA 1H0KA 2H11A 3NIGB 3V4OA 3ZWAA 2AXQA 4E14A 1G18A 2QE6A 3QFRA 3TLYA 5IULC 1U3CA 3QVSA 3GZ4A 1EB9A 2R7NA 3NKLA 3VH4A 5ESXA 3GDGA 3ZIAA 3PT5A 3G2OA 3FNQA 4OHWA 3L0ZA 5SY6A 3JD3A 2R0QC 4OG2A 1QV6A 2PXAA 3T95A 5LM3A 1GTVA 5FQOA 5JXWA 1ICIA 2JLCA 4ZI2A 4YJ2F 2I71A 5FOTA 3F7NA 1KJYA 2PZLA 1GFSA 4EENA 1OX4B 3H42B 4GI7A 3LBYA 4TMKA 2GBFA 2RIRA 5UKDA 3THWB 3DBVO 1U04A 1YMQA 2FEPA 1WXHA 4YQEA 3TEFA 1YQ9A 3OCYA 4E5PA 3BCUA 4L0CA 2P91A 3WNDA 4CW7A 1N2ZA 5JG7A 1BRMA 3H84A 1IQPA 4HB2A 3MWYW 1T9HA 1KJ8A 3K1ZA 1QDUA 1E2QA 4JHLA 3GP8A 5IW8A 1ID1A 3Q3VA 5FYDA 3WRYA 1P77A 2WMOB 5CT4A 5FLXA 1AUOA 2AFRA 4JBNA 4V0OA 3ABZA 5CR9A 4D9KA 2CZCA 5KDDA 3OLYA 4ENUA 2WJJA 3VI4B 4RPKA 4P36A 4Z54A 1R9NA 5HKKD 3GAMA 2QZZA 2Z5VA 1P60A 2BOVA 2KLHA 4GLJA 5DGHA 5H68A 2PEYA 3SKXA 4IGEA 4J0GA 4BFUA 4C4SA 1NRIA 1R0SA 2BGKA 3Q7QA 4HAVA 4QPZA 4ZAFA 1U0LA 4FD2A 1X39A 2BMDA 4GYKA 1MAUA 1SXIA 2LV8A 4LQDA 2E5LB 1EDBA 4NY1A 2H1OA 3FRIA 3ITNA 4EX7A 3NRBA 4HDSB 2A78A 4IW3B 3EFOB 1U9IA 5JPIA 2GBCA 3ZU4A 1D8TA 3MGGA 4YFVA 4TWRA 1RXEA 1Q20A 3B53X 1ACMA 3GCZA 4ZU3A 1N2CE 2WJWA 5DTJA 3RIHA 3U39A 4Z4GA 3ZTTA 1Y6GA 1WXEA 4HR7A 3UF0A 1KA9H 1TZMA 4IMIB 4MW5A 3H5VA 4ZALA 4INJA 2XGSA 4BRSA 3J81A 1SOAA 4B81A 1A8HA 4C2AA 4JI0B 4AYTA 2CDCA 2OGSA 2P90A 3BB3A 4PWYA 3NP9A 4TYYA 5I4CA 4KL8S 4DDKA 4ZYLA 2C7QA 4JGGA 4OHPA 3BTVA 5G4KA 3A6LA 4I5IA 1T4CA 3VV2A 3FPEA 1ZH2A 5EWMA 3I42A 5KX5B 4ZRDA 1JTVA 4J0HA 1NXSA 5TQ0B 5CM9C 1CRLA 4BKOA 1XZQA 2VCYA 2DUNA 2Q5FA 5AKKA 2VHUA 1ULAA 3C41J 3Q0TA 1HDZA 5C5IA 1NVAA 1OA1A 4P4UA 5C0OE 1U5CA 1GYPA 2OP0A 3QPAA 4D4KA 2I91A 1VYHA 1Q12A 1A9OA 1OIVA 4JODA 3OM0A 4N54A 3RD5A 5KQSA 2B36A 2N42A 4WCFA 4YR7A 2BKXA 2R1VA 4GW3A 4F12A 5M04A 1R66A 1FMTA 1WD5A 4WLEA 4I2VA 2VNJA 3I2JA 1JHUA 2OVBA 4UD2A 1XO1A 4NC9A 1GPJA 4QPDA 3ETLA 5DXJA 5U4QA 4D9GA 2VUUA 3MELA 5A2GA 5JD6A 3MTJA 3O8LA 2MOKA 4Y1EA 3W7AA 3JVDA 1L3CA 3D4OA 5BW6B 3UMYA 4LVCA 3A1TA 4F2WA 3PGVA 3NCTA 3QA9A 3REFA 5HRUA 4OB8A 1JT9A 4FYPA 1B3RA 1GFWA 2G17A 3ECSA 3NHFA 3WGGA 3I01M 4DTIA 5T67A 3KWJA 1QV7A 3SU8A 2BFEB 2FSHA 3ETDA 4CKEB 4ZGWA 5JR3A 3GA0A 4KVGA 4DDWA 3LHSA 4CNQA 2I6FA 3K9CA 2XNDA 4GR9A 3JQDA 4KYVA 2F9MA 2QVYX 5H02A 5EHGA 4AW9A 3CVUA 2WQ7A 4JJ8A 1QFYA 2FRDC 3U3OA 3QBJA 4PO3X 5P21A 1E7YA 2D0OB 5BSHA 4FE3A 1L5MA 3HUEA 4PXAA 2W2TA 2IYUA 2BEWB 2I6SA 3J7TA 4R8SA 5DCLA 3WL7A 3IVXA 4IDHA 5B7PA 1WUHS 2C57A 1WLSA 2CGEA 2NWQA 1IQ0A 3TI9A 3JQBC 1WIWA 5KYUB 1DEKA 1ISIA 2CFCA 3AUXA 3NX4A 3ZE2B 3P9IA 3RUCA 3K70D 4L16A 2JGLA 2W2MA 3DCJA 5I8ZA 1G291 1G2PA 4Q1DA 4AIRA 4LN1A 3ST7A 3UUEA 2DHRA 1DCFA 3ZE9A 1LS6A 3E8MA 3ZD8A 4NK5A 1QU2A 2MT9A 1ZGGA 3PGKA 1WHSB 3K71B 5BORA 2VA9A 1P1BA 1Y34E 2XLCA 5DYWA 5DX8A 4DLLA 1CLEA 2P30A 3RRMA 4HPWA 5E1MA 1I80A 2P6MA 1RI1A 3RRZA 2I33A 4YQZA 2BRUA 2QDKA 4Z1OA 1IL0A 1NJGA 5L6LB 3U09A 3ZTWA 3JQGB 2FR0A 1JR3E 4M9XA 2JZOA 4JP3A 4PYOA 3WKBA 1W94A 3HH8A 3AO0B 1UZAA 3G9ZA 2H00A 3K5WA 1AK2A 3BD6A 3JVIA 4JEHA 1Y3DE 2EXXA 3ER6A 3LYLA 4MWGA 1AK9A 4MVJF 3RYIB 1C1DB 1IHXA 3RJMA 1KZYC 2RHWA 1ZGAA 4B2YA 2TMDA 4RHCA 5DT9A 2GBGA 1Z68A 3ASUA 2QVXX 5JBIA 2HMUA 1Z56C 1XVIA 4ZV4A 3T5GA 2QNRA 2GZAA 2H8KA 2F3PA 1IY1A 1SUCA 4PYLA 1JBQA 3KC2A 5DM0A 5AOVA 5KTYA 4NYMR 1JXAA 2TSYB 1EUCB 2ADFA 3VAZA 5DN6D 3HB0A 2X9LA 3F9RA 1X19A 2VTDA 2X6RA 3GUYA 5F5LA 3A2LA 1A7KA 3RUDA 5C8YA 2UUBB 4LIPD 4TGLA 4AKEA 4AXXA 5CDYA 3G2PA 3GJ6A 4K81B 5E38A 3DKVA 4GG1A 3RODA 4Z0PA 2PWAA 1W2WB 5LJIA 1ZNXA 3G85A 1I4OA 1P5FA 1T3HA 1YL5A 1YZHA 4GOKA 3CCCA 2Q0XA 3M4ZA 3QMMA 3HB7A 4CMHA 4INPA 1XU9A 2VNKA 5HIJA 1XJ5A 4CBVA 5EZYF 4XVCA 2XHEA 5JW6A 1IJEA 3JCZA 4OJNA 4IIBA 5AI9A 1T1IA 2V7EA 1ABEA 3ZKWA 2VC2B 1KK1A 5EAIA 5KTPA 4HWSA 2PD3A 3K8QA 4J16A 2XOEA 3VC1A 2X6QA 1AQJA 1B0ZA 2I80A 1K3TA 1NBIA 5ALSA 2Y66A 1YOBA 3RSQA 4AF8A 4XR9A 1U2PA 3NC1C 4GL4A 4I6EA 3TOXA 1QKIA 3AVQA 4PIPA 1PHRA 3GWZA 4PQYA 4RLQA 3WHPA 3WYNA 4KAXA 2AYZA 1KDPA 3OJ0A 3QOWA 3I8SA 3SE7A 2WAMA 1RMYA 1MXFA 1ISPA 3ZD6A 4R5HA 3U7IA 2PKWA 3VQTA 4EB8A 1XI2A 2FZ4A 5AICA 2YIVX 1X9GA 3VYUB 3HY6A 4FOSA 1GNLA 4RFLA 4AIIA 1A8QA 3B3AA 4EBBA 2OOSA 5JANA 1EE9A 2CYAA 4WKOA 4MB2A 5EINA 4DSZA 3JTMA 3HY3A 2RB4A 3GAFA 4IDOA 3RADC 3ZBTA 2Q5HA 4BL5A 1GUFA 1N8KA 2WJYA 3EVDA 5J1TB 2ISCA 6ABPA 5EZSA 1LS1A 4V0RA 3H9EO 3ZU6A 1Y6ZA 3JASB 1Q0ZA 1WSWA 1GPDG 2A0UA 2NACA 4NYMQ 3OZVA 3AJ8A 3H1GA 4PTZA 5AUOB 4L27A 1E20A 2R3SA 3C43A 4O1IA 1CR0A 1T0BA 4DPMA 1ZMRA 4J4TA 3FWHA 2R87A 3I9JA 1QP4A 3IMCA 4PBTA 1QHGA 3VZSA 5BSFA 4FOOA 4QJ3A 2ZSBA 4LDPA 3D02A 2X8AA 2ZITA 2JFYA 1TZBA 3Q8MA 1NIPA 3TMKA 1DLIA 1PJLA 3A7EA 4I1IA 4JK3A 3H17A 3JPYA 2Q1SA 3MTQA 4K9QA 4OO3A 5BR8B 2F3UA 1DB3A 1WVIA 4S35A 4E46A 2EVWX 1N77A 1XEXB 3FTPA 1MW8X 1P1IA 4IHKA 2OQRA 2HSGA 3MRXA 2GXAA 4L4UA 4YT8A 2CEAA 2IIQA 5LYJB 2C9BA 5IYZF 3WWEA 1XWIA 3GFFA 3WK8A 3F6CA 2Q28A 3ADKA 4UXHA 1UC5B 4HMOA 2H18A 4X8HA 3TQHA 3TGPA 4GECA 4JVLA 1ADYA 3FCSB 5BWBA 1SOMA 1OHHD 3O83A 3WLHA 5LLDA 1PGJA 1OCEA 3SYTA 4BP9A 3TXAA 5JNVA 5DP2A 1I3KA 5FTMA 4ZVVA 2W11A 4MA4A 3KWLA 1KZ4A 2ATCA 2XMBA 3NXSA 2C3OA 1X1TA 5JD5A 1KNXA 1D8AA 2C3UA 3F2VA 2G07A 1KP9A 3HJUA 3LP6A 4PLYA 3E9MA 1W0KD 2CE2X 4AROA 2ADMA 5EMHA 1XZFA 1UBKS 3PI7A 2GKGA 1NMEA 2HGSA 4EHIA 5BMOA 3Q5GA 4GP9A 5IAAA 4DSNA 4EBFA 1ZSYA 3BHNA 3OWXA 3CLSD 3CS3A 3L8EA 3W2TA 4KQHA 1H9AA 3UXMA 4IWYA 4LJ5A 3GRUA 1NVKA 4YJDA 2P0YA 3LXUX 1U3WA 3KJGA 1ZM7A 4RK0A 2IV3A 3ROFA 1BO6A 4OBXA 3WYCA 3EGDB 3LA8A 3URMA 3X44A 1IZ9A 3WRVA 3DV0A 4PQEA 5DTIA 5KKAA 3TKAA 2EDAA 2GCOA 3GD7A 1NI4A 1N9ZA 5LZ5A 1F2TA 2IWRA 4N3AA 1L1RA 4L3OA 4FFNA 3DB1A 2DUJA 4HDRB 4L2IA 2X22A 4CODB 1O08A 1PLKA 4CKWA 1NU6A 1ZD9A 2OZVA 1YDGA 4FKBA 5AW8A 1Y8ZA 4W5TA 1KYZA 1M0WA 1SM4A 2GHIA 2QRMA 2VA8A 1KZ9A 4IJWA 4K9SA 3DR3A 2ECPA 2I55A 4BMSA 2GCOB 2VFAA 1RQLA 4RTRA 1M33A 1Z26A 5LA6F 1H3EA 3WGHA 2J0QA 4F60A 4E2FA 4ZCRA 4Q7MB 3CLRD 3K1AA 3H1TA 2HK6A 1Q14A 1R4AA 4JJKA 1GA4A 1E3LA 4O2RA 4C7VA 1DKUA 2SKCA 4BNMA 1F8GA 2XDQA 1J97A 3X43A 4RVUA 1M1YA 4L6AA 3C24A 1E0KA 5DYGA 1JG4A 4DR3B 3EAGA 1L5VA 4U7HA 1GN8A 2Y68A 4TWAA 3LE8A 4UOQA 4JLWA 4M8LA 1EEXB 2JFZA 4F6LA 1IN7A 1E58A 2ZWOA 3GK3A 4YJGB 1TYEB 3M81A 4MB6A 3QIVA 1Z75A 2GNAA 2RHDA 4CG2A 1X7YB 3EXEB 3V2GA 5EKTA 1PSWA 3H3XA 4C87A 2CLCX 3PI6A 4UMVA 3SHTA 4BQPA 4AZSA 4HG2A 3U4GA 2QLTA 1Y9DA 4O8CA 2FPPA 1OE0A 2Q4BA 5KAMA 4JXKA 3O2JA 1UZLA 4N8EA 2ID4A 3QEMA 1XJQA 4WECA 3VJMA 2VLBA 3EVBA 1Z3CA 4QULA 2WABA 3B7PA 3WSWA 3E3LA 2J9FA 2PRYA 1M2FA 1YA6A 3Q5EA 4S1NA 2PV0A 2FZ5A 2ORIA 5CH3A 1BWRA 2I4NA 2WTEA 3AETB 3GEHA 2O8EB 2JCXA 4RDHA 3FE2A 3MINB 4R83A 1JBKA 2C99A 1IY9A 1G63A 2DWOA 4EG0A 3QKRA 2W48A 1PIWA 5J5CA 3SZRA 4RNCA 4OQFA 4O4IF 1MTZA 3L6BA 4QFCA 3TTXA 4WZBE 3BMNB 3O73A 3FFWA 4FR2A 1P1FA 1B6RA 1ZITA 2A1IA 2QX6A 4IZOA 4IIHA 2BBTA 5EKDA 4A03A 4IMJB 1W85A 5FPKA 2C1EA 1PNRA 3LUKA 4I14A 4CV1A 1NJFA 5ADVA 1IEVA 3F5MA 1V0JA 2DZDA 2GTHA 2XUJA 3QOXA 3A27A 2O2XA 3FH0A 3L02A 3NJ4A 4AZ0A 4MUYA 1U98A 1YASA 3V9PA 2GAJA 3HPQA 4XX1A 4XYLA 2P2GA 3GLVA 2CVZA 2TRSB 4IFBA 4LJ7A 5EP3A 2B1GA 4MW2A 4TV9B 4L6IA 2B83A 1T13A 4O4IA 4YN3A 2I3DA 1EFVA 4PYMA 1XLVA 5A3QA 1T2CA 4R84A 2QN2A 1B14A 2HHJA 4OFBA 5IDWA 4Y9UA 2PX8A 5IXYA 2H51A 5JI2E 5L9AA 3U44A 1SH7A 3EUEA 4MIEA 2VXYA 2ZSAA 1U2TA 1DZIA 1QX4A 3PCTA 4IHJF 3NVMB 4BBAA 4ZHSA 1KC3A 1YS9A 2Z8XA 4Y7DA 1C9NA 3WBFA 2L2QA 3FYHA 1D2CA 1K2WA 4IGFA 5EKSA 3SOZA 1EX7A 3I2YX 2BFOA 2PX6A 3EUWA 3I2IA 3C8MA 3QVOA 1GZ6A 1HX7A 5KYVA 1Y98A 2JLRA 4DPLA 3KPJA 5KNCH 4I66A 1NVBA 1SKMA 1N1DA 5LIRA 2OEPA 2W2KB 4DQXA 1BDMA 5K8IA 1QBGA 2KI5A 3SEQA 4C7XA 4L78A 1S01A 2ZIEA 3AGPA 2WP8J 4JEIA 2DPLA 3ZBUA 3FDIA 2OFPA 3FWPA 2AF4C 1FFAA 1XAIA 2PO5A 5IT4A 2F90A 1T5DX 2QTGA 3CRVA 3DZ8A 4DILA 2YHIA 4GE0A 2YW2A 3HU3A 3TBHA 1T1GA 3V4ZA 3LCCA 4ACAA 4TMWA 2PQ6A 1DLJA 4RJTA 4BJ3A 4QT0A 4RMNA 2XCQA 2Y0CA 4L73A 4LXIA 2XUGA 5TMBA 1JHRA 4LNAA 4A5SA 4MDFA 3IQFA 3ZHVA 2HPVA 4L6CA 4L3VA 4QM6A 3IV9A 1L5YA 1FUUA 4LECA 4A0FA 4MUNA 3NGLA 2JHPA 3DKPA 4D9MA 2ZTUA 3RSZA 2V7VA 1NQTA 4UVGA 3A10A 1R3UA 3B1YA 4RCVA 2ZBFA 4CTJA 4MPRA 3DMTC 3O8QB 3PC6A 3OPXA 1FDSA 3RAFC 1QDEA 1TGYA 1GCIA 1KZ1A 3UJAA 2DLCX 3ICWA 5ALFA 2QR5A 2KM1A 2XWSA 5LR6A 3R6DA 5EXTA 3JVEA 1UOQA 3C3DA 1CEEA 1E1QD 1FTSA 1UBNA 4H6PA 4PGAA 1UWKA 2HJWA 1ZBQA 5BWCA 4LF5B 1S1MA 1O4VA 4DCUA 2CFSA 1TO2E 1EGMB 1W581 3OTGA 1XZNA 3PUZA 4UC0A 3MGBA 3P9NA 3KYJB 4PLPA 2QTMA 4M36A 4BHTA 1K8QA 2Q6TA 3PQDA 2XGJA 4NI5A 3MERA 2Y0BA 3N3BC 3LQ4A 4BO2A 5GVRA 3HB9A 1XQ1A 3C7AA 3OG9A 4DNXA 1CS4C 1O1YA 5CIQA 3PE4A 2FEMA 4AJNA 2XBLA 2VUSA 3V4LA 3A9UA 2BF4A 3E2IA 1WDMA 1TJPB 3AM3A 3CWQA 4KUGA 821PA 3HBAA 1QQ7A 3L8YA 4M7RA 1SXHA 3HO1A 3OZEA 1AM4D 4NBUA 5KZMB 3REQB 3ONFA 2NU8B 1EESA 3WJ2A 5EJ7A 3EYWA 4G5RA 3O5AA 1GEEA 1OZAA 1PEDA 4YROA 4Z9YA 4B7UA 5A6SA 2FFHA 3KKQA 3V9AA 3ABIA 2PM8A 3WDMA 3O9VA 5A9TA 3NAZA 4LE0A 2GXSA 4XZ3A 4S1TA 1M75A 3HSSA 1X2EA 4KSYA 1TTQB 4JJ4A 1C5KA 4QQRA 1M2GA 1YZUA 5J9FA 1NBMD 3AF5A 3R7NA 1T1RA 2W2KA 5IVPA 1L5HB 4EF6A 1PSDA 1N6HA 1NPTO 3GRRA 1X7DA 4MGEA 3FLEA 1PR1A 3IBSA 1BTOA 2CJPA 3QLVA 4YX9A 4OQNA 1P1CA 3KFLA 4KIGA 1AS2A 5BXQC 3U7EB 3SG0A 1FP2A 5KMGA 2W2OA 1UJBA 1A96A 2L82A 1SELA 1XTPA 5GV8A 3VR2A 4OB7A 3T3MB 4ZVLA 2K87A 4Q39A 3U44B 5A02A 2PH5A 2GYVA 3T3DA 5HZGA 3ERCA 1V8BA 4C78A 1ZCZA 4BRZA 4ATNA 4H7JA 4DUGD 4YVFA 1AKRA 3CUTA 2IU3A 2WTXA 1WF6A 4N8DA 3PEWA 3R9XB 1ZOPA 1FNNA 3NYWA 2ACEA 1OFGA 3QXXA 4GFDA 4MEJA 4OD0A 5K6AA 4PPGA 2EKPA 1CRWG 3QX7A 3IQDB 3IKVA 2IYRA 2O3RA 2DP4E 2O3TA 4PG6A 1R8JA 2Z1NA 3DE4X 1VYTA 2R47A 5EVCA 3TD9A 4TSFA 5LNK1 1KJNA 2NN3C 1EHCA 1E1KA 3UUGA 4JBWA 4FQ5A 5HJ7A 2RKWA 1KDRA 3D6NB 2IKQA 5EN4A 4NZYA 1PKXA 2HH9A 3Q7IA 1JA0A 3CPEA 4OXKA 5HUQA 4G4SO 3S28A 2PX5A 3W6UA 3WOVA 4CMCA 3PFWO 4BNFA 4E15A 4Z3OA 3NB0A 4FE4A 4FWIB 2HYIC 1N3LA 1AV6A 3WGJA 2OM2A 3OZBA 2RARA 4FYXA 3A1WA 1Z62A 2JHCA 3BMNA 4NBNA 1K7FB 4U1RA 1XVAA 3LWBA 4UZEA 3IOCA 1TKAA 3IP3A 4QYSA 3VZCA 1FXSA 2P4QA 2ZS8A 1SWVA 3H5LA 3N5CA 4GPAA 4XUDA 4Y30A 3JQCA 3UG6A 3FHCB 2IGTA 3QG1A 1O3YA 2IQ5A 3PE6A 3RG2A 1P8JA 4ABTA 3TNFA 1Z7EA 3OJXA 3EVEA 4QL3A 3BPSA 3VAAA 4CL3A 5B64A 2FQYA 2JJ2D 4TLAA 4IH1A 1E69A 4UMEA 5SV2A 1T2NA 3GLFB 3TINA 3G9UA 5CW2A 3LHKA 3VU9A 4UOEA 1H6AA 4RJJA 1NF3A 2EBFX 2AI1A 5LDGA 5JCPA 4N5NA 5JVDB 1GQQA 1NXWA 1U8EA 1OJLA 1UWLA 1GV0A 1XG5A 3QOYA 1E77A 3GQVA 4QDUA 1BN6A 4O2AB 3RU9A 5G0TA 1VGVA 1VG0B 4MGHA 1A9SA 2FG5A 1OWMA 3AESB 4CIXA 1X2BA 5KBYA 3RT1A 3WR5A 3QU7A 4K9PA 4TWBA 4Y9SA 1T5BA 5I4KA 1XDWA 1NUAA 4QXRA 4XGQA 3RFUA 4B31A 5FWXB 1K4YA 1M73E 2CLSA 1USIA 1X15A 1VL1A 3OKFA 5EZYB 3PCRB 1I7LA 2EQAA 1ZESA 2PGNA 4XIIA 3OJFA 5KQMA 3KV1A 4Q3KA 4AX4A 1WPQA 2PL9A 1QH1A 4BLTA 2R6ZA 2VXOA 2YXDA 1G3UA 2A1UA 3E7WA 4M98A 5H16A 5AW9A 1JG7A 4O25A 2MTBA 4Y2SA 2ZUBA 2HRCA 4QGGA 3HUFA 4Z6KA 1BH6A 1ZC3A 2AFHE 2O20A 2OORC 4FOTA 4CDMA 4DMFA 1N2HA 3DT9A 4W5HA 2UUCB 3C3YA 1M2JA 5BN1A 3TGLA 4FPXA 4AICA 1BMTA 3AXSA 4ZDKA 3GJSA 4CKZA 4YGYA 3MM4A 5H82A 3M4NA 1I5EA 5JY1A 3AL2A 1HL7A 4M1YA 3ZWKA 3PWKA 4RTOA 3PPXA 2I9PA 3AI3A 5IABA 2PLAA 4MV8A 4BNGA 1Q3HA 3MW8A 1E5QA 3TRFA 5IHPA 2C0CA 4F8EA 2PZJA 4E13A 1LBTA 2H0AA 3K9NA 4GGMX 2GKOA 2ZRPA 3QLTA 2X8JB 5ALRA 3K0AB 3VHQA 5CBPB 4UQLA 1A50B 2OXEA 3BB4A 2QG4A 3AWIA 1E6WA 2JFPA 4MLCA 3WBJA 4AMVA 1E6CA 1G42A 1LFDB 1P1HA 4ZP1A 3RC3A 4AU1A 2RAFA 3ZCRA 3F3YA 5LDHA 5G1NA 3S2IA 5JPDA 1SU4A 2I6UA 4ZI5A 4E03A 1OX4A 4FYWA 3MJCA 1D2MA 1OY1A 3ENZA 1UMCB 1LRKA 4FN5A 1Q0TA 3MJDA 4FMPA 4IRXA 1NQ5A 1G2QA 1XVLA 2FZEA 2ZE7A 4TKVA 1RPTA 3IBGA 4KDCA 4XOIA 3VYRB 1B93A 4O2BA 5HIIA 1JEQB 2YL2A 1DE0A 2EX1A 3PBKA 2HK7A 3U49A 3D8RA 2Y1DA 3U0VA 5JSKA 2I1QA 4LYFA 2H63A 4BN5A 2GHTA 2YINC 3D4LA 4OL0A 4Z1MD 4FEYA 3WZ2A 1D4AA 1O6GA 1IZ0A 3C7KA 3ORYA 3NT2A 1Y82A 2WAOA 3U6BA 1V5IA 2B2NA 4YUYA 2CYBA 1V43A 5AO9A 2ISSD 4PFQA 4KBYA 4HNAA 2NSDA 3A9RA 1KYTA 2MYUA 1QWOA 4EG3A 4CQMA 2NZUG 4D9FA 4X91A 4NJEB 5TS3A 3DE1X 2YQ5A 5NULA 2LPMA 3MS4A 4LF9B 1H2XA 3VUEA 1U9YA 4Q01A 1YR8A 1GQRA 1PG5A 3WAJA 1F2DA 4TUYB 1BG6A 2CFIA 2CC2A 3FGZA 3IOEA 1A69A 5K4AA 2IPAB 1M83A 5JZMA 1BS1A 2BMEA 2A0KA 3B70A 3R6GA 4K6OA 3GUZA 5A04A 3L0YA 4EG6A 3P5BA 1YUMA 1BS9A 3V1YA 2WWYA 4HO1X 2O1EA 1N0IA 3P9ZA 2O8BB 3TZQA 3SSOA 3EPKA 5CGZA 3C5EA 4X64B 2R2AA 4Y8VA 4YRQA 3LECA 5IJ9A 5DNUA 5IJ0A 5AJHA 3KLOA 5EXXA 1UPCA 5AJXA 4BMYA 1TJ4A 4ETIA 4R2WA 5EJIA 4EEKA 1I24A 2HREA 2W2QA 1Z2PX 3GAAA 1WPXA 1FP7A 2YXBA 3BWVA 2RGYA 5TEVA 1M74A 4EQ6B 2XE6A 3FY4A 5KCMA 3LOUA 3WK7A 4G8CA 5L4NA 1THZA 1AY0A 1ZOIA 4BKQA 5JFTA 3PVCA 1F6BA 3H9CA 4ERXA 1U5BA 3QVTA 3QLJA 5BN3B 3WDSA 2QD3A 3KEGA 4PQFA 2YXPX 2CB0A 3G8BA 4B32A 3G2KA 2KWIA 3IYLW 2ZI7A 4I50F 1FQOA 4CM5A 3IAFA 1N3IA 3IVGA 1K5HA 4KGXA 3OIWA 4RH1A 3ZKWB 1X70A 2Y92A 1EVEA 4BXOB 5DGDA 1IOWA 2YUIA 4RZHA 1VMEA 5CB4B 2ZQYA 1X38A 3N6VA 3BH0A 1NYLA 4B4KA 4RL4A 2O07A 4DLXA 4OAOA 2AR9A 3EZ7A 4NEHB 2XNDD 2IPMA 1CEXA 1GP2A 3U4QB 2ZBPA 1TAUA 1GAXA 4H31A 4DIOA 5F7JA 3T3OA 2H2WA 4XGRA 4EDFA 2XYHA 1XTQA 3O47A 4S0ZA 1KIMA 4LTDA 4TZKA 5D84A 4ZGGA 5MN6A 2E4YA 1FRNA 1PFKA 1QFJA 1U5BB 4RZQA 2B3DA 2J31A 3TUIC 4DBLE 4W5WA 5CLGA 2ZTLA 2OCBA 4N3BA 2LZ0A 3FOBA 2DWPA 3RUFA 5DBEX 4CIVA 4KE7A 2B78A 4W1RA 1XHEA 1JN0A 2H7CA 2ZYVX 3NTXA 4TMTA 3UN1A 3MVEA 1BX3A 2C2BA 4RADA 4BBJA 3RWOA 3L7IA 1JFRA 4D9BA 4DLZA 2RCYA 1G8KA 3VISA 1V1MA 3QWBA 1MOQA 2AYXA 5JRDS 3FB1A 4XM2A 3I2KA 2ZXUA 2PCLA 4TUYA 5JMTA 1ODCA 2PKEA 4G4JA 1HY3A 2YNMD 2PX2A 1PNVA 5D86A 2J3MA 1GAEO 3B89A 4R8LA 3V2HA 3VH2A 3GRFA 1ZMOA 1HK7A 1Z8HA 5EJEA 3OM8A 2GD6A 1SCDA 2O5RA 1FRFS 1GJRA 4OVKA 4PSVA 4HEA6 4YEDA 2F6RA 1PQWA 3QVGA 1ORVA 2ATXA 3WICA 4ZO6A 3SQDA 3KTDA 4HAXA 5CK5A 1OB5A 1ZCAA 2C4NA 2GLTA 5FTJA 4ZKEA 5HTOA 1A4UA 2Z58A 3H9GA 2V1UA 3K70B 2C4TA 5EXDA 3CVXA 1WG8A 1EQAA 1HYQA 1DFGA 1FF9A 2V1XA 4IS3A 1DTEA 3L07A 1UC8A 3RFFA 1XDDA 1YRBA 3JALA 2Z3WA 3ZH9B 1MABB 1S8NA 1VHWA 1EK1A 1OFIA 5E4TA 3I62A 1LA2A 4MS3B 1IB6A 5FUVA 2HX1A 3H4VA 2QRPA 1J99A 1ZGJA 4OUDA 2QTWB 4I5EA 4PZCA 2B30A 1AG9A 4PV7A 5CNMA 5JZVA 1XSEA 2YWFA 2AE1A 1JQDA 1N2OA 1JEQA 1TIKA 1TO6A 3L79A 4KEAA 4EHJA 4ARZA 4IJQA 5IYZB 4R31A 5LYJF 2BEWA 2IYZA 3LK6A 5YASA 3IAEA 3QFCA 5AW5A 3A37A 4P9NA 2HMYB 1ZOOA 3ZHBA 4RX1A 3EASA 1JPVA 4OGWA 5U9CA 4DCMA 3F97A 3CRW1 4UBLA 1DBRA 3EW7A 3NTUA 4FBGA 3SYLA 3INYA 2CMDA 2ZIXB 2JK1A 3OZDA 3DV2A 2D5IA 4ZC8A 3MHTA 2VZEA 3R5TA 1RQ7A 1Y6QA 4E5SA 5EMMA 1B8UA 1BW9B 4IM7A 4AY4A 2G36A 3AWDA 3K6KA 3DBLA 4ZVTA 1DTWA 3OBBA 4L7VA 1HMPA 2GEBA 3U7QA 4REMA 4CKEA 5CG2A 3QGMA 2X8JA 2CL7X 4CPDA 4P7JA 1QB7A 5DI3B 4FKMA 1ZAYA 1VP3A 3Q6MA 2AC7A 4HTFB 4IDAA 3AC0A 5D7BA 2P8SA 3JSAA 4UUNA 1XRJA 2UYQA 4MPJA 2G0TA 5ELLA 2PU5A 4J1SA 5I7FA 5CVJA 4GDFA 2WK1A 2VSNA 4CM9D 4B4VA 1GLNA 2N46A 5HQ3A 1ADJA 2A57A 3KHUA 5DH9A 2Y6UA 3EXHC 1AKWA 1AB6A 3GLKA 4ZFNA 4U7DA 2FRVA 1LZLA 2B8WA 3UENA 2ZU6A 1CY8A 1EDZA 4BMOB 4L4SA 4AK9A 2FTKE 2R1VB 3LL7A 4HATA 1R74A 2ODNA 1N6IA 2TMYA 2ZI3A 3BM5A 2CSUA 2A1UB 3DD5A 5IKXA 1QRSA 3DWIA 3KKKA 3CZ5A 4RU1A 4DC0A 4WINA 4QBIA 2ODAA 4RDCA 5K0BA 2QX8A 1GKUB 2FPGA 1CXZA 4I55A 1N7IA 3CX8A 3DEKA 2A9JA 4Q3NA 1MGOA 5C8YF 4JA0A 1NY6A 2QN8A 1GL3A 1MORA 1OYOA 3MRVA 3EDQA 4URWR 3TZEA 2XEDA 1ZGBA 1P5JA 1RE0A 6LDHA 4B85A 4FQ8A 4GM0A 3M6LA 4L4YA 3H5RA 3BMCB 4G5YA 1JFLA 1PW5A 1YR6A 4ZOLB 3ZI4A 3HBMA 2YYYA 3PQCA 4B0PA 2YJ4A 3K7EA 3BRCA 5JPCA 4LFAB 2A5GA 5KNDD 1A5ZA 1Q1GA 3PXDA 3B2EA 1ZRHA 3RARA 1MVOA 5EJGA 4YMWA 3N2KB 5JVDA 4TS9A 2FV8A 4B6RA 2H59A 3EIEA 4BVGA 1JUDA 2GVDC 4QOJA 4E6PA 4YLYA 1B6GA 1NLFA 1ZEMA 3NLLA 1NSFA 3U17A 5IANA 2CV2A 2I67A 1XK6A 1YR2A 2I6GA 2X2EA 3K0CA 2E1RA 3OKAA 1XMXA 3AYZB 4UCXA 4YECA 4MJLA 4FHDA 1EU1A 3RAPR 3U3KA 3TECE 2YJGA 3M6WA 2PUBA 1HE1C 1M6EX 2V96A 3KB2A 4L8YA 2XLBA 2PUJA 4JXJA 4RV5A 2GCPA 3ET4A 4QPPA 4YAIA 3Q15C 2VT3A 2DLNA 3HCOA 1ODFA 1QYDA 4JR2A 1P4RA 1W2HA 1YD7A 2PS9A 1OTYA 2R1UA 2BCEA 2Y71A 3EIFA 3N74A 3FGNA 4QARA 2B25A 2YWJA 1RRKA 2XADA 1CUIA 2P3LA 3GCGA 2QI9C 1N2XA 4LVNA 3SSNA 1RYZA 2EP7A 3CR8A 3IQEA 4MKHA 2QPOA 4NSNA 4QBKA 1R0BA 5HF9A 2WZBA 2R7LA 2V6FA 5B2ZA 2R60A 3FKQA 2D59A 1GDTA 2BGNA 4D44A 1Q84A 3QTTA 1GKLA 3O75A 6REQA 3RLIA 4CLRB 2AEFA 5D5PA 3QFFA 1P9WA 1IOLA 2COKA 3G0GA 3DM9B 3DDNA 3MPOA 5E8JA 3OQMA 1HDRA 4ZC1A 1SCAA 1V3UA 2A92A 1Y8RB 2BH9A 3HMQA 1FU7A 2X8LA 4LV6A 4N47A 4HWRA 4F85A 1QIKA 3GA5A 3FKJA 3FWZA 3H65A 5ERYA 3IJRA 4U6SA 3NMUF 3AGQA 1B8NA 1KMNA 2DKFA 4NBWA 3HEAA 2JJYA 3HUUA 3MC1A 4R2IA 4HWGA 1YHZA 1NT2A 3GLRA 5JH7A 1U0OC 3T7TA 5C8DA 4C5CA 2PQMA 2EYQA 3RRBA 3TN7A 5AUNB 4ZT4A 5KMGB 3THWA 1JIKA 1GZUA 4JUBA 2FMHA 2G9ZA 4QU9A 1FFXB 3U7RA 4KMMA 3X1JA 3LCRA 4OXNA 1NHWA 3VVLA 4M1OA 2OV4A 3DL4A 4JX8A 5HCNA 1EIZA 5HFNA 1SXJC 4J03A 1BNCA 2P9CA 2TYSB 4IFEA 4R9RA 1GNRA 2Y1XA 4LWQA 4Q3LA 4RFVA 3E0XA 4NRDA 4ZHQB 1LPPA 2ZPUA 3PGLA 2QR2A 1XEWY 2VBGA 2DUUA 1LLCA 2Q27A 2ZCUA 2UU9B 2I7VA 1BDJA 3CV3A 3IMFA 3PWZA 4JL8A 3NHMA 4NJMA 4QUIA 4WFQA 2FW7A 1QNLA 2H1WA 4ALMA 1R18A 1H42A 5JD3A 5JUWA 4LBWA 3D5EA 3W1EA 2HWWA 2H3EA 3ZWDA 1OV4A 4DA9A 1TQ2A 2O2YA 1T5TA 4B33A 1KDZA 5E1BA 1D2EA 2RI0A 3M34A 2I7XA 4XD7D 1DC5A 1IXYA 3RVMA 3QY0A 4I4TB 1JDJA 1VGRA 2AMYA 3WGVA 1P7PA 3KVNA 3ACCA 4PZ0A 4KQCA 4B6EA 2D5CA 3QWIA 4LX8A 1XFDA 4K6MA 5CX1A 4IICA 1KE2A 1ZONA 2DPMA 4BO3A 2DHDA 4EKDA 4TQ9A 4OMDA 3MPUA 2AG6A 4G0ZA 1KAOA 1ST2A 4KFSA 4XYEA 1SG6A 3SJCA 5IZ4A 3A36A 1L4EA 2CNWA 4XB6B 1E8NA 1F12A 2VK8A 5H9WA 1T9CA 3GUHA 3LVFO 5JLAA 1BDIA 1C81A 1KO1A 3RLFA 1UAYA 4WZAE 5CVEA 1X1DA 3NALA 4A23A 1YGYA 3N0TA 4IEIA 3ZW9A 3FTCA 3W3ZB 3RDPA 4F4FA 1J0DA 3W5BA 3ES9A 4ND5A 3WGLA 4WESB 1ZZGA 2ZRQA 3PC2A 2I6QA 5HMMA 1W4ZA 1GL9B 3O8QA 3LI2A 2OPBA 1PJRA 3IE0A 5IK2A 4GI2A 4O3FA 4RQAA 2AIRA 3HHPA 1W59A 2AMFA 3ZEAA 3RUAA 1GLGA 3T7CA 5HS4A 2Z4SA 1GUZA 2P5SA 5SYAA 1AKUA 4RSMA 4G5QA 2JJ8A 4CM8A 1NI3A 2IE8A 5BP7A 3NWPA 1CIPA 1CNEA 1EJBA 1G4UR 1LD3A 1HRDA 4IF4A 4PW0A 4RIGA 2QD1A 5ESDA 3ROEA 3KNZA 5DBOA 1HQDA 1ZINA 4K6CA 3KTAB 2K6GA 4XEHA 1JB9A 5EL0A 1G8SA 1H69A 4PHFA 4RA6A 3HZRA 1OTHA 3GMIA 4BJHB 4B8WA 1THGA 3ZNNA 1SVNA 5KO2A 4OP3A 4TXLA 2AEMA 2VAXA 3K73O 3W1VA 1XUOA 2YJ6A 3TOCA 4N3CA 2P69A 4X1KB 3OP1A 1SUSA 2IRWA 1B15A 2IYTA 5A62A 4Q7EA 4EVIA 3F1KA 3KOMA 2BDTA 4KJZA 3BWYA 2G9QA 4YRKA 4JDUA 1FBTA 2WINI 4Y67A 4B6PA 5FIUA 4GKAA 3SQLA 1T4BA 1G5QA 1EAYA 1PWXA 1UKEA 1J23A 2VUTA 5FULA 3OOHA 4LRSB 3WHKA 5C4IA 5ILGA 2GARA 1OXTA 3GA7A 2O3UA 4A2QA 4KX5A 4QYMA 5COBA 2MR6A 3EBPA 1QHHB 5DASA 1H0SA 1Z6TA 1T6NA 1C8BA 4E09A 2GVZC 3L4BA 3TMAA 1QCZA 4B4DA 1L3BA 2FPKA 5IDXA 1MO6A 1TNDA 4DABA 3K4HA 1WQ3A 3DVAA 3O74A 4N5LA 3AB7A 5DM60 4CTOA 1KQOA 2YW9A 1SKUA 4NCBA 3HK2A 5EHQA 3O38A 1YE8A 3CZPA 3OX2A 4MA5A 2B1RA 4BC0A 1OI7A 3DE7X 4PM4A 3D1JA 3WLNA 5DU2A 2QYSA 4KAFA 3G2JA 4ZA2A 1CUCA 1JA9A 1BQ4A 4F96A 4W5RA 3HLKA 4XIFA 2FSPA 2Q2QA 4IHQA 1GTSA 4EHAA 1R8QA 2VF7A 5TSDA 2RK6A 2ID8A 2Z98A 3HVJA 3KZCA 3NONA 4CLHA 4MR9B 2O5CA 2K5UA 2QRVB 3QVUA 2IZOA 1HH4A 1W85B 3FYSA 3P9SA 1U8FO 1OKKD 3ORSA 4IUYA 4REOA 5ARDA 2QUHA 1A9ZA 5DVZA 4U3JA 1KZHA 3WO0A 1VIVA 1Z0UA 1U0RA 2H07A 3A8TA 2V6IA 4AUNA 3GLIB 4DKXA 5HK8A 4LGMA 2FPLA 2C8VA 2IZ6A 1R7RA 5DCUA 2BGMA 2Z8YM 3GEBA 4JHXA 3TBFA 1GCGA 4MQUA 3WFJA 3QVVA 4AQYB 3FHJA 3OPYB 1G6Q1 4TL7A 1MX3A 2GM4A 5LWHA 3QBVA 2QQEA 1R0WA 3R44A 4WADA 3FRJA 4KG7A 1H05A 4JLSA 2Y0PA 2OCYC 5AM0A 2K2QB 2PGOA 2PKQP 1YA8A 4DA0A 4EARA 4S24A 3LZDA 4URFA 2FPPB 1MRSA 1HUQA 2YCBA 3AJ9A 2IYNA 1V8ZA 2CY0A 4D46A 3Q72A 5HHTA 1Y7TA 2Z6VA 4BFZA 4ZO4A 2I1LA 1U0FA 3AVWA 1BFDA 2JLBA 3E4CA 4JOQA 1JU3A 1W8IA 2PBZA 3CZ9A 3GHYA 3IP9A 3L84A 4FGLA 3RS4A 4IVPA 4R7GA 1R5BA 3EC7A 2HA6A 5D3KA 2BKUA 2KPOA 3SFVA 3DB2A 2JJMA 5DX1A 3S1SA 1H9CA 4M1WA 2P40A 4C4AA 1SC3A 2VDVE 5BMVF 5DLEA 3D3EA 3LLCA 2W71A 1ZXLA 5I51A 1N2EA 3GFPA 3KXKA 1GU0A 1X7YA 3IELA 2VDOB 1OR8A 1GGVA 1JQ3A 2HDOA 4NH4A 4YJGA 1B42A 1MT0A 1A88A 5I9NA 1SQ5A 1L5SA 1D9ZA 1QTNA 2HDWA 2J4CA 3FTQA 3KR2A 4A8JC 2Q9AA 1Z8DA 4W7IA 1BMDA 3L8ZA 4QO8A 1MJHA 2XDQB 4PR3A 2ODEA 2ZYWX 2RHBA 3FNHA 2YOHA 3HB4X 2Q1XA 1ODKA 4Y6OA 4X65B 4K9KA 2XQVA 3W2FA 5JYDA 1Y8CA 2W8ZA 3NOQA 4JLBA 1K0FA 1ZFNA 2PWZA 4O63O 3MTGA 4HGNA 1TEZA 1NQWA 3K05A 2BGGA 1Y1QA 3G2IA 1QGED 3U4IA 4RD1A 1HYGA 3AY3A 4KP7A 4BU1A 1ZN8A 1CRZA 1JILA 2ROQA 4P4TA 4MCHA 3G5MA 3FW1A 3CINA 3IFSA 4ZVQA 2HT6A 1W5SA 2CXQA 2Q3DA 2ZXFA 5HQ3B 2ZYDA 3GP5A 4MWDA 2L69A 3NDJA 2ORVA 5D3QA 1Z0FA 4EA8A 5GONF 3KOXA 3RRJA 3L7OA 4M54A 3ZYZA 2GS9A 4BNUA 1QAOA 3A1SA 1GPMA 2N0SA 1JJIA 3EGDA 4UEOA 3EPLA 2TS1A 1BX0A 1JP7A 1FSZA 3L93A 2DHQA 1SBTA 3N2YA 3AI7A 3OPVA 3DBLB 3HSYA 3HR8A 3P2MA 4BX8A 1L7PA 3PC3A 4C0XA 5BW8A 3AKZA 2EW8A 4HQOA 3CUWA 1MIOB 5G0SA 4LOAA 5A3RA 1KI3A 1BGWA 3A3OA 3D0OA 4W6QA 1ZN7A 4BUJA 2P2CA 1EB8A 3PXCX 4L1KA 2OECA 2W6ZA 3QH4A 2VL7A 4HYYA 3TE6A 4R6XA 4CR8A 3THSA 4R9UC 3AP3A 1G64A 1E3WB 3IBCA 3M6UA 4FFPA 4BLPA 1L9KA 3T38A 3MJHA 3N2EA 4MV0A 5C52B 3FUVA 2VEOA 4N18A 3DT8A 2YKGA 1CUWA 1PNQA 1AQIA 1SC1A 2WVGA 2R9VA 2YMMA 2G5PA 3IESA 4MS3A 3BHMA 5L95A 1V2HE 4DOMA 4JCCA 2CN1A 4WBNB 4ND8A 5GTDA 1N57A 2GFIA 3I0NA 5IF9A 1N9KA 4YXWD 1JS1X 5BQ3A 2XZOA 2WSBA 1GG2A 3QU5A 3TNDA 1XVUA 3KVVA 3VM6A 3IUEA 2LIPA 4LF4B 4UPDA 1XWWA 2DQZA 4ZEVA 3MZ0A 1X8XA 3KAPA 4ZZ2A 3VFDA 3E53A 4I4LA 5AW4A 3JYPA 5KOHA 1P2BA 1J4AA 1NLMA 3EN0A 2ZWPA 1Y33E 1VPWA 3KR0A 4R2JA 3SZLA 4LBYA 1PZFA 1QOPB 3ZPXA 4EKEA 3E7PA 1P80A 4EGCB 3JSXA 4HWTA 4BU0A 3A1EA 1GZ5A 3UV3A 3ZCXA 5MHTA 3GRKA 3KOZA 3TAHA 4DRXA 4EJFA 1AKMA 4G5FA 1TA9A 4PRLA 3TX2A 2DBYA 1CUEA 1HXHA 3H2JA 2HMTA 3R7FA 4MUBA 1E2DA 3LPMA 3DFFA 1J5PA 1YZLA 2AVDA 4K9NA 4RHXA 2Q3LA 3MOSA 3IDAA 3AK4A 4PS0A 1Q16A 3VDQA 4A8TA 2Y99A 5H7XA 2FUEA 4ZCTA 2VQSA 5KJEA 1EHIA 3DWFA 4P54A 5JJBA 4CEIA 5FV4A 4ZQGA 5IZCA 3FFAA 5EJFA 1Y9ZA 2BELA 5E6SB 1IEXA 1RABA 5TARA 1R8XA 4X8MA 3KSAC 1ZR2A 3P4UA 1IM5A 2QRNA 3FYUC 4FFDA 4RVDA 4HB4A 4GYJA 3QQPA 3F6PA 1BQ3A 2FW9A 1JAZA 2GD2A 2VAPA 2QTVB 3H16A 3HVIA 3NEPX 5SY4A 5ABPA 5AVRA 1QH0A 5HKOA 3H87A 2X76A 3B1KA 1QTQA 3HBLA 3SBEA 5ED0A 3BC1A 3HJFA 1X80B 5EHNA 5CLQA 3RSCA 1GAJA 4CM4B 5IM4F 4B3RB 2JRCA 3BWDD 5GONA 4UM8B 5ICFA 1XAHA 2FP4A 3R5SA 1I5OA 3PYLA 3V42A 3TLMA 2BL4A 1U3UA 2GPTA 4II3A 5IM5A 4AFNA 2FUKA 5FPPA 1KSGA 2EWMA 3CVYA 1IZ8A 4J0KA 3GOQA 4HXFB 4JR0A 2V4UA 2W2XA 4BATA 1TLLA 1Z4MA 3G2LA 3NNSA 5C8YB 3A7DA 1XL1A 3FUCA 4G0QA 1NF2A 1U7DA 3CR3C 2OHHA 4KTVE 5JVDF 3SHVA 2D0DA 2R751 5TF4A 1RQRA 3RF7A 2FSVA 3VHLB 3L3BA 3GLGB 5IKMA 2VATA 4TMVA 1M8KA 3OIUA 4NMHA 4UE3S 5HW0A 2JCYA 2HU2A 3H7IA 2AQKA 5C35A 4MW0A 3FCAA 4OQ4A 5LUBA 1HE5A 2JZNA 1IIRA 4FHZA 2Z2KA 4LGVA 2W8BB 3FCYA 3DDHA 1U8CB 1J9ZA 1O97C 2IU0A 2VTKA 3DYVA 4IG4A 5FUQA 2R6DA 3ZGZA 2YZGA 1JHPA 3R0QA 1CIJA 3PHBE 2IHNA 3TCNA 1YQEA 4BFSA 4QVIA 1WD7A 1ECBA 2R8BA 1TIPA 2GJSA 5EHZA 4DWVA 2YV5A 3B20A 1C9DB 2DY1A 4A0RA 1JH9A 4ND6A 4F86A 5B3KA 1P6QA 1HE2A 2XXAA 3I9LA 2RGUA 4FS8A 3T1VA 5EXPA 3ROKA 2HSZA 1U7HA 1CR2A 3F49S 1U8ZA 4Q16A 3W8EA 3BXHA 1UOEA 1QPGA 2AOTA 4MTCA 2BEJA 2CMKA 1DAMA 1UXOA 1MC8A 1XAGA 2WYUA 3HXOA 3JQGA 1QHXA 2BCGY 2PT6A 2ZIAA 3FD8A 2B9VA 2QLMA 2V3WA 4LTNA 4OHCA 4XPZA 4PLHA 5LQSA 4AMUA 1W1UA 3REGA 1X94A 1Y4ZA 3IEIA 1MA0A 1RE1A 1GA6A 2BPOA 4Q1VA 1A82A 3BWXA 3FMFA 3H2ZA 4PX3A 4U7GA 5KYUA 4CG3A 4CKCB 5KYXA 5AVWA 1DCMA 1A8IA 2QD2A 4IS2A 3UPDA 2ZCVA 4FLFA 2J3DA 3IEXA 4G25A 3IILA 5ALXA 3WYEA 1HQYE 2B82A 1I7SB 4Y0VA 4L3WA 2ZUVA 2FWJA 2M9MA 3AR3A 3BK7A 2YBEA 2IU6A 2PUHA 3MTBA 4R8KA 5FXMA 5LB2A 1DQNA 1RLTA 1RYFA 4QQKA 2JFXA 4MVCA 1V3VA 2IXEA 3I04A 4GPEA 4BKUA 1NP7A 2A5LA 2ZB7A 3KVYA 5ALYA 1B4DA 1E2HA 1E66A 3RKSA 1NAIA 2VAVA 5AM4A 1UDCA 4PBSA 3AHHA 4LKRA 3EPHA 4JL6A 2UXDB 4AKIA 1Y8QB 2RHCA 4UATA 2HRBA 1TTTA 1DADA 4K6FA 5KIAA 2VJKA 1I2BA 1LDBA 4D8UA 4PQRA 2QGNA 1MPXA 1RAGA 2PANA 1E9BA 4OMFG 5JH7B 4QHYA 1EVQA 1NDHA 4F4JA 3I61A 2EL9A 1RRCA 1H1LA 3EY9A 2Q9UA 1PL0A 1T1SA 2OWEA 1U2DA 3INGA 2XAUA 2WIDA 4KFRA 1EWTA 1J33A 1SVLA 2MJLA 2R8PA 4R2LA 1E32A 1PUXA 2ES4A 5CCDA 3SE0A 5LQRA 2JLUA 4RENA 1IC6A 2AOUA 1BGXT 2YVUA 3UW1A 1MENA 1L7NA 3W5DA 4S1PA 1OWNA 1W8DA 4PZAA 4C7OB 3K3PA 3WSVA 1A5BB 2AZMA 1UFKA 2P1ZA 3HKCB 4NBRA 2NV6A 5ER9A 2P0AA 1KVUA 2G09A 2O7RA 2YVLA 3VU8A 4TTIA 3QSGA 3N0XA 4LF8B 3UZUA 5J23A 2JB9A 1RAFA 2Z57A 5HVNA 3GJRA 4NBTA 3E4DA 3IP7A 4IUDS 4CF6A 4COOA 5KYGA 3KDPA 4KJXA 4HKTA 2FX2A 1RXYA 3TTWA 1Z7GA 2UUOA 3BIWA 1B6SA 1QK3A 3T3HA 4YMTA 3KYCA 4N7MA 5F1KA 4M8IA 1T4CB 2DBZA 2R1TB 5FFNA 5A3SA 5CFPA 2NV2B 1OMOA 1UBFA 2PZMA 3WLAA 3ZK8A 3VR4A 1I4DD 1C4KA 1YRQA 2D0PB 2QMQA 3F5DA 3C14C 2IS2A 1IVSA 3P9CA 4U7TB 1Z37A 1T9ZA 2QPTA 3NI2A 3GGGA 1J0CA 2P4HX 3D59A 3NTOA 4KWCA 5KNBA 4CGZA 5LZ9A 1XALA 2YFHA 3OFKA 2X7HA 3TZ6A 4BLSA 4HUQB 1QVWA 4IUBS 2R1TA 2IEGA 4BQFA 5I7EA 3LBFA 2AG0A 4Q9DA 2OK8A 4R8VA 1D2NA 4HFMA 4OIFA 4UUOA 3GZJA 5EE0A 2QMEA 1PEKE 3SJAA 4FDVA 1QE0A 2VHVA 3LZCA 4QRDA 1J09A 2VJBA 3D3KA 2OR3A 3UYLA 1CNMA 3Q9UA 1IY2A 1KU0A 4P3XA 3NR2A 1FSPA 1XZGA 4O4JF 2AV6A 4ZIRB 1G3IA 3E1SA 4HDKA 4Z8YA 3ZOZA 5A7GA 1YKGA 4QYTA 4ZEOA 4DT1B 1R0XA 3WLRA 4YHHB 3OQOA 2PKRA 4C0WA 3D81A 3LT0A 5BSUA 4L85A 3O0TA 2INGX 2OOKA 2YYSA 3PWTA 3QBDA 2HI0A 3T15A 5A2QA 4H6WA 3PJGA 4RCYA 1VM6A 2WYWA 3RSOA 5KYWA 2WMNB 5E4FA 2IVFA 4LJAA 3WNBA 3MD9A 4Z4EA 3AVYA 3LSTA 4JUAA 2W6CX 3OJEA 1KI7A 4PXYA 3EG9A 3TLGA 3ZQ6A 4CNBA 3LL4A 5M29A 2HFJA 4H3VA 1NA5A 1H1LB 1XRQA 3FKSD 3STWA 4EO4A 1RFGE 5DM4A 2X4IA 5A3VA 4W82A 3V7FA 3O92A 3T7EA 1JFSA 1TB4A 5H0IA 4O3MA 4P22A 4RYLA 4UEKA 1LX6A 2V59A 1VJDA 3EGWA 3L05A 5EWJB 1XGKA 1JHDA 2A35A 4YTEA 3TAXA 4EKNB 3H5NA 3RHZA 3DG9A 4B6SA 4X45A 3UQZA 3SIRA 3G6WA 1O57A 2WY2D 5HF5A 5DNCA 3IAAA 1J2EA 1Z88A 4AT1A 3ZHZA 1ZJYA 2HDHA 6AT1A 2B7LA 1UZMA 2JIPA 4K26A 1PJ4A 2JANA 3PDIB 4HN9A 4I36A 5CMLA 1O4WA 2J5XA 1QH9A 4IAOA 3IGFA 5EJAA 4QYIA 1IATA 1EH5A 3ND7A 4KB5A 4K8OA 1P18A 4R6WA 3RC2A 4AWBA 4V1CI 5LJLA 1DAHA 4MVJE 3RK0A 3TJRA 1SXJD 2IE0A 1M6YA 2FCRA 1D5WA 4J3NA 4OX9B 2QNIA 2XMSA 3O8RA 4H7IA 2ZSIA 5JAOA 3O84A 2EHJA 5AVOA 3DONA 1KKMA 1L4KA 4LX0A 1UPAA 3UMCA 4WDQA 3M3DA 1C41A 2DAPA 3BTOA 1QAMA 2VSQA 1JXMA 4EKIA 3EWNA 4C0KA 5C18A 1CJCA 1KEWA 5EMLA 3SBXA 6Q21A 3JAWB 1XJWA 4M8SA 4LVUA 3AV3A 2PX3A 3HJBA 1Z7YA 1RXWA 1GVNB 1OGJA 4YYZA 3CKMA 1M34A 2QDXA 4XGNA 5E6RB 1J2TA 2NU9A 3BAZA 4YT5A 2QV0A 3REQA 5JTTA 2AUNA 4GQAA 4JP1A 1PFVA 4GXNA 1EBUA 3H5WA 1WCXA 2VQDA 2X9QA 3HCEA 4OYLA 5IKPA 5IKEA 4HEJA 4TLEA 3M70A 4JB2A 2J0SA 1TD9A 1NBMA 3QVGB 3TZCA 1A27A 3GG9A 4DXHA 3JR3A 3AR2A 1IQRA 3CURA 4RESA 5IG2A 1KEEB 3LDGA 1PWEA 5ALHA 4LISA 1ADGA 2NSYA 2HUNA 4GRAA 3GOHA 3TWOA 1PK7A 2ZROA 1G5HA 1KFCB 4GZ3A 7YASA 4ER7A 1FCJA 4OM7A 4PFSA 3HUTA 2XJ9A 5D3MA 1EJ2A 3F0TA 3T4UA 3UQYS 1V45E 3GT3A 5HIMA 3AIKA 4DV5B 1U0SY 2JJQA 3CNHA 1GG9A 2B7CA 4ONEA 1MDBA 5LA6B 4ZZ1A 1J0AA 4A6XA 3AZOA 1THMA 4DJAA 3ANLA 3D5QA 2C92A 2IU4A 3K4PA 3C15C 4TLDA 3VKWA 4WKPA 3ML1A 1OSNA 1PGQA 4AP9A 2IY8A 2YQZA 3BK1A 1ZK4A 1JTEA 4RGBA 1SMKA 1NR5A 2DFNA 5BW4A 2DF8A 4WKCA 2XD9A 2D1SA 3L9XA 1P62B 3TBKA 3FOAA 4D97A 4D3XA 3HHEA 3I1JA 1V7QA 1XRRA 4TKMA 1B2LA 4PONA 5AVQA 3BE5A 4P5DA 1IBCA 4MJXA 4Y2YA 5AW6A 4FK8A 3OIDA 1SCNE 5F2OA 5JASA 3V8NA 2Q62A 1XMIA 2QX9A 2VZ8A 4AWAA 1USWA 5JT1A 4Y2JA 4Z9FA 1E1RA 3RVKA 2PZEA 5AIBA 1QRTA 1BU5A 3GI1A 1H8HD 2VRCD 2ZJ6A 1COWD 5CYOA 4G5GA 1OYYA 3AYXB 1DQRA 3S0JA 4IYJA 3RS8A 4GPTA 3ZY5A 4FJ2A 5E9QA 1O7JA 3L92A 4UFNA 4B3IA 2Q5JA 4LYHA 3RFXA 2SICE 4KK4A 4RZSA 1RJ9A 3LXRA 1DV1A 2JGIA 3Q5DA 3BBPA 3MJVA 2P2DA 4PTYA 4PVDA 9LDBA 4UU1A 1TECE 3N39C 5B4VA 4OX9Y 5E6SA 5LLTA 3E2PA 4OI0A 4NCIA 5IJXA 1JBEA 8MHTA 1CYEA 1N5JA 4KMOA 2VHQA 3AKDA 1LJUA 1ISJA 1UM9A 4QA9A 1L1FA 5KHLB 2VDJA 2AK2A