4QPDA

Crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase (wild-type) complex with tetrahydrofolate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
308
structure length
308
Chain Sequence
MKIAVIGQSLFGQEVYKELKNEGHMIVGVFTIPDKDGKVDPLAIEAEKDGVPVFKFPRWRLKGKAITEVVDQYKAVGAELNVLPFCSQFIPMEVIDHPKHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFTVFWADDGLDTGPILLQRECDVEPNDNVNSIYKRFLFPEGVKGMVEAVRLIATGKAPRIKQPEEGATYECIQKKENSKIDWNQPAEAIHNWIRGNDRVPGAWAEIDGKSVSFYGSTLLENDHFSSNGQPLEIPGASRAALVTKNGLVLFGNDGKMLLVKNLQFEDGKMIPGSQYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 10-formyltetrahydrofolate dehydrogenase
publication title Structures of the hydrolase domain of zebrafish 10-formyltetrahydrofolate dehydrogenase and its complexes reveal a complete set of key residues for hydrolysis and product inhibition
doi rcsb
source organism Danio rerio
molecule tags Oxidoreductase
total genus 92
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
A PF02911 Formyl_trans_C Formyl transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.10 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Formyl transferase, C-terminal domain 4qpdA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4qpdA01
3R8XA 4TS4A 1YRWA 3O1LA 4ZZ2A 4YFYA 1CDEA 1JKXA 1GRCA 1RBZA 1RBQA 3DCJA 2BLNA 4ZYYA 2CFIA 4TTSA 1MEOA 1RBYA 1ZLYA 3NRBA 5CJJA 4QPCA 1C3EA 1ZGHA 3TQRA 4ZYWA 1FMTA 4TT8A 3N0VA 1NJSA 2YWRA 4NV1A 1RC1A 4QPDA 1ZLXA 4ZYUA 3Q0IA 3KCQA 4EW2A 4ZYVA 1CDDA 4S1NA 1MENA 2BW0A 4ZZ3A 3LOUA 4EW3A 4ZYXA 5J9FA 2GARA 1RC0A 4R8VA 1MEJA 4ZYTA 4ZYZA 3TQQA 4ZZ1A 2FMTA 3P9XA 4Q12A 3GARA 4EW1A 1C2TA 1RBMA 1GARA 4YFVA 3AV3A 4DS3A 3OBIA 4IQFA 3AUFA 4PZUA 3DA8A 5J63A 3W7BA 1S3IA 4ZZ0A
chains in the Genus database with same CATH superfamily
3KQUA 4U0JA 1JQ5A 4JBGA 5KYUA 1ZH6A 4HDSB 2XVMA 5DTEA 2HRBA 1N8TA 3PPVA 3UOWA 1Q0PA 1M72A 2QM0A 1N2IA 4PPQA 1X7YA 1OVMA 2OD7A 1U11A 3ZGXA 4B45A 5TLSA 2ZUWA 1XG5A 2G8NA 1PEYA 3PJGA 5D6OA 2C4KA 5CDYA 4AQYB 4UAJA 2ATEA 1U99A 5ALQA 2BMAA 1GNLA 2JFNA 2ZIWB 2QK4A 4F5EA 4FYYA 4DBVO 2E87A 4RKQA 1GUZA 2H51A 2ZT7A 1WF3A 4TLAA 4R0MA 1JYSA 1G9SA 4L5AA 3C1TA 3GWZA 3G8BA 2WD8A 4AJNA 1R00A 1ZMTA 2J48A 3PD7A 221PA 2VTDA 4ADSG 4DG5A 4EFLA 1E32A 1US8B 1SUFA 1AQIA 2EX0A 2I99A 2XECA 1ULHA 1USUA 3PPWA 4XJTA 3UWMA 4C4TA 2NUPB 1EJBA 3F47A 1KY4A 3O1IC 2BHRA 3U3XA 3WLQA 2QM7A 3KE8A 1LGYA 4EX7A 2IIBA 4GNRA 3ZTWA 1KXZA 3QLTA 3F5SA 3IL2A 2D6FA 2HF9A 1YZKA 4G41A 1I8TA 4HF7A 5BW6B 1KVRA 1BA3A 2F9MA 1X87A 4LXYA 4LTNA 1GUFA 1PI3A 3RKRA 3Q2OA 1W9MA 4JBNA 1DFGA 5JZBA 4EBFA 5KREA 1RXYA 1RLTA 3H2YA 1S3GA 3L0YA 4N39A 1Q1NA 3W4KA 1DINA 1T2FA 4FFPA 1BDHA 3TZLA 3BE4A 5JADA 4KITB 3ZKWA 4AJPA 5IK2D 3BD6A 2B78A 2WB2A 1U2RA 3OUZA 2QEQA 5DLYA 3RHTA 4H59A 2JHPA 1OOEA 1I7LA 2YFHA 3DFFA 3FCAA 3KCQA 3Q41A 4NZYA 4Z54A 2VP9A 1K63A 2XCUA 3O2SB 1GRRA 4IDNA 4RVFA 4DABA 4MA0A 1G3MA 4Y1GA 1NFRA 2G4VA 1C8LA 5B1YA 3RFXA 2J0UB 1XK7A 5J4YA 4LSMA 5B7GA 4A8PA 5A9SB 3HCBA 2WC1A 1AUXA 3DR3A 4ND6A 3U7HB 3LXXA 3B3QA 3UK1A 3DLIA 2VJMA 3GBVA 3ZIDA 1NUSA 5C3UA 4OLAA 5E6RB 5H9VA 2EFCB 4PSDA 1KSFX 4O5OA 1BDIA 2H1VA 2Q4OA 2EFGA 2REQA 4OEHA 5CGQB 4BAGA 4WKCA 3MD9A 3HJUA 4MKFA 1PGJA 2XYPA 4BC1A 4HNGA 1UOOA 4I8IA 4DXAA 3NTQA 3UK0A 4A92A 5C8YB 5A4DA 1U9YA 4FNOA 5E9JA 3TFOA 1D0IA 1U8XX 5F1YA 3RC8A 1TQ8A 1MAWA 3NATA 4PYOA 4UNRA 1SZCA 1E3TA 3UQYS 3N0WA 1YQDA 4PO9A 2NU6A 3CT6A 2JIDA 3MXOA 2ODBA 1YHZA 2BBWA 4M0UA 4O3MA 1GNRA 2W2LD 2NSHA 3CGWA 3T38A 4P7BA 3UMJA 1N2GA 3AP2A 3WGMA 3ZS8A 1ST3A 1D1QA 4PY2A 5EKDA 4BWFB 4KXWA 4CG0A 4K9NA 4TS3A 5CB0A 3E9ZA 4EUKA 1ZNYA 5BOSB 4XDYA 1B7GO 1OU0A 2DGDA 2OCDA 4QQNA 1VCOA 3PWTA 3HP7A 4ID3A 5AUOB 3W6UA 4B09A 3SCZA 1D09A 1RM5A 3NVMB 1URPA 2PH7A 5K8TA 4LVCA 3W2HA 1EUCB 3IBGA 5EPEA 3WWDA 1ZH0A 4WD3A 2G5CA 5BN3B 3I34X 4JB0A 3UATA 4ZDIA 3ISJA 1LEHA 1SCUA 3C3CA 3B70A 3RUDA 3W5CA 1NY6A 1A1VA 4UOEA 2B61A 3I0MA 1Z56C 1UBCA 4DPLA 1L5QA 5BT8A 3BMOA 2XE8A 3MK31 3P96A 3PUIA 3GJ3A 1BEEA 5DYTA 3QF4A 2X4DA 5AVVA 3RVPA 3P0IA 4BO8A 5ADVA 3Q8MA 2Q1WA 2W2KB 2C8LA 3OFKA 4QU8A 3FF4A 4XPIA 5A0FA 4BNTA 5KVVA 3LQ1A 4H7KA 4W5JA 1TTQB 4G5QA 5BNTA 2VQ3A 4ZAYA 2AC7A 1MFPA 3AETB 2CMGA 1VRCA 4N0EA 4CCSA 2FFRA 2VBIA 2XA1A 4FB4A 4L1KA 4EVIA 2WUWE 3ESXA 4H1HA 3QFFA 4COKA 4EA8A 2FU5C 3SN6A 4XH9B 1VZ2A 4GX1A 2BKXA 1UIRA 5FBZA 2DPHA 5C7OO 2DULA 1YKFA 3BH6A 1JSRA 1QBKC 2P8SA 2FN9A 4K9QA 4RPJA 4WFJA 2Q4EA 2RGGA 3IEPA 1TPYA 2K6GA 4E1VA 1SXJA 1LSSA 2SKEA 5KYKA 3CJQA 2NTEA 3R3XA 3TAXA 1P5JA 4CT5A 2A9QA 4HAUA 4I81A 2HF8A 1QIHA 1UJCA 1XJWA 2P3QA 3I05A 1E0SA 4JBLA 1W1IA 3R75A 1BRMA 2JLSA 3U1VA 4DA6A 5KX5A 4JXKA 2O8DA 4HEA6 1ADCA 2IRWA 3WJAA 3GFSA 1DU4A 2QTMA 3OU2A 4KZPA 1VKNA 1VGVA 4R2MA 3KNZA 4FC7A 3FDIA 3LQ2A 1PJ4A 3K7EA 2HJ9A 3SD7A 1TT5A 2CGEA 1LDYA 3NRCA 2F3QA 3EGXB 5T7BA 1IOLA 4EVSA 3OPYI 1SPXA 1JH8A 1M1NA 1ZGAA 2R6GA 3O4RA 5DSXA 2J0SA 4J2HA 4WKBA 4QRDA 2QS9A 2QMUA 4DEVA 3WIUA 1W44A 3DE5X 3EIFA 3FFBA 2QRMA 3PXGA 4BJ1A 2VZEA 3MVEA 3LC0A 2JARA 2NGRA 4WA7A 3CT4A 3TJMA 4FEEA 3HADA 1FEZA 3FNQA 1H5UA 3TZQA 4BLVA 4JEMA 4L28A 1O94D 2QLTA 3QIVA 1SQ5A 5FR1A 5KWIA 5KNLA 1OWPA 1X7WA 2YN4A 1UAAA 4CE6A 3U09A 4FMBB 1IUNA 1W96A 3KQMA 3FN4A 4J90A 4Q9LA 3ZY6A 1VL5A 2A92A 3TQTA 1E6WA 3EPRA 5IKOA 4PYJA 3TUZC 3TLZA 5A3JA 1ISFA 3C7DB 4MHSA 1BE0A 1RYHA 2IIQA 5I9SA 1C81A 4F71A 1KZ1A 2IOHA 4OLFA 5AI8A 4OUKX 2NUTB 1UM9A 4W1SA 3QU5A 2LIVA 4Y2RA 1YRQA 1A8UA 5DK6A 3RV4A 4EF6A 1IHPA 3OZRA 1HY3A 2I65A 2QL5A 3CLTD 1KC1A 2H5LA 2NZYA 3ZDEA 2BEVB 3FLEA 2B0JA 4EYQA 4XOUA 2QPAA 4HZGA 4DDMA 5CTAA 3GX1A 4BGVA 2A88A 4HZIA 1DPFA 2WTBA 2F1HA 3E3LA 3FYUA 4L9WA 3WGHA 1N77A 2E49A 2O0KA 3WIOA 1F9AA 4C6HA 3N9IA 1V39A 1YTLA 2QX9A 1MGPA 1T8SA 2CE7A 5BPHA 4IXTA 3AONB 2ZUFA 1YB2A 5LMNB 3DZKA 3Q1LA 1HYGA 3LUAA 5K20A 3U7FB 2FFBA 2FDXA 3QHPA 2NPFA 1W4BA 4RIHA 3AJAA 2RBEA 3V2UA 4Z0TA 2C8KA 3S2UA 5KS2A 3K5IA 2FSGA 4IH9A 3KX2A 1LA2A 4FHCA 2E5LB 1G38A 3ZDDA 4FT4A 1CR2A 1X7ZA 3FBWA 5L3QA 1B8PA 2JBAB 2DY0A 3UTDA 1DXQA 3TSCA 1JJBA 1TYCA 2WTXA 1D4FA 3BXXA 3LG2A 4JJFA 4EYGA 3L05A 1FXWA 1YS7A 2BKVA 2QI9C 4L5CA 5EPOA 4Q7JB 1E58A 2DB3A 3FRJA 4YV0A 2G17A 5BSUA 2ZAYA 3ZJ5A 2B1IA 2J30A 2QXTA 5G0UA 3TFWA 1O4WA 2H4JA 3M6AA 3UJ6A 3K0AA 1JDVA 3DAOA 4IDAA 2I8LA 4J6FA 4MR8A 4RK1A 1FMTA 3WLMA 2VFAA 1VHQA 1Z29A 1Q1GA 3EBLA 4JI3B 3HXOA 1ZY2A 1ZA1A 1BU8A 5JY1A 3VVBA 2HU2A 3Q3EA 5HF6A 3K0EA 3QFHA 3FVRA 2IXBA 4X65B 1E2HA 3DZJA 4FHEA 4MIKA 2RGRA 2QPTA 4U7GA 2DFKB 3KZKA 5AW2A 5JTTA 4JJ6A 1MQSA 3FD8A 3FSJX 4M8SA 5CPBA 3I04A 1Z8HA 5KQPA 4H0FA 2X14A 3W5HA 4OF4A 4B4OA 1KRWA 1G7SA 3JWGA 4IUDS 5KNDD 1FTWA 3KWMA 3PHJA 2F8SA 3F71A 4U9IS 1TTTA 1Q3HA 4S12A 5KNDH 3UAVA 3AFHA 2DSNA 5AJWA 2NXEA 4UEWA 3LUDA 4F8JA 1GO2A 4GGMX 3NAQA 1G8KA 1MO3A 4HD8A 1OXUA 1Z6AA 2GCIA 4J0HA 3BERA 3NDPA 4MIOA 5CX1A 5KHLB 3RSGA 3RUAA 5KZMB 2XMPA 1VPWA 2NYAA 4KXVA 3SLRA 5K51A 4R2KA 1ZOOA 3BFVA 3UAOA 5BNWA 2HXSA 2AFIB 4NBSA 1EE1A 1KK3A 5B57C 1ECFA 1RD4A 3HKDB 2A0YA 3SR0A 1ZMBA 3LQKA 4BO3A 3LIIA 4G0UA 3W5UA 4D56A 1DWOA 4J29A 4OVKA 4YJ2A 3UMRA 1JDBC 1O0SA 1XB2A 2ENUA 4LUCA 2ZT8A 3F5QA 4XQCA 4Y6PA 3PD0A 1W35A 3HHPA 1T4GA 2GHQA 2FLWA 4PYKA 5T4FA 1G21E 4GOKA 3SXUA 3ER8A 3KXPA 2LNDA 3HEMA 3OEYA 2P35A 8ABPA 3CVVA 2D1SA 4H7FA 4ZOQI 3GLHA 3BXPA 3I9V6 4C06A 2X23A 2ZI5A 4BV9A 1OC2A 1U2SA 3I1IA 4H1VA 3BGOS 4NZZA 1OZAA 3HUTA 2I9PA 3AKCA 1H8EA 5AICA 2OY0A 1CX9B 4RVDA 4OV6B 1IG0A 2AOTB 4UD2A 4PZ9A 1OFGA 4IZIA 2IKQA 2YOHA 3TRKA 1U5AA 4HEHA 5F78A 4MJLA 1S3SA 3JV7A 4X61A 1JQ3A 2BF4A 3C3EA 3FGZA 1NBEA 3EUWA 3T3OA 1W8DA 3DAYA 3A4NA 2GWRA 3D6HA 1UKYA 1SHTX 4OH7A 1G20A 5COAA 3UJHA 4CM1A 3AFMA 3TDMA 1S7CA 4YP0A 2NUBA 4MMYB 4KR0A 4KSCA 4RDXA 3LQRA 4C2AA 1CUCA 2PH1A 5ITZA 4BFXA 4FHGA 3SR4A 2PCLA 1R9MA 1GA6A 1F1BA 3H9CA 4RLSA 2FUG6 5KOJA 2ETVA 1FFWA 1Y34E 1RRFA 1U7DA 2PD6A 1SBCA 1H4SA 2V4UA 4N8EA 3DPSA 3AGPA 1ENPA 2IW3A 2VDRB 1GGKA 1DOZA 2YJZA 5DO9A 3TI7A 5JHGB 2O1SA 3M82A 2QRNA 3H19A 3NCTA 4PC3A 3JCZA 3OTWA 5TE9A 4XD2A 3LFUA 4V0MA 2LWIA 4PTZA 4CKZA 3I61A 2O3TA 3I9V1 3SC4A 2PMWB 3DBOB 1UP4A 4U8GA 2TMDA 1QMGA 5JQGF 2P3LA 2BP7A 2P77A 3HMKA 5A1JA 3V80A 1DZ3A 2ARKA 2EQAA 3GB9A 3H18A 3RFCA 3L7NA 3EVBA 3VNQA 5B3KA 5JJIA 4LJKA 1V1MA 3A1UA 3A9CA 4HXFB 4LVNA 5BYBA 2F62A 3AVTA 4DG9A 5B37A 4KVAA 1T3LA 3T5DA 2VPTA 1JDTA 3G59A 3TSYA 2V97A 4LOIA 4NSNA 5ALFA 5EZYA 4ZVVA 3TVYA 4C08A 4CMIA 5J1SB 3PGVA 3I1FA 3TF5A 4K9SA 1ZSNA 1UOQA 5GTDA 3UT5B 2IX3A 3O8CA 2R5NA 3ZZNA 1W88A 1ZM7A 3ZNQA 2O7NA 1YAJA 3TOCA 3OFSA 3A4IA 4IICA 3QEKA 3O8OA 3SZ3A 2PX8A 5IDWA 4IV8A 4EFKA 1TM7E 5C8XA 1UADA 3HDHA 4K9KA 2AA3A 3OG9A 3BMXA 1TTHA 3KJHA 3ONEA 4EY3A 3VTAA 3LO5A 2AYYA 1XLVA 1MQ8B 1M34B 4R9SA 3V8BA 3LPAA 2AFVA 2IUTA 3GPIA 4G9GA 2E1RA 4M83A 3U48A 5A6VA 1ZO8A 4UEKA 4KOAA 4G0WA 1QJ4A 2WYHA 3K16A 1W25A 1KO8A 3S27A 4ZYXA 4QO8A 3WNDA 3RBZA 5IJ0B 4IL5A 1BX3A 3MMSA 2YJTD 1Q1AA 2D8AA 3GT4A 4FZJA 4X24A 3VU3A 3MIZA 3AF6A 2HWUA 1BKYA 4DQUA 1THTA 1JSCA 3TKAA 4TX1A 3BQMB 3DDUA 2AR7A 1RWXA 2CNWA 5EE3A 4NLLA 3C3MA 1SUIA 4XGRA 4KGVA 4AM8A 4Y7DA 1BG6A 1H3NA 2D5IA 1TC1A 1A71A 3ER6A 2QQ0A 1KS2A 5DYNA 1MB4A 4YWJA 3UC5A 4C07A 4OUDB 3ZQ6A 2QY9A 1G8MA 2ZCUA 4MUBA 4QWWA 2ZJAA 4F6RA 4UPVA 3TX6A 1CQPA 4QLBA 3T41A 3RYHB 4GGOA 5J4LA 1ZNWA 2ZYHA 3CO5A 3KPUA 3TNYA 2HW8A 1OI3A 1OBFO 4R54A 1L8QA 2XIQA 3B9QA 5HUJA 2FW8A 2Z04A 1B00A 4P54A 4KSYA 4FI3F 1P4HA 3VKFA 4B6OA 4JI2B 4CN9A 1P1IA 3VR2A 4D2IA 5GADl 3ERCA 4C4PA 1BE8A 3GT7A 2XTAA 3SF0A 4RZXA 3CRRA 1G0NA 1L4FA 1AK1A 2O14A 1UC8A 2VHXA 2CLFB 2X0IA 5I9TA 1RR6A 3S2IA 3R5TA 3ZGVA 4D74A 2XCOA 1PNVA 1JWAB 3GLFA 1IMOA 1X1SA 3WGVA 1FQJA 5IZ4A 2HXGA 2J0EA 4XVCA 1D5WA 2GAAA 4YR7A 4AF8A 1XOIA 1VCNA 4G5OA 2O3JA 1MEOA 3JYLA 4KIWA 4B3TB 4DDKA 3PTAA 3UYLA 1IVYA 2Y1GA 2HO4A 3JD4A 2PUGA 3I8XA 3U81A 2D1FA 3IGFA 5A4IS 3JQFA 1VLJA 1JA1A 1V2GA 3AW9A 1AK9A 2JKVA 3N8NA 4A10A 1OAAA 4RKYA 1FP7A 4UZEA 2B1QA 4E0BA 3L8MA 1B43A 5TEWA 3REFA 3WL7A 3N6XA 3NHSA 1X77A 3D9QX 4Q05A 2V45A 2WU0A 5BNIA 2G1JA 1XCGB 2BFFB 4MQFB 2QZ4A 1EVLA 3U44B 5A1TA 2V7QA 3WZ2A 1PP4A 3QVMA 5F23A 1ZBQA 3S40A 2AJBA 4KBYA 4TLBA 1ZU5A 2NVOA 1RYZA 2RHRA 1EU1A 4TVOA 2OMKA 2FN4A 5AW9A 2QD2A 3F3MA 3PQ5A 4BKRA 3JQDA 4ENSA 1M1YB 1QLWA 4CCYB 2ZE7A 4J07A 2XW6A 4IJ5A 4RMJA 4QODA 2XQJA 3VGPA 4BFVA 1IAVA 3PT5A 4E4TA 4OBWA 1U4SA 5HMLA 4D3ZA 2IH2A 2G80A 5IBRA 4D46A 2W42A 1A1SA 1TECE 2B4KA 3R3UA 1E2KA 2OAEA 4NV3A 1AN9A 4HFNA 1OX5A 1NW9B 3PIDA 3A3NA 1MGOA 3BZUA 3VDQA 3VX4A 2YXEA 3ZH9B 4P4LA 5CNKA 4PO1A 4RFSA 5GZ3A 2AXEA 1XTPA 2W2TA 4WE3A 5EUMA 2Y0EA 5F2OA 3TOVA 1ZR2A 5KQGA 1W2GA 4WV3A 3MWDB 5SV2A 5K8CA 1JW9B 4FMCF 4P7KA 1EYZA 1FOEB 4L3VA 3DAHA 4HPXB 1JKIA 4QZVA 2OXRA 2RIRA 4BFSA 2HCTA 1DWQA 1RQ2A 2EG9A 2VSQA 2MIIA 2Y1XA 1WG8A 1N5LA 3BXOA 3LAWA 4G0QA 4OL9A 1N5RA 5CXXA 3X1WA 2Z83A 2PPVA 4LYAA 3TSZA 4HAVA 1OZGA 4UPEA 4LTMA 5I7RA 5JQGB 2WJHA 4CMEC 2R66A 4CQLA 5HUQA 4MS1B 4DV1B 3ZTTA 5C1OA 2JB9A 4G26A 3I5YA 4FFWA 3L02A 3EQ8A 1FZTA 2YZ2A 3W2IA 1HO3A 5ECWA 1OGIA 3I58A 4OIMA 1CQJA 1ZD1A 1P8AA 2ASVA 1T9AA 2OXEA 4Y2VA 2ZRKA 4QDOA 1B4DA 1WUJS 1XXHE 3LHKA 2PUDA 4MI1A 5THKA 5JBNA 4AROA 4JKOA 4KWEA 3NQ41 2I6XA 1OC4A 4P93A 4RTKA 4RM2A 1YBMA 4ZQBA 1R8SA 4YFYA 5GWXA 1QGZA 2ZE5A 4K81B 2NUAB 3J7TA 2K5UA 3EPKA 2KQUA 1BWRA 3LWZA 2QU7A 3DCJA 3L0SA 4IDCA 3W8NA 4C7JA 4F92B 3P71T 4IMJB 5HFAA 4DYVA 2BD0A 3H13A 3PNLA 4HUQB 4HZUB 4OGKA 2IBMA 3B12A 2CK3D 1M6WA 2H48A 1M2NA 2NO0A 1RKVA 2PMKA 2OR3A 3ZOKA 1JXAA 3RSLA 1FX1A 2ZG6A 3T4UA 5LOVA 2GCPA 4K6KA 1BOOA 2J5QA 4N0DA 3DQZA 3EZGA 5DM2A 1XA0A 3GP5A 4C4AA 1DAGA 4JT4A 1G8SA 2DR3A 4LFBB 5JPDA 1F14A 2OGZA 4LPSA 4IIFA 3OECA 2R6FA 5BR4A 2HJGA 4F2HA 3E05A 2DHRA 1PR2A 2GJ8A 16PKA 4HDAA 1SH7A 1VCIA 2EL7A 1QCCA 4JOBA 3R7SA 4REQB 3TQRA 2R4TA 3ZHRA 1KWGA 4UTVA 2RHLA 4KQHA 1NJ6A 2P65A 4JEHA 3ZYCA 3AB7A 2FWJA 3L07A 4TV9F 1QHEA 5DNEA 1EP9A 2GB4A 5DTMA 4EITA 3LO8A 4BX0A 5FI3A 5EZ6B 1QYIA 2P27A 1E1NA 3RSQA 2FMHA 4P4SB 2YIVX 1EZ1A 4A6PA 1WTCA 3AR5A 1JQEA 1GQQA 1T3GA 2JEOA 3IV9A 5A4KA 3QQ5A 3K8OE 4QECA 2PV0A 2Q9UA 3P0JA 1ZGBA 1Q3KA 5C1BA 5FTJA 2PGXA 3KAKA 2QXUA 5L4NA 3TR0A 1XZNA 4WFQA 1GCOA 4I46A 2WHQA 4CLOA 4IIDA 4LX8A 4RHTA 4ROSA 3PQCA 4ARZB 4KI0A 1XMIA 4R1QA 2RHTA 4RY8A 2DAPA 5BN5B 2PGLA 5JPIA 4F3KA 1MABA 1UXJA 3D7LA 3S5JA 5B6IA 5KYTA 1QG6A 4HAOA 5JJLA 4A6DA 3BE6A 2EJCA 4HKTA 5JXHA 4DHEA 2C0PA 3DKIA 3WMXA 3ZU2A 3CMCO 3LUGA 3R0ZA 1IDN1 3PUXA 5LA6F 2VT3A 3KVVA 4IJMA 3K70C 4B3RB 2B7LA 1P9LA 1NU8A 4FJ1A 2CXQA 2NYVA 1QQTA 4CG2A 1OH7A 4IVNA 2PXHA 4QRIA 1XZJA 3O90A 3UMCA 3WLHA 4XW2A 2GK3A 3KQTA 3MRSA 1K8RA 1GCIA 2PFKA 3NP7A 1WZNA 4QYXA 1P61B 4YUVA 2QZJA 3ULKA 1XHLA 3F8WA 2E6UX 4XRGA 2AZ4A 1TVMA 1E1QA 3OQ6A 3HI4A 2Q21A 4NOLA 5CRIA 4BQSA 1VBFA 4M22A 2PUEA 5B55A 2JZNA 4HB4A 3BMCB 3JW8A 4IX1A 3M6UA 4NAHA 1FRNA 1L6RA 3TECE 5DOVA 3LIPA 4IVQA 3C70A 4B3IA 1QBGA 4KPUA 3R6LA 1U1EA 4RSGA 1R6XA 4KMSA 4W5OA 3LGAA 3L7CA 2F3SA 4PG5A 2GBPA 3BFKA 2OCLA 4KYIB 4ZAWA 4HNAA 4AZ0A 5F7OA 1PKXA 2WZQA 3W4JA 1LQUA 3BD8A 4KWIA 1IBMB 1SVUA 2CFRA 1QONA 2V0CA 4RA9A 4RV5A 2VNIA 4V2IA 5L7YA 1UK8A 2EBWA 2F1OA 2YWDA 2ZRDA 3NG1A 3QHQA 1GNTA 2BGUA 3AF4A 1NR5A 4ZP1A 4Q1VA 3EWSA 2WOOA 5IH7A 1Z4QA 2I7TA 2JCSA 4QGFA 5EKSA 4C43A 3SFTA 4YAJA 3NTVA 1QZXA 3F4LA 6NULA 1X2EA 1MC5A 1T2VA 2GHIA 4S0ZA 9LDTA 4R83A 3G8DA 3CW8X 5EGSA 3T99A 3KQWA 4DA0A 3HYLA 4U4AA 3SQWA 3RT9A 2Z6QA 3CSDA 4DADA 4AK9A 2J41A 1ZITA 1H5NA 3TUIC 2C4WA 1ZA2A 2P6OA 3EQ9A 3KEQA 4KIGA 4UQPA 3LXUX 4J1QA 2DPLA 4BFUA 4NEHB 1GA4A 4KYUA 4B1FA 4GE0A 2N46A 5IAJA 1HF3A 2J67A 2VUTA 2FNAA 3B8EA 1ESEA 3ANLA 4FMCB 3TMYA 4ED9A 3SBXA 4OU5A 1BE6A 4HWOA 5ITVA 3I2HA 4ND2A 3SBEA 1SK9A 2SBTA 2V6IA 4MP8A 3U19A 3PQ2A 2BH2A 1R0YA 1FB5A 2HT1A 1IXSB 3GAMA 3I4CA 2UUOA 3KSUA 4FX5A 3C3XA 1IOZA 2Z95A 1HGXA 5BYJA 2VPWA 4OFZA 1TM2A 4OK6A 5EJFA 3ZCUA 3U5TA 5IKXA 1E2UA 3RYTC 2B92A 2RHGB 4FT2A 1Q3TA 2YINC 3UJAA 4YY3B 5TS3A 4B2YA 1O4VA 1J09A 4ZT4A 1TB4A 2DH5A 3C6YA 4XGIA 5FV4A 4K0RA 3JD2A 4HBGA 2QJTA 4AJJA 2H06A 2BFBB 3I9KA 2PKQP 2OQIA 4C1NA 2E37A 4Q3NA 3HP4A 1QAOA 2OVFA 4PO8A 2YVLA 4OHUA 3WGJA 2ZRIA 3HM9A 5KDOA 1DC3A 4P84A 2W00A 3DWIA 5AP9A 1GY8A 1H1TA 4ZYVA 5JYEA 4TM8A 4UBJA 2OM2A 3OA0A 3LXRA 1PJRA 4MVJH 2ISSD 5ITWA 3EVTA 2A0WA 5KKNB 1KGDA 1Z8DA 2GZSA 3AF1A 4JJGA 4Q3KA 5AI6A 3W9UA 3WIDA 4DANA 1NBIA 4OBXA 5D00A 4D4IA 1C9JA 1MAVA 2GCEA 3DZBA 4EA6A 2C0QA 3K2BA 4A8TA 2GQ0A 3U5ZB 5DXAA 1W19A 3RJTA 1L7NA 2ZQ5A 2C3YA 1XELA 2ZU6A 4YAKA 1PWXA 5IZCC 3D3WB 3HP1A 4FGSA 4JENA 4WBXC 2VDVE 5ECGC 3E5RA 2YKGA 2B98A 4OHPA 4U7HA 1JFFA 2PWBA 4WLUA 2J4FA 3S70A 4F93B 3STYA 3DNPA 1SKYE 2BPOA 3L7JA 3TBHA 4I6GA 3FHOA 1KERA 1XTJA 3BULA 4WZBB 3SDSA 4HFMA 2WIJA 3EMVA 4AN0A 4HMPA 1NBOA 1XTTA 3ASVA 2HGSA 1ZIYA 2GLXA 2DBVO 2XNHA 3JR3A 3COSA 4TV9B 1J24A 4ZKEA 2WA2A 4WFIA 1Z4IA 4GOOD 1GLGA 1D03A 4RY0A 4BQFA 4JU9A 2W98A 1A69A 2VS1A 3G0BA 3HFGA 4FMDF 1T4BA 4QOFA 5BQXA 4INZA 2FRDA 4EFNA 3VX3A 1VBKA 2NLOA 3P0EA 4U2FA 5IZCA 3FSGA 5FOWA 2AVDA 3AVXA 3CNEA 4HNSA 4YRRA 1F1JA 4AXXA 4BVJA 1Y63A 2Q4DA 1PVDA 5TMDA 1F2UA 1CUBA 1KNXA 1M0SA 1PSZA 1YBHA 1T26A 1GRCA 1RBQA 5JZ9A 5I4KA 2OV3A 2UZ4A 1GKKA 5BWNA 2IUFA 2C9CA 1XUOA 3F8SA 1LK7A 2RAPA 3OUTA 4DNQA 2QL9A 1O8CA 2W6OA 4M88A 4UNNA 3RFFA 2D7DA 1YVRA 4F2WA 1QOQB 2V58A 3W9SA 2IEAA 3BJEA 3B5IA 5LA6B 2GX6A 2WF6A 3KB8A 3UXYA 5JOQA 3WGIA 1RKXA 1L4UA 2WSIA 2ZIXB 4IUCS 3AEKB 4Q16A 4TVSA 2O8FB 4F12A 3M34A 4KXXA 4ECAA 1D3AA 2OYSA 3DFKA 3IILA 3MUOA 3ROZA 5DULA 3T4XA 4C0BA 3V1MA 3CLUC 1PJCA 4LDPA 4L0QA 5HG0A 2DSTA 4AKSA 2D54A 2VHUA 5EHQA 3K05A 5AVWA 3V7UA 1KQOA 2NX2A 2D1RA 1YMVA 1NVXQ 2XZTA 4B6QA 3MUEA 1Z8FA 3BIXA 1KRHA 4UFNA 5AUPB 3LY9A 1H4VB 3QLJA 3R3VA 2GF0A 1KZ7B 5DM70 1P62B 1C3JA 1MV8A 2OZPA 2ZB3A 3NV7A 4LN1A 5E7MA 3VISA 4OHBA 1SBZA 2H11A 5CCDA 1DJNA 3VUEA 3PVCA 4DRXB 5CNJA 4IUBS 2ZTUA 1W6UA 3K94A 4AJ1A 5HJEA 1Q7CA 1MG0A 3ZWKA 4AAYA 5BW4A 1MJGM 2NU9A 3I3OA 4DUYB 5AXBA 2C7PA 3ETHA 2NZJA 5KVQA 4DY4A 2C9MA 5IANA 1MOSA 2QVYX 1I4OA 2OD9A 2GK4A 2HRDA 3NPMA 1GKYA 2M1ZA 2QT0A 5ECYA 5H4HA 1V5IA 1ORTA 5TC4A 2ZATA 4RTMA 4OG2A 3VDRA 4Z3DA 3PENA 4ZARA 1KYTA 1ZCAA 3E7XA 5A71A 3VJRA 5AUQA 1VA4A 2CL7X 4QFDA 3HBAA 4LJ4A 4E5NA 3ROFA 2QN9A 3SEAA 1K2WA 4BX2A 4DJ5X 5JI3E 2BFEA 4DRZA 2PX2A 3IQWA 5FHQA 2DTXA 2DHDA 1P4SA 1QAQA 4DWJA 5HQTA 1QIFA 1WY5A 4RK7A 2ZP1A 4IDGA 4NESA 3PPXA 5K05A 4KPGA 4LC0A 1TW2A 2FPMA 1DG3A 2BKLA 2QHXA 3ZCQA 4D0GA 3E1SA 2VP5A 3LI2A 3RF6A 1OCEA 4BEVA 3PU6A 3F5FA 2X6QA 5SY4A 3WY9A 4AKEA 1D0SA 4BUCA 3EFOB 1B1CA 4EENA 1Y42X 1TYEB 1SCNE 1AM4D 2J32A 5LDDC 2GI4A 2YUIA 2JRLA 2FY8A 3HH8A 1ZC4A 2CXSA 4HGYA 1ZOLA 1IBLB 3HXPA 1QZUA 9LDBA 2P2YA 1I2ZA 3DO5A 4J0JA 4PPGA 3HG7A 4R40A 3ABOB 5FBWB 3OBIA 4AN1A 1UJMA 1C3XA 2ID7A 2X22A 3IJ5A 4B7CA 2W6PA 5KNBD 2RH9B 3MT8A 5KNBH 2IHNA 3I1YA 1OXTA 1YI1A 1KDRA 1O95A 3K4PA 3H9GA 3SE0A 5HRAA 3VZRA 1NV9A 2OWDA 2QIOA 4NJOA 1UZLA 2VPZA 3RRYA 5I7EA 1W76A 1ZM2A 2V0GA 4YMUA 4GMFA 1A4XA 4X62B 3RCBA 2V4ZA 1Z4KA 3EXEA 4FSXA 1JDNA 3FZGA 5K2OA 2C1XA 3AFGA 3MCWA 3RNOA 5AM0A 1WB6A 4EEKA 1TJ5A 1FNSA 1KAHA 1RPAA 4FKZA 1ULAA 4KJZA 2H1SA 2ADMA 2EL9A 2ZXEA 2CNLA 4QFCA 4QJIA 3RBVA 3ZWWA 4CKEB 1H9CA 1GSHA 1HQDA 3ZHQA 2DBYA 2ZSJA 3UMSA 1FTGA 3OPVA 1K2VN 2AE1A 2C2GA 1HLPA 4G97A 1WTAA 3JWEA 1KI6A 2NT4A 3PVZA 4NYJQ 2H17A 1Y7TA 4OBBA 3H04A 5L9AA 4BASA 4NCBA 1O03A 2O8BB 3PNQA 4FIZA 1P7ZA 3NWBA 2VDWA 3EDQA 3Q40A 4S2EA 1SXQA 5AK6A 1ZESA 3CUVA 3FSEA 4XQGA 1X7YB 4DLAA 1C8BA 3AM4A 2WLSA 1HRDA 1E9DA 3O2JA 4F7DA 1UJ2A 2G77B 5JY6A 5KIAA 2VSXA 2WG0A 2A57A 1GZ6A 1OXSC 3MCTA 4L85A 3WP0A 2QZZA 1RHUA 3O1JC 4R51A 4PANA 1B6GA 1PG0A 1S2NA 4PU0A 4AFNA 4E22A 1G8AA 2IYOA 5HKKD 5HTOA 1QNFA 2WE8A 2BDTA 2VZ0A 3F2VA 3WV5A 1EXWA 1ZK0A 2BELA 2WNSA 1J56A 1QHGA 3NW9A 4I9NA 4P5PA 5IBQA 5I4BA 3D4BA 3TSAA 1Z0DA 2JFZA 4WGFA 4FOSA 4BOYA 3VPHA 3KJXA 4ZVNA 1TYAE 3GT0A 4FMDB 5FHRA 3MCVA 1GAWA 2WSLA 3OZDA 5DT9A 4YROA 3W1VA 3X43A 3RS7A 3UV6A 4B40A 4I50A 5LDGA 1I7QB 4E6PA 3KU1A 2X9LA 1MLDA 3DBHA 5AVUA 1E92A 1PDWA 1YCHA 2NO6A 4G89A 1PL7A 4L08A 4OA5A 3RC2A 5KYNA 3T9CA 1P1FA 2VBFA 5KCZA 1OXVA 2X8JA 2FSUA 2R68A 2RG7A 4MRVA 4CV0A 3IBYA 4N7BA 3ZIAD 2AG1A 2FSVC 3D3KA 1XKLA 1MVLA 2PAFA 4RW0A 4YYEA 4ANFA 5CFNA 3UGJA 4C2TA 2C7RA 4HWTA 4IP0A 3ZKWB 1RXUA 4PQEA 3LC1O 3GOHA 1XZEA 2A1UB 4R1TA 1HYBA 4RE6A 4L95C 1WSDA 3QKSB 4P1ZA 1N9KA 3LBIA 1XALA 2O05A 4HRXA 4PZAA 4XRRA 3U3JA 2W11A 3BVPA 3IHLA 3Q7QA 1GZHB 3EYWA 3HSYA 3P2KA 1VZ3A 4LKRA 4BRWA 4F5DA 1OLOA 1Q84A 5FA5A 3S1AA 4CEHB 4HJXA 3A10A 4YRFA 3ND5A 4ALJA 4RA6A 2GCOB 2NG1A 1HI9A 2PS3A 1NVAA 1LQ2A 3B7PA 3F74A 3FWHA 1G3UA 4U2GA 4XQ0A 2AJDA 2F64A 4CTJA 1XL1A 1U3CA 2C95A 1NVTA 1ZMOA 3N0TA 2VJMB 1K3UB 3IB3A 3VC2A 4CGYA 1H1DA 2ZSDA 1RFGE 4C7KA 3BN3A 4C9BA 4FGZA 1XMVA 2D62A 1RXSA 3BHNA 1PN3A 3QY0A 3LK6A 5DGHA 2IYRA 2W6CX 1EPUA 4G4SP 3TFQA 3G89A 4N5LA 2ZIZA 3H86A 2JJ8A 4IH1A 3ZWYA 2J5RA 3JZDA 3WSTA 2Y2VA 5AHKA 3QVGA 4JB2A 4D57A 5LQAA 2ATIA 3KXLA 4E2ZA 3OCZA 5E4JA 1NXVA 3SU8A 4RTNA 1U8FO 4UU8A 3ZCPA 4FS8A 1ZI8A 4XFDA 5G1PA 2NU6B 1Q1EA 1G59A 4ER0A 2AXNA 4BJ6A 1II9A 2JGDA 3NNDA 3R7NA 4BPRA 3HM2A 3SVLA 2HWWA 1Q0QA 2NSLA 4J49A 3WLIA 1ATZA 1KJYA 4Q3EA 4ZDJA 3EEOA 3L0PA 1BHJA 2I4MA 2SKCA 1WETA 3U3MA 2AQIA 5EG5A 1U0TA 3IVGA 3NWOA 4ZVSA 4C7OA 3O84A 1L5MA 1HFKA 1PUXA 3AF3A 4L9SA 3RANA 3L9WA 3RAPR 2O8EB 5BV2P 1IATA 5DI3A 5CDSA 1DDGA 1XZFA 2QI9F 1VE3A 4P0TA 2QJOA 2PUTA 2XSZA 3H4MA 1TKAA 1V6SA 2LRHA 1SB8A 2FUKA 3H4TA 3JU3A 2NTVA 4G63A 1QIKA 1MR3F 1P19A 1XJ0A 3LTEA 4J1TA 421PA 3JZAA 2OE2A 4HMQA 4C0XA 2QTWB 4EJ6A 3S0JA 5H9WA 1OFVA 2TYSB 2F1IA 3PV0A 2AX4A 3LP8A 1MO5A 3IQGX 2NXWA 1XZBA 1Q0SA 4CYMA 5MFZA 1U0SY 4I5EA 4S1WA 3BMOB 3JY6A 4XVRA 2B2XA 1E3IA 2QAGC 2QSJA 3G02A 3GCGA 2I2FA 3LWDA 3M4YA 4XGKA 2C61A 3O8QA 1Z18A 4LBVA 4XPIB 4YJ2F 2Z5LA 4K6FA 5BQPA 4WMLA 2XDAA 1TU0A 2QUHA 4JQCA 5DSZA 2RI0A 1NF8A 4X8MA 4D92A 2W70A 5CB4A 3D4LA 4PLCA 1EQAA 4AQDA 4OLBA 2QPLA 4KACA 4NOJA 3H4IA 2GRJA 4C7OB 4BWVA 3ZQUA 1MFZA 2XGGA 4G65A 3AR3A 4HFRA 5FPPA 1NI4A 2AGVA 3C87A 3O4VA 2NO7A 2O2GA 3W34A 5SZJA 3FYCA 1IZ0A 1SXJB 3H75A 3SS7X 4QG7A 4X1IA 1MJFA 4KBGA 1MB2A 3N2GA 3S6JA 1F8GA 1SXJD 2W93A 2D2IA 1KORA 5AVKA 4AKTA 5F9MA 4EOGA 5K7SA 3Q6MA 1J0DA 2AHRA 3I04M 2O8DB 4AJEA 1OFHA 4O1IA 4OQLA 1JQJC 3WIBA 1R0WA 5JR3A 3PC8C 1YJ5A 1M1NB 1IN4A 2C9ZA 3OLXA 1CZHA 4C6SA 5DWVA 4W5NA 5FADA 3N7TA 4RKRA 4BE7B 2PL9A 1NVDA 2IX9A 4MYUA 3SYTA 3CTPA 2WMYA 4MUHA 4PAGA 5AXDA 1EGVB 1IEXA 2Q46A 1JIQA 3HKBA 4I6JA 1QOZA 2GASA 2X3UA 3CNNA 1AT1A 4V0SA 2FPOA 4CNQA 1N2ZA 4LFCB 1X7WB 3WGNA 1G8FA 4B7UA 1M10A 3WKCA 2IS2A 4HNQA 2MU1A 2GPSA 1Z75A 3PNPA 4W5HA 3BMNA 1A7KA 2ECKA 2XTMA 3FCOA 4WECA 3KT8A 1PZNA 3RYIA 4ENRA 2OAQ1 1J5PA 5JNRA 4CV2A 4D8YA 3AOEA 1O1YA 2VR1A 3NEYA 4MMZB 4PHFA 4H17A 4V0OA 2O7VA 2VKQA 1HRKA 3KQVA 3T95A 4EMBA 1B0ZA 2CLCX 4MUXA 1I94B 1QU3A 2I4NA 4YCJA 2GXUA 3CWQA 3KLOA 4ZV4A 4NHEA 1SFRA 4QUGA 5EZYF 5JRZA 3AR4A 1UM9B 2B82A 1JG4A 4PAWA 1J21A 1BMTA 4E13A 1WV1A 1C3VA 5CIWA 4QM7A 4JC8A 2PG3A 4JROA 2I8CA 2JDIA 4Q7KA 2Q6IA 3EH1A 2ON6A 1MDBA 1B1AA 1H6DA 3P2IA 3HCEA 3QVJA 5BV1A 4JOQA 2BY4A 3C5VA 4R71A 1BA2A 3TNDA 3WK4A 1BWQA 1U04A 1OWLA 2ZTLA 4BMDA 3IUPA 1AX9A 2ZI7A 2OXIA 3EQ6A 3HN7A 4EG8A 3WP1B 3MZ0A 4YUAA 4CWAA 5BPFA 2BZ0A 1XD2A 4PQRA 2QQ5A 4N3BA 2G9RA 5IU6A 2TECE 1GT6A 4YMTA 1C0KA 3BG5A 4Q4JB 2A35A 4F96A 3C3WA 3T7KA 3CWCA 4WNAA 2Q8NA 3QV1A 5EWLB 4G1BA 1L3CA 4B87A 4DDVA 1M67A 3FTNA 4ND3A 4HVLA 2R00A 2C3PA 1Z6PA 1FX0A 3WLTA 3S28A 2QR3A 1Y48E 2HU5A 3LW7A 2PL5A 3OZBA 1U0FA 2YCLA 4L8FA 4PCVA 1X7ZB 4HRVA 3TLJA 4CR7A 1AO3A 2FDCA 3ZGZA 4B81A 4LGMA 5JCZA 1IZ7A 5JSZA 1KYZA 1A8QA 1T4MA 4D5GA 4BVFA 2ZGVA 3ZBPA 3IVCA 4OJNA 3PE6A 5G02A 4G4GA 3JYHA 4PNEA 2P9EA 4JH0A 4AB1A 5FDFA 1UWLA 3ZVNA 1ORRA 2QTGA 4Q21A 3NV9A 4ND7A 3K0AB 3HJBA 3Q8XB 1LU9A 5H3HA 2ZRAA 2VDOB 1JIXA 3CLRD 4C7BA 4AZ3A 3ZXXA 4ZEVA 4D26A 1PQPA 1VHTA 3L7YA 5EHXA 3ZV4A 3K0SA 1N8SA 2B4RO 1EXVA 1LBIA 2E5WA 2WYIA 2Q2VA 3PSHA 2YV1A 4FIDA 3K9BA 5C51B 4EGAA 1XQ1A 3O21A 4QG3A 3DQQA 1MO4A 4PEVA 5NULA 2IJGX 5LYJA 2UYQA 1USGA 1GQ2A 3FGNA 3HWX1 4Y2JA 5IH3A 3K9QO 3CVWA 3FCSB 2IOFA 1KETA 3A7DA 5HIIA 1E69A 5TDHA 3AEYA 2D13A 3QBDA 4QYTA 4E14A 4S1PA 1E3EA 1MQAA 1AF7A 2R7MA 3QYAA 2EP8A 3RRNA 1EBFA 1L8LA 3I64A 3VH3A 3W2GA 4GYYA 3BORA 1PAUA 1WXIA 2FUEA 1Z7EA 3LQYA 4P3OA 5AQEA 1W0KA 1QK3A 4HWRA 1X14A 2C97A 2R47A 4Q12A 1Y8RA 4JSRA 4NNJA 1VJRA 5IW8A 2RGYA 4W5WA 4YAIA 4DDUA 4AKGA 1VDMA 2ZE8A 2P5SA 1YCFA 4EFDA 3KUCA 4K28A 4M1EA 3MGAA 4AP5A 3M83A 3RVKA 4FE4A 3A25A 3MJRA 5KDLA 4JT8A 1EP2B 1LPBB 3AXSA 3AR2A 3D31A 2WVHA 2ORVA 4YJ2B 4NYIQ 4DJAA 1OILA 4DMMA 4FQ5A 3RSHA 1YDWA 3TZHA 4PLVA 4B8YA 3SXUB 2FLKA 1L4KA 3O7MA 3B1VA 4I1IA 1F38A 5F52A 5LN1A 3GLHB 3IIJA 1T35A 3LFHA 4KR6A 3O82A 1TJPB 2QTAA 4C4ZA 5IM4F 3T15A 4LF8B 3PSAA 4FNGA 2ZRJA 1B23P 2VEDA 3PUZA 2JAXA 3FTPA 3H8JA 1YL5A 3ZE1B 5G0TA 2PSEA 2JVJA 4G3XA 1NP7A 4G4JA 4YAFA 1UBGA 2GZHA 2ZAMA 3ICVA 3QJYA 5BQ5A 4CT4B 5B36A 1H0KA 4LDNA 4N3AA 4QNMA 3A06A 2LR0A 1TGVA 1H8ED 5BQ3A 5I01A 3MYYA 2X1LA 2QF7A 1FYDA 4K6OA 5DCYA 2H5IA 3LT1A 4ZQIA 3V48A 1LC0A 3WIEA 3OZIA 5HOEA 5HRUA 3BYZA 5I7VA 1JDBB 1Z13A 1Z36A 2BR3A 2PKRA 4X3PA 3WICA 1CERA 1G20B 4E11A 5EJ8A 2ZRFA 3KQKA 2P9GA 3C16C 2PXXA 2A84A 4RS4A 1CUVA 2IYAA 3D6TB 2VAWA 1U0HC 4YRDA 1WE2A 1O77A 3DG9A 3TBKA 2Y1FA 4X7PA 1N0VC 2RJNA 1UC9A 5KOJB 3ZK7A 1FYXA 3GVIA 2Y1WA 3LLVA 5ES3A 3HWWA 3DUWA 1NC1A 5EHZA 3FR7A 3WDMA 5JH7A 3OQPA 2AR0A 1XDWA 4PIVA 4C22A 4YI5A 4CV3A 1UDRA 3H9JA 2AZMA 1EX6A 2V8BA 2O1XA 1QQ5A 1U8ZA 2GEUA 3Q15C 4K3VA 1LF5A 1G4HA 1HQYE 4AJOA 3T7JA 3IDAA 3MILA 4W1PA 4TWBA 1VLZA 4R1NA 2GTPA 1MJHA 1T2UA 3FVVA 1SC6A 3LYUA 3G5LA 4ZT3A 4K87A 1J7JA 2VHTA 1RI3A 1G5HA 1YOVA 4U2BA 2YS7A 3BREA 4PYMA 4ZCQA 2Y4NA 1ZJYA 3D1JA 1V1MB 3OC6A 4IHQA 3VAZA 5JQWA 5BVHA 3HN2A 3NH6A 1LJLA 1EXDA 4C4OA 4EB6A 2PGAA 3LHFA 2GSDA 5K0LA 4C0QC 2EKDA 5EZYB 4ZTZB 1HE5A 5KU7A 3AT1A 1CR1A 1D2CA 2G28A 3HU5A 2IS1A 3UENA 5REQA 2ZITA 4H15A 2GM5A 2JD0A 2R8RA 1W88B 3D8RA 5CXSA 5I45A 3HB4X 3HL4A 1PGOA 4IIEA 2EFYA 3NDIA 2VYNA 2NN3C 2GILA 4QGHA 3DYBA 1PLKA 3QKUA 1NLZA 4O1MA 4D0NA 1EG2A 3GUUA 5JS1A 3IP8A 4BBJA 1E3DA 1GZVA 2OHVA 3ETEA 4B3XA 3WG9A 4AP6A 1Q44A 2FMTA 1UC4B 1ZU4A 2D0OB 1PYGA 2GK7A 2ZJ5A 3ECCA 3GARA 3DL7A 4BE9A 1QCYA 3NC4A 2VUSA 1YQQA 2WWGA 5ENVA 2VWHA 1EX7A 2IYUA 4HLCA 2C1EA 1GEEA 2ODWA 1KA9H 2QYSA 1B6RA 5CT8A 5DB4A 5F12A 4Q3OA 5FI5A 5EQTA 4B9EA 2CC2A 2O7SA 1X1QA 3AUAA 3N2EA 4UVIA 2UZ1A 4DZTA 1I2CA 4X5OA 1HTBA 2RB5A 1VIAA 1QH0A 1RI4A 2D1YA 3EH2A 5AWFC 1KTIA 1NN5A 1G17A 4MUYA 4II2A 3O38A 4EGQA 2QB5A 1BCRA 1ZX1A 4FFLA 2DG2A 2OFXA 3D5EA 2YQ5A 4FTWA 4UXHA 4ZJYA 4DBZA 3NH9A 1Z0SA 3DCYA 2QUIA 2CNWD 2GBIA 2E4VA 3IVRA 4BO9A 1JDUA 1H5QA 3GIWA 1PJQA 2ECQA 2Z57A 4IMIB 3CBQA 2IZ5A 3QPVA 4RF2A 4F6RB 4ER6A 5I4IA 2SHKA 1KQFA 1S8OA 3KR2A 4RIIA 4YGXB 4WHMA 2IDMA 3I92A 2WMNB 1J7KA 1NXQA 1TCAA 1RRGA 1LK0A 3KS9A 4QAJA 3MMZA 3IBFA 3QE3A 4BMYA 4TL6A 1AKVA 1UKBA 2QLMA 3A11A 1KOJA 3NKLA 4XQEA 3I0NA 5LP6C 4BLPA 3HY3A 1YF3A 1SCQA 3IAAA 1V3TA 2FGJA 3NBKA 1Z2NX 1NVWQ 1A4UA 3AC0A 3VNUA 2FW0A 2IBTA 4HAXA 1WBJB 1Y3BE 1DQNA 1XAHA 1KMHB 2BSXA 3RC9A 1AJEA 3KAPA 2VF4X 3IYLW 4ZQHA 1Z25A 1X7DA 1TEHA 4KAXA 1UXIA 4NFYA 1ZK4A 3VR2D 2CNDA 1KWKA 2DOKA 4LYGA 4QXPA 4GOMD 5F4BA 3VR6A 1TZKA 3BTVA 3GJYA 1L8OA 2C3OA 3FPLA 4PHHA 2PRKA 2BSQA 1LFDB 5HXAA 5C8ZA 4KFSA 3GGCA 1F12A 2PWZA 2QROA 3KKEA 4YRAA 1X0VA 2P3OA 4U02A 1EEXB 2QRHA 1IQPA 5D86A 3FIUA 2CDAA 1DRJA 2P75A 2XVXA 3KL4A 4MW2A 4XAQA 3TYXA 4OSEA 4TL7A 1SR8A 3TOZA 3WO0A 4R2LA 1ZRNA 4XX0A 4W9NA 2KS6A 2I2XB 4FHFA 4KR2A 3KOMA 3MQ2A 1M7GA 5A7GA 2DPXA 2I2CA 3AR7A 2VCYA 3WK9A 1YE8A 1Z35A 4Q3CA 4HWSA 1GTMA 4TMWA 4TTQA 4DEYA 4LNHA 1Q21A 2RGNA 2VVTA 2EDAA 2BV3A 1CXZA 3MJSA 3BBPA 1N6RA 4ZZ3A 1RWOA 1P8JA 3MRXA 3S99A 5DIFA 4J76A 2R1TB 3OZFA 1P9RA 2X4LA 2H3HA 1HC7A 2XYRA 4QQKA 2VJDA 2Q07A 1O5TA 1VSQA 1ZYUA 2BONA 1T91A 3QVOA 4XR9A 1KDVA 1DBRA 3VNRA 2QNRA 5I7SA 2XWSA 1UPFA 1XMPA 1G41A 2OSBA 3G0DA 1ODTC 1WUIS 4EA9A 4E5MA 1M6YA 2VYFA 2WWIA 4JP5A 3RTEA 1P3Y1 2CUTA 4OQMA 4L0CA 5AKEA 5CYPA 1G7TA 5EI5A 3TDKA 1E1CB 4K1LA 2RI1A 1S0UA 1OV6A 1RQGA 3MTJA 3DMTC 2GLUA 4EI9A 1F6BA 3DEZA 1WU7A 1X9GA 2VRBA 2YR0A 3O2QB 3T9DA 4QX6A 4UW9A 1WDKA 2JL1A 2VDLB 3DL2A 5AVOA 1I32A 1KY3A 2BGIA 2XAUA 4YT4A 1Z5WA 1C50A 4D25A 4HGPA 2ONCA 2JCVA 4JCCA 1KKUA 5DYWA 1I30A 1RYBA 2J6IA 2MDTA 4M9SA 4AG3A 1XRLA 1XXLA 3PHLA 4FYHA 5KNCD 1BROA 5CA1A 1N3BA 2DJ5A 3BQ9A 2XXAA 5DN6D 5KNCH 2C2MA 1OHHA 5HA5A 3PGKA 4NYMQ 4EO4A 2QA5A 2DCMA 3RQIA 4BKMA 4HR7A 1DAPA 1XGKA 4FCCA 1G3RA 1RE0A 4W63A 2CW5A 4ASUD 1HQKA 3DMTA 2J6CA 3WLRA 3KAQA 4H9GA 4CQLB 2D3TA 2ZUSA 1CPYA 1WOMA 1NMEA 3MCZA 1SIUA 3ENKA 3B2EA 3IPAA 4A8JC 1GKUB 2QPOA 2ZWPA 4TKUA 4NP6A 1CQJB 5DBFA 3U7JA 1U7HA 2IK8A 5CUQA 4B3BA 2GAIA 5BMVA 1JKJA 3GC6A 1ISIA 1RJ9B 4LWZA 1NT4A 4TKLA 2VJKA 4TROA 4UM8B 4Z51A 1VLMA 4U6SA 3TZEA 4MCAA 5DFAA 3G2HA 5TQ0B 1YACA 1U7ZA 5EHNA 3WX0A 1QS0B 3E4CA 2UYOA 4BYGA 2BGJA 3NM5A 3ZJ4A 5ADUS 2WQ7A 2FLVA 4JHXA 4MB6A 4N8SA 1Y7LA 3HGTA 4AIIA 4CL2A 5AI9A 1VKOA 3MQ4A 2P9HA 3WE7A 1LRLA 5H02A 1D2HA 1Y9EA 4Y2HA 1DJQA 2O3SA 3FMFA 4YRKA 3T9BA 5CG2A 5LQKA 4G84A 1QX4A 4OQYA 2Z9BA 1MG5A 1DOAA 1TQ2A 2A9FA 2GZ3A 1EJ0A 3P0FA 4Z86A 3MTIA 1NWHA 2IUUA 3F98A 5KSWB 1EH5A 4MV6A 1T0HB 2F43A 3NBZC 3RK0A 4NCAA 1OLUA 2HRRA 3DJYA 1UKCA 1LWNA 5JO0A 2W2NA 2HQRA 4QVGA 3ZHYA 2GZMA 1A7JA 1NLMA 2EW2A 2JK0A 3F67A 4WCFB 4HV4A 1Y8ZA 2WTUA 4LDZA 1ES9A 4XJXA 1EXNA 3HCNA 3FFTA 4UDOA 2E4ZA 3R09A 3IEVA 1DADA 3OE1A 3R5XA 1JKMA 3SI7A 1KJWA 1WLYA 2QJRA 2XNSA 2OBNA 4UBMA 3R9XB 5CA0F 2IZ6A 4C01A 1T6BY 4EG3A 1UJBA 1XN1A 4JLPA 2QAIA 4KXQA 2JKYA 4WKOA 4QVIA 5KPDA 2EOAA 3WL6A 4UJ5A 4GKAA 3SQXA 4N48A 1YR2A 1YDFA 3FE2A 2X3FA 2QY6A 1GUBA 4UDXX 1C3LA 4DMUB 5K03A 5AKXA 3HFJA 1DQPA 2P30A 1OVGA 2I29A 2VT2A 3A32A 4TWZA 1IZZA 4YPFA 2GZAA 2QUZA 3K1AA 4F60A 1D9XA 5DT2A 1HNNA 1RZUA 3VI4B 1CQIA 4ZYTA 3C43A 1YE5A 2JEZA 4V1CA 1MABB 4UAGA 4AO7A 4MYTA 4F56A 3VYUB 1GG9A 4IXWA 1RLMA 5HK8A 2CT8A 1Z0UA 4KRGA 4LG1A 1VSUA 4Y6SA 1HE2A 4YJGA 3B1XA 2AKAB 3NJRA 4NS1A 4RETA 1HURA 5E4FA 2FZGA 3BRQA 5H68A 3P2EA 1YFKA 3OCWA 1G21A 3O9MA 2MTBA 1NGSA 4FFRA 4GQAA 5JJ5A 3NHAA 1C0LA 3DV9A 2HSEA 1BQEA 1TPZA 3C5WP 4R3NA 3GPDG 4L76A 1XROA 4IUYA 2H2FA 4EIWA 1DWUA 3WBFA 4EZIA 1IUOA 2PSHA 4IF6A 5FX2A 2G4CA 4MV8A 1Z9BA 3V4FA 3K2EA 1CDOA 3S5UA 1BS1A 5FPHA 1NJ2A 4BGUA 1SVKA 3ASYA 3R0QA 3AI7A 3L8CA 1Q50A 1A4RA 3IR6A 2H57A 4HQKA 2HF7A 3WYNA 2NM0A 3OEHD 5HZHA 4NDNE 1ZRHA 3NGXA 3T06B 5B4UA 3KJIA 2CHFA 1QHHA 1TA0A 1XDZA 3Q88A 4KPUB 3G5TA 5C0OE 3WV4A 5FULA 2JFUA 4Y98A 2R751 2VK1A 3PTZA 3ROQA 3R3HA 1M2FA 4PONA 3LV8A 4GI1A 4I1RA 4R2IA 4XWYA 3SGLA 5E2IA 4AYTA 2YWGA 4BTLA 3LD9A 4RA9B 4JVLA 3IUSA 1PL0A 4DR2B 4IJVA 1XRQA 1EVJA 1JHZA 3OCJA 1M8JA 2XWJI 5E3JA 4RLFA 2ZRHA 4BNMA 2IZ1A 1Q74A 1DO0A 2NYUA 3ADOA 2VSFA 4QARA 3RFVA 5AXCA 1VBNA 4BP3A 3U56A 2QTVA 4ZK2A 2D0PB 2VNJA 4YP7A 5LMUB 4K88A 3JR7A 4RPGA 4WZBE 1AF4A 3KQOA 3WGGA 2RGEA 1AZSC 2P9JA 1GRNA 1TD1A 4I3HA 3SDBA 3KM0A 3SS9X 2FX5A 2FP3A 4X1OA 3SYKA 3SSNA 2HN9A 5AFSA 1ZK2A 1Y82A 1T6ZA 3I9FA 3LUHA 4M0DA 1T9HA 5JCOA 2VHWA 1PR4A 2CLKB 2LKCA 4PE5B 4ZT7A 3G1WA 3VDMA 3TW8A 4LE0A 3HXKA 1CJBA 1LTHR 3STTA 4GMHA 3BCRA 2WW8A 2FZ5A 1NMQA 4KVGA 1JJFA 2Y0CA 5ERYA 1TM5E 1U6IA 2IP4A 4A2CA 2Z2ZA 1WVMA 4FYMA 4F4HA 4REOA 4OB6A 2O19A 2VC2B 1A9ZA 2IKSA 3L9XA 3U3RA 3MT9A 4CUKA 1A88A 2X1MA 4MKHA 3HYSA 2HNBA 2YY7A 1CLEA 3GJRA 4H6VA 1VYVA 4ZIRB 4W1RA 3EWIA 1NHGA 3M6IA 4EHIA 4G1EB 2YTZA 1M5RA 1GGFA 1KFKB 1KK1A 1C1HA 2MT9A 4MWOA 4NABA 4JLJA 2O5EA 1JP7A 2C7BA 4IEIA 4BNYA 2BGRA 2HQOA 2GBFA 5J1TB 4GBJA 3RADC 3VOBA 4TS9A 1RC8A 1VJGA 1Z6GA 1PJZA 2C4UA 1NLYA 4R69A 3VH4A 1RACA 1U5BB 2I7VA 3AZQA 3COVA 4OQZA 2JI9A 4TMTA 1NPTO 4K6CA 4A26A 1I2DA 3B6ZA 3RTAA 1IUPA 1BMFA 5J2TF 1AS0A 3FDZA 4HGQA 4JB3A 2JIRA 2XADA 1W9HA 3LHIA 4R5MA 3MBKA 4Q02A 3UXEA 1IAQA 1JFLA 3IQZA 2YX1A 1PF7E 2GPBA 1P0QA 4N5NA 2C88A 1Z17A 1T9DA 2IY8A 1DGQA 3BL6A 1VFPA 2C03A 4JXJA 1A9XA 4UCQA 3DC7A 4GZ5A 1T5IA 2OCYC 3FLAA 3A6EA 4FZ5A 5HKAA 1TU3A 5HF9A 4TYMA 1RADA 2HMTA 1GUAA 2OZLB 4DIFA 3UPTA 4RTRA 1QE0A 4HS9A 3HA2A 1NL3A 2VTBA 4EG5A 1F4VA 3AUUA 3TTTA 1DIHA 2RONA 3X1MA 4Z4QA 3JAKA 3EEFA 4RENA 3GDOA 1PLLA 1E2FA 3EHDA 5BSMA 3OX2A 2ZZNA 1G5PA 4BGIA 3ZN2A 3OTOB 3UWPA 3AHJA 1UAGA 3RU9A 1NXSA 1LDBA 2M98A 2OPHA 4M1ZA 3VSDA 4QDJA 2MINA 1NOJA 4MARA 5JANA 1U3TA 1ZXBA 3O92A 3NKVA 1O8BA 4GZMA 2AC4A 1YRWA 2YW2A 3HLYA 4R2WA 4EUSA 5JFOA 2WICA 3V3KA 4PAOA 4MI3A 2HA5A 2W6MA 2HF2A 3O83A 3TW0A 5JSUA 3PVSA 5IVDA 4B2PA 1Z6QA 3U7QA 4LC1A 2YHUA 5CH3A 2IDZA 4NMXB 3PRYA 1JDJA 2J5XA 2B34A 3EK2A 3DHYA 3HY4A 5ALOA 1E2BA 2IT1A 5ARBA 3KEOA 4RTQA 5CA0B 4WI1A 1ZPDA 5JWRA 3NC0C 3KT3A 2BEWA 4QICA 2XNDA 2VEOA 2CFOA 3DO6A 1QQ7A 4JJ8A 1A9PA 1MZVA 2JH3A 4NQRA 2OOKA 1J1ZA 2W48A 3VNAA 4B84A 4G1MB 1MIOB 1XTBA 4FDMA 3ZXIA 1VE5A 2COKA 3EF0A 4BU1A 2IDKA 5AW1A 5FYDA 1NW8A 3U0BA 5AW5A 1F2UB 5BVGA 3OLVA 2YRFA 1FMFA 3FSGD 3QVVA 5JFGA 5SZHB 3W9BA 4OXKA 3FVQA 1CUAA 1JR2A 2GHRA 2JHAA 3SX4A 1ISSA 3H8SA 1WZEA 2GM9A 1R50A 1O6CA 2V3VA 3AF0A 1W0JD 4NEQA 3VOAA 2DY1A 1DB3A 2YHAA 4J43A 1Z4MA 1PR9A 4D4MA 3HB0A 1GFZA 2VHVA 2ZJOA 3CMMA 4C29A 1VCMA 1TZBA 1UC5B 1X39A 4IHKA 4PC6A 1UMDA 3BGDA 2GAJA 4E46A 1Y4DE 3G9XA 3IA7A 3RHZA 1YH3A 2JGJA 1Q17A 1XRNA 1ZH4A 3CW9A 1VCHA 4MVJG 4B3MB 2X8WA 2ZCVA 2DQKA 4CQNA 1E6UA 3M9LA 3RJ9A 2ZBPA 1T2AA 2XDQA 3H65A 5C18A 3A1VA 2ZBVA 2ZYRA 4UBLA 4RX1A 3PUWA 5HKOA 3ECSA 3R7FA 5TVGA 2EZ8A 2H7CA 1C8VB 2I5PO 2OECA 4Q37A 5LNK6 4HX9A 3I6IA 4PFQA 2JRCA 1COZA 4OQDA 3TL2A 1HDRA 1MENA 4JNCA 4MRPA 3KKQA 3FDJA 3WAKA 1R66A 1SKBA 3U26A 4W99A 3HZOA 4PG4A 2G76A 3KZMA 3HMQA 5H59A 4Q1DA 1PW5A 3HVIA 4IO0A 4YCBA 2R8EA 1G63A 2XUDA 4B4UA 1AV6A 5C52B 3CIOA 4GOXA 1GZ3A 4FC6A 5E7QA 1MD9A 4D96A 3JQBC 5BR1A 2ZJYA 4LHVA 1YZLA 2GJAA 4XUDA 1G6HA 2ZM6B 1PT7A 5JDCC 4GLBA 1JFSA 1K5PA 5IJ9A 5IJWA 2UZIR 4UM9D 5FQOA 3BDAA 1Y8QB 4PBSA 5C32A 5CNIA 5CT6A 5D5HA 1VJTA 4Q9AA 1XTRA 2XUOA 3RG8A 4AMYA 4OGGA 3RHSA 1P0FA 2B30A 3R20A 1T36A 4TSFA 4KXYA 5AOVA 1ABBA 1CY2A 4NPAA 1Z73A 3AV3A 4ZVRA 2XHEA 3EZ6A 5FF9A 1QZTA 5LQRA 3TSOA 4RZ2A 2E5FA 4MI9A 1XDDA 3AOGA 1S89A 2ODAA 2OAGA 1RE1A 1TJ3A 2PU5A 3DTVA 1EZ4A 3TEJA 5TPZD 3WRYA 1ZRMA 3NYRA 5L95A 3QU7A 2DUMA 4L5BA 1JXMA 3ZD8A 4K6GA 2QGFA 4ZZIA 5AR1A 3AJ9A 1Z63A 4RGQA 3KTDA 3JQBA 5GM1A 1WBBA 4DLTA 4PRKA 4AUEA 5KUTA 1F2VA 1XA3A 2VDUE 1JQLB 4N82A 2COUA 2IHTA 5IUNC 3KLNA 4LCJA 3WNBA 1S8NA 5IVPA 4MZDA 1XXHA 2ZSUA 4RYDA 1YVPA 4ZYYA 3I01M 2CF6A 4HDOB 2YWCA 4HVAA 5BQFA 3QXJA 4K3UA 3RVMA 3QBEA 4DCUA 3E4DA 2Q5IA 3O94A 4ZAGA 5CB4F 1I7NA 4M8NE 4IDEA 2MSNA 1UDXA 2GCNA 1WDWB 3CJTA 3R5HA 2XKJE 2NWQA 4EGJA 3UG7A 1RI1A 2WE7A 3L8HA 1PWEA 5DEIA 4I0WB 4L8VA 4TRRA 1NW5A 1G8PA 3BAFA 2EWWA 3KKMA 4M99A 3H5IA 4P34A 1O95D 1S8AA 5J2TB 1I13A 5MF6A 3Q7IA 3EXEB 1DBIA 1PT5A 2BTOA 2CE2X 4OB8A 3D2LA 4N7RA 4PYRA 2WFMA 5L3RA 3SKYA 4ABYA 4A8HA 3VKGA 2R62A 2O3QA 1PR1A 2KWIA 5E38A 4D9JA 2JAWA 4YA6A 4TT8A 4R5HA 1VHDA 3TI9A 1M0WA 1GD1O 3ITDA 2JFOA 4JLUA 5EKXA 4MR7A 4IM7A 3JQAA 4U8HA 4DT1A 2HZ7A 3KPJA 2X7XA 1ADGA 1Y89A 1K7EB 1KI6B 1NQWA 4FDTA 1PFVA 5F98A 3HXQA 2L19A 3GD7A 4POOA 4CUZA 3LGXA 3TL6A 3M1AA 3SZOA 3WNCA 3WKEA 1RPZA 3BCUA 1F20A 1VIVA 2PUJA 2ICAA 1OFUX 3I2JA 1XKXA 3IMCA 3PHBE 3PGXA 2G71A 4N12A 4FP9A 3L8DA 4ZN6A 2CEAA 2XCTB 1YUNA 3BWCA 1I6LA 3EZLA 4M9XA 3ZHOA 1QAMA 2TSYB 1ISJA 3THOA 5FLXA 2NAPA 1S2LA 3P9QA 1BXRB 1WXXA 1OF1A 1XRMA 4PNZA 4S1NA 4DOMA 5C5DA 3CVXA 3KO8A 4URFA 2H63A 1SUBA 1RWQA 3K4HA 1E3SA 1TM4E 5F76A 5KOHA 3GDGA 3ZW8A 1VL0A 4L7VA 4H60A 5D6NA 5EXXA 1YRLA 1TUIA 1U2EA 5M34A 4NXMB 3QKTA 3Q98A 4QXOA 4HCJA 2QZ9A 3AUKA 1NF9A 3CTMA 3Q8WA 4IINA 3IIEA 5DHAA 2Z5VA 2I87A 2ILTA 4W9MC 1OBOA 2QBYA 1BGWA 3A6KA 3EVEA 1RHRA 5ALVA 2OHGA 4G5XA 2P90A 1VOTA 3Q7PA 4Y2SA 3RARA 3STWA 2VYQA 2H2IA 3DBHB 5EIAA 1NI3A 2QTNA 2CVZA 1DX4A 1QHSA 3FPSA 4LRYA 1RKUA 3CM0A 2Q4RA 4ZYZA 3GR6A 2UZ3A 4RD0A 3OTGA 5DMHA 3OESA 3CH4B 5C9ZA 3TG8A 3IP1A 5IT4A 4EL0A 1DC8A 3OEWA 1CEQA 1CS4C 3A37A 2EEZA 4GPIB 1L7OA 3P27A 1JJVA 2OEPA 2VQFB 3UT0A 1LXCA 4NOKA 1KEEB 3IBCA 5IDYA 4CR8A 2AMYA 4B3FX 1TXGA 1FFCA 2JGMA 4CLDA 4MWGA 4Q9KA 1TKRA 1MC8A 1MB3A 3S1AB 2MCFA 1HYHA 3U62A 3LPCA 2JIZA 1L5OA 4B3CA 4PRZA 4YCLA 2AI2A 1XNJA 2VF5X 4GNKA 1F5SA 3G2MA 5I9BA 4OHCA 3ZW7A 1XHEA 4OFXA 5ALGA 1Y1RA 1P91A 1ESMA 5TF4A 3JALA 5HM6A 1I2BA 2CYCA 2Y9PB 3B9RA 4CU2A 3L8GA 3SNHA 4IDPA 1XQXA 3GN1A 4KSBA 1KNQA 4PC2A 3TLGA 2AJTA 1JSXA 1FPQA 5KWJA 3PKJA 1FPMA 2Y66A 3K32A 2OD2A 2WWFA 1FFEA 3UHOA 7MDHA 1GPBA 1O89A 1NU6A 3QWBA 5BSEA 4Q00A 3QVGB 3ANMA 3ZU5A 2HLHA 1JF8A 2XDWA 4H31A 5LSAA 1M2HA 2GD2A 3RS8A 4CFSA 2P40A 3KZ1E 1I6WA 2J0QA 1ZMRA 1XCMA 2AYZA 1MPTA 1ZLYA 4BVHA 3GELA 2O3UA 3QX8A 3OKPA 2ZDHA 5CYFA 1R0LA 4QD3A 4TXJA 3L7BA 5TB5A 2PSFA 1Q0HA 3K8ZA 4HATA 1S9DA 1KEKA 2N0SA 2YRXA 2XD4A 4DC9A 1USKA 2Z2KA 2KJQA 1KBQA 5DWQA 3GAAA 5BP7A 3DEIA 2F1RA 5EEHA 1KFJB 2R7AA 4YBRA 2PNJA 1RAFA 3IEIA 4DZRA 3IEUA 1NJSA 4P98A 4WK0B 3MTDA 1KDZA 5DI3B 4IMRA 4GKJB 1OYVA 1QANA 4ALMA 1AXRA 3HVUA 4DPMA 1QKKA 1QE3A 4WBNA 1PEAA 2HDWA 2DCUA 5TIIA 1PSDA 1WWKA 5HEKA 2HJHA 4BJ3A 5CLHA 3GJQA 4OYHA 5LKAA 4QJ5A 3DTTA 4G8JA 4YRQA 1Y5RA 4NC9A 2OCIA 3K92A 5B53A 2O5RA 2XZPA 2CZCA 3WGLA 1QWOA 5JV5A 3WXMA 5K6TA 4G07A 1L1EA 2Q28A 4UULA 1FTQA 3QNMA 3UGQA 1UJ6A 3UEOA 3BJZA 4J4TA 3LUFA 5F7XA 1CUFA 4MXDA 3CWZA 3E9QA 2A78A 5DCUA 5EXEA 3MJFA 2H2DA 1PL8A 4H08A 1RTKA 1JBKA 4H4EA 4IHJF 4EI2A 1S4MA 2J3HA 3QE4A 1V25A 4F3RA 4F6CA 3ELUA 1D04A 2TMGA 3Q7TA 5CB4B 3TCKA 5IXSA 1I1HA 1PJAA 3HR8A 1K4KA 5CVDA 3ZCXA 3SHFA 2EFHB 2CNOA 3EULA 4OM8A 3SHOA 4CNBA 1O9GA 2C54A 1KC3A 3IPLA 4B32A 2C8JA 4R8VA 1NI4B 3OO1A 4JMPA 4XUEA 2HMAA 1NQUA 1C9MA 1UBKS 4RS3A 5IEBA 1M2OB 1J8VA 1E5LA 2Q5FA 1WMAA 3IUJA 4HGOA 5JUWA 4O8CA 2JCYA 2Y1LA 4M9ZA 4X1IB 3ZWOA 5JNSA 3N2GB 4HH4A 3F3SA 2QAGB 2WF8A 3ABQB 4HB3A 5C4GB 2PE5A 4BGDA 4NCHA 3T1QA 5U4XA 2JK1A 4G9EA 2GPTA 4IZ6A 1C41A 1NAIA 2Y93A 5HDQA 3K4QA 3DHEA 3F3KA 3I30X 1SHJA 3MT0A 3CLSC 1NYRA 1YBVA 4ARUA 5ULLA 1XA4A 1PVOA 4D6PA 4KR9A 1MO2A 3F90A 3ILVA 4QVKA 4ALLA 1MH9A 2J08A 2OCBA 1Z47A 3FKQA 4LY6A 1PG5A 2BHNA 1CSEE 2W2VA 3DDZX 5AYVA 4IDQA 3UTCA 5EHIA 4ZZ2A 3ZWBA 2G88A 5I3ZA 3QG5A 3AIKA 1KEVA 2Z3VA 1A8PA 4YAOA 5FD8A 1BGXT 3OZXA 3CEAA 1KGSA 4M60A 2F4NA 2NMVA 4KQKA 4XIFA 4J0IA 1N32B 2OO5C 4EHHA 1TCVA 2QJFA 3DGFC 4NENA 2FUNB 2BFPA 4LMAA 2ID4A 4YP1A 1W36C 3DOOA 4U2CA 1LLCA 3LSYA 5AESA 3V1LA 3U16A 3IUEA 3WSVA 1CJMA 2DUUA 4PVCA 1UOEA 3RYIB 4C05A 2P6RA 1MZPA 2QRJA 5GGXA 4BNDA 1YJAA 3G2KA 2Z2IA 2PYDA 4DV2B 4D80A 1E2PA 3A9UA 2OORA 2NVUB 1MKYA 4AUKA 3GLVA 4RM3A 1A72A 1EMDA 1NOKA 4MEJA 3DONA 4TOIA 1ZI9A 3MJVA 4GYKA 4OXNA 3OZAA 1K6EA 3C74A 2HTFA 5IVHA 4OM7A 5CCBA 1DQSA 2XA9A 3EARA 5AVZA 1PFQA 1KMMA 2Z8ZA 5HVNA 3M6FA 1KOGA 4CIAA 2GJSA 1FBNA 2ZSAA 2BI8A 3C48A 2AQ8A 3QVXA 4IVPA 4S1OA 4XJSA 3TTUA 4D3DA 1PBTA 3KWFA 4LXGA 2WILA 3T5MA 4EVRA 5KBYA 4WFKA 3DCIA 3DGEC 3NETA 3PI6A 3KXKA 5JAUA 1NLFA 4MRMA 3SXJA 3OA2A 3ONDA 2M6RA 1XD2B 3BDIA 3HGMA 2VP0A 1JFVA 4R31A 3RRMA 2AOXA 2QTBA 4F6LA 1Z4LA 4LCBA 1E20A 2YC4C 1D2RA 3FVTA 1VL2A 2BM9A 3GBPA 4WNAB 1WCWA 4E09A 1GOTA 4HDSA 3RUFA 3V42A 1AMNA 5J23A 2OCAA 3RAEC 2H3EA 3EAFA 1FX0B 3C15C 2QVCA 2JAUA 4FZ3A 4AZVA 3KVNA 4URHA 4CG3A 4Q4AA 2F55A 3RW9A 2B4TO 1SC1A 3R0XA 3WFZA 5BRAA 3RYFA 3TR5A 5I7FA 3QUAA 3VYSB 3ZLVA 5DGCA 4DHWA 5LMCA 4LGVA 4IGAA 6ABPA 2F7SA 1CP3A 1AB5A 2EFJA 2X0EA 2VL7A 3V8VA 5FBVB 4Y67A 2H0RA 1Z7WA 5HCUA 5ALMA 1GPAA 3OTQA 3J81A 2JCBA 2VG8A 4RVUA 4BUZA 2XE4A 4GBGA 2LCFA 2VT6A 2I9KA 3F6EX 4L4ZA 1L5SA 1QRDA 1JGTA 3GRCA 2CMDA 3KEMA 1U7XA 3CG4A 2XMQA 1IDOA 1P17A 2ABWA 4PCUA 1US8A 4XVHA 2X5KO 2YFQA 3G2OA 3WJ2A 4AZ3B 2ZI9A 4BLSA 3D8NA 2FR8A 2JGLA 4WXHA 121PA 3G2LA 3UOAB 1XEFA 4KPEC 2RGXA 5EA2A 1WKBA 1WY7A 3EPPA 3OM9A 4L75A 3SJCA 3K2IA 1RBMA 4TUYF 3AKDA 3BIOA 5I5EA 3HZHA 4IIVA 1SOAA 2YV3A 3UUGA 3M9XA 2J7KA 3WNVA 4QE3A 1SXHA 3ETJA 4TMXA 4WKPA 4UOQA 3X1JA 3LPDA 4LVUA 4UTXA 8MHTA 2CXUA 4LX0A 1O9BA 3AHFA 5EYPB 2ALJA 4OQQA 4QXMA 3HRHA 3PX3A 1R8JA 1V45E 1VGRA 2V59A 2VLIA 1AB6A 2PX5A 3A3OA 2BE9A 3AEUA 1CCWA 1Z0AA 1E9FA 1Q7BA 4RTJA 3V7NA 1YA4A 4FKBA 3MWJA 4J9VA 1BXGB 2QV7A 3RUIA 2C00A 1JDSA 1AHPA 4JC5A 4OCZA 4RKEA 1G60A 1KDYA 3VKUA 5AW3A 1W0KD 4MUKA 4RK0A 4CG1A 4Q1BA 3WADA 4Q6WA 1KFBB 1Y6ZA 3BX1A 3GBSA 1XAJA 3H84A 3ZEAA 5LP6F 4Y2PA 2C4HA 2Q29A 4X1KB 1G5QA 1C7RA 4Q1CA 2HMUA 2RE8A 1YC5A 3JRNA 4E07A 4IHJB 2WJIA 5JISA 1O5IA 2R87A 4JT2A 4NZPA 4PFJA 2HOQA 5K0JA 3GRRA 4RU1A 3A0UA 4IXMA 3H0CA 1YIDA 3EBPA 1OT5A 3QTLA 3A8TA 2WYOA 1CY7A 1R6BX 3SZGA 5LQCA 1QYDA 5IAKA 3A6PC 1FJXA 1XRRA 2VJPA 3DZIA 2C2KA 2P8JA 5C8YA 1ELOA 1KZ4A 3EB9A 1Z3IX 2CZGA 4KQMA 3E0QA 1RQRA 4LKOA 2P2LA 2ZM5A 5FIUA 3IAHA 3LCCA 3N0XA 3OOSA 5IBPA 4EGSA 4B48A 1LBTA 1GG5A 3E9DA 4H1TA 4HVCA 8ATCA 2XITA 3E23A 3QU2A 4D6YA 1PT9A 3F7NA 4ITUA 4L4SA 5F7JA 4KXLA 3T1HB 1VMKA 1HEYA 4EJSC 2HYDA 2JIPA 2ZWAA 5AVTA 1UMKA 5FWNA 5I7WA 1Y8CA 1YQTA 3QWIA 5CXQA 1PYDA 3RK4A 2O1WA 1OA0A 2EDCA 2ORYA 2R6CA 3EAGA 5FBKA 4Z4HA 1AD2A 5K0ZA 3D8SA 3DT6A 5JAHA 2BDEA 2XEDA 3G2IA 4EHKA 4K9OA 2A0UA 4YCSA 2FZWA 1PQWA 4LJYA 4PYQA 3CB2A 4YCNA 2FJPA 2EGGA 2CXNA 1IN1A 2ZE6A 3ZBTA 1U7OA 1GU0A 4FDLA 1KI3A 1L1RA 4P7FA 4RQUA 2IU3A 1HR0B 4WJLA 4B17A 3W2TA 2K87A 4DSZA 2QRVA 5IF9A 1SOMA 3DFMA 2PTHA 1RRCA 4RD4A 4H27A 5GQSA 3VJLA 4DNXA 4P33A 2PZLA 1Z28A 2D0DA 2E9SA 4JP1A 4WDRA 1U2QA 2XMRA 1PK7A 4Q9IA 5E9AA 4AMBA 3X1ZA 2WAXA 13PKA 3EOBI 1FJ2A 2UUCB 3RGWS 1E3MA 3IESA 4HTFA 1XRSB 2W2KA 1X1BA 5FA6A 5LC1A 1YS4A 4EJSA 2H00A 2P1ZA 2YVKA 1M0TA 1XDBA 2JLBA 1GPDG 1Y3IA 3KYIB 4AG5A 4F8YA 1JXOA 3HE3A 3MPUA 4RZ3A 1GCUA 4IIYA 1I6KA 3LDAA 1RLUA 3VSCA 1AKWA 1HSOA 2QTRA 3A1FA 3K5PA 3RRXA 5DF1A 1LPSA 3THYA 2QVGA 4V2UA 1I3KA 1GGEA 2KX7A 3N76A 4MRRA 5CK4A 3R7BA 4C03A 3WA6A 4RDIA 3ZD9A 4EB6B 3I2IA 3D5TA 3NNSA 3W5DA 3IQIX 1KHTA 1U2GA 2CBXA 3I2FA 1OIXA 2JANA 3C4VA 3MMPA 2X9VA 2RK6A 3DTNA 4GWLA 2I4TA 3X1KA 2HBQA 3LDGA 2DPGA 1K08A 1IHOA 1TRHA 4H16A 3W7AA 5H4GA 1C0IA 1WF6A 2EG5A 1W5AA 4C30A 3RVQA 1KHHA 4K46A 1CW2B 3GG9A 3LBHA 3IUNA 3E7PA 4OXRA 1E77A 5A05A 3SQNA 3NOOA 3T7CA 4BMOB 2D5CA 1YVDA 4KXUA 2CHEA 1ZGGA 2A94A 1I2AA 2BMVA 1C4WA 4OHFA 4FYVA 1FP4A 3SMVA 1E3QA 1ND6A 4K6HA 1SBYA 4MUGA 1LTQA 2JGEA 2QW0X 4HWPA 1XZAA 3HCCA 4EHLA 1UEIA 4JWTA 1CU1A 4XIGS 1YQEA 2IZ0A 1CZOA 2PJUA 2RC6A 3FMGA 2NXNA 4YMIA 5LBUA 5LJIA 1ZJ4A 1NQTA 4IGKA 4Z0HO 4FFBA 5GIPE 1IVSA 3DFUA 1QH8A 2Y76A 3VR1A 1IVNA 3EVNA 3QLVA 1XVVA 2VA9A 2PGDA 3A1WA 4L6CA 1MW9X 4ENVA 4YO7A 1WMFA 3A7EA 5LD2C 4CFZA 1N1EA 2NADA 2AWNA 3D1LA 1ODCA 2AN9A 2HLDD 3QYPA 1BCRB 1I3LA 3L0CA 3SJZA 2OHXA 4MUAA 1ODLA 5A03A 2D00A 1T3SA 4XPZA 3TVDA 4C78A 4YAGA 3QNWA 5E9QA 1KSHA 4KQEA 1C9YA 1TOAA 4LZWA 3C8DA 1RAGA 3PWZA 1A3CA 1CUDA 4R2HA 1VDZA 3WNZA 2WA1A 2ACEA 3ZGNA 1B74A 4CCWA 4UTPA 2JJ1D 2X0JA 3MQFA 5CB6A 3BEOA 3DW3X 2NZWA 4J4HA 4X60A 5B30A 3JSXA 2R0QC 2EERA 4QSHA 2ZWOA 4TUYB 4E2WA 2P41A 4DR5B 4DA9A 3ZV6A 1EWRA 2WYWA 2NUTA 4FD3A 1G19A 1Q7TA 3MS2A 2RGAA 2PKEA 4Q9JA 5EMNA 1TF7A 1XQVA 1N2OA 3RV3A 3G7NA 4CIBA 4XYLA 2OXTA 3PQ3A 3F5MA 3STHA 2XJ4A 3VPCA 5KWEA 1GPJA 1QM5A 4LZZA 3W5AA 2O20A 4OLJA 3DT8A 5AM2A 2V9CA 2DQZA 2B69A 2XWPA 3M6XA 5F77A 1E9VA 4MDFA 3ELBA 2HA7A 4P92A 3GPCA 5C7LO 1O6GA 4OI0A 4MGIR 4YQYA 2XYGA 3HYCA 4HLUC 1H2HA 4FOOA 3ZH2A 3SBOA 3USCS 1JWLA 3EEIA 2ZUCA 1A5TA 1HLDA 1B0PA 1ORVA 3VR6D 5I5GA 4UZFA 3PXEA 1X1EA 4HDCA 3VR6H 3HKCA 1JEQB 2CY0A 2WBLC 4I19A 3JASB 4H4CA 5LP6B 4JEIA 4DAEA 2QQFA 1VQ1A 1JI3A 1Y7PA 3EIEA 1W1UA 4EHBA 1Z7GA 4LDRA 4MV4A 2FK8A 4RD3A 3GP8A 4LRUA 1QP4A 2ZUBA 4P08A 4ZO8A 3F4KA 3EYAA 4FN4A 2HRZA 3FOBA 3AUSA 2OKGA 5HJ5A 3KG2A 5H0IA 1OROA 3HV2A 3EVCA 3GMIA 2RJOA 1VIDA 2X7HA 4EJFA 1J0BA 1Z38A 1YUBA 2AMFA 3EIXA 4EPRA 1XD9A 1ZAYA 1LQTA 4XWAA 3DH0A 4MWEA 1Q12A 4PNHA 2CMHA 3TZKA 2Z0MA 1E6MA 1YOBA