4QPDA

Crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase (wild-type) complex with tetrahydrofolate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
308
structure length
308
Chain Sequence
MKIAVIGQSLFGQEVYKELKNEGHMIVGVFTIPDKDGKVDPLAIEAEKDGVPVFKFPRWRLKGKAITEVVDQYKAVGAELNVLPFCSQFIPMEVIDHPKHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFTVFWADDGLDTGPILLQRECDVEPNDNVNSIYKRFLFPEGVKGMVEAVRLIATGKAPRIKQPEEGATYECIQKKENSKIDWNQPAEAIHNWIRGNDRVPGAWAEIDGKSVSFYGSTLLENDHFSSNGQPLEIPGASRAALVTKNGLVLFGNDGKMLLVKNLQFEDGKMIPGSQYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the hydrolase domain of zebrafish 10-formyltetrahydrofolate dehydrogenase and its complexes reveal a complete set of key residues for hydrolysis and product inhibition
doi rcsb
source organism Danio rerio
molecule tags Oxidoreductase
molecule keywords 10-formyltetrahydrofolate dehydrogenase
total genus 92
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
A PF02911 Formyl_trans_C Formyl transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.25.10 Alpha Beta Roll Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2 Formyl transferase, C-terminal domain 4qpdA02
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4qpdA01
3DA8A 3GARA 4ZYZA 3R8XA 3Q0IA 1C3EA 4S1NA 4Q12A 3P9XA 1C2TA 3TQQA 2FMTA 4TTSA 3NRBA 4ZZ3A 1FMTA 1CDEA 1RBMA 1ZGHA 4EW3A 2GARA 3AV3A 1RBYA 4QPCA 1GARA 3OBIA 4PZUA 3W7BA 4YFYA 1NJSA 4TS4A 1RC0A 1ZLYA 4NV1A 4YFVA 4EW1A 4ZYWA 3TQRA 1JKXA 2BW0A 4ZYYA 5J63A 1S3IA 5CJJA 1YRWA 3AUFA 1MEOA 4ZZ1A 4ZZ2A 3KCQA 1CDDA 3O1LA 4EW2A 2BLNA 4IQFA 1MENA 3DCJA 1GRCA 2YWRA 1RC1A 2CFIA 1ZLXA 5J9FA 1RBZA 4ZYXA 4ZYVA 1RBQA 3LOUA 4DS3A 4ZYTA 4ZZ0A 1MEJA 3N0VA 4TT8A 4ZYUA 4R8VA 4QPDA
chains in the Genus database with same CATH superfamily
4JXKA 2BFEA 4PPFA 1E92A 4RHFA 2QGFA 1P9WA 1ZISA 1N78A 1LH0A 1RLUA 1WQ4A 1YKSA 2O1EA 2PXXA 4GC9A 4YJ3F 4D3ZA 3I42A 1Y48E 2VZEA 5A0FA 5C8XA 5U9CA 2N0SA 4ZPJA 1NJ5A 3X1XA 4KBGA 1LQTA 2VCHA 1P2GA 3OBBA 4JL8A 2C7VA 1WL8A 3BJRA 1RC8A 2EGUA 2DULA 3MINB 1CF9A 3MTDA 4OJTA 2RGGA 2VDUE 4HNTA 3THWA 4EO4A 4FGUA 3DDUA 3IDZA 4ARUA 2IHZA 5LXTB 4W7IA 3UOWA 2QN8A 1WF6A 5KQLA 4X71A 5TJ9A 4FFLA 5I3ZA 1JJIA 1I3LA 3DQPA 1N77A 3G7NA 3P97A 1Z18A 4CDGA 3I52A 3CR8A 1B6RA 3LA6A 4EWLA 1YRBA 1GL9B 3DMHA 3VZDA 5DNCA 1HDRA 3S7TA 2C2YA 3K6JA 4NZOA 2YYZA 4YBRA 4R01A 3UBTA 2QPAA 1V48A 3FPLA 5TPZD 4CTNA 3TG2A 4G0WA 1TVCA 3CBQA 2Q3EA 5J4VA 4BWYA 4EH1A 4J7UA 2E4WA 2IEAA 1KAOA 1FS6A 3EUAA 4PHCA 1N2GA 5FI3A 3C3DA 2QG4A 4G07A 2VCYA 4CIAA 3SKVA 1PJCA 1WXIA 2C03A 5JSZB 1MX5A 4Z7QB 4XUDA 4G2NA 4C0AC 4FCVA 1MJ5A 2HJ9A 2CUKA 3ROQA 5KJEA 5JYEA 1V5GA 4O2AB 1F3OA 1X7HA 1Z6AA 2BFCA 4D97A 3SF8A 1U0GA 3HDGA 1XR3A 1NP6A 5I6DA 1PR1A 2WRZA 4DLNA 1GPAA 1OBCA 3NOQA 4MV7A 3TM5A 2LP4Y 1KEWA 2OGWA 1RPNA 1QQBA 1P8JA 3MELA 5C3UA 3DS8A 4DY6A 5H68A 1WXGA 3N8HA 1E8DA 1JHOA 2GR9A 2JCXA 3DHYA 2K7ZA 1R0RE 1R8SA 3BULA 3MB8A 3O4JA 3K09A 2DKFA 4C04A 4GHWA 2VR1A 5JBQA 2OHGA 4DCSA 3NBYC 3BFVA 5H9WA 3RRJA 3WYBA 5ALRA 3CSUA 1MABA 4LRWA 5EIBD 1XCMA 5D2CA 4BLTA 3KTAB 4NEHB 1LA2A 4F2HA 5HIIA 2F3SA 1CRLA 1J1UA 2FP4A 3ZJUA 2N9UA 3UWMA 4EKEA 3PJRA 5DGXA 2VDKB 3WRYA 3LW8A 1R0KA 3PE4A 4FMDB 3B48A 2M6SA 2LVBA 5F5LA 1RABA 2MYUA 3PTAA 4F5YA 4RV9A 1PTJC 3NC4A 3SE7A 3RU7A 2PL1A 2BP7B 4FYWA 2I7TA 3CH4B 4IDCA 1BFUA 4RFLA 1OWPA 1DKRA 4C7BA 1M72A 3GFOA 1BW9B 4Z99A 4PS1A 3TBFA 1RZRA 4KREA 3GB9A 1UP6A 3CLTD 3QU7A 2CJFA 5TXGA 4YMIA 3AR3A 1E9FA 4O4JF 5E1OA 1OAOC 4L8LA 1T9AA 2GRAA 1GGVA 1JQKA 3H4VA 3WJ7A 3UOAB 3Q98A 1XD2B 5LQKA 4CR6A 4Q21A 2OD2A 1I33A 3G8CA 3IXMA 3I9JA 4KE9A 4K86A 1MB2A 5IP5A 5AVVA 1EFTA 4LZWA 1XK7A 2VH1A 2ZIEA 3IBSA 4KPGA 1PK9A 2I1QA 2O8NA 3HKDA 4PCAA 2GBIA 3BRWD 3MD0A 4WLOA 5K3CA 4DVGA 4MVJP 1CZKA 3R74A 1EYZA 1GT6A 2FX2A 2EKLA 1RMQA 4WASA 4JBXA 4B87A 3N6RA 1Z62A 5C80A 1PFUA 4LJ6A 5EEHA 2YH2A 3AKEA 3L05A 4ND3A 1P3JA 4XQEA 5FFFA 3ICQB 3N2IA 1P7YA 4DLRA 3TD6A 4CDRA 2A4MA 2H1HA 4HCJA 4FM9A 1B73A 1K1EA 3R5JA 4ETWA 4ILEA 3MJEA 2FZKA 2H0AA 5LQCA 3UHPA 4BV9A 1ZH2A 1Q7TA 2PE5A 4BJ3A 3EC1A 1G6HA 2I8LA 1PJ3A 2OPHA 1RYEA 2V7UA 3IQZA 1LLQA 1W4ZA 3GV0A 2PSFA 3HVHA 2YN4A 4N0PA 3RRYA 4MYCA 4Y6LA 2XXAB 4LYDA 5C5IA 2XMPA 2C3YA 1DQNA 1ODCA 2Y8EA 4LRUA 4ND5A 4FP9A 1YJCA 4R1LA 2GBCA 2ECKA 5DJ5A 4UHJA 5LZ9A 4YRZA 2F4VB 1JX6A 2WT8A 4LNHA 5TVGA 1QO9A 3KKMA 3FLMA 4EL5A 2O2EA 2HBZA 1RFLA 2N75A 1HDIA 4D0GA 2NNLD 1TW2A 2XYPA 3QPAA 2VHWA 2JLCA 3H11B 3AM4A 3LLMA 2F67A 4YALA 4HKTA 3ETEA 4C14A 3D59A 3GMDA 3U4HA 3EAFA 1SIWA 2W4QA 1XTKA 2P75A 1TM2A 4K81B 1DDOA 1BG6A 4WOCA 2B34A 2CDAA 1APBA 1EWVA 4IDFA 4MVJD 1DZIA 1XZEA 1EUDB 1AHHA 4ARCA 4X3OA 2BHTA 3SIPA 1KXJA 3L41A 4TTJA 4BEWA 1AT1A 2IHUA 1NVBA 1T13A 4JHLA 1FTYA 2AI3A 1FLDA 2V7PA 2ODAA 3U5ZB 2C2WA 1J0EA 1D6SA 3TLCA 4XVHA 2NO9A 1SFRA 1VIDA 3MLAA 3OFNA 3KWMA 3KYDB 3SEFA 1L5QA 2O3TA 3HJAA 3ROXA 5HUJA 5B57C 1M1YE 5JAMA 1JWBB 2VH5R 4HGRA 1WETA 1JVSA 4GPTA 5JJLA 1W34A 4P54A 2YNMD 3FDIA 1P5JA 1T0JB 3H4TA 3K0FB 3KNZA 3JQ7B 1PSWA 1M6WA 2QZPA 1A69A 4QASA 5E6UA 1VI2A 4W8OA 4BGEA 1A88A 3QA9A 4KGXA 2OBNA 2W2LA 2HWXA 2RC6A 1X87A 1U0EA 4ZRDA 1EVEA 2WU0A 2R8RA 3H9CA 4CKWA 1G8KA 2E4ZA 5ALPA 1CUBA 3UG6A 3H1BA 1N57A 2PT7A 4H3HB 3ZLUA 1HT0A 4Z8XA 4PSCA 1S02A 2AZMA 4BPRA 2AV6A 3RTBA 1EXMA 1VE3A 4WE3A 1XDSA 1EUCA 3RRBA 2VQDA 3C8HA 2FSFA 4TKUB 4AWXA 1VRVA 1GYQA 2RK3A 1A50B 2B9VA 4H31A 2GDZA 1M34E 1IJEA 3O5AA 2G82A 2IYYA 4IJ6A 1JFLA 4LYHA 2H4HA 1YIOA 1G291 5DEOA 5EMMA 1Q6ZA 3INGA 3GN1A 4I1UA 4AG3A 2IJGX 3U13A 3RC3A 3SC4A 1ZNQO 4RZIA 3E9DA 3DPIA 5C81A 1M2HA 2QRZA 1GQ2A 4DCCA 2GBPA 1OZFA 3JD0A 2VZ8A 4LK3A 2XODA 1K5DA 5K01A 5KOIA 3Q3EA 1NOJA 3K96A 6REQB 1B0ZA 1NI4B 2CK3D 3HJGA 2P69A 3KUXA 3OPQA 2A7XA 4JL5A 5IJ0A 1J00A 5LQRA 3TR0A 4AQDA 4H4DA 1HO3A 3PSAA 4NMHA 4UNNA 1GL7A 1NLFA 3OOHA 1EQUA 4BNIA 3HUEA 2YBEA 1TX4B 2PU5A 3QYPA 3U3JA 3FF4A 2J46A 3O9MA 3UMVA 1H2HA 3DBHA 1ML3A 3MT0A 4DSUA 2QI9F 2Q1UA 4GZ3A 1UFOA 5LWQA 4PSAA 3UGJA 1E94E 4JYPA 4OQPA 4MPTA 4JB2A 5EIWA 2JGDB 3GL9A 1QHNA 3HPQA 3U31A 4A3SA 1Z2EA 5K0ZA 4HVAA 2VPXA 3VDMA 4GI1A 1ODLA 2RB5A 4YT2A 2ZYWX 1HQKA 3EDQA 1VJ1A 4J2HA 2ZSIA 2AG6A 2Q5IA 3GJRA 3RFUA 3FCAA 2ZUWA 4KLNA 4AIRA 4F4DA 4B6QA 4JLAA 4EYEA 2PXAA 5ALQA 2KBFA 3KUDA 4KK4A 5DYYA 1F38A 2J3DA 2UZ4A 4RY8A 5JVDF 1C4WA 1YO6A 2JFPA 1DKNA 1KY2A 1YCFA 4KLRA 5EE1A 2ILTA 2V5VA 4R05A 1CWUA 2F3TA 3QFFA 3ZH2A 3VSAA 2F55A 2I2FA 4MQFA 2EQ5A 2WMOB 5BWCA 3P32A 3QEJA 1DAGA 5AJVB 3WGMA 1NTOA 5DBGA 1N2ZA 1B6GA 2RJNA 3F8SA 1K3FA 1PKXA 4Z4EA 3MWFA 2BJVA 4B47A 1U2GA 4XIIA 5JLAA 4QSMA 2CFOA 4BB0A 2C0PA 3FWPA 1T6NA 4MV9A 4PE5B 1OF1A 1C9YA 1VJDA 2OE2A 2OM6A 2VT2A 2PUCA 1TF5A 4HUJA 1ELOA 1LNQA 4EDFA 2HHCA 3KO8A 5I7EA 3HCBA 1SMKA 1Z88A 2VDNB 3LLVA 3D1JA 3FROA 3OLVA 3BC1A 2EZ9A 3FVRA 3RTDA 1OW3B 2EFDB 3G9ZA 4DJEC 1GKKA 1OAKA 1ACLA 1VJTA 4G4GA 2OBMA 2QENA 1X8XA 2W58A 5JRJA 5ALHA 1JL3A 1MORA 2C2OA 5D6OA 3H17A 2ACKA 2E6KA 5DNEA 2NU9B 1ULTA 4D8WA 4QFBA 5HBGA 4DR3B 1E1QD 4CEIB 4QOFA 2Z6UA 2JFXA 1K8QA 4RTMA 4C0JA 1QLJA 4H6PA 5HZGA 1YB6A 3FW1A 2C4WA 2WAOA 1DWQA 4NYMQ 1D04A 1Z12A 4IVNA 1JI3A 4HDRB 4QIHA 2X19A 3TZBA 2PX8A 3FFBA 2GNOA 1QGUB 2YMPA 4BNHA 2ZIWB 3MFQA 4YRSA 3BT7A 4Z5XA 3EXEB 1SA0A 4TMYA 2W6OA 3HYRA 3HGTA 1K4KA 2M1XA 3E58A 4MOWA 2E5LB 3PD0A 1EJ2A 1K66A 1LZKA 3AR8A 1J39A 1XUOA 3A70A 2XI4A 4FX5A 3EXG1 4NU6A 2C8JA 4BTLA 1JQLB 3FE2A 3HB7A 4QPCA 1IMOA 4QXOA 4UBJA 3BIWA 1FRQA 1FX0B 4YDHB 5CR9A 1AGXA 3STWA 4TQGA 1V39A 5GONB 4BV2A 4KMOA 2NO0A 3P45A 2OENG 1Z0IA 3WZ2A 4COOA 2QTVA 4AX8A 5I3CA 1L5KA 3FLAA 1CSEE 2M2IA 1Q95A 3DCJA 3TS1A 4YTEA 1SUBA 3ZWYA 4L0DA 1DC7A 5EPEA 4A1FA 3CUUA 3DTNA 4M9ZA 4Z4CA 1E1CB 1FSZA 1ZNWA 3G82C 2Y1KA 1C3EA 4AC9A 3BZUA 3SNKA 3UJAA 1YDHA 3RS7A 1FVFA 4J3FA 1NJFA 3QU9A 4X60A 5EHIA 3RVQA 3UFBA 4GLLA 1MJGM 1TK2A 4GMXA 1W1IA 2IEBA 2ZUBA 2BOVA 2XUPA 3I64A 3NHZA 4HNRA 4B84A 2ORWA 4MW2A 5EXSA 1KOLA 3VNAA 4BFVA 4A2QA 5KYKA 4Y2TA 3O0DA 2P2GA 3QUTA 5IXSA 3A3OA 3E9EA 3MQFA 4MRNA 3R0QA 2QT0A 3TMYA 4RMHA 3EQ8A 1TD1A 5ETJA 5AM3A 2JLRA 1KZ9A 4IQ4A 3LYHA 3IURA 2FPLA 3A9TA 4WSOA 2DHEA 3OLCX 3E2MA 3IBGA 1Z0FA 4FLEA 3UNXA 4HAOA 4AJIA 3TD2A 3F2VA 4V02A 3Q9LA 3HFSA 1UK7A 2BONA 5BOVA 2XQGA 3GJSA 3TIVA 1Q0TA 4HX2A 1S8OA 2D1RA 3MQ4A 4P7BA 3Q7RA 1RJFA 1SCDA 1UBFA 3NGMA 4IX9A 1CJUC 1UM9B 4NYMR 3GRZA 3OJFA 3FHJA 1BX0A 1UM8A 4XEUA 2V6MA 3U1VA 5D01A 2ZDQA 1KH1A 2PKCA 4S1OA 2J0UA 1S5PA 4QBFA 2OKGA 2UUAB 2FWIA 3IOYA 1DRJA 3WISA 3OG9A 2ARKA 3TSCA 3ZEAA 3ZX4A 4DCPA 1R66A 2IU0A 4DCNA 4BPBA 1USUA 1WE2A 1JAIA 1UMBA 4R1TA 1FDUA 1A7JA 1V0JA 3C4QA 3TLAA 1ZQ9A 4HXFB 1WCIB 3V1LA 4ZVUA 3ZK8A 1P4JA 5H9VA 5AIAA 1P2TA 2UZ3A 4XYGA 5AKIA 1EVZA 2ZAMA 1G4HA 2I2CA 5M5BA 3KPVA 1NLMA 3U61B 3C6BA 3VR6A 1QPGA 4I1YA 1OGYA 4JZYA 1BN6A 4JH0A 2REQA 2B2NA 1L4HA 1W5SA 1DJNA 3JQGB 4ZEVA 3LNCA 2Q5HA 2A4KA 3ZDEA 1Q1GA 2YFKA 1UDBA 4M9QA 1Q7GA 3O6VA 1CUAA 1LQUA 4X1KB 1VJ5A 2IZ7A 4C1BA 3AFMA 2I6FA 2IH5A 1SKAA 3RYTC 3P71T 4LZJA 4B80A 3OFJA 4JB0A 3K1AA 1BVUA 2EP5A 3VZRA 1JHDA 3FI9A 1FC0A 3ZJ5A 3D54D 4G5XA 4BJ6A 5LLDA 3KWLA 4YAJA 5F2EA 2QEQA 1DIHA 1UT8A 2JFVA 4NYJQ 3WL7A 5L45A 4FFWA 4G81A 2H29A 1IUNA 4NARA 4OYLA 2AG5A 3CRNA 3AF0A 5M34A 1SKYE 3BGOS 4NKRA 4V0OA 5A6VA 2DHQA 4IGEA 3CCCA 3R0XA 2J4CA 2X14A 2VUIB 4WXMA 1LVGA 4DDWA 3CEJA 1MEOA 2X8JB 3QPUA 5LWHA 5J3JA 3PNQA 4PAQA 3CBGA 1VIYA 3HO6A 2QT1A 4PLWA 1JALA 3H0EA 3ABRB 4RZ3A 4ZI3A 4O4IA 4FT4A 2F59A 4LHWA 2W4MA 3BWDD 2BR5A 4GR4A 4XB1A 1IB6A 3LBAA 1QFSA 1VGQA 1OZGA 1GA1A 1T0BA 4NOLA 3QX3A 3ERCA 1HY3A 2QMYA 5ITWA 4I46A 2YHIB 3DCNA 3UXEA 2CLDX 1JLMA 3HN6A 4RJKA 2NVUB 3RUCA 4A6EA 1E2MA 1VBFA 4BQQA 1JT2A 1T43A 2R8EA 4RADA 2F8SA 1IM8A 2AW3A 5F3WB 3KSAC 3BIOA 1ZGAA 1MTZA 4LHZA 4MX8A 5KMGA 2RSLA 4E7PA 1AXGA 3RRMA 1PU2A 4FYXA 2GN8A 4B6EA 3RBVA 5TQJA 3WICA 4NOKA 4DMKA 3V6MA 3EHDA 1XEWY 1FRVA 2VUSA 2HWYA 3SR3A 1N0UA 3T8YA 4G37A 1OSNA 2NG1A 3U4GA 1BS9A 4V1CB 5FL7A 2R4UA 2HMSA 4DIMA 3PPXA 3SZLA 3RJZA 1U0LA 2GCIA 2VJKA 3QTTA 3SE0A 5KKAA 5KB3A 1JLLB 1AU9A 1JE0A 3M1IA 1KY4A 3DNPA 1FS4A 4L02A 3EOAI 4GI3A 4LC1A 1Z0UA 2GLXA 1XVIA 4V1CI 5CPBA 3CRZA 3JY6A 4I55F 4MNTA 4TTIA 3IV7A 2JHGA 5BSKA 1F7VA 1PRYA 5ELMA 1GNQA 3FN4A 3PV0A 4KQMA 4C1NA 1EE2A 3RIXA 4D2IA 3DE5X 5MN4A 4M8SA 1XTIA 1EDEA 2C82A 2NO1A 2DQZA 4L5AA 2PBZA 2N1BA 3BF7A 3I3SR 3R7DA 3SMQA 4X92A 1QJ4A 5I7AA 2I6QA 3UW1A 2PZBA 3T7AA 1UPBA 1W44A 4V1CA 4GLBA 3JQ7A 3HVKA 3NJ8A 3GBVA 2PPLA 3PNPA 3LUHA 5KJ1A 4DB4A 1E0AA 2QYOA 1O6BA 1YACA 1WOYA 3A37A 4HMQA 4EHAA 1AGYA 2RCNA 3GRVA 3TIFA 3WY9A 1GD1O 2FY8A 1VYTA 4PYLA 2JFHA 2XADA 4Q6WA 4L8GA 1YE3A 4LJKA 4P3KA 3QG1A 1IY9A 1GARA 3PUXA 2DUWA 3H2SA 2GUGA 2NZVG 2DZDA 3AUYA 2EJCA 4H1VA 1ZJZA 1J21A 4ISBA 2RKWA 3PFCA 1H2WA 1XZDA 3G17A 2XT9A 3T1QA 1NG9A 4X93A 5CDFA 2FVXA 2QLTA 3R7LA 4RZSA 3U48A 3FPSA 4NCIA 2R751 1J23A 2H6EA 2VDOB 1PIWA 2VUUA 3AEYA 4HGZA 4E5DA 2JFOA 4F3KA 4Y2QA 3RTGA 2ZUSA 4K03A 4MWZA 3SPXA 1YC5A 2G76A 5CFLA 4J2OA 3RUDA 3ZV6A 3M8KA 3B1XA 4G65A 1QB7A 2WUFA 2DBYA 2HMAA 3MCTA 3T54A 3D3WB 1G8SA 3AM3A 3D3KA 3VAZA 1GUBA 3SC2B 2QE7A 1FSPA 4TVSA 5AJHA 4E2ZA 2BP7A 4MUJA 1AQIA 1CC1S 2BEKA 2BTQA 1EJBA 4D3DA 5IG2A 3JARA 1N8SA 1VMAA 4PANA 2Q2NA 1ORDA 3IEVA 2ENUA 1QTIA 2Q5FA 4XQ9A 4OXRA 1EGQA 4PXAA 3H84A 4EW2A 2E5FA 2ZJBA 3FCXA 1PJ4A 2XXAA 5BNZA 1YRHA 1A98A 2Y92A 1JPNA 2WIBA 3I9FA 3TMKA 4CGZA 1WXWA 3FNGA 2DXIA 1OXSC 2HRBA 1KA9H 2W6NA 4CF3A 4CM6A 3FRJA 3SEQA 5BN4A 1V47A 1HQDA 2JIZD 5L53A 5HKKD 1D03A 2QYHA 3MJSA 2OP0A 4MRSA 3ZKAA 1SHKA 1QG6A 2ZM5A 3MVEA 2HTEA 5TMDA 2G77B 2KWIA 2VAXA 2CHVA 3HV2A 3MBIA 1QIDA 3OM1A 4K8RB 5BV1A 5FA6A 1JYEA 3EG5A 5E4FA 2FPKA 3LVRE 5EHNA 4B73A 1S01A 1SCIA 4P86A 4PINA 2Q2OA 1YONA 4XJXA 3WYFA 1QWSA 3M6XA 6ADHA 1RQRA 3AU8A 1AH2A 3KT0A 2YFHA 1PWXA 4IH4A 2YY7A 4Y2XA 4IXMA 3K1ZA 3DL4A 3RUFA 1O5OA 3DOUA 1T2EA 4CIBA 3AF2A 5JSZA 3HWX1 1O96B 4WTOA 2HF7A 4TMFA 3KXIA 1PTKA 1G8HA 4X7RA 1E0SA 4OHYA 3CWCA 1JQEA 4UEOA 3KQYA 1Y5MA 2XLCA 3HDYA 4MVJI 3NDJA 4R2XA 1PWZA 2ZG6A 5AI8A 5BRNA 5HDBB 2QN1A 1PWYE 1DC5A 3RGWS 4AN0A 2GDJA 5ADVA 4JVLA 5HQ3B 3KSBC 2A5JA 4JROA 4MB2A 3UUWA 5BVHA 4O3MA 2H3HA 4C78A 4MQ5A 4AQYB 4O4HB 4KV7A 3WO1A 1NVMB 1ZCZA 1GL3A 3A1SA 3A31A 1CUCA 1JIIA 2AMVA 1X9HA 2R6CA 4PO1A 4K3VA 3SSAA 1AA6A 4X62B 4MI9A 4KHZA 4ZO7A 2D7JA 1XZGA 2PJZA 4CZ2A 5EVJA 4EYOA 4MMYB 3KTAA 5CVEA 1ZUNB 3L8CA 3UHAA 2ZBQA 2I7DA 2V6BA 5KSOA 3JYLA 3MOSA 1PD0A 2JPDA 1X8LA 3OOYA 1KJ8A 5IMSA 1F5SA 1WUTA 2RFLA 4R84A 2HR1A 2QMZA 1U2DA 5AT1A 1UC5B 4PQGA 2WV9A 3F74A 1U8TA 4Q16A 3DLCA 3GLGB 2X3YA 2E87A 2ZWMA 3FKJA 4XM0A 1EWQA 4KGDA 3OZSA 3KPUA 2VNIA 3DMTC 2O8BB 1WWKA 2HV9A 3JXEA 3EOZA 4NP6A 1YMUA 1NNI1 5CDYA 3WGTA 2BH2A 3SNHA 3V8QA 3AT1A 2C2XA 4E13A 1RI4A 1Y4DE 3EDCA 5AXAA 1KY3A 4QG3A 1E66A 1YQUA 2VRBA 4OF4A 2V96A 1CW2B 3LPLA 5C7LO 1JKJB 2IP1A 3PR2B 3AJDA 1FUIA 2QYSA 5H0IA 4M0FA 2B2XA 1VLQA 5JQGA 4G36A 1YS2X 3KM0A 3N8GA 4G5HA 4C2AA 1TEHA 4ECEA 4HWGA 1I5RA 2AOUB 1RQGA 1HDEA 5I01A 4LJ8A 5FLXA 2JKVA 1DJOA 1JYFA 1KVQA 3MJDA 4KI7A 3AO0B 7MHTA 4DOMA 1IRXA 1G5PA 1T5OA 2IYEA 5DN6A 1AHIA 3I58A 3O47A 5LP6B 3I1IA 2XE6A 4JVOA 2QV0A 1YWGO 4I5GA 2IELA 2XF8A 1EFDN 4YASA 5FPYA 3H97A 1US8A 3FB4A 2NUAA 4FMPA 1IIRA 1FE8A 3UPTA 1Z33A 2XTJA 3A1EA 1P2FA 4KXMA 5IVKA 4FNOA 1C30A 4ENVA 2EEPA 1GGEA 1GTL1 1DDGA 2AOWA 3B1FA 4FGZA 4HG2A 5J2UA 3T5TA 3BXXA 3LUPA 1D6NA 1Z0AA 4W5QA 5LFAA 4MKRA 5CFPA 2DTEA 4DEXA 1E60A 4GMFA 1RM4A 3EQ9A 3NBMA 3TB4A 2GD0A 2WA1A 2OECA 4BVFA 4ZYWA 3R0JA 3ZVRA 4WBSA 2BW0A 1XYVA 2Q1TA 4MW5A 1VSUA 1OBHA 3EA4A 2C20A 2R8YA 1N6KA 3MG9A 5CDFE 2QMOA 3LQ4A 3TCNA 2GXQA 4QPPA 3L7JA 2G83A 1XAJA 3MMXA 1KR5A 2VSFA 3W4JA 1H65A 4JOSA 3MXOA 2FMIA 3E61A 3K16A 2G1JA 2J45A 1OY1A 1UBRS 2QJOA 2ZK7A 3H1EA 1JB9A 3S27A 2VHEA 1G20A 2LXNA 1G17A 5LYJF 5BWMA 2XZLA 3HHPA 4PRZA 3OESA 5JZ9A 2HSJA 4DKJA 3I61A 3JATB 3FGOA 1ECLA 1BHSA 2X8JA 1X7ZA 2VPZA 2AFIE 5A3QA 3WQBA 5I7OA 3PWSA 1ZR2A 1GFSA 3PPIA 4JUCA 2IPMA 4Q19A 4UU1A 3MQ2A 4RKRA 2GXSA 3GCGA 2OA0A 1EHCA 4G4SO 4QYSA 5FLEX 3AV0B 2ODWA 4GLOA 1VL6A 2JFQA 4IIJB 1KYXA 2ZT6A 4G8JA 2Q2WA 4BECA 1E8MA 3LNTA 3ZV7A 1L1EA 3PNYA 3SYLA 3NR2A 1DHRA 2ZR7A 3F96A 4POAA 3WZLA 1MC5A 2EYQA 4URXR 2OAGA 3FCCA 3PEEA 1DINA 4HMPA 5FPQA 2P2LA 4PZPA 4WVFA 1JLLA 4C2BA 3JR7A 2IYWA 1VE9A 4IYJA 4ARAA 4Y2GA 4LJRA 5KJ6A 4TGLA 4OHVA 5DIFA 1M33A 4AO8A 3BPSA 2FOLA 1DARA 1GUDA 2X9LA 3HL0A 4L0QA 4N3NA 4OQEA 5A71A 3UH1A 3KYIB 1QMPA 4TKZA 4BVAA 4ESHA 5JCZA 5JAUA 4CLOA 1CRWG 2ZUCA 4AYXA 3TAUA 3MSXA 4C21A 5A7FA 4G0OA 4UBMA 1B3RA 2LCQA 3C8ZA 4DJ5X 3O4RA 3F7MA 4L73A 3ZIUA 4ZKEA 1NVUQ 5EIBC 2I71A 3FOBA 3D6NB 3BKXA 4V0NA 4ZDWA 1DG1G 1U1IA 4DTCA 3U56A 4W1SA 1C2TA 3UC9A 4YR7A 4FI3F 4RAQA 5BMVB 5KX5B 2I4IA 4M0UA 1UBTS 3ZBPA 3FFTA 1VCIA 4V3BA 3FGZA 2BEWB 3ZNOA 4YV1A 1O3YA 3RAEC 4BAUA 3DF9A 4Y2JA 5DFAA 2NIPA 3SDZA 1F14A 1QLWA 1YZHA 2JIRA 2LNDA 3EISA 4FUQA 3OTOB 1AMUA 2P2ZA 3M6MD 4HGQA 1TM5E 1L3IA 2I03A 1JQBA 3EFBA 4JR1A 3VC7A 3KJZA 4NE2A 1KZ1A 2C8LA 3WWPA 1S7CA 1NZJA 3ZVLA 4CKCA 1CD5A 3N0XA 1BE1A 3MS7A 1WBBA 1BD3A 1WXDA 1CERA 2CFCA 2GO1A 3WOHA 1H2ZA 3RBZA 1E6WA 4IJVA 4EI8A 1ZK0A 1YCDA 5J4LA 5TC4A 4F2DA 2W5UA 3WP0A 4R2HA 5LQJA 3UENA 1NX9A 2IRWA 4HF7A 1KEPA 3O8OA 4YAFA 2JNWA 2OZLA 2YS7A 3BMOB 3EW7A 1FTQA 2YZ7A 1Y6FA 1UKEA 1N32B 3BMQB 1D0IA 2A1IA 4MR9B 1JQDA 4XLTA 1QHHA 1W6UA 3T7SA 2AR9A 3K94A 4GZMA 1F48A 1J0BA 1P2DA 2BN4A 2ZSEA 3NIWA 4MRRA 3PEWA 2WWHA 1EUDA 4CUZA 3BDIA 5IC4A 2NQTA 5EJ6A 4GKJB 2QU7A 5MN5A 5A5GA 5G4LA 1ZGZA 3W3AH 3QIAA 3H1TA 3EN0A 3E2IA 3X1MA 5JJKA 3L7OA 4PZDA 4CCWA 2YXEA 2QTRA 3G0BA 5E7MA 3DYIA 4XM2A 3VR6D 4QBIA 2QRKA 1G2QA 3T94A 4TM8A 3OQNA 1CPYA 5HQ3A 3BGVA 2MYTA 4UAJA 5CX1B 1JMVA 5B7QA 5BNWA 2EWVA 2J3KA 2R1ZA 3OQ1A 4TT3D 1SD1A 4PC3A 4L5YA 4P84A 5ECDA 1P4RA 2PX3A 3C74A 5DHSA 3VU0A 1JH8A 2B6NA 1Z6TA 1YCGA 4LHXA 2QJRA 3W5IA 2PGDA 4PV7A 4QVGA 4CXMA 4UDOA 1JEQB 2NT3A 4BNLA 2JHCA 1DLJA 5EWMB 2XGSA 3IPAA 1DWOA 3UGQA 3KZNA 5SYAA 3V7FA 2QM7A 4R1QA 3G02A 5AJXA 3V8EA 3LY5A 1OFTA 3FSEA 4YHBA 1PYDA 3S2GA 3WFZA 1T1RA 3OHSX 4JI2B 1UP4A 1XOIA 3OHMA 4Z0TA 1NBME 2C77A 2ONZA 4L85A 4RY2A 1JVBA 4B2LA 5ELLA 4DEVA 4FFMA 3B36A 3BEDA 4GDFA 4IPTA 2Q4TA 1UDRA 5AW6A 4B5LA 4CEHA 2R5WA 1HE4A 2VNKA 1OYOA 3KJFA 1Y6QA 2QP9X 1Q44A 4I6EA 4LEIA 2H4FA 5FAXA 4D56A 1R0YA 5KHLB 2NZ8A 1U0SY 4G1MB 1JNXX 2E49A 1B74A 2X1MA 4QUGA 3ZU4A 1KSJA 3HGQA 3WLEA 1FDIA 3G5TA 1YBAA 1MTOA 2OXFA 2EF0A 3GA7A 4WJZA 1M0TA 1RRMA 4K26A 4QULA 2QRNA 4JR2A 5LIPA 1KGSA 3PVSA 3VNVA 1QOZA 4JSYA 3FPBA 2QKYA 2QVXX 5INTA 5JXWA 5AW4A 1EBBA 1ZOPA 2XUOA 4MYDA 2OV6A 3ZCXA 4N41A 3ITKA 3JPYA 4WLEA 1PNVA 4DLZA 1ADCA 1NATA 3ADPA 4OHRA 3DE2X 3TLJA 2FFBA 3KDPA 1O97D 1Z0SA 4ICIA 3BUSA 1ZJJA 3GA5A 4R7ZA 4AG6A 4KLAA 2C5GA 4HDMA 1SJ9A 4LQ4A 2AMLA 3LHFA 4X8HA 4ZOBA 3V8BA 3LBHA 2C3UA 2DWPA 1VG9B 1TC1A 2EW1A 2HFKA 1U7OA 4FBMA 1NMQA 5L3VA 3NU1A 1XZBA 1V3QE 4OL9A 3O8QA 4C9BA 1E32A 1N0VC 4M46A 2EBHX 1B0PA 2JIQA 1NZDA 2XDWA 3CPHA 3LMKA 3ORQA 2PWBA 4V3CA 1YKGA 2ZIVB 4JA0A 4NXMB 1DMSA 2PX4A 2A9VA 4I6JA 3I9V1 3LSTA 4LJ5A 3KUKA 4HHEA 4MB0A 4V24A 2Z30A 4US1R 1KI1A 2BUBA 4WA7A 5A5EA 1B26A 3EF1A 1ISJA 4BRUA 3ZGLA 1O9BA 4LYJA 4U9HS 1NZFA 4B3HA 3ICCA 4Z0NA 2XXJA 4YQEA 1RM0A 3KKLA 3Q1LA 4XPIA 5AHKA 4C08A 2C8KA 1X0VA 3UUFA 3W4IA 1SXHA 4C4PA 4EHDA 2XCSB 1NXXA 1RRCA 3KC2A 3JWEA 3D4OA 3O38A 3K53A 2A5YB 1M1NB 3OEHA 2PZAA 2V7VA 3HKCA 1KYVA 4MPJA 4OHKA 4V0LA 3NKFA 4DAEA 3RSSA 4QUBA 3DXZA 3SFVA 4LKRA 4K05A 1JHAA 3D4IA 4II3A 2Q45A 3E05A 3UTDA 1EIZA 1EP2B 2JA1A 3H0KA 3AHDA 1VSTA 3DA8A 3RYIA 3BH0A 4HLNA 4UHDA 4P0QB 3HZRA 1E6KA 2DFVA 2H1IA 2RI0A 3B6MA 3THRA 3WBFA 3WV5A 3C1OA 2AQ8A 3PNVA 2Q9CA 4RHUA 2IYOA 1GL6A 4RD1A 1GTMA 4DA4A 4QO7A 2ZYDA 2QL6A 4RKYA 1KPIA 4WNCA 3K9NA 1TXGA 1CQJA 2MT9A 1BU8A 4F4JA 1Y81A 4XGNA 2I6GA 4XWTA 5KYGA 4PQEA 4RTLA 2WD8A 1XIVA 3ABIA 3RH0A 2CVFA 3D6VA 2O2XA 3EDRA 3OZFA 4D81A 1B23P 4RPJA 1PSZA 1KTIA 4TMTA 3ETJA 1PTJA 4AS1A 1Y89A 2C95A 2QVGA 4QNRA 5A7HA 4BKPA 4KVFA 4MQ6A 4RD2A 4C4ZA 4ZJYA 2NX2A 3H8VA 1BKDR 5TMBA 5CCEA 3J7TA 3EBLA 3LKVA 3VO9A 1NY5A 5JAHA 1X8JA 3K5HA 3B3GA 1H6BA 4LG1A 3QUCA 1O5IA 1UMDB 2ORIA 3IR5A 4LWPA 1KSGA 2A88A 2VSNA 2FXIA 3CONA 2XYVA 3BTUA 3D2LA 4TMXA 5TE9A 3UA4A 3VOTA 1HRDA 5DX0A 4IMPA 4JA2A 4FHCA 4JQYA 3TL2A 1AO3A 3DGFC 2OFPA 4KPUB 3V80A 1VLLA 1FVHA 1DO0A 3TW0A 2G1AA 3GWGA 1F0KA 4Z9FA 2FLWA 4XD2A 2BGNA 1DELA 3C3BA 3LVFO 1YZUA 3ZW7A 2VHJA 4PTYA 4TSFD 1RWMA 5EZSA 8AT1A 4FFNA 1HNWB 1IWBB 2HGZA 4LF8B 2BZ1A 5T4BA 1IN5A 2B61A 3AL2A 3BJEA 2COKA 3PFGA 4WVLA 3COWA 3S1AA 3UEOA 4ABTA 4TYYA 1YT5A 4CKBB 5GAJA 2D5BA 1IWOA 1LDGA 3K31A 3RKSA 5KYYB 5K8TA 1MV5A 2FB9A 4OD0A 4ZP1A 1AURA 1O89A 3QJGA 5K03A 4P93A 5JI2E 3AZOA 2H8KA 4WACA 2Y1OA 1WX1A 1IEWA 2FZGA 3CUYA 3B6KA 2B1GA 1Y3FE 3C85A 4KSYA 4NYIQ 5DM4A 3TJZA 1XP8A 3R8FA 1M1XB 1FDTA 1TJ4A 5DB4A 1H8ED 4PYNA 1HTTA 3FG9A 2OV3A 2IXGA 3GAFA 1ZAYA 2YOHA 2BISA 4ARZB 3NDRA 1JIKA 3ZQJA 2JLYA 1M67A 3CC8A 3HFJA 5KTOA 1I7DA 2EZ4A 5LZ2A 3ACCA 5TLSA 2DFKB 2N46A 2XHEA 2C7PA 4LNUB 1WHSA 1USVA 2VP9A 3NTLA 2J30A 1SKBA 4DY4A 1QZUA 3DLAA 4HS4A 2R0QC 4JQZA 1MO2A 2JK0A 1A9TA 4KL8S 4Q3CA 5T6BA 2QD2A 1PP4A 2W2MA 1B6SA 4CQJA 3KJNA 5ED4A 1H0RA 3EXHA 2XNJA 1TKAA 2GZAA 2VWQA 2ZI7A 3GQBB 1TQDA 3LXMA 4OVKA 4PGHA 2OYCA 3ZGXA 5BSGA 2QX4A 3AJRA 4E5YA 5FUMA 5FADA 3VAAA 1A8IA 3QQ5A 4NU8X 3PGJA 1QQAA 3QQPA 4G0XA 3RODA 4MICA 4RLFA 3WB1A 1XKXA 4MR8B 3OU6A 2ZDGA 3RFXA 4DJJA 3WWCA 3VPXA 5C3MA 3ONVA 2JD0A 2VHVA 3QV2A 3GVHA 1V8OA 4QT0A 2HIMA 2YRWA 3KDSE 4FYJA 4PO3X 3IJPA 1INLA 2DBQA 3ID6C 1VOTA 5EVCA 1JZQA 5B2ZA 3UV6A 5C5DA 4ETMA 1LDBA 3UW3A 4OKIA 1DJQA 1WCXA 2GERA 3I2HA 1E4VA 4Z49A 2H2GA 3A10A 3KQPA 2QY6A 3CUEF 1NW9B 4KMMA 2F9FA 3WLSA 1GRNA 4JT2A 4MVJA 4OHWA 1BCRA 3SK0A 1EEHA 4YT8A 3MNFA 3TRHA 2GBGA 3LZDA 2MINB 3F6SA 3G2QA 1IUPA 3ONFA 4G8BA 3MGBA 3E70C 4I7EA 4M3NA 5LU8A 3LWNA 2YNMC 2LCFA 5KPJA 2IEZA 2I3GA 1GZ4A 1U2SA 2AI2A 4JJKA 3CH6A 2E4UA 4RVCA 1Q84A 1HEYA 2PIAA 2JD2A 4EF5A 1IG3A 1K8YB 1SOWA 1RLMA 2ATXA 3RBXA 3VZPA 4S35A 3TOXA 1UPXA 3L7KA 1I94B 1BROA 4D74A 4C7JA 1N25A 3R44A 1MOPA 4UOZA 4NVRA 1E3LA 1PJRA 3MPUA 1K7YA 3S99A 2VYVA 2PGJA 3HS3A 3KKPA 2X8BA 4O0LA 1XN4A 1XF1A 2O7SA 2ZYGA 4DSZA 1JDSA 4GL2A 1SZDA 4FDTA 4H0NA 4OQ4A 4LY6A 4N39A 3DWGA 4ZD6A 2EP7A 1KZGB 4A5OA 3FGNA 5HJ7A 3VKUA 1ZOLA 3OF2A 4PZEA 5TQ2B 5D5HA 1UOQA 2R8ZA 3W06A 2O8BA 5CD1A 4IMIB 2V65A 3F5FA 2UZAA 5BPHA 4U3JA 3JQ9A 4DB2A 5L40A 3Q7PA 3H5AA 2VRCD 3W5UA 4NBUA 4BZWA 4OCZA 4P92A 3WZMA 4MAAA 4Q1CA 1EB9A 3VJKA 2F2TA 2WZDA 1ZLYA 2H3EA 1XWFA 2I1LA 1JEEA 3L84A 1L7MA 2EL7A 3F49S 3VX3A 3Q2OA 3QXGA 3IULA 3O2QB 4I50F 5H7XA 5AJZA 5GP1A 2BGWA 4LBWA 1IQPA 1ZUNA 2FDXA 4MJ7A 4XRRA 5GADl 5BNTA 5REQB 4WESA 2FR0A 2R1UA 3WLLA 2A5LA 1DRWA 4A8HA 5HJEA 2ZRJA 3EX7C 5JXHA 2C5EA 4OP2A 5H82A 2H7XA 5GTDA 4GYYA 1YQGA 4X95A 1C0KA 1HUQA 1C8VB 2OEPA 4MV8A 2HEGA 4XM1A 4BO3A 3TLGA 4I4TB 1SXJB 4BFCA 4F7DA 1HDOA 2V7XA 1BA3A 4AW9A 1FLAA 2A84A 2BJWA 2O7RA 3TTWA 3KZCA 2HC9A 3IEMA 1AV7A 2QW0X 1OJLA 1WMAA 5AM0A 1W4AA 1PG5A 1LJLA 4KACA 4K3UA 3D8UA 1KJZA 2YJ5A 3A9SA 3T15A 3T9CA 3IELA 3AQ4A 4II2A 2Y1XA 1CJCA 3TLXA 4C06A 4LSMA 3MUOA 2P3LA 1NMEA 4MUYA 2PG3A 4ZCQA 4YRRA 1JGTA 4YP5A 3I4FA 1ILEA 1BHO1 1G20E 3BSYA 2DX7A 1L5GB 3A25A 2JG3A 4Q00A 1KAQA 1NJGA 1XJWA 1ZA1A 1JEAA 4IIJF 1MAAA 2JAHA 4KAAA 2FKAA 4HDRA 1Z73A 3M3HA 4MA5A 1X1RA 1DEHA 2B1IA 4G1FA 1Y9ZA 1EFVB 1XLVA 4C7OA 2AUNA 2CE7A 1TQ6A 3KK0A 5IAJA 3ZCQA 2BY4A 4EJ0A 2ZWIA 2E18A 3UK0A 4AX4A 4XJVA 5FPPA 4AL4A 2ZTUA 5C5EA 4XGKA 1N8NA 5CHYA 3IE1A 3AQIA 4EUKA 3AP1A 4OBXA 1YMVA 2DU8A 4MWOA 1E6CA 5B5SA 1DEOA 4HN2A 2QP3A 5D1NA 5BT8A 1NLUA 4Y7DA 3GEHA 4NCKA 4OKNA 1NFQA 4JLOA 3SYNA 3VYVA 1DIAA 1XD2A 3EB9A 3T3OA 4N0DA 3L5OA 3O82A 4OHBA 3LJKA 2GN6A 2OD7A 3ZWBA 4XIYA 3DDZX 1CJBA 2PQ2A 1T2CA 2P3OA 2YV3A 3Q4GA 1YRLA 3SBOA 1YK1A 5IVPA 2JLAA 3QX7A 4PFQA 1L7BA 1OUMA 4CLDA 2C4VA 1BYIA 1J2UA 3OWOA 3K8QA 2HLHA 3OC6A 3KVNA 3EVDA 3F8TA 4I08A 4TLLB 3DOIA 2IZ5A 3LM8A 2VXBA 4YY3B 1RCUA 3UMCA 4J1TA 4RIIA 3L04A 5C4IA 3W7AA 4FHFA 4BBJA 3EH2A 2WSSA 1NBOA 1GAJA 1QPBA 5DGTA 2VNJA 4ZQHA 4CIYA 1U04A 4CM4A 2X8WA 3H4MA 1C1DB 3T7IA 3IKMB 4FYMA 4IHQA 3RC2A 4P3NA 5FCDA 2HK6A 3HJRA 5FR1A 1YOVB 3UAGA 4TMZA 2BUAA 2OR3A 2EJBA 4B9EA 2FH5B 1Z7GA 3B2EA 1H2YA 3U4QB 3LFHA 2ZBVA 1HEIA 1N8TA 1ZC3A 3F5DA 4FHGA 4N6NA 4H1WA 1DS6A 4Y2YA 1O9HA 1Z9BA 2JJMA 3TI7A 1UDCA 4BQFA 3UJNA 1UBEA 3IB6A 3FXAA 1ZD1A 4NIMA 5G40A 2PWPA 4YP6A 2C3OA 1KVTA 4LHYA 4ZU1X 1D1SA 1J20A 1JPUA 1L7AA 1SBIA 4HFNA 1SWWA 2NU8B 2YWFA 5EE0A 5I7WA 4B6JA 3L0YA 4O5AA 1S3GA 3LQYA 2PA3A 4YV0A 2VZLA 1Y8AA 1P0FA 2WPDD 3KWJA 1E3DA 1KI8A 2AVNA 1SKMA 2KX7A 4JB8A 1WG8A 3UJDA 4CM3A 2XGMA 3FWHA 4G0VA 1DQYA 2P62A 3AJ9A 3VH4A 1MAUA 1YI0A 3V33A 1XN1A 2FMUA 3D3NA 3QXXA 1PFKA 5I9SA 1LI4A 1H42A 1DKMA 4PHHA 3W79A 4XGQA 1XMVA 2VYFA 4DKXA 3WYNA 3GX1A 3IQDB 4NAHA 3VR6H 4DDVA 3DMYA 3CF0A 4XSGA 5E9JA 3E5MA 3QBVA 4BVLA 1CUDA 3IL2A 4IHAA 5BR1A 3JD3A 4QAQA 1XDWA 5A5FA 2JIDA 3FA2A 2GX6A 4A5SA 1K9VF 3OTWA 1SXQA 1F4VA 3ABSB 3PS9A 4HNGA 4TS9A 2VBGA 3RBAA 4YCNA 2RIRA 3AB7A 1XV5A 4UHCA 4TTQA 1DKUA 4HNHA 4DNQA 1YZKA 1RYBA 2X2PA 3CXUA 2X1LA 5A6SB 1YS7A 4H7HA 1EE9A 5KCMA 3C97A 5E6UB 4YPFA 3OQHA 3TZLA 3OE7A 2C7GA 5E2BA 4FONA 2I6TA 1JI0A 4O8CA 4LGVA 1R10A 4KWTA 2FSUA 2W48A 3FVVA 3PUIA 5JS8A 1PZFA 4QYTA 4GAEA 3KEMA 3EULA 1ZCFA 1ETHA 4Q7MB 3HXLA 1GNLA 2DUUA 2R2AA 1G55A 4NZZA 5JC1A 4ZCSA 5FX2A 3DVAA 2WWRA 2IA5A 4BB5A 3FBWA 2SKDA 2GAFA 1SWVA 4NEQA 1M2OB 1JWAB 3PB3A 3AY6A 2VP2A 2C2GA 2RGNA 3L4BA 1RM3A 3PL1A 4H17A 2RB4A 2X0KA 2NSLA 4ZI7F 3ILVA 1DQPA 1YV9A 1P4SA 3PLRA 1I36A 3GLKA 4MW9A 5DNVA 3RS8A 3VVMA 1I13A 1VGVA 3KE8A 4HSGA 1T9ZA 5F51A 4Q93A 4AN1A 1K8RA 2CVOA 4DQUA 4J90A 4RNDB 2IQIA 1QGUA 1Q19A 1QCZA 2PSDA 2XE8A 5FUWA 2GMWA 3ECAA 3R7WA 4G1UC 4IOMA 4NNPA 1UXIA 1F4LA 1T9HA 2GCEA 4U00A 1U8AA 3CMMA 2QVCA 3H65A 2P4HX 5CCDA 3OCCA 1IIBA 2CCGA 3F7OA 4D5EA 2P6RA 1L7QA 1KI2A 2UVQA 3RSZA 5KYVA 1FPQA 3WK9A 1OE0A 2WKPA 5J2TA 1DXHA 1HSOA 2GEJA 2BWJA 1HI9A 3X1YA 4E3ZA 5JAZA 3CKKA 2ZBFA 1ZEMA 4CL3A 2IEIA 1WV0A 4ZKDA 4LHVA 1IEQA 1YR2A 4FDVA 3BOSA 3LY8A 4D92A 1XEXA 2AYXA 3F1LA 2VOJA 4PBTA 3RJ9A 1TF2A 5FOVA 2XYGA 2Q3MA 3AERA 4JLBA 4QQFA 3V5NA 3RAFC 1M2EA 3HDJA 5K3FB 1T3TA 2V7EA 3PFNA 1ZCBA 5JU6A 4OI1A 2C9OA 4F8EA 2HEIA 2XQKA 2VJNA 4S1WA 1ATZA 1HTWA 3EAQA 4F72A 5AHWA 4I66A 1UL1X 2WQZA 5B4UA 3DLBA 2WPDA 4ARSA 4JVSB 1XMOB 1GR1A 1V2GA 2XDQA 4YPOA 1YB4A 4GOKA 3KZKA 3Q7IA 1WY7A 2FFRA 4PAWA 2E3JA 5EZYF 4BX9A 1E3JA 2CJXA 1V7QA 5DM2A 5FUVA 3HVIA 3T3PB 4NECA 3UYKA 4RJTA 4X65B 1SD5A 1HA3A 1LKZA 1VJCA 4F1WA 3B7PA 4CMBA 2KW5A 1OH6A 3IPCA 3GCDA 1UAYA 3F3YA 3TKYA 4TVKA 4BO4A 2W11A 3IOCA 1M6EX 1YUBA 3QKSB 3IVXA 3R2JA 3U1BA 1IBMB 1L4KA 2JFNA 1IUKA 3KJEA 3AB8A 1LD3A 1VMEA 2R6AA 3C24A 5CX1A 1RPJA 1JLHA 3WYAA 1QUEA 2IZ6A 1T34A 1L4LA 1GNTA 1H93A 1IHUA 2P9BA 2XCQA 4U9UA 5FLYA 4UUOA 1IBSA 4P80A 1VKHA 4MZXA 3SQDA 3WXBA 1S4MA 3DAYA 5HE9A 3EZ6A 3ESXA 4BNNA 1JAXA 3G9TA 4ADSG 4HMOA 4JS0A 3ZHYA 3VZBA 4MO9A 4L8VA 1NKTA 3VYRB 1OC4A 2GN4A 1PNOA 1SUAA 3JRWA 4B4DA 4RF5A 1DTWB 3E3OA 3T3HA 1YZTA 3A26A 4TV8B 1YZQA 3CCFA 2P2DA 2I4NA 1A04A 1NDUA 1X7YB 2MHCA 4MEBA 5ECGC 4EY6A 4JKOA 3L0DA 1QH9A 3IRVA 3KOWA 5AM5A 1N4DA 4B3TB 2HD4A 5AW5A 4DL9A 3OO1A 4PO8A 5IJZA 1PR4A 5BURA 3UUGA 2FNAA 3K35A 3L0ZA 3RVDA 5HIJA 4MP6A 3S55A 4LPSA 1B4DA 1NRWA 3W6NA 3EDMA 3ZDRA 1L5VA 2ISCA 1SC6A 5EESA 4RCVA 4X61A 3EEYA 1FTSA 5DHUA 1R64A 3REOA 1XHEA 1ZVMA 3IV9A 2WUWE 3O2NA 4R4JA 4JC4A 1PFVA 5FULA 3DOEA 3GXBA 4PO9A 2XWQA 3E9NA 1K5HA 2XSZD 4FPXA 1PEAA 4GICA 4CM8B 5JWOA 2B4RO 1JKIA 1XNJA 4CI0B 3DZHA 5AD1A 4DC0A 4NH0A 2IU4A 4B3CA 2P9JA 4QQ8A 2VHYA 2Q3LA 3WYDA 1E6LA 5DU2A 2VH2A 3GLHB 4JT8A 3CSSA 1ZDMA 1SA0B 4JSTA 1FNDA 3SYMA 5JSFA 3A3YA 4XDZA 5BRJA 3ZI7A 4PZAA 2Q6OA 1EUQA 1W8DA 1PUIA 4M49A 5I45A 3MILA 3PGMA 2X0EA 2B94A 1T4MA 4QGFA 3GJ8A 3L0BA 2FW8A 3HCOA 3VR2D 4BX3A 4F9FA 5F4ZA 2I4OA 3Q5EA 2EDCA 3KEQA 3BB1A 3F78A 3AILA 1X9GA 2XKBA 3A4VA 3KALA 3H83A 4L4UA 1TO6A 5M3BA 2A35A 1NF2A 4BE7B 1YASA 4MROA 5BW8A 4RY0A 1FY2A 2YFQA 3QVGA 4TV9A 2FG5A 4LC9A 1NQXA 3KOYA 3A1DA 2QRHA 5EERA 1N2HA 4KNYA 2NAFA 3B9RA 3KSUA 3EEQA 3NW9A 3GUCA 3NKLA 1MVLA 1ZN2A 3R0IA 4MW6A 4DMHA 4HB2A 2Q46A 4BQEA 1H4TA 5EQJB 5IVHA 1VL5A 2DFLA 3IIMA 3ND6A 4ZO6A 3N5CA 3RKUA 5F3RA 2QDKA 3DBLB 1A9ZA 2IS2A 4IHKA 5ALXA 4BFTA 5K6TA 5AUNB 1B6TA 4D0RA 1KOFA 1E9CA 3CIOA 3P2OA 5EJAA 3SD7A 2FAXA 2BKAA 2HM7A 1CHDA 2O07A 4FC7A 5LQNA 3RYIB 4S1PA 5J58A 3CX3A 2BKEA 1E4OA 2LBPA 3WRWA 1OASA 2EKQA 3CUVA 4ALMA 1AQ6A 5KNCA 3QVWA 4GKKB 1S2IA 3KSDO 4OOEA 3K70B 2C5FA 2J3LA 2YVAA 1JHVA 3TGWA 2C83A 2I6XA 2MSLA 2OM2A 1XTJA 1V1RB 1E61A 3BRQA 3E22A 3HUTA 3ND7A 4G9BA 2H4WA 4M0MA 1IB0A 1TPYA 4RA9B 4X00A 3NM5A 1JFTA 1C0PA 3JYHA 3SHFA 2HO4A 3KEGA 2JASA 5BV2P 1ZVVA 3GLUA 1A5ZA 1E5LA 3L43A 2DE0X 2VYVD 3H6HA 4L5CA 5AI4A 2CL6X 1Q21A 4TN1A 4BCCA 2O3RA 4RA6A 4H3SA 4OJKA 3FOZA 2YINC 3A1VA 4IS3A 3O0TA 3GMIA 4UW9A 4FBLA 1ENYA 2VF5X 4K1XA 4IIHA 2YWBA 1NR5A 4J0QA 3WIVA 2GHIA 4YLEA 5KVSA 2WJVA 4UULA 2XCUA 4ND4A 4Q4AA 1N6OA 5I8ZA 3K2QA 4KR6A 2AR7A 1R7RA 2Z5LA 1U4OA 3VU3A 4U2FA 3GRCA 4YDSA 3RYFA 2Z1NA 1L5ZA 2F1RA 5EWLA 3Q8MA 1IVYA 3ZHXA 2EHJA 1L5WA 1QK5A 1B8OA 5IZCA 4UZFA 4WERA 4GPIB 4YGYA 2O23A 5ENVA 5DULA 1CYDA 1UXJA 4WESB 2QAGC 3NHPA 1ENOA 1HDYA 2WSBA 4N6OA 4YLGA 1MO6A 4S05A 3CVOA 3QBJA 4GQAA 2ZJYA 1A4RA 1VCMA 4YRPA 5H59A 1K0UA 4R41A 1CQPA 1RIFA 3LXRA 3RV4A 4F3RA 2B1JA 2EBFX 2I62A 2P1ZA 2LR0A 3NYIA 3PCXA 2YJNA 5E2AA 4QREA 4B2YA 4L2IB 4URFA 4IFIA 3U7JA 1TVKB 1FQWA 3ROMA 3QNWA 1UWKA 1C0LA 2IYAA 4FR0A 2VF7A 1P3DA 1XZ8A 2JEZA 2ZI3A 1KMCA 4DDTA 5AMXA 1DIOB 1KH2A 1MGPA 3GGOA 3PHHA 1ADFA 1J8VA 1YA4A 1W94A 1TCVA 2OG1A 4TRNA 5DTRA 2AKAB 4YJFA 3H2IA 3O7WA 4I4IA 5M2QA 4ZREA 5BRAA 2J9FA 3VNRA 3M4ZA 4MKFA 1H6CA 4MW1A 1K75A 1KDOA 2IP2A 2JF0A 3AJAA 3OZIA 1XAGA 3L79A 3QPBA 3E5RA 2H1VA 2E7ZA 1MN6A 3ROGA 3M6UA 4C6HA 2Y93A 3RYCB 1VSVA 2V9ZA 1W59A 2Y77A 3WRXA 1WY5A 1JBQA 1YOVA 1H8EA 4Z9BA 2YYYA 1N6RA 3HKBA 3DAGA 3EPLA 2IYUA 1ESDA 1AKVA 1BH2A 1DBRA 4KIWA 5F1KA 2O3QA 3HYTA 1ZOOA 2Y0DA 5AUQA 4BVJA 1EAMA 1L4YA 2P40A 4AJKA 4ESOA 3QEBZ 2VEOA 1KQ3A 2A67A 2VPWA 2AHOA 3Q12A 4S1NA 4DR2B 1U28A 4XLZA 1T3GA 3W1VA 4QGAA 4HVLA 3RHTA 4UHBA 4R2JA 3U81A 2HWUA 4Q5IA 4G09A 3T4PA 3ORRA 3CINA 1IMJA 2ZRGA 5G1NA 3WDSA 1VGRA 2W8BA 1QK4A 2YFYA 3V4OA 4BQPA 3H3XA 2FETA 1ZCAA 2XMBA 1CVRA 1ZIXA 1JE1A 3FOEC 4CG3A 4ZAVA 3GUYA 3HCFA 4LXUA 1G5IA 3TH5A 5C46F 1H2AS 2HPZA 2DVMA 1HFJA 2J3QA 4CJXA 2GKOA 1E20A 1J07A 1O7JA 1VKJA 1PS8A 2GJAA 1ISFA 3BWBA 1T8RA 2YC4C 3JATA 5EPUA 2HSZA 1HK7A 1TJYA 2QQEA 1Z75A 2IWHA 4O2LA 2IDMA 4U2DA 1WQ1R 4EW6A 2ZQ5A 2WMYA 3GEPA 1WAMA 4IG4A 2WOOA 3IXQA 4C29A 4V2IA 3HLKA 3S6JA 2AJCA 4GBGA 1O4WA 4DTIA 4ZTBA 2LKDA 1NOIA 3LD9A 3QZUA 4Q18A 1UOOA 3JYPA 4AM8A 5KEIA 4X45A 1I30A 1TZMA 3Q2KA 3GLGA 5DP1A 1ZM3A 4Y6SA 3T5CA 3TJRA 2IUUA 1Q0ZA 3PC7A 1ZJWA 3BL5A 2ASEA 9LDBA 4TT8A 1ZN9A 1QAOA 4BFZA 2ZE5A 4NU0A 1N2OA 2ZVDA 1UK6A 3CX7A 1ZM4A 1R1DA 3ENVA 3SQMA 4JI6B 4EDHA 4US2R 4GP9A 4LS3A 1Y8ZA 3MRTA 4KXQA 4CHTA 1BU5A 4E5NA 2IBTA 3VC3A 1Z36A 1HE1C 3CZAA 3DV0A 4TYQA 5K20A 1EXDA 1V9LA 3WYGA 5HXAA 5DNDA 2ZUVA 4O02B 5JQWA 4KVGA 5CLGA 3RIYA 4B2IA 2OQRA 4GI2A 3HR4A 2NNWB 1DLIA 3A9UA 1XELA 5BWNA 3R7SA 2UZ0A 1RPZA 3NETA 4ENSA 1TAUA 1GFWA 1OTXA 2VJCA 2XDAA 3HZOA 4I1OA 3OEHD 1T5BA 1TA9A 1EVYA 3C5VA 3KAJA 4ZAWA 2AFIA 3U9LA 3FOFC 1EFPA 1TTTA 1WTCA 4CF6A 3I53A 4IDGA 2WIAA 4FE4A 3Q1KA 2BKUA 2I7CA 2JFFA 1VZ3A 3E7XA 3WLKX 4DR7B 3EXEA 2Z9BA 1T10A 1QQ5A 2L82A 4UDNA 3UMFA 4EFNA 5C8ZA 2O2YA 4WT7A 4DLBA 4B3IA 2OBYA 4EB6A 2J5XA 2NXCA 3KD2A 2PRJA 5LOVA 1ZK1A 4OFZA 1JRLA 2LE0A 1NY6A 4P33A 5G0UA 2FX5A 3PJGA 5FIUA 1WUHS 3VH3A 2YXLA 5I7UA 5BO5A 2CHFA 2ZB2A 1LNSA 4M0EA 3B1YA 5JECA 1XPJA 4RDCA 5FTWA 3K6SB 2P27A 4EOGA 1E6UA 2ZUFA 1WZNA 4ER7A 4CKZA 4N0EA 3SR4A 3W3ZB 1Y3BE 2APJA 1N5IA 3H3FA 2HIGA 5A9TA 4RGYA 1ENZA 2HA6A 2NUTB 4O3FA 2JFZA 1EE1A 2W7TA 2XZTA 4X6YA 3M70A 3NTOA 4EB0A 4DV2B 2BEVB 4YVFA 2ADMA 3SZMA 2WKSA 4I99A 4CT0A 1BDMA 1KZ6A 3BMQA 3NVDA 2WIJA 1KAHA 5AKHA 4CR8A 2H54A 1L7NA 2YIDA 1Q3KA 1TKRA 3BWXA 4L15A 4MQMA 4JC0A 1GILA 3L0CA 5K09A 1KQOA 3IVAA 3L8DA 4QYMA 2PH7A 1I4OA 2CJWB 3QLUC 4H7EA 3QYJA 3TI9A 5AW7A 1BXRB 2A3NA 2ZBGA 3BMCA 3THXA 2AWOA 4OI4A 1KPHA 2BFBA 2OO3A 4XWAA 4DMCA 4NBKA 4B4KA 4FQ5A 4BKMA 4DWOA 2Q7OE 3E48A 3EEFA 3IKJA 4G5OA 4FE7A 3U7RA 5C32A 5JD6A 2JHPA 3G6WA 4C2UA 1T9BA 2RHGB 4KQWA 5HIMA 1Z29A 3PP8A 1O0SA 2CHEA 4OU5A 3X1KA 1AQYA 4TWAA 5G3YA 4EG4A 4IUCS 2NLOA 3RVBA 2PQ0A 1J24A 7ABPA 3EXG2 4I6GA 4OAQA 1RCTE 4RZHA 4YJGB 5DNWA 4ZT5A 5FKJA 2HDHA 5DCLA 5H1YA 5HZMA 4AYTA 3AL0C 2P5TB 2CMDA 3K0SA 1AE1A 3BK2A 2VPYA 3C87A 1KDTA 4X3CA 2X15A 2YWCA 1ZK2A 2Y0CA 4YH1A 2IHNA 4DNPA 2FX3A 3BGSA 1X7XA 2R68A 1QIFA 3NUGA 3U3KA 4E7OA 2H2WA 3AVYA 5DRTA 4IIEA 1U2PA 3D81A 3OX4A 4KQ6A 4IDHA 1AKYA 1AVTA 1PT5A 3GFSA 1FQKA 2BM0A 1NVVR 2PZMA 2V6GA 1C1YA 2D3TA 2TSYB 4WMLA 4BGUA 2W42A 3PLAE 3BN3A 2VPIA 3DAPA 2VN8A 3ENZA 1T35A 2ODPA 4FE3A 4D43A 1RIIA 2NOAA 1THMA 4EUFA 3C4VA 5HP4A 1Y3AA 9MHTA 3T9DA 4HQLA 3H87A 4BTVA 3VR3D 2XOKD 9ATCA 3BK1A 3QOYA 2D8MA 1XDBA 4QFCA 2V4ZA 5K8UA 3H5OA 3MRSA 3IT1A 3HXKA 3QEKA 2EKZA 1N3IA 3HJNA 1GPDG 3PG5A 3MYYA 5JZSA 1QX4A 5CDUA 4XTRA 4PC6A 2OGTA 3EIFA 4QM7A 2J8ZA 3O4HA 2IGBA 2GAOA 3M5WA 1YE5A 2B4KA 3WXMA 1VFPA 2O2SA 2ZE6A 4D0LB 3DB1A 4O2AF 1CDZA 2NN3C 2NWQA 1KK1A 2BZ0A 3G2KA 3M2PA 4W99A 5EUQB 4KR7A 4GL4A 1X74A 3QU2A 5IAOA 2WINI 1B43A 4YCDA 4ZAYA 3VBCA 3NPAA 4MA0A 2LKCA 2I4MA 1F5NA 3EZ2A 3OE5A 4HH1A 5LZ8A 5A06A 4RTSA 1Z2CA 1K4YA 3GJXC 2UYGA 1IAQA 4HLUA 3LXXA 1AKTA 3HJHA 3OTHA 5KVVA 1TF7A 4BKOA 3CZQA 1JB1A 4YMGA 3TOSA 5IULC 1KIMA 1CEXA 2ZIZA 1I4TD 1A96A 4RVSA 1FFAA 1SHZA 5CB8A 13PKA 4R8KA 5CK4A 3II6X 4OJQA 1OFUA 1UQTA 4I4TF 4A26A 4LECA 4E22A 5JPDA 5EJ4A 2FQXA 3TLEA 4EJMA 2X0DA 5KAMA 1XI2A 4KYVA 4Z7NB 5EE9A 1CUZA 5K1ZA 3PXBA 2IOHA 5DLPA 2ZS7A 3D6JA 3FPKA 3N6VA 5CBKA 2JD1A 3L8MA 4YAUA 3SXUB 5E2IA 2ADFA 4F7WA 2CY0A 3VJLA 1DOAA 3KQSA 2FSSA 4BFUA 5BW6B 4CEJA 5C7OO 5JPIA 3HKEA 5AVTA 3UHFA 4MXDA 1JEYB 1UANA 2EF1A 1TOAA 4AZSA 4IFEA 4P34A 1XCBA 1KF0A 5ECYA 3TQTA 3RJTA 1KP2A 1TNDA 5KVAA 2V7TA 5CT6A 3GLIB 5B2FA 4REQB 3ZZTA 5CYPA 1VXOA 5B58T 5AOBA 1E2NA 3IAFA 2I29A 2W22A 2HJWA 2JRLA 1EZZA 2Y3IA 3LCCA 4OK5A 1QU3A 1XQ6A 2GARA 4ZQIA 2L18A 2M9MA 4OXYA 1PJLA 2BMEA 1W5BA 3NHWA 3R7FA 4E07A 1C4KA 3IX7A 2G88A 3C6XA 4IVRA 4I4LA 2P6MA 2VBCA 3AUFA 4RDHA 3I5XA 1EJ6A 2Z1DA 4G89A 1KYTA 3KQWA 2MCFA 2DHRA 3LDHA 1P0CA 2FK8A 3M4YA 2D59A 4GMDA 4P5DA 5GVRA 3DFFA 2PH5A 3A58B 1WU7A 2MSEB 2ON6A 3FLBA 1X1BA 3HKCB 3K0FA 4FDLA 1CVLA 1LF5A 2KHZA 2X0IA 4O8ZA 4D3XA 821PA 2CT8A 1M0EA 1DSSG 3ILHA 1K9SA 1NI5A 4TROA 1VIMA 4OQMA 2IEYA 1RAGA 4X7PA 5DCYA 3SC2A 1CULC 4OQZA 5LXTF 1MB9A 3QKSA 3PSHA 1F8UA 3CM0A 1WUYA 1CZLA 1TJ5A 3ABZA 4FIZA 1Z63A 1HFKA 3F90A 4AUKA 3AEUB 4J7XA 2VWHA 5JRZA 1OLSA 4DPLA 1C5KA 3LUKA 1IVSA 2H1SA 2Y68A 1X92A 2C29D 1WD5A 4WOBA 3W1WA 1G21E 3O9VA 4P08A 1MRNA 2J33A 4IV8A 1W8IA 1YZGA 4I1IA 4Z2YA 2AMJA 2WJPA 3DMDA 2XUFA 3HB9A 4K6CA 4AS3A 4CG2A 2AFHE 4W63A 1VM6A 3V34A 1LW7A 2Z8YA 3LHSA 5K2MA 2NW6A 3FGPA 5JEEA 2NSHA 4QECA 1ESNA 3EVCA 4FINA 4PX3A 4EAQA 5EIXA 1QS0A 4LJAA 1PZNA 5ALUA 3E82A 3G2HA 3HBMA 1VL0A 2EATA 5AICA 2XTZA 1Y1QA 3DC2A 1STOA 4EQ6A 1W4BA 5LKAA 4NHEA 5TX7A 3TQIA 5CXSA 3P7MA 3SF0A 1HT1E 3EZ9A 4H6VA 1KEZA 1WRBA 3EQ6A 5KUTA 3QOFA 4FD2A 1P0MA 4YO8A 1TIBA 4TRJA 3X1JA 5I9MA 3ZHUA 3W04A 3M3DA 4HX9A 1YFKA 4E88A 3UIEA 4GYKA 1PL0A 3F6EX 2HCJB 1QYWA 5C4GB 4ZAGA 5P21A 1L5LA 1BWPA 1LPMA 4N5HX 4Q3BA 4Y9TA 2ECPA 2R8BA 3GLIE 1Q5PA 3ORHA 4TV9B 2QN9A 3QUBA 3EF3A 4F6LA 2PR7A 2J5RA 4C4OA 3QX9A 5HUQA 3PHCA 2XNSA 4W1QA 3A27A 4BUJA 4Z7OB 3GBPA 4C3VA 4TWBA 3RUHA 4G4SP 3TOCA 1JBKA 3NT4A 1GKUB 2PXHA 2Q28A 5L3QB 1A0OA 4DV5B 1IK6A 1IQRA 1GZ3A 2ID8A 3IESA 1EVLA 1JHZA 3EFOB 5EJ2A 1U31A 1QO7A 4QL3A 2ZT8A 4JENA 5DK6A 3R1IA 3NHFA 1VPDA 3BORA 1JSZA 3ZWVA 4J7CA 5G0WA 3P9YA 4KR2A 4MIKA 1DRKA 3N0WA 2EWWA 3JRXA 1K7FB 4KV9A 4N1AA 4LF4B 1RJEA 3OQ6A 5EMKA 2COUA 4H27A 2ZSDA 2QIPA 3AUJB 4RLHA 4XAQA 3RQSA 4CVNA 3T9FA 3ORSA 5K0JA 3LRTA 3PQ5A 3RR2A 1OMOA 4D9CA 4QBKA 2NQ2C 1GGHA 1XSEA 2P3QA 3I73A 4CL0A 1JTEA 3ZUGA 4ZTZB 3HJCA 2W8BB 3IFSA 3OX2A 3FKSD 3OOJA 1ZIOA 3PRHA 3PE3A 4Q3AA 3DO6A 4KH1A 5CIQA 3LP6A 1G3MA 4ZT7A 1L5OA 3A2NA 1H3EA 1PVOA 1K5PA 2NT4A 3EXFB 2MOKA 4NV1A 1R4MB 1XRNA 4TSKA 2DPGA 4AJ9A 4FW9A 1OFUX 5LJLA 2Z5GA 3A11A 2QW8A 3OJCA 3CUWA 3WWOA 3U9SA 3LWBA 1C7QA 1JA9A 1HKHA 4M87A 2J7KA 1QTRA 1U0RA 1CJVC 3VAYA 3ZUPA 4D0SA 4CM5A 1VHWA 4RX1A 1YTLA 3DTYA 3EIWA 1GU7A 1SNYA 2IH2A 1RADA 1ZI6A 4I55B 5F1PA 3UAXA 1H4VB 5B3LA 4DV1B 4JUBA 1N2XA 4LTDA 2BFBB 2FW9A 4GPZA 2O57A 3GJQA 4ALNA 4LBZA 4UFOA 1Z83A 5EXXA 2J41A 3STHA 1CQJB 4B75A 3AXSA 5F3DA 3EIQA 1N6HA 1YHNA 3KHSA 4UHEA 5HF5A 5K7SA 3C3KA 4MQFB 3B2QA 4UMEA 2IHYA 2QTNA 2BL4A 2ECQA 2IS6A 2F00A 3CGWA 4ZO9A 1VZ2A 3ONWA 5IZCC 3VOBA 3D8NA 3BJZA 3QP9A 5TQ2A 2QF7A 5D3MB 4ZT2A 2XB4A 5AWFC 4H1TA 3L92A 5A9RA 1U11A 4PBSA 2R86A 5IH7A 4W1RA 2F43A 1SY7A 4X6UA 5JANA 3U44A 1CB7A 4AF7A 4J94A 4RKWA 4XVUA 4PZCA 4TOIA 4M1MA 1CIPA 5ADHA 4DBZA 3VZQA 4G4IA 3SI7A 3GZJA 4MO2A 1VP9A 4B33A 4KGZA 1FEZA 4N48A 2GK3A 2XGGA 4H35A 3MIIA 1GPUA 1HFEL 4GDMA 4LY0A 1QIIA 3ELDA 3QJYA 5LVAA 4U5XA 3IMKA 4FCCA 4G5GA 2FWBA 1NW3A 2XQVA 3MWJA 3PQ4A 3Q9UA 3ZYZA 2HH9A 5JBNA 1LDYA 4WAUA 1SB8A 2MSKA 1QVAA 4OHZA 1WMSA 3LSYA 2HQOA 1XZFA 3DLIA 4OMUA 1GPJA 2GK4A 2DM6A 1WP4A 1W88B 2E1RA 2H1WA 1IVNA 2R44A 2FZLA 2W98A 3GGCA 6YASA 4CHGA 3R3JA 4JFRA 5CM8B 5J5VA 6REQA 1GUFA 3E22B 1NQ5A 1RTKA 4NH4A 4RAOA 4EHKA 3DM5A 3AM5A 3W5SA 5AHXA 1JECA 2JJ1D 1KBQA 5JH7A 3O8CA 2F1HA 4GSYA 4M37A 1Q22A 3AUSA 1G16A 2JLVA 1PK8A 3N58A 1OWOA 3OZ7A 4HWKA 4JJZA 3HU5A 4DCMA 1C30B 3AV3A 5K4HA 3CCBA 3L77A 3OH8A 5TNXA 5KWEA 4MUEA 5EG5A 4HUQB 1T4DA 1D09A 2WTXA 1J2JA 1VHDA 4EYSA 1XRLA 2Q3BA 2OCPA 3R7AA 4PWZA 5JDCA 2CGEA 4ZAZA 1FF9A 4MI6A 2EW2A 4LJ4A 5IABA 1WM1A 4OB6A 4ZVRA 5THKA 5JIBA 1TUBA 4RORA 4N49A 3BILA 4B8ZA 4C4SA 3S40A 4JLUA 3FDXA 4DHWA 2ZREA 4NBSA 3SLRA 1E1RA 1HYGA 4O08A 3RRNA 1XJ5A 2M32A 1O08A 2X2OA 1TZKA 2CVQA 3AFIA 4O0MA 1GVHA 1H66A 1CY7A 5IHXA 3DDCA 3TRFA 2KM1A 2YUTA 2VO1A 3QMMA 2RHMA 5JNSA 1OT5A 5DHPA 2HHLA 4HZIA 4NZPA 2PRYA 3CNOA 1M8PA 3BA1A 1E99A 4M83A 3P9RA 1JR4A 2GFQA 2I3DA 1H3FA 4HYQA 2GBLC 3HTXA 4BAGA 3MGCA 3ZTWA 3HCPA 2GHRA 4RABA 1E2LA 2QM3A 4QSHA 1XTPA 1UBUS 1ZLXA 4Q7EA 5KDLA 4A03A 5FPKA 1T5IA 3WLTA 2EQBA 1HE2A 2EHDA 2YW9A 1M10A 1OXMA 3UGTA 1IPEA 2JI9A 1JLSA 2R79A 3D5EA 5GY7A 3P8ZA 3UKDA 4WN3A 4B8YA 2PUDA 4RYDA 1HL3A 5D86A 2O2IA 1M5UA 5K8CA 1E0KA 1XT6A 1XX6A 3IP9A 2DG2A 3THOA 4DN6A 3NIDB 4XVQA 3ZZ1A 3DEIA 1A5SB 4NCNA 5UKDA 4CMHA 3TUZC 1NM5A 1LDNA 2AUTA 4LSGA 1QU2A 4BBZA 1URPA 4JCOA 2BZSA 2FGJA 2QX8A 5JMOA 2QBYA 3PGVA 1IJBA 1JH9A 1YR1A 2X9QA 1CZOA 5KOJB 3QXHA 2NTEA 3VH2A 1BH6A 1R37A 3G8DA 3JYNA 5DLEA 5FP0A 4NDNE 2N1MA 1GZ5A 4NMWA 1DCMA 1Z4NA 2AD1A 4DXHA 2LCIA 5BQFA 4BS9A 3ZY3A 3PXGA 1N1GA 3B70A 1W0CA 3IUNA 4XOIA 3H8JA 4MUAA 4H15A 3AGQA 1SC1A 2NVWA 3AUKA 1U7DA 2I66A 1NAHA 3TXYA 4E21A 2QW1A 5HKOA 2ZULA 3IT2A 4LOJA 2BGRA 1ULUA 2VLIA 1QHHB 4R98A 3AETB 3TD9A 4DDMA 1JG3A 2A5FA 9ABPA 1KZ4A 3GYGA 4L7QA 3O8NA 1RXSA 3CX6A 1WIWA 2GTHA 4Z1MD 3FPHA 4B48A 1XD8A 4G8CA 3UAVA 4FYKA 2HZBA 3H2KA 1MX3A 2ZANA 3JD2A 4NC9A 1W9MA 1E1CA 1VBMA 5AW9A 3S4YA 1ODIA 1Y1TA 4NBRA 4OBWA 2IEGA 4MVJF 4H2DA 4Q4HB 2O0HA 3BERA 1QRSA 1PW7A 3G5UA 1RYDA 4RETA 3DONA 3AWIA 1DV1A 1ZMXA 4FFBA 4F3YA 3NV9A 4DQVA 5ITVA 1H0SA 3LP8A 4W5JA 1F51E 3OEWA 3P0IA 1HNXB 4OLHA 1Y8QA 1GVNB 1JG4A 1NMZA 2NV6A 3UA3A 2G5TA 5H02A 1B0UA 1S2MA 1SPBS 1Z7EA 2BFOA 2TMKA 4DYDA 4KO2S 5KJCA 3A6GA 5L4NA 3VM6A 4W5RA 4Z53A 2WHPA 1DOHA 4PONA 3TUJC 4BWGA 2X23A 1N4AA 4ZIRA 5HDQA 3JVVA 5D85A 2FWAA 5L51A 3PK0A 3ODPA 1EINA 4JLNA 3GFBA 1Y98A 3TNDA 1F2UA 4M76B 3LQKA 3D8BA 2K6GA 2BBTA 2CW5A 2PKQP 4KR0A 4P82A 2X0NA 4L78A 5C1DA 3VR4A 4QO8A 3ZCRA 3I2GA 4H3KB 1IY1A 4QOGA 3QE2A 3GGJA 3EXHC 1WHTA 4JN6B 4R69A 2F3UA 2V97A 5JNTA 4CMJA 2XITA 1XHLA 4LMPA 3QH4A 1DUSA 1DAEA 1I3MA 1RMYA 2X77A 3OBIA 5CRIA 2VT6A 3PC6A 4QQNA 5F9MA 2PEYA 3QUAA 4GH5A 2XRMA 1QQ6A 4OJMX 1FP4B 3W90A 4F11A 3X1DA 4OXIA 3JZIA 2QN6A 3ZDQA 5ALNA 5BQXA 5DNUA 2FCRA 5CHEA 1U2GC 3RVKA 5IKMA 1EFUA 4ND6A 1T25A 2QTCA 3HJFA 4LWQA 1RBZA 1WDTA 2JA2A 2MR6A 3KR9A 4OAPA 3BIFA 4F4IA 2C97A 2H08A 3RKRA 1IATA 5LIRA 2FW6A 3IP7A 5LMUB 5LA6F 4JMPA 3HL4A 5IYZB 2H07A 1O0BA 3ANNA 3DZBA 2B0CA 1OYWA 4O6VA 5A4MS 3QY0A 1JXOA 4N18A 1MZPA 3K20A 4I3FA 3AI3A 2DRIA 4GI7A 3MBKA 3E6AA 2UVPA 1UP7A 1UZUA 3CZ5A 3DE0X 4F4CA 3E8MA 4KKVA 1GG8A 3B3FA 3PUWA 1D1PA 4I9GA 2PUWA 3T1NA 3KQNA 5DTQA 1EZ1A 5H70A 2XWJI 1OOEA 2XYQA 4ENTA 4C88A 4RKFA 2X1HA 4DV0B 5LUBA 3IALA 4RZXA 4RIFA 2GCPA 4H7FA 5I9BA 1UBMS 3ZKWA 3JD1A 4YT5A 4BJ1A 1KKMA 3PXUA 3DZCA 3TSYA 4LE0A 2BHNA 2HLNA 4PAMA 2FZ5A 4RSMA 2A0UA 4BO8A 3NYWA 3IE0A 4PWYA 1RM5A 1TM7E 1ZH6A 3S68A 5J2UF 2FZ4A 2E9SA 1CR4A 5JWRA 2B8WA 3FMPB 4XX0B 4PN7A 1TCUA 3N5KA 3PJFA 3ULKA 5F21A 2P9CA 2H52A 2V7BA 1Z4MA 3N7AA 3P52A 2WSSD 4E6PA 1U65A 4R8LA 4UTNA 1SUCA 2IF0A 2PHZA 3B6JA 2O52A 1KYZA 3CNHA 3FLEA 4L22A 4URHA 2ZT5A 1ESCA 3CZCA 3OTIA 4EHIA 3E3NA 1H2RS 3CO0S 4JUIA 1K6EA 2QUBA 5CJJA 1DV2A 4Z4HA 2ZRKA 2AEMA 1DEAA 1P7PA 2FN3A 5TF4A 1JJFA 3M49A 3BTOA 5FQNA 7YASA 2O8CA 4IDNA 3OO0A 4MARA 4WADA 3WK5A 1Y1SA 2HXYA 3R8CA 1FNMA 3BM5A 5CA0A 2Y66A 1X77A 3RUPA 3AFHA 1BXRA 3NTUA 5D3KA 1QYCA 4CPDA 3LRPA 5K3OA 4Z3OA 1RJ9B 1LQ2A 4MV5A 3LT4A 3Q6IA 1MO5A 1VA4A 2VK4A 5AVZA 1IDN1 1M2NA 3I45A 4JBNA 2GO7A 1WZEA 1ZJ6A 2Q6IA 2C96A 3ZHQA 4HWSA 2EEZA 1BXKA 4WINA 2HPVA 3BCUA 1HMYA 4RIGA 2G5CA 3GNSA 3OCVA 5IBQA 1SXGA 1FTNA 1O6FA 2EFJA 3M1AA 2HY7A 3GK3A 2QWXA 4E46A 1E2GA 5GOTA 1KQNA 5KIAA 2W90A 4C6TB 3UM9A 1YBFA 3HP7A 4GM0A 3G2NA 3K7EA 4A8JA 4NSNA 3Q9SA 4R0NA 4MTLA 4D8VA 5HW0A 2Q4RA 3AUAA 2CMGA 3W05A 4PR3A 4D26A 1PF7E 4EKNB 1AB5A 1YCHA 2HCFA 2YCBA 1QAQA 4RL4A 2IV3A 1Z6ZA 2VZ9A 2GZ3A 3NCTA 4NFLA 3EFOA 1XNGA 2VATA 3FCUB 4FHZA 4LDNA 2Y2VA 4NNJA 3KT3A 4EGFA 3J7AC 4IG9A 3LCJA 3E4DA 4P4SB 4XR4A 4F5ZA 2BMFA 3IEUA 5JY1A 1NWCA 1OAAA 1LK0A 1K7EB 3SHOA 4A15A 4A36A 2O50A 3LL4A 4WGGA 1K86A 3ANMA 3OA2A 4AMVA 4PTZA 1A2BA 4RE5A 3GUHA 1XZAA 2P9YA 4KXFB 1GLNA 1AN9A 2YQZA 4OBBA 1W5EA 3N2NA 1QTQA 3DFUA 2DF8A 2VK8A 4MR7B 3RAPR 3ZW8A 5M29A 1Q2XA 1J42A 1LUAA 3S1AB 1YZVA 2I7XA 1CKEA 3KKZA 3O4FA 4FILA 4PLCA 2FQWA 1XTTA 1FFBA 4I4TA 4MUIA 5TJHA 3QMPA 2GCOA 1GUAA 3HZHA 1CLEA 4INAA 4P58A 1RS0A 2GUWA 4LSWA 4U2GA 2W6PA 2O6HA 2WAYA 1MVNA 1XBTA 3ETGA 3TQQA 3GZ4A 3ISTA 4V0SA 3AZPA 5B1DA 5LYJB 1YA6A 1FFEA 2C9MA 1IOVA 1GIAA 2XNKA 2WE7A 3DEKA 4G1BA 3R5FA 2CJYA 3MTIA 2EX0A 3IAS1 1TK9A 1XG5A 5ICGA 3VRHA 4QJ3A 4YJ2A 3CNEA 1OBOA 3FCSB 4FD3A 4R1MA 3O8BA 1AK9A 2HRQA 1QO0A 4KN9S 4EHNA 5K45A 1U1DA 2RARA 2QLBA 3QOWA 4OJNA 3H1PA 1HR0B 3IGFA 5JZOA 1TT7A 2PWZA 4KXYA 1P39A 4S0XA 4BNVA 3C14C 4RACA 2YR0A 1ZD8A 4MTCA 5EFOA 4D9JA 1VPLA 4NCJA 4GPAA 1GN8A 2ZTLA 4Q4DA 1UWVA 4ZOCA 3CKMA 1Q74A 4Y1EA 1KDPA 3C41J 4QU5A 4EIWA 2OUIA 4RV4A 2CHQA 1WEKA 3ZWOA 2E5WA 2D0DA 5LQAA 1ANKA 1FTGA 1XAHA 1Y7TA 1ZM7A 2FJ0A 2J5KA 2UV8A 3DUFA 3NT2A 4RVGA 3V9PA 5L9AA 3I5YA 5TMEA 3GMSA 4RVHA 5LP6F 2ZB4A 4HZUA 4GKVA 3IO5A 1A7AA 2GTIA 1JMYA 4YUXA 1TTQB 3D6HA 1FVXA 1SKYB 1BQ4A 3F5MA 4JIMA 4A73A 5JS6A 3OPNA 3DPSA 5CEJA 2WB2A 2WYIA 1DX9A 3E7FA 2WP0A 4MUHA 4TXHA 2B36A 5KTYA 1TJPB 5JALA 1ZN7A 3GLRA 5D6NA 4DIOA 4JT9A 4XPZA 2XEXA 1HXHA 2VPQA 4YRIA 3BL6A 1FNBA 3GPDG 3NWEA 1T0IA 4I9HA 4GP6A 3AHJA 2GF9A 2MJLA 4P1ZA 4JLWA 2YXPX 2I33A 1NE7A 3LCRA 1LXCA 4L9WA 4WFJA 3QUSA 2AD5A 4RJLA 1V6CA 4FYHA 3PDHA 5KTPA 4JYMA 4DMGA 4Z8YA 3CF4G 1HC7A 1QS0B 3OJXA 3QMWA 2HU8A 4LYGA 2IITA 2Q6TA 1X2EA 5KVCA 5HHTA 3COZA 5HF6A 3UT5B 3UAOA 2A9FA 4OG2A 4YIKA 3UB3A 3E1SA 4INJA 1SU6A 3LPNA 4QM6A 4U7WA 3IDFA 4FT2A 5G41A 3H1GA 4L4ZA 3TM4A