4QPGB

Crystal structure of empty hepatitis a virus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
204
structure length
204
Chain Sequence
GASYFTSVDQSSVHTAEVGSHQIEPLKTSVDKPGSKKTQGEKFFLIHSARWLTTHALFHEVAKLDVVKLLYNEQFAVQGLLRYHTYARFGIEIQVQINPTPFQQGGLICAMVPGDQSYGSIASLTVYPHGLLNCNINNVVRIKVPFIYTRGAYHFKDPQYPVWELTIRVWSELNIGTGTSAYTSLNVLARFTDLELHGLTPLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hepatitis A virus and the origins of picornaviruses.
pubmed doi rcsb
molecule tags Virus
molecule keywords Capsid protein VP1
total genus 28
structure length 204
sequence length 204
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qpgB00
4IV3B 1AL23 1EV11 5L7OC 3VBRA 1ZBA2 3JD72 5BNPC 2MEV2 2PLV2 4RQPB 3ZFEA 1ND3C 1QJX2 1ZBE2 1RUF2 1FPN1 5LK7B 1QJU1 1W39A 1RUC3 1FOD2 4N43A 2R042 5C9AC 3VBHA 2RS31 4RS5A 3JBG3 4JGZA 4Y5Z0 5J96B 1AL22 1VBD1 1H8TA 1PIV2 1RUG1 5CFDB 1Z7S1 4QPGA 2HWC2 1ZBA1 1POV0 5GKAC 1BBT1 1RVF1 3TN92 3VBSB 1OPOA 3VDDC 5D8AC 1AR83 1F8VA 2R063 1QJZA 4FTEA 4AEDC 1PVC1 1FOD1 2RM21 1QJU2 4CEYC 3VBUC 2WFF1 5ABJA 1NY71 1VRH3 5DDJ1 1VBB3 1FOD3 5ACA1 1ASJ2 3ZFGC 3VBHB 3VBFB 1Z7S2 3VBHC 5DDJ2 4LLFA 1VBD3 2BFUS 4IV1A 1PO13 3LOBA 1RUG3 4Q4V1 2BUKA 4IV3A 2RS53 5FOJB 3VBOC 1FPN2 1BEV3 4GMP1 4FSJA 2HWF2 2WZR1 1MEC3 3ZFFB 1AR93 2HWE2 2XBO2 1RUH3 4YVWA 1FMD1 1HXS1 2QQPA 4QPGC 4GB32 1V9U3 5DDJ3 5CFDC 4Y4YA 2R072 2RS11 1ASJ3 5AC92 1MQTC 4N43B 1D4M2 5K0UB 1R082 1ND2B 2ZZQA 5BNPB 1VBC1 4IV1B 2IZWA 1K5MA 2HWB1 1RUG2 1RUC2 1NCQC 1PIV1 2R062 2HWF1 4QPIC 1RUF3 1RUI1 2HWB3 5D8AA 4CDUC 5D8AB 3DPRB 1H8TB 1X33A 3DPRA 1RMU1 5K0UC 1OOPA 1RUH1 1AR63 1RUI3 4RQPA 4WM8A 3ZFEB 4CEYB 1TME3 1AYN1 3VDDB 3HAGA 2HWD1 1RUD3 1RMU3 1R083 2R061 1BMV2 2RMU1 5ACA2 1AR71 1RUD1 5C9AA 1QJY3 1QJX3 1VRH1 5BNPA 1QJY2 1NY72 1HQNA 4CDWC 2RMU3 4CDXA 1VBE3 3ZFEC 2HWF3 4RQPC 4GH4A 1ND3A 1PGL2 1ND3B 1PIV3 4Q4W3 3J8F2 4JGZB 1RUF1 5FMOL 4JGZC 3DPRC 5C8CB 1D4M3 5BNNC 5C4WB 3JB8A 4IV3C 2PLV1 1BMV1 2R073 1QQP1 1NCQA 1VBA3 1HRI2 4RFT0 3J8F1 2RM23 1ZBE3 1RHI3 4QPIA 2DF7A 4GMP3 2RS32 1C8NA 2ZAHA 4RS5C 2HWE3 2XBO3 1R093 1MEC2 1IHMA 1RHI1 1OOPC 4NWWA 1B35A 2FZ1A 4CEWB 1FPN3 4WM8C 4Q4W2 5A32A 1ASJ1 2VQ0A 3VBSC 1AR62 2HWC1 4GH4B 5AC93 1EAH2 1RUC1 4GH4C 1TMF2 4Q4X3 4WM7B 1VBD2 4PDWA 2WFF2 4RR3C 1C8M3 2RM22 2RR12 1H8TC 4Q4X2 4AEDA 1VBA2 3VBOA 5BNOC 1RUJ3 2WS93 1VRH2 1QQP2 2ZTNA 4FTBA 1QQP3 1VBA1 3ZFGB 3TN91 1E57A 1RUJ1 2X5IC 1AR81 1R092 1RUE1 1TMF1 1B35B 1PVC3 4CEYA 1PO21 4YVWC 2WFF3 4Q4Y1 5ABJB 3JBG1 5BNOB 1VBB1 2HWC3 4EJRA 2MEV3 1AYM3 1VB4A 4Q4X1 1PO22 4WM7A 1CJDA 4Q4Y3 3CJIB 1QJX1 2Y26A 1RUD2 1COV2 3CJIA 3ZFFC 4AEDB 3M8LA 1QJU3 4Q4V3 2WS92 5JZGA 4QPGB 4N53C 1RUJ2 1PO11 4RHV3 1VBC2 4Q4W1 2RS51 3VBRB 1GFF2 4YVSA 1V9U2 2GH8A 3FBMA 1VB2A 1MQTA 1Z7S3 4CDQB 1HX6A 4RHV1 4CDQA 4YVSC 1EAH3 4NWVA 4CEWA 3JD73 5CFCA 1FMD3 1HXS3 1HRV2 4YVWB 1NCQB 1NG0A 1TME2 4QPIB 1FMD2 1HRV3 1HXS2 1OHFA 1PO23 2TBVA 3S6PA 5BNNB 1AYM2 2HWE1 2XBO1 3VBFC 1VBE1 2XPJA 1NCRB 4PDWC 2RS33 4PDWB 2RMU2 3VBFA 4IV1C 1NA1C 5A33B 1PGL1 5L7OB 1PGW2 5C8CA 3VBUB 1VAKA 1VBC3 3ZXAC 5L7OA 1BEV1 2RR11 1AR91 1ZBA3 3J8F3 1X36A 3JBG2 1ZBE1 1MQTB 4N43C 3ZFFA 1AR61 1RUI2 3VBOB 1K5MC 4CDWB 1PO12 2RS13 4CDWA 1TME1 1EAH1 5CFCB 1AL21 4N53A 1RHI2 2BPA2 1MEC1 1HRI3 1WCDJ 5BNNA 1F2NA 1RUH2 4RHV2 1AR92 1A6CA 3JB4C 1ND2A 1V9U1 4CDUB 3CJIC 1VBB2 1NCRC 1BEV2 1NA1B 1HRI1 5C4WC 2X5IB 1C8M1 5JZGB 1CD3G 1POV1 5A32B 1B35C 2MEV1 4Z92B 2RR13 1C8M2 3ZFGA 1DDLA 1AL0G 3TN93 2PLV3 2BBVA 3NAPA 5J98B 3NAPB 4GMP0 4Q4V2 1RB8G 1PGW1 3VBSA 1AR72 2BFUL 1AR73 3VDDA 4BCUA 4JGYC 2GSYA 5BNOA 1QJY1 1SMVA 1R091 1RUE2 4JGYB 2WZR2 4CEWC 4RR3B 3JD71 3VBRC 4RR3A 1NA1A 1AYM1 1AYN2 2HWD3 5A33A 1R081 5FMOS 2X5IA 5C9AB 1K5MB 1R1A1 4CDXB 3NAPC 1COV1 5ACA3 2RS12 2WWSA 1RMU2 4GB31 1NOVA 1R1A2 1COV3 5C8CC 4Q4Y2 2R043 5C4WA 2FZ2A 5CFDA 1BBT2 1RVF2 1VBE2 2WS91 1EV12 2HWB2 5JZGC 1ND2C 4YVSB 4JGYA 1TMF3 1AUYA 1AYN3 1PVC2 1HRV1 2HWD2 4FTSA 1M06G 2R071 4WM7C 1NCRA 4CDUA 5AC91 4CDQC 4N53B 1R1A3 3IDEA 2RS52 4SBVA 4CDXC 5CFCC 1AR82 5K0UA 2WLPA 4RS5B 4GB33 1POV3 1EV13 2R041 1OOPB 3VBUA 1BBT3 1RVF3 2WZR3 4WM8B 1D4M1 5ABJC 1RUE3
chains in the Genus database with same CATH superfamily
2CV6A 3VBRA 1MZ6A 3KCCA 2K0GA 2JIGA 4CP2A 1F9KA 1LU2A 4MV2A 5F2WA 3CKHA 1ENQA 3U4SA 2MPFA 1QU0A 3UT0A 3WHTA 4L2NA 2RE9A 4GXLA 3RRDA 1W8HA 4H7LA 3TB0A 1LOFA 2A3XA 4RQPB 4UFMA 3K48A 1T6BX 1XNCA 1GP5A 3WQ1A 1ZBE2 1RUF2 2G1MA 2WO1A 1NQDA 1V6NA 4XVHA 4N7UA 1XXNA 2A3YA 2AREA 5LK7B 1XOYA 3MIFA 1W39A 5GZGA 2UYAA 2ES3A 3GCXA 1G86A 4LO4B 5FPVA 3D0SA 3MI8A 5A6YA 4P00B 5CYYA 4KGGA 3I2JA 2FCVA 4BXFA 3JBG3 2QFEA 1KD7A 1WGPA 3M3QA 4JGZA 1AL22 1S0IA 5J96B 1WW4A 3WDYA 2Y34A 1CIYA 2J1EA 2R1BA 2A70A 3OBRA 3SHRA 4TXWA 4BA6A 3K4AA 1ZBA1 4FQZA 4Y24A 5FZ4A 3C7EA 3TN92 2CTVA 5J48A 4META 1GANA 1I3HA 1LOAA 3T0BA 1QJFA 3VDDC 1YI9A 1ZYBA 5JLVA 3M7AA 1WLWA 1W2NA 3UGFA 3M3CA 1FOD1 5KXCA 1XRUA 2WO3A 4ZY9A 4P14A 1NY71 2ENRA 2BP6A 4CXXA 3MGUA 5DDJ1 1VBB3 2OUHA 2Z4FA 4QQPA 5A3LA 3UJQA 1CPMA 1VMFA 2EXJA 3TEXA 4AFMA 4IW3A 2P6CA 4LKSA 4S2DA 2XUEA 5ACA1 3K77A 3KCYA 2ARCA 3MDPA 2B7YA 5FIXA 2PQQA 5FZAA 3VBFB 2WNUA 1OA3A 4HKOA 4FFGA 3G7DA 1ULCA 1QXPA 1WBFA 2SBAA 4JVAA 5DG1A 4WVZA 1FV3A 2J1TA 4PF5A 3HN1A 1DGRN 5L9BA 1JW6A 3ZR6A 2BUKA 3Q8EA 2VCAA 5LB6A 3U10A 1GKBA 3WQBA 5JR2A 2OZJA 4XF0A 1JYIA 1FPN2 4LULA 1JMUB 1HDKA 2YBKA 5GLTA 2C1FA 1L7LA 1MEC3 4QPYA 1AR93 1NXD1 1ENXA 2V5YA 2C26A 2G19A 3HMYA 3GZEA 5HI0A 1UIKA 4BJ0A 1DZRA 2D40A 4Y20A 1DFQA 1GV9A 1OT5A 5CFDC 1YRZA 3MUZ1 4HT1T 5JIAA 4I0BA 1GUIA 1MQTC 4P9WA 1OQDA 1QF3A 2CAUA 3KCXA 1M4WA 4FP2A 2JXAA 3HQUA 3PUQA 1W2UA 4NAOA 3FL7A 2ZZQA 5EJZB 4L92A 3I3DA 5C8WA 2ZEZA 3PMEA 3U78A 3PVNA 4EV0A 1JOPA 4H3WA 1VBC1 2IZWA 5CEHA 1KQRA 1IQDC 3X29B 3P1IA 3OY8A 4Y1YA 5FZLA 2D6NA 4NVPA 1DZTA 4O9EA 1W2AX 1MVQA 3THCA 3IPVB 4M3CB 4M4RA 3OCPA 5CKQA 2IXJA 4UW5A 4HVOA 2HWB3 5D8AA 2R6QA 3RI9A 2LM3A 2VGDA 3DPRB 5HXVA 2TEPA 1X33A 2VTXA 1T6GC 1LU1A 4Q5OA 2Y64A 2B39A 2ETEA 4CE8A 5K0UC 5JXGA 1PM4A 1AR63 4CEYB 5JOZA 4EN8B 5FZBA 3LIGA 2H6BA 2FDGA 1SPPA 3P3NA 1SLTA 3T4HB 3VDDB 2A6ZA 5I8SA 3HAGA 3VZOA 4LO5B 3KHBA 3QLQA 4QXCA 2WAAA 2DCZA 3I3QA 3LOIA 4FVVA 3OB8A 1QDOA 3RJ2X 1BMV2 2GH2A 2RMU1 3H8RA 3N3HA 4X6QB 3EHKA 4BHPA 1PHMA 5ACA2 1W8UA 2XDVA 3MW4A 3ACLA 3CBNA 1Q56A 2IWGB 5JOYA 1W3VA 4MX3A 4NPRA 4KL1A 5BNPA 2VUAA 1QJY2 2EIGA 3KT1A 1OKOA 2PHXA 4HANA 1POQA 1F31A 2QQVA 1VBE3 2VZSA 3ALQA 1UCXA 1L3JA 4Q1RA 2I07B 1Y4WA 4RQPC 3U0ZA 1IS5A 5FP7A 4NROA 3ZOIA 5FZDA 1G9BA 3O0VA 1ND3B 1Q5OA 1PIV3 2B46X 5BPXA 4C90A 4GJYA 2DYCA 2YUEA 3ZR5A 3E5QA 3N7MA 5C3QA 1LEDA 2KA3A 4QM8A 2GDFA 2W1WA 4HVRA 4BK5A 5BNNC 4YW1A 3QACA 1BMV1 2PQSA 3HBKA 4NOTA 5FYSA 4BYYA 4KG8A 1RHI3 4AVVA 1OUXA 1GZWA 4IL7A 5CU1A 1WBLA 5J36A 1XNAA 4FXKB 2ATFA 4YLZA 1REDA 3WQ7A 4DB5A 2UY8A 3IT8A 1W06A 1O6UA 4RS5C 1H6XA 2P3KA 2HWE3 2XBO3 2WABA 3RDIA 1IHMA 3BOWA 3HQRA 4NWWA 1OVPA 2FZ1A 5JSOA 1Q3EA 3FWEA 2WWJA 4FOQA 5CKMA 3VLBB 2FMDA 3ST7A 1BLZA 1YWKA 5F2SA 3O1UA 2PAMA 3VBSC 1JH5A 1I9RA 3R05A 1WMFA 3BYWA 3WG1A 4ASKA 1W3XA 4HN0A 3K75B 1R1ZA 4JRAA 4Q4X3 3T30A 5J7MA 1VBD2 3N9MA 1Y9GA 1W0OA 3DYMA 4IEQA 3TEWA 2RM22 4Q4X2 1VBA2 3FHIB 3S0MA 4A44A 5EJ1B 1W6MA 3LD8A 1HB2A 4PLMA 3SCFA 3WNKA 5IVYA 5FYZA 1IG3A 1PMIA 2YMZA 4XXPA 1UD1A 1QIQA 2JECA 2FDJA 3IDBB 5JOXA 2OT7A 3ZN4A 1Q8VA 5A7PA 3BKZA 3BB6A 1CX4A 2G9GA 4XQ4A 3U11A 4BU2A 1Q8QA 3CHXA 2F6BA 3ZXDA 2X5IC 1KS4A 4Q1PA 2VBDA 5B2GB 5C33A 2VMFA 5A7NA 2IXHA 1XQNA 5DABA 4DXTA 3BOPA 4FPHA 3DF0A 4CEYA 1RJ7A 1PO21 1RJ8A 3PLQA 4Q0PA 4AI0A 5F9TA 2PYTA 2UY9A 3BGAA 4Q4Y1 1OA4A 3SC7X 1ZA4A 4QQ2A 3T0DA 2UWAA 3JBG1 4K40A 1ULGA 4LHNA 4QDQA 4XFGA 5GZFA 3VKFC 3WLUA 4EN0A 4HOOA 4PQQA 1ULFA 3AMMA 4XURA 1O3RA 2PHUA 1AYM3 3HT1A 4XUNA 1O4ZA 4XJAA 2J1UA 2VE1A 4DEQA 1RUD2 1A78A 3AP4A 2AEZA 1F35A 1V6JA 2KXLA 3M8LA 2YDEA 1JZ5A 1H4GA 1QJU3 3CIHA 4QKDA 2VNGA 1UX7A 4HZFA 4Q4V3 1OFSA 4QPGB 4N53C 4TWTA 1RUJ2 4EQVA 1PO11 5FMDA 2ZMKA 3LFIA 1F4HA 2A5ZA 1O8SA 2P3IA 1D2QA 3WUDA 1GFF2 4P9LA 1CN1A 1V9U2 5DAVA 3TEYA 1EY2A 1QOOA 4MGSA 3T2QA 1EYBA 3DXUA 1HX6A 3WEZA 4CDQA 2D6OX 4YVSC 1SLAA 1EAH3 1ZZ6A 2ZHNA 4DY5A 4JHTA 5DZEA 4NPMA 4AAXA 4AEMA 1QH6A 3I59B 4ZKTB 2A6YA 4BPZA 4LO8A 2WR9A 2D6MA 4W50A 3MF9A 3OGGA 4YNIA 1NG0A 4M4PA 3ILFA 1MS9A 1Z78A 5FYUA 2Q8DA 3A22A 2FQPA 1PMHX 1PO23 3TYJA 4MHRA 1J3PA 1I1EA 2UYBA 5FPXA 4KBZA 1G9CA 3RGBA 4HKWA 1PNFA 1RINA 1YYNA 1VBE1 2C4XA 1KGYA 3URFA 3VUOA 1C28A 2W5FA 3GBWA 1UMZA 3NNGA 4JHZA 3E6DA 3ZLIA 5FPUA 1OD3A 2XKPA 3KMHA 4B8EA 3ZVXA 3MV01 4HVQA 4Q8KA 1V6IA 1KFUL 5JAXA 4OQ8A 1PGW2 4GKXA 4GALA 1MZ5A 3N36A 4KQ7A 3SEPA 1VAKA 1TQ5A 3O1OA 1XNDA 5FPBA 1UN1A 2Y38A 1MR5A 1UPSA 4IDZA 3UL2A 3C7HA 3IDCB 3IIIA 1K42A 1ZBA3 2BGCA 3JBG2 1WD4A 1QKQA 4DEVA 4F3JA 1MQTB 3V56A 3M1HA 4N9HA 4BM8A 3KVAA 4RD7A 1K5MC 2RHPA 3W5MA 4AWDA 1PO12 1TME1 1XE8A 3N9OA 4AR2A 1ZZCA 3T2OA 3LSDA 5T52A 1WD3A 3WF2A 2ZHMA 2YG0A 5A7SA 1MEC1 2VO5A 4YW3A 3POYA 1H6YA 1C57A 1I6XA 4W8JA 3GHNA 5FO9B 2ZGMA 2ZGNA 1JZ2A 1AR92 2KD7A 4O7XA 1U5ZA 4LEJA 4ZHNA 4FPGA 1ND2A 1V9U1 4QB1A 1QOTA 3K2OA 4UFKA 3I2OA 5LY1A 5FZ0A 4AI3A 1HRI1 5FXZA 5FXWA 4XJ9A 2ARXA 2EA7A 1C8M1 3FN9A 5L9VA 5JZGB 5F8PA 1N1SA 4MSVA 3OUHA 1QDCA 4N8MA 3E5UA 5EIYB 1B35C 1PZ9A 5A6ZA 1JS9A 2WJSA 5JPNB 2JDAA 2V09A 2VQTA 4V2WA 3UKNA 5BXXA 3BTAA 1ULDA 1DDLA 5JXHA 5F5CA 2RJKA 2K46A 1ODNA 2FCTA 4LHLA 4LBQB 3VV1A 2W46A 3NWKA 2J7MA 3PUSA 1RB8G 1RGSA 1VAVA 1PGW1 2Y0OA 5T5PA 3VBSA 3ZN6A 2BFUL 4XAEA 2MNGA 4FPEA 2JDPA 4QQHA 2H0VA 1FNYA 4MADA 4NMIA 4UF0A 3WP5A 5JXIA 4OYUA 3WG2A 2NMNA 2RDQA 2Z5WA 4YZ4A 3TRSB 2XVKA 3DUIA 1WWYA 4KU7A 5F37A 4M0HA 2PHDA 5A33A 3K46A 2P34A 4L97A 5LY2A 5FZ3A 3VKMA 2ET1A 1DQ6A 1XJAA 2W95A 1UY1A 4XDPA 1UAIA 2A6VA 3AVSA 4KH9A 4QKNA 2WBKA 4XEZA 3U14A 3C7FA 4GB31 1H0BA 1R1A2 2W2IA 1OI6A 3LA2A 3LCPA 5FWEA 3RZMA 4JX0A 4NIDA 3LE0A 4LJHA 5L36A 5A3TA 4NHKA 2X53S 1OURA 2VNVA 2BW8A 1U0AA 2R16A 4V1PA 2FZ2A 3Q8FA 3R4SA 1SDWA 5CFDA 3T4VA 1RVF2 5T54A 4GWNA 4YM2A 1SPPB 1LGCA 2WS91 3AVRA 5FPZA 1FXZA 3F95A 1ND2C 3GJBA 1H2LA 2P3YA 4YVSB 4WV8A 2W92A 3POJA 3SLIA 1TMF3 3AZYA 4JAAA 3EBRA 2NLRA 4XDOA 2ZGLA 5JPMB 4TZDA 4WM7C 4XZUG 4NR1A 4CDUA 4RGAA 5AVPA 2JD9A 4JC1A 1UZWA 4ZPIA 3WNMA 2VMGA 2BWAA 2EXHA 3O14A 1WLCA 3T3YA 3IKWA 2EAAA 3IDEA 4JDOA 4BLJA 5GALA 2BRTA 1L7RA 1RYYA 5CFCC 3B02A 4DIQA 3ACIA 3OGJA 3AB0A 4LO7A 4M00A 2FDHA 5K0UA 3ATGA 3WNPA 5FY8A 4I02A 4XZPA 3PDQA 5IYYA 2CGOA 1POV3 2XLAA 2W1SA 3SH4A 2R041 3CF6E 1XC6A 2ZS6B 1UU5A 4XFAA 5EXOA 1RVF3 4QX3A 3VBUA 1GMMA 2OQ7A 1G9DA 2VCBA 5SV5A 5KBFA 3VD3A 2VW0A 3MYXA 4KU8A 4MHUA 4PT6A 1EV11 3UGGA 5L7OC 2AZ5A 3KV4A 2BNOA 2CL2A 2ZHKA 3HN3A 3ZYGA 4XF1A 3QH6A 3RYPA 4AVBA 2JG8B 2PHFA 5A3UA 4OHYA 3T1LA 5BNPC 1IKPA 2YBSA 2VNOA 3WW4A 2XVGA 1WKYA 1W04A 3POFA 2BTVC 4I3GA 3ZFEA 4AVCA 3S57A 1OQEA 1IPKA 3AXDA 1DG6A 1JHJA 5DUUA 3B94A 3FMGA 1QJX2 1ALYA 1NLRA 3B01A 3EO6A 3ZSEA 4CUAA 1B09A 3RZGA 1OD5A 4K8FA 4I2OA 1QJU1 1UYYA 1GNYA 4XABA 1Q8PA 1FYUA 2R042 4HMZA 4N43A 5IAVA 2V4VA 4NHMA 1DHKB 2UURA 2RS31 2W91A 1PIV2 2GAUA 3MPBA 2W39A 1LOBA 1UY4A 1WZXA 3N9LA 4Y4RA 4E8DA 5CFDB 3PMSA 1Z7S1 3HEIA 1OLME 4QPGA 4TLGA 2HWC2 2JJ6A 4NIGA 2BEOA 3HOBA 1POV0 1JI6A 3LPFA 4OUSA 1RVF1 5EFUA 5FCCA 4CU7A 3LKJA 1CQ9A 2NQYA 3AMNA 2Y6FA 1LB2A 5IWFA 4FFHA 5FZIA 4FFFA 4W65A 1LNSA 3MZHA 4AXOA 3HVDA 1WA6X 4EZ4A 1OPOA 4M3CE 5KR7A 4CXYA 2QQIA 2Q4SA 3BN6A 3QOPA 2R063 4RA0A 2K2SA 5GJ6A 3ETPA 4MGYE 3S5AA 2FBEA 2GNMA 2DCTA 4ZXEA 4FTEA 3MFCA 4C1XA 5FZKA 3GYDA 3WD5A 2D3PA 1BVVA 1XPWA 3APBA 1BK0A 3CLPA 4AVSA 1QJU2 2CWSA 3EYPA 4CEYC 4LE4A 3UESA 3VBUC 2WFF1 5FFOC 5IUQA 5ABJA 2ZGTA 3IAQA 2YFZA 4ATFA 3WDUA 1MS1A 3VD5A 1NXMA 3HJRA 1UYPA 4YW7A 5F5AA 1APNA 4MUVA 5FUNA 1UF2C 5HCBA 2YY1A 1CAXA 1W8TA 2Z79A 1Z7S2 4XUOA 1G7YA 3VBHC 1SQ4A 1YQ5A 2BYVE 2D98A 4W6XA 4URAA 2BU9A 3M3EA 2GZWA 3ZIXA 1W6OB 2ZCWA 3MIDA 4MH0E 4QT6A 2VZ3A 2Y6HA 3O0XA 2B42B 2PAKA 4WBBA 3PVOA 4UBHA 3NV3A 4O65A 2BNNA 4A4AA 1RUG3 3BVCA 4H55A 4Q4V1 5GM0A 1WMDA 3LA3A 4QX5A 4XUPA 2RS53 2XQXA 4CPBD 1GZWB 1CR7A 2BVVA 2P6HA 4FOWA 4Q26A 5FREA 4BQ5A 4AI8A 5FOJB 1S55A 3CZJA 5C6CA 2O8OA 1SLBA 3AJYA 4XJZA 3ES1A 2CGNA 4CCJA 5CAZA 4DUWA 1REFA 1Y3TA 1OVSA 1BKZA 2WZR1 3ZFFB 4COYA 4HONA 1RUH3 1W9WA 3A4UA 3BPSA 4BQ1A 5F7UA 4YVWA 1FMD1 1HXS1 3VD9A 2PTMA 4LBOA 3TNQA 2X05A 1V9U3 1PGSA 3RSJA 2WO2A 2ZEXA 3ZN6B 5DDJ3 4COWA 2D6KA 3K51A 4FPLA 2R072 1UXZA 1VIWB 2BWCA 4ONUA 3UJOA 1GQPA 2EIDA 1SCRA 3NW4A 2QQJA 2C9KA 1EP0A 1U5IA 2TNFA 2WL1A 5K0UB 3DKQA 4ITCA 1ND2B 1G6NA 2I2SA 3AP5A 4E4ZA 2IUWA 1WCUA 2O1QA 4QWNA 3HNBM 3SISA 3MW3A 1Z0HA 2QDNA 4XJWA 5H9SA 2VOXA 4EYUA 2HWB1 4D3WA 1US2A 4LBQD 3AMHA 1NCQC 1PIV1 4JTOA 2R062 4DMIA 1UW8A 4G3YC 4X8PA 2QQNA 3FLTA 4MGZE 4YGEA 4OI1A 4S2GA 1RUF3 2DDUA 1RUI1 5JOWA 4MZUA 3WNOA 1BK1A 2W68A 3LEMA 1E5HA 4Z07A 3ZYBA 5L73A 4U36A 4NRPA 1H8TB 3N35A 3DPRA 2WDBA 2GC1A 4QQLA 3MF6A 2W0XA 2PELA 4K3UA 3ZO0B 1CIWA 4YG3A 1W0NA 1TME3 1AYN1 1W9TA 3JXSA 3LAGA 5CIRA 2IVJA 1K12A 1PMJX 1NX9A 2E6VA 1S0FA 2D43A 2YV8A 3KB5A 1OFNA 4XHXA 2VCMA 3O1RA 1R083 3O5SA 1X9TA 2JDYA 2JX9A 4HL0A 3LEKA 1OXCA 2OX0A 5C71A 4LBKA 2AR6A 1X8MA 4JCKA 4OUMA 2WKKA 1RUD1 3M4FA 4PI2A 1QJY3 1QJX3 1VRH1 2LROA 2AENA 4CDWC 1OUSA 4KBBA 2WA3A 2Q1MA 5FYYA 3VHRA 3VD7A 5KXBA 5JCTA 2VMCA 3JCIA 4CDXA 4UYBA 5IK8A 5FK8A 2VM9A 2WINB 1DGRA 5FWJA 2JE8A 5HXMA 2RV9A 2JDUA 1P8JA 3KWVA 3UETA 4Q4W3 4P08A 4D69A 4XBLA 3GDBA 4ASMB 3AZVA 2WNVB 4JGZB 1RUF1 5FMOL 4I09A 2V4AA 3DPRC 5G05L 1CWPA 5E1RA 2WZPP 1REEA 3JB8A 2OXBA 4IV3C 3T08A 3QBQA 1XE0A 4HG6B 3JQWA 2DBIA 1QQP1 1VBA3 2CWMA 4I0AA 4RFT0 5FLHA 1DIWA 4QXKA 4QPIA 2WT2A 3SITA 2ILMA 4GMP3 1SFYA 3ACGA 2I74A 5DPNA 2R30A 4AVAA 4I0WB 3WUCA 2FCUA 3KSCA 4COZA 5J3UA 2ZGUA 4A3ZA 1R093 1JHNA 4QGNA 4XQWA 1DQ1A 4LBLA 1E5IA 5DUVA 2YROA 3WF3A 4CEWB 1FPN3 4XFIA 4P9XA 2AC1A 2ZGQA 4WM8C 1BCXA 5FPAA 1YFUA 2OYZA 2WT0A 4NRMA 5A32A 4FBFA 4JDNA 4QX2A 2VQ0A 1KEXA 1DYPA 4JQRA 2ZBJA 4CUBA 1OMIA 3ME2A 5FY4A 1D4VB 1EAH2 1CAXB 5FDBA 2NM1A 2UU8A 3K3NA 1PK6C 4YYOA 1SDDB 1TMF2 5C4WB 4ZZ5A 4QD2A 4PDWA 1C8M3 4ZONA 2D3SA 1H8TC 3F2ZA 4E2SA 4AEDA 2A73B 3GNEA 4GULA 1DF0A 1GP4A 2ZJCA 3O0WA 3KF5A 1IGOA 3CDZB 3DCQA 3D8CA 2C5DA 1OF4A 1N3QA 3AL6A 5FY5A 4FTBA 2ZTNA 1TEIA 4B1MA 4EROA 2HEWF 1QQP3 1VBA1 4NE9A 3TN91 4IEXA 1R092 1RUE1 2E53A 5A1AA 1JZ3A 1JU4A 5DAXA 4BDVB 2DU1A 2JICA 3AYEA 5DXDA 5E88A 5E89A 2QQKA 1E5RA 5T50A 2E32A 5KHHA 2QQWA 3RMYA 2X10A 2CAVA 1NT0A 5FYVA 4R52A 1V6OA 2DURA 1VBB1 2JG9C 5EQUA 5FYHA 3RZZA 3S5QA 5IK5A 5FYBA 4FAGA 5E8AA 2MEV3 5APAA 2P5BA 1GR3A 3PIGA 3VZNA 5KHIA 4Q4X1 1H30A 1PO22 3FLRA 1CJDA 3AMPA 3CJIB 1OLQA 3MBWA 4WM7A 3WP3A 1JZ6A 3CJIA 2VMIA 1NE4A 4LKEA 3OYWB 3PUHA 5EYYA 5LBBA 2ZACA 3AZWA 4FPJA 4C1WA 1H9WA 3V0AB 5BV6A 2WLQA 3PTYA 2VZPA 1QH7A 3BU0A 2E7TA 4LA3A 4OUEA 2YGMA 3RPQA 2VZOA 5FYMA 4IQPA 2WQZC 3PVEA 1S1AA 4GJZA 3OBZA 3VBRB 2ZMLA 1IKQA 2C24A 3L2YA 1W28A 3A7QA 3OG2A 4P9IA 3HIFA 3DEMA 3ZXFA 3FBMA 1Z7S3 3W21A 4CDQB 3AK0A 2BERA 5K7PA 3Q8BA 1MPXA 4RHV1 3ROUA 4XXAA 3B00A 1UOJA 5T5LA 4AFBA 2HYKA 1A34A 3SKJE 1NZCA 3PIJA 2HKXA 1YHFA 3ITQA 4A6SA 4LIVA 4CP9A 4BQ4A 1CJPA 2IVIB 3CU7A 5IHRA 2GN7A 3ENRA 3DKWA 2JKBA 1DU3D 2TBVA 2XVLA 2WZ8A 5AVAA 4KWUA 1JOJA 4K8RB 4OULA 2XPJA 2CU5A 4LK6A 1ODMA 1UY0A 3IDAA 1W6PA 2WNUB 1QHDA 3IMNA 4K20A 4NHLA 3OD4A 4NAMA 4PDWB 4QX1A 3VBFA 4CU8A 5GLUA 4IV1C 1H2MA 4UFJA 4ISRA 5AFBA 3LB9A 5C8CA 3TWIA 1LRHA 1R64A 3V0BA 3LF7A 3ZXLA 5DAQA 3AYAA 4AI2A 3B5LB 2RJLA 5C5TA 3KQRA 4YZ1A 1K5JA 1Y9MA 3IPVA 1VJ2A 4AFDA 4UOJA 2FDFA 4UBGA 2LW8A 4YG6A 3W58A 1UIJA 2X8KA 2ID4A 4NRQA 1UMHA 1YNAA 1V6KA 4P5YA 3KHCA 3LWCA 3RZKA 4CDWA 3N9QA 2WZEA 5FZEA 4DINB 2LALA 1CX1A 1OC1A 4XACA 1J58A 3PNAA 4A3XA 2BPA2 4AW7A 1HRI3 4B7KA 1TNFA 1F2NA 2E7AA 3NJXA 5HCFA 1RXFA 5DZGA 1DYOA 2HJIA 2BDRA 1RUH2 4FPOB 4RHV2 4ASLA 4NO4A 3TEZA 3JB4C 1V6LA 4FQ4A 1UPIA 1XSQA 3CJIC 5EP9A 1VBB2 4IGOA 1XB9A 3RJRA 1GOFA 4A41A 1L7QA 4LMFA 2QNKA 4MGKE 3LEGA 4J25A 1W2OA 1MS3A 5KXEA 1HN1A 2WFPA 3ZMOA 4MG2A 4LA2A 1N1TA 4Z92B 2LUWA 1URXA 4IEUA 3AP9A 3ASIA 4DXZA 5JMOA 1UOGA 5AFEA 3MLLA 2JB4A 1C8M2 5FYIA 1KXGA 1KJLA 2GP5A 1HQWA 1X50A 3UKVA 3TN93 4YGCA 2PLV3 2BBVA 3NAPA 5J98B 5JWPA 3WNLA 1FX5A 4GMP0 4YW6A 4YM3A 3ZSKA 1S0BA 4QXBA 4YZ3A 1QXJA 5DAPA 5FKBA 2OKXA 1AR73 2JB8A 4BCUA 3R0RA 4ZU7A 3WG4A 4JGYC 1ZRCA 4ORFA 1STMA 1QJY1 2DWRA 1JZ8A 3KF3A 4H14A 4OHZA 4KI5M 2FDIA 4CSWA 4LQRA 1PX3A 2D7FA 4RR3B 2EICA 5FZFA 5FZGA 3T0AA 3JD71 3PURA 1NA1A 5IAXA 4E4DX 4FI9A 2JENA 1VPHA 3MLJA 5C3SA 1R081 2XUMA 5FMOS 2XJTA 1UKRA 5C9AB 1R1A1 2DBNA 1HB3A 2A6WA 4UT5A 2RS12 3VZMA 2AYHA 1FV2A 4D6QA 1S2KA 4HPKA 5I8TA 1LHWA 3NNJA 5FOBB 2P3JA 5GLZA 4HPKB 3WOGA 2ZGSA 4L99A 3VHOA 1H4HA 4TN7A 1RMU2 4QKBA 4AVTA 1NOVA 2D97A 2WQ4A 3K4DA 2ORZA 1BXHA 4O9GA 2PMWB 4MGIE 4QAWA 2CNAA 4AQ2A 2VU9A 1COV3 4K6BA 1GNHA 3PUAA 1UY2A 4E8CA 5C8CC 4Q4Y2 2P17A 4YW5A 2VVFA 3WVJA 4BIOA 3KGLA 1O59A 4CU6A 5C4WA 1Q8OA 1LECA 3LQCA 2ZABA 1BBT2 1VP6A 1CZTA 5I91A 4CP9B 5FPLA 3ZSLA 4E4HA 5IVCA 1ONAA 1Y7BA 2EF6A 5LA9A 4QHOA 4XFHA 3H3LA 5EYXA 1FT9A 2WIIB 2XH6A 1WW6A 3LSEA 5HCAA 3MPPG 2XJQA 3DYPA 2HWD2 1PVC2 1W99A 4TSVA 1D7PM 2IXKA 1XYOA 2VZ1A 2WRAA 1M06G 2O14A 5C70A 5DUXA 3ZX7A 3BIWE 3N7LA 1WLTA 2QBXA 4RGKA 3RNSA 4P02B 3O12A 2H6CA 2DVGA 2GC2A 5AC91 4Y1ZA 2UWCA 4CDQC 1QY4A 1OH3A 4R9AA 4AI1A 5FZ7A 1YFWA 4XPVA 5F3EA 1WUVA 2EIEA 1CESA 3KQ4B 5LASA 3N4MA 4SBVA 1QMJA 4CDXC 2PXJA 2Y6LA 3ZSMA 2Y6JA 1UOFA 4YGDA 3WCSA 3WY6A 2VD7A 4QB6A 3WW3A 2WLPA 4GQ7A 4B1LA 3ZKUA 4XETA 3SCHA 2VULA 5CA6A 1EV13 4W6YA 5EZWA 3LDKA 1OOPB 1BBT3 3MIHA 1FI2A 4WM8B 1GYKA 5CG8A 1RUE3 3ZSJA 2OA2A 1W8ZA 1PNGA 1AL23 3T2TA 3GF6A 3ECQA 5C3OA 1VAMA 5DAWA 2CY6A 1MS0A 5A1FA 4UWDA 3JD72 1T2XA 3P3PA 5FMBA 4AHYA 5IT6A 5J37A 2SLIA 1OKQA 1NLQA 5KXDA 4N7IA 4A2UA 1HJGA 2PLV2 2YPDA 1W9YA 1TVGA 4L8QA 4M3CF 2VOVA 4A7KA 4JKLA 4X6RB 3GZTB 3ZPYA 3THTA 4B29A 5B4NA 1WLDA 1NQJA 2PN5A 4AGGA 1O5LA 3J4UH 2ARAA 3FFQA 1H8VA 4E27A 2OZ6A 1YEWA 4Q0VA 2FHRA 1G8WA 1FOD2 1RUC3 3ZPOA 2BZDA 4QX0A 2ZX3A 3CQOA 3VL8A 3JUUA 4RS5A 1F15A 3BALA 2XXZA 2K9ZA 1H8TA 2WYFA 3POWA 1RUG1 2XKOA 1YQCA 3GBGA 5IW0A 1DCSA 1BHGA 2VXJA 4MVTA 4Y5TA 2BV4A 4DXRA 5C3RA 3NV4A 3JU9A 1BBT1 4G9SB 3SXWA 4DOUA 1SLIA 2VECA 5LATA 1YI7A 1HIXA 3MO4A 2BOIA 4N90A 4OCTA 1XYPA 3N7KA 3C7OA 5D8AC 1AR83 3AKRA 1ZRFA 3WSOA 4QMAA 5GLVA 5FJHA 4CXWA 4AEDC 3E6CC 4C0BA 1PVC1 3NO8A 1DGLA 3ZXEA 3IZOA 1XBFA 1SZBA 5I93A 1J3RA 2VAUA 5I0SA 3ZXGA 2W47A 4ZXKA 1PVXA 4XFBA 4F7ZA 4IE0A 4LUMA 1FOD3 3KV6A 4MXWA 4KNCA 3I54A 2R1DA 1O91A 2VVDA 1ASJ2 2QE3A 2ZOEB 1WCKA 3VBHB 2ZX1A 3FUQA 2XQRA 4LR4A 2VVEA 1QNYA 1J1TA 4LLFA 3E6BA 3PTRB 1TE1B 4PCRA 3RQ0A 4BQ3A 4I01A 1YUDA 2EXIA 2A3WA 4AOCA 4Q29A 2BFUS 3NKTA 2W94A 3GGLA 4GZ9A 4IERA 4JQTA 5IK4A 3TOJA 2QKDA 2QVSB 4Y22A 1KS5A 3B9CA 1UU4A 4LK7A 1KDKA 4IEZA 1YFYA 4HSLA 4OHXA 4Y5SA 3WDWA 3HR9A 3VBOC 2XG3A 4PLOA 4FSJA 5FZHA 2B9UA 4X8NA 2W08A 4KGQA 1MZFA 5FP3A 2V5DA 2Q0AA 2QQPA 1IG0A 4QPGC 4JTNA 4YM1A 4AQ6A 3WF4A 2ZGRA 3KGZA 4GB32 4NJ4A 1EUUA 1NE6A 5FLJA 4CCNA 2Q30A 1WMXA 1YQ2A 3OGVA 3O1SA 1ASJ3 3JQXA 4N43B 2R49A 5GZCA 1JZ4A 1V0AA 3ZYPA 3DXTA 3H7YA 2QQOA 1AZDA 1C1FA 2YB7A 3H3UA 3RYRA 5BNPB 1NAEA 4IV1B 2XOMA 2ADEA 5L9RA 2HBTA 1RUG2 4XCBA 4Y22B 2XL9A 1RTVA 4D7YA 4IETA 3MIGA 3U4XA 4QPIC 5F3GA 1N3PA 2LTNA 3AP7A 2JD4A 3KVBA 3POSA 2A75A 5IATA 1LOCA 4Q8LA 5D8AB 5FMCA 1O3TA 1YJKA 5IFTA 3USUB 5K9YA 3NNFA 1RUH1 5CKNA 1BZWA 2YGLA 3IN9A 3KD4A 4OMDA 3ZKYA 3ZFEB 4JV4A 4WM8A 2FD8A 4AAPA 4Z1VA 2JKXA 5LBCA 5TSWA 1JUHA 2PHWA 4HK9A 4NIHA 1J3QA 1IPJA 4LNVA 2A71A 3AJZA 5FBZA 1VALA 2BGOA 3P5BA 1RMU3 3KT7A 5JSPA 2R061 4Y1XA 2JDZA 2XR4A 5SV8A 4BQ2A 5FP8A 4YFZA 3FC0A 5LA0A 1C5HA 1OSGA 2XLGA 2ZHLA 4LITA 3RFRA 1XSRA 1AR71 2RJ2A 4Q0QA 4Y1VA 5J1XA 1YFXA 3T1MA 4LKFA 1GZ9A 1H1MA 2H0BA 3OPTA 4TTGA 1WCQA 1IZ3A 2C0ZA 3H50A 3ZFEC 3H7JA 3AXEA 4AHZA 2XL7A 1Y9QA 5T5JA 2WAOA 1ND3A 4GH4A 3ZN5A 4W4ZA 1QGLA 1H1AA 1SFNA 3J8F2 3ZYHA 1S0JA 2DVBA 3UK9A 1LENA 3HWJA 5FQ0A 1D4M3 3U1XA 4XDQA 3W5NA 4IEPA 1UL9A 3UKTA 4LIUA 3WNXA 3I3MA 2R073 1NCQA 3MHZA 1DQ4A 2ZEYA 3I2GA 3IB3A 2IXLA 3FBYA 2DF7A 3HT2A 3MW2A 5JR7B 1W8NA 3U75A 1ACCA 4R9CA 2RS32 2FMYA 2XHKA 5CG9A 1OLMA 5CBLA 2ZAHA 2W3JA 1O8PA 1UX6A 1ZA7A 2GNDA 3BTYA 2QZ2A 3N9NA 5LWBA 1OOPC 5FZCA 1H1IA 4PQ9A 3A23A 5JI9A 5I0TA 3BI3A 1CAWB 1UU6A 4XQDA 1CAWA 4Q4W2 1I5PA 4IESA 4RGGA 2WNOA 3NRUA 5HPOA 4AGRA 1QNWA 4M01A 1AR62 3W59A 2HWC1 4LOSA 5AC93 1CAVA 1QOSA 3GJAA 3ZYIB 4GH4C 1XNTA 5F39A 3RS6A 4L0PA 3V65A 3NNMA 5DN2A 5IK7A 4YARA 2J42A 4LT5A 1W2TA 2WFF2 3AZXA 3GZUC 5IVVA 2RR12 2VBPA 3K4ZA 4HK8A 1W05A 3VBOA 2ADDA 2R32A 1GZTA 3C8XA 5FUIA 4Q0SA 4C8DA 5K4LA 5A3OA 3OTFA 5KWRA 1ZRDA 5CADA 1DLCA 1VRH2 1QQP2 4RYDA 1UMIA 3O7OA 4QDRA 1E57A 2I45A 1RUJ1 1JOBA 2DVAA 1JYXA 3AM2A 3KV5A 4FO9A 1TMF1 5FXXA 1AVBA 3FX3A 5HBAA 2HEVF 3O1TA 3B9IA 2VOKA 3I59A 3NMBA 2VOWA 4XW3A 1LULA 2VTXJ 4YVWC 4H2AA 5F1RA 5ABJB 3J7LA 4QKFA 4AHWA 2GC3A 4GKYA 5F3CA 2VXRA 4PF1A 2HWC3 5HV0A 1J83A 3S7EA 4QB2A 3OJBA 5A7WB 4EJRA 4LORA 1PK6B 2PHTA 3M2MA 1VB4A 1N1YA 1UZVA 3R6SA 4CCLA 4INDA 2Y26A 3QH7A 2AH2A 1JU3A 4AE2A 3ABZA 5E6HA 4XUTA 3VZKA 2HLEA 2QQMA 1D2SA 3KM5A 3OPWA 5CNAA 2DFCA 3MV11 1JYCA 2WS92 2DVDA 4LOTA 2XWBB 5JZGA 4HFSA 4NUBA 3BPZA 5JDBA 2E33A 2L9LA 4AF9A 2RVAA 1VBC2 4PLNA 4BOWA 4Q4W1 4IEWA 2RS51 5A3MA 1XE7A 5HCHA 4AYUA 5LBFA 2WN2A 4IGQA 5EHDA 4DRVA 2YC0A 3B69A 5BUVA 4LXLA 3GCWA 2EVXA 1DQ0A 4NWVA 2G9ZA 1FMD3 1HXS3 4UXAA 5B4XA 1NCQB 1Y43B 2JE7A 2Y8KA 3AX4A 3I4IA 4QPIB 1KITA 1FMD2 1HXS2 1ZZ8A 1OHFA 2JG9B 3NJVA 3S6PA 3WHUA 5BNNB 2HWE1 2XBO1 3CMGA 2AACA 3SKVA 3VBFC 4BQYA 3HNYM 5F5IA 5IJRA 3DV8A 4B4RA 1NCRB 2JDKA 4ZU5A 4UI9L 4F8AA 4NIIA 1JN2P 4IXLA 2RMU2 4D8MA 4CCMA 4RFRB 1BVP1 5A33B 2CGPA 2VJXA 1ZZ9A 3E1F1 4YW2A 1JBCA 3SMHA 1UOBA 1PGL1 4XOGA 3O1VA 1VBC3 3R4UA 1WCSA 4HBNA 3LDBA 4BH9A 2IFRA 2RDNA 2RR11 4HN1A 1LTEA 2YU1A 3KZ4C 1X82A 4QU2A 2C9AA 2WSVA 5T55A 4Y3OA 1S0EA 1X36A 3OGSA 1ZBE1 1YCIA 5JSRA 2ZKLA 3DYOA 4N43C 4XE9A 4XYXA 3BCWA 5FP9A 5EJ3A 3ZFFA 1AR61 4E4SA 1RUI2 4TLFA 3FLPA 4PBOA 4CDWB 2RS13 4OHVA 2ZMNA 4AZZA 1AL21 4QX7A 4N53A 1RHI2 2NPIA 1C1LA 3WP6A 5ANNA 4D0QA 1AXZA 2EALA 3I2DA 1W0PA 3AFKA 4QM9A 5H9RA 1KRIA 3GM8A 4XBNA 3TBDA 1V70A 1XNKA 4BWOA 5D2AA 3ZXJA 3VGIA 5HV4A 2XJUA 3THPA 2EIBA 2X5IB 2W1UA 3ZMNA 5A3NA 2DTYA 4LKDA 5G04L 4C0HA 2B8MA 2MEV1 5KC6A 2QDRA 4OFGA 2YU2A 4FOVA 4LBNA 2IC1A 5K8SA 3LIHA 4RL7A 4AQTA 3NV2A 2RR13 5FY1A 1I5ZA 3OEAA 3PJQA 5FY0A 3BODA 4R4ZA 1W03A 1BYHA 1GOHA 2Q8OA 1AL0G 4CPBA 4XC9A 4EWEA 1G9AA 1LJ7A 4XF4A 1LEMA 3FE5A 2CSGA 3O1MA 2G9FA 1ULPA 4XHBA 3VKNA 3H8OA 1EPZA 1S0DA 1W6MB 4MO3M 3ZYFA 2R0FA 2P4EA 2YBPA 4GA9A 1E5SA 1HV0A 4LE3A 4L9BA 4B4PA 3NSTA 1QEXA 1DBNA 2D5HA 3AP6A 2GSYA 2YXSA 3WF1A 5BNOA 1SMVA 1AHSA 5FTTC 4D7TA 3BTZA 4GWMA 4CRQA 1WW5A 4RR3A 3IMMA 1YJLA 2HWD3 2VZUA 3POEA 1JTZX 3ACHA 1LHVA 2JDHA 1Q8SA 3WXPA 4LTAA 1O5UA 3IIAA 1X7NA 2Z69A 1PM7A 4UFIA 5FV3A 1MS8A 3GALA 3NAPC 1W8OA 3DGTA 1COV1 4J1WA 5LA2A 3SEEA 3POIA 3WW2A 2GMMA 5FP4A 5LW9A 2P1BA 3CO2A 1V00A 5A7QA 3RWKX 3B7MA 3ZDSA 4EN6B 2NN8A 3PVBB 4K9SA 5I0RA 3E5XA 2B5HA 1OH4A 2VZVA 3VDAA 2VQUA 1W8WA 4ARYA 2V73A 2QQLA 3ILRA 2ZAAA 4CA9A 2VBBA 5FZ8A 3PU3A 5IVFA 1ULOA 2XGXA 1YXWA 4XMAA 3C3VA 1N47A 1VBE2 2OVUA 3WZ1A 1N3OA 4AGVA 2QCSB 5FZOA 4CCOA 1WW7A 5H9QA 1F4AA 5LBEA 4BQXA 1KJRA 2KR2A 2VMEA 4XJUA 5F5QA 4UW4A 1AYN3 4XIKA 1HRV1 2PHLA 4FTSA 1ZZ7A 1OF3A 2BQPA 2ZX2A 1RL3A 3ON7A 1HLCA 2R071 4IEOA 2ERFA 4QX8A 1UYZA 1DGWA 1KDMA 4A6OA 3J7HA 3FZ3A 1DYKA 4D6RA 1GWKA 1YIFA 4N53B 2NZ9A 1R1A3 1SBEA 1ZVFA 2D93A 1MZEA 4IE6A 1RUNA 4RSUA 2JG9A 4JKMA 4DS0A 3DN7A 3AKSA 3SQOA 2E51A 1GSLA 4ZU4A 1CAVB 1LR5A 3GZAA 3PJYA 1XYNA 3NNLA 2UWBA 4Y1UA 2N7GA 3RWNA 3ZYJB 1DP0A 4KG0A 1OPMA 5DMYA 3HNMA 4XCAA 3WW1A 4OZOA 4PIZA 4FPFA 5JIUA 5J09A 4OI4A 2D5FA 4CZSA 1ST8A 3A21A 4AFAA 4ZS3A 1O7FA 2BBAA 1CAUA 1D4M1 2W1QA 4PHZA 2ARBA 1AXYA 2JDNA 1A8DA 2VPVA 4IE4A 2JIJA 1RXGA 1UZZA 1MACA 2KM2A 4IV3B 3I3EA 1OQ1A 5CVRA 1ZBA2 4D7SA 3UV9A 2VG9A 4E9KA 4QGMA 3M3IA 4XF9A 1W9SA 2NYYA 2MEV2 5CISA 5FJKA 2EXKA 5JI7A 2ZEWA 4RN5A 4AG4A 3GBFA 5E16A 1AXKA 4CCKA 3PU8A 4ET7A 3BU7A 2ZZJA 4EWDA 1ND3C 4OI0A 2ORXA 1FPN1 1WA4A 4DY3A 1W6NB 1UKGA 1N1VA 1IPSA 1S0CA 4OI2A 5FZMA 1A8MA 2XONA 4IUGA 5C5UA 4S2HA 4PBPA 2E7QA 1HKDA 2CHHA 5FUPA 5C9AC 5A1LA 1GP6A 3VBHA 4LUKA 2X09A 4A7YA 4U2AA 4Y5Z0 4MGQA 1VBD1 4E2GA 1RC6A 2RDSA 2C6SA 3HBZA 5DZFA 5FAXA 4E2QA 3I2HA 3AC0A 3VD4A 4XUQA 4QQOA 5GKAC 2VL4A 1UXXX 3RG0A 3Q8AA 3VBSB 1OA2A 1VE0A 1YQ8A 1UQXA 3P6BA 1YC61 4YRDA 4GWJA 1RIRA 4NIAA 2OPWA 1UZ0A 2ZGOA 4Z2WA 4JKKA 2WNVA 2J1VA 1F8VA 4XTPA 1QJZA 1HJFA 1GQHA 5LRRA 3JZVA 4NPLA 4CUCA 4BZ4A 2RM21 3I3BA 2YFUA 4CP1A 4DUVA 2F4LA 1PZ7A 1VRH3 3WG3A 3RZHA 2WSUA 2ZX4A 2J1AA 4JZRA 2HH9A 2Q8CA 1CVNA 2VQAA 1JZ7A 4J1XA 2PAEA 4CP0A 1IS6A 2WNUC 3SH3A 1CZSA 4P9YA 3ZFGC 1DGWX 2QJVA 4R4XA 4CCEA 1XU1A 1LAJA 1J59A 5DDJ2 2ZX0A 4B7EA 1DQ2A 5BNQA 1VBD3 2CYFA 2ET7A 5D21A 3O1PA 1NZIA 4LLOA 1O3SA 1S4CA 3MIEA 4IV1A 1PO13 3D3AA 2LRPA 4A42A 3LOBA 4GWIA 5T3NA 3H8XA 2D6LX 4UAPA 3MFAA 4IV3A 5JUVA 2J1SA 3R4DB 4PIYA 5FK7A 4XJ8A 5CB7A 3K3OA 2LS6A 5A80A 1X8EA 2CDPA 1C3HA 4Q0UA 4A7ZA 1BEV3 4GMP1 1QJEA 2ZXQA 4LBMA 1D0GA 4YWAA 3NL1A 2HWF2 4BIFA 1GWLA 5FQ0B 4OLLA 2HWE2 2XBO2 4EN7B 4DPNA 2BGPA 4IEYA 3FJSA 3FHAA 5EWSA 3USSA 1ZRIA 4IE7A 3H0OA 2WNEA 4PIXA 3SH5A 4WVMA 3EJKA 5LA1A 1SCSA 3RZLA 4Y4YA 3W9AA 5LZ6A 2RS11 3IM0A 5AC92 2A6XA 3LDRA 3VB9A 3HD8B 4ISQA 1D4M2 4F83A 1SFPA 4QHBA 1ULEA 2QUOA 3L2HA 1JUIA 3LPGA 1R082 3OUIA 2Q1FA 3VHNA 1H2NA 3WT3A 2WT1A 4B4QA 2VCCA 4TYSA 3ES4A 1TZOA 3J9SA 5A6QA 1AX0A 2DUQA 5GZDA 1K5MA 4L11A 1RUC2 4QPWA 2B4KA 1GLHA 1XNBA 3VDCA 1NYWA 5A7WA 2HWF1 3PHMA 3B93A 1LGNA 4NHYA 1HB1A 2V72A 4MLOA 4YSFA 3KV9A 4CUGA 3IAPA 1F5JA 2WNVC 1RITA 2JG8A 4CDUC 3OGRA 3MIBA 3H1WA 3SCGA 1AF9A 4ZZ8A 3WP4A 1HV1A 1RMU1 1OOPA 4ARXA 1OLRA 1SACA 1RUI3 1DZQA 4RQPA 2GU9A 3H1YA 4GAZA 2ZGPA 1UYXA 3OPZA 3VDBA 4ES8A 5IVEA 4A45A 2HWD1 1WMEA 1RUD3 3H9AA 2J22A 4MGTA 4EN9B 2VY0A 3CZUA 4FOYA 5CZKA 1IQAA 4AHXA 4R8HA 2YYOA 5BY5A 3DECA 3Q9OA 5FY9A 3D6EA 3H1MA 4AL9A 2XMLA 4N9IA 2XHNA 1IS4A 3OYWA 2WA4A 5I0UA 1W6OA 4XTMA 1UNBA 5C9AA 1BQPA 1NY72 1HQNA 3VHPA 5C3PA 2RMU3 3LEIA 3KLSA 2O8QA 1W9FA 1ZZBA 4LHKA 4OVEA 4DXSA 3V0BB 4CVUA 2VZQA 1TNRA 2VUCA 4YW4A 1LOFC 4NN0A 2IFWA 2PA7A 2HWF3 3A0NA 1O4TA 5D1IA 3CJXA 4FCAA 3THDA 1PGL2 1NLSA 2W9XA 3I8TA 3IWZA 3QCWA 2D3RA 2VZTA 4BISA 5JVVA 3ILNA 2DV9A 1G9FA 4GIQA 3POBA 4R9DA 4WVWA 5I0DA 1SBFA 4JGZC 4HETA 2WN3A 5C8CB 3AFGA 4XILA 3WDXA 4DNYA 1PZ8A 2DFBA 1AJOA 5ANQA 2WYSA 3ZXKA 2CDOA 2PLV1 4YZ2A 3H42B 3C2UA 1VMHA 3VKLA 3M70A 1HRI2 3I7DA 3D0JA 2RM23 1J1LA 1ZBE3 3J8F1 1KFXL 3B3QE 4DRRA 3D5OA 4AEKA 5LK5A 1C8NA 5FY7A 2ZGKA 1LHUA 1ZX5A 2DU0A 4JDMA 5C7GA 2Y0IA 2PHRA 1MEC2 3LA7A 1RHI1 2HEYF 3J7NA 4LHSA 1B35A 4AK3A 1LHOA 4J6GA 1VLNA 4K1YA 3FUOA 4OZXA 4AQSA 2AEYA 2QQUA 1AJKA 1VR3A 1JYNA 2B45X 1ASJ1 4B3NA 4ES9A 2P37A 1D0HA 4KWKA 3RZJA 3INAA 4GH4B 1RUC1 2FDKA 1TG7A 1SBDA 3T09A 4WM7B 1NKGA 1X9PA 4RR3C 3D82A 4CYDA 4P9JA 4FT8A 3I2KA 4IEVA 3V0AA 3EQEA 4MYEA 3OBAA 5BNOC 1O4YA 1RUJ3 3OY8B 2EAKA 1JYWA 2XJRA 2WS93 5FRAA 2GC0A 4BMBA 4G4FA 4WVMB 2PFWA 4YFWA 4PJYA 2Z42A 1CPNA 3GHMA 3HQXA 4QXHA 4MOAA 3WX5A 3ZFGB 2QZ3A 5DQ0A 2GMPA 1S2EA 3AKPA 3LZZA 1K45A 3ZM8A 1AR81 2BJSA 4HLTA 1O3QA 2OPKA 1B35B 5KHJA 2VUDA 1PVC3 1PX4A 1W6QA 3TAYA 4DZGA 3NQHA 2WFF3 1JYVA 1W6NA 4BXSV 1IOAA 1UO9A 2OW4A 5BNOB 3OD0A 2AGSA 3WV6A 3AKQA 1MS5A 1UZYA 4Q2FA 5L19A 4Z82A 2P2KA 4URTA 1GWMA 4D6SA 4QU1A 4EWAA 2J1RA 4Q4Y3 1W6PB 1QJX1 3NV1A 4COVA 3VZLA 1COV2 2R7EB 3OBTA 2YPJA 5T5OA 1H2KA 3ZFFC 4AEDB 5H9PA 2Y60A 2YC2A 4BE3A 4FPKA 4BK4A 5IFPA 2Y6GA 5DG2A 1GBGA 3D4KA 4OHWA 2YHJA 1CAUB 1Q43A 2IXIA 1LODA 4RHV3 3OOXA 3RMXA 4P5HA 3WQ0A 2OS2A 2RDRA 3AMQA 3PUIA 2DCJA 3SNMA 5GLWA 4XAAA 2Q1ZB 4M3CA 4YVSA 2GH8A 2Y33A 1S0GA 3OSDA 4Y33A 1HN0A 1MQTA 1VB2A 3VZJA 3WCRA 1CGPA 4K7JA 5ISLA 4H7MA 3N9PA 4LBJA 5DUWA 4FAHA 1SLCA 1CONA 1W6QB 4XFCA 4DQAA 4BLIA 3WR0A 3DL3A 3JD73 4AFCA 4CEWA 5CFCA 1HRV2 4YVWB 1V6MA 1SEFA 3UNPA 2JEMA 5FZ6A 1A3KA 3MLKA 1TME2 5F6KA 1HRV3 3TNPB 4EE2A 1AYM2 3EXUA 2QTWB 2GNBA 1PK6A 3E97A 1W8FA 2JG8C 4XBQA 4FPYA 5FXVA 1LOGA 1U5YA 2JDMA 4PDWC 3BIEA 2RS33 1YIPA 2VOTA 2WC2A 4SLIA 5LRSA 3I49A 1NA1C 5A6XA 1FNZA 1SLLA 2DVFA 2E31A 2XWJB 3T2PA 2GNTA 3WDTA 2VC9A 2D6PA 4COUA 5L7OB 3VBUB 3ZXAC 5L7OA 4XMIA 5FZ1A 3H8UA 1BEV1 3IBMA 4CCDA 5JMCA 1VRBA 4HSJA 2DTWA 1CZVA 3C7GA 4LO6B 1JODA 4HKLA 1AR91 4WVVA 2HBUA 2F4PA 1NUKA 3J8F3 4O61A 4V2VA 4WZFA 2OUJA 5FO7B 2HYXA 4AI9A 1GU3A 2X29A 3J7MA 5ERLA 4Z2AA 4YZ5A 5M0TA 3OUJA 1LGBA 3CEWA 3VBOB 5JXJA 2BVBA 1LHNA 4KMQA 3W20A 3AKTA 2DUPA 1GICA 4LBQA 5A3PA 1OBNA 1EAH1 1GNZA 5CFCB 5IVJA 1C4RA 1ZRRA 2GALA 4XIOA 3MICA 1EPWA 3CL1A 1UY3A 4S2FA 1MS4A 4DO0A 4DFSA 4P9GA 1RUOA 1ZNPA 5GZEA 1H9PA 1WCDJ 4UW6A 5BNNA 4UFHA 4Q27A 1C5IA 1A6CA 2DUOA 4UFLA 3U37A 5KHGA 4FFIA 3NJZA 4FP3A 4QGLA 4R9BA 1NCRC 4IGPA 1BEV2 4CDUB 1NA1B 5FBJA 3POGA 5C4WC 2GN3A 1QXRA 2Z2SB 1ENSA 4FXGB 5FR3A 2VW2A 1CD3G 1POV1 2G4IA 2VNRA 2GP3A 4KWLA 5A32B 4IE5A 1JYTA 3UYJA 5EV7A 2XJSA 5FLIA 1DLLA 1FAYA 1U12A 4C91A 4EZHA 2VZRA 3I97A 2DCYA 3WDVA 3FFZA 3FHQA 3ZFGA 4JRLA 1ZM1A 1EUTA 3I2FA 4QHZA 1ZREA 1W90A 2A1XA 2Q5TA 2WUHA 5F32A 2RG4A 3NVCA 2BNMA 2XB6C 3NAPB 4FPCA 3M3OA 2R0HA 4Q4V2 5A7OA 3PL0A 1FATA 2F17A 5A70A 2WWUA 3QD6A 2Q8EA 3ORJA 4AEJA 5I8YA 1AR72 1U5XA 5FZOB 1MVEA 3RYKA 3VDDA 1K3IA 3AYCA 3J26N 1IS3A 2E63A 3AL5A 3NJYA 5A3WA 4LPLA 1R091 1RUE2 2GMEA 4JGYB 1SHWB 3S7IA 4MXWB 1AX1A 2OQ6A 4UF0B 3ELNA 5F3IA 2WZR2 3WNNA 3ETQA 2IXCA 1SG3A 2VR4A 4CEWC 5IVBA 3VBRC 1S2BA 1YO8A 5FYCA 2ZKNA 1AYM1 1AYN2 3LGRA 5FO8B 3GXUA 2JWPA 2XJVA 3KS7A 3G6JB 5KHKA 4Z8BA 2Y6KA 4BMEA 2X5IA 2VMHA 2D44A 2ZA9A 2XJPA 3EB7A 1F5FA 1K5MB 2BOJA 3NKGA 3WINE 1XU2A 4CDXB 4KWJA 4MXVA 1GQGA 3VKOA 5ACA3 1AX2A 2WQ8A 2XLFA 3AYDA 2VH9A 2JE9A 4K1ZA 4M0NA 3RVHA 3ZYRA 4ATEA 4CCCA 4HXCA 1ENRA 1GZCA 1YLLA 3EMRA 5LEKA 2WWSA 2O0OA 2AUYA 4D94A 2VW1A 2VMDA 4XFFA 4BB3A 2ZPXA 3L9JT 5FKCA 1DQ5A 2OIIA 3USUA 5BYNA 3VN4A 4I3PA 1J84A 3ZIWA 2R043 5LCWL 2W52A 3LFMA 4CU9A 2VUJA 2A7AA 4CTEA 4DUXA 2E9QA 4YGBA 4I30A 3CNAA 4YPJA 3RI8A 1EV12 3MEPA 1LCLA 2DCKA 5FZ9A 2MHFA 4Y20B 2HWB2 5JZGC 4QDSA 3I2IA 4OQ9A 4JGYA 1AUYA 3OEBA 1HB4A 3H3ZA 1HW5A 4BQWA 2W87A 3BUCA 1NCRA 2WO7A 3WF0A 4WZCA 4Y26A 1QWRA 1VMJA 3HPNA 3UGHA 3ACFA 3ZDVA 3OF1A 1JXNA 3Q8CA 5LEJA 2B9VA 2NP0A 4NHXA 3V64A 2VTFA 2RS52 4K21A 4XF3A 3KT4A 1YQ6A 5F6LB 3BTXA 1LESA 2YC4A 2NMOA 4YG0A 1AR82 5FYTA 3VL9A 4UW3A 3AZZA 4RS5B 2TUNA 5KC5A 1HQLA 4GB33 1UWWA 5EPAA 1LKNA 3A0KA 1US3A 2E26A 4ZS2A 3S30A 4OMCA 3N7JA 3U07A 2WZR3 2YZ4A 4GD4A 1LOEA 3MUY1 1GOGA 4YM0A 4PI0A 5ABJC 4W6WA 1BJQA
chains in the Genus database with same CATH topology
2CV6A 3VBRA 1MZ6A 3KCCA 2K0GA 4CP2A 1F9KA 1LU2A 4MV2A 1ENQA 2MPFA 1QU0A 3WHTA 4L2NA 2RE9A 4GXLA 3RRDA 4H7LA 3TB0A 1LOFA 2A3XA 4RQPB 3K48A 1XNCA 3WQ1A 1ZBE2 1RUF2 1NQDA 1V6NA 4N7UA 1XXNA 2A3YA 2AREA 5LK7B 3MIFA 5GZGA 1W39A 2UYAA 2ES3A 1G86A 4LO4B 3D0SA 3MI8A 4KGGA 3JBG3 2QFEA 1KD7A 1WGPA 3M3QA 4JGZA 1AL22 1S0IA 5J96B 1WW4A 3WDYA 2R1BA 2A70A 3OBRA 3SHRA 4BA6A 1ZBA1 4FQZA 4Y24A 3TN92 2CTVA 5J48A 4META 1GANA 1I3HA 1LOAA 3VDDC 1YI9A 1ZYBA 5JLVA 3M7AA 1WLWA 3M3CA 1FOD1 5KXCA 1XRUA 4P14A 1NY71 2ENRA 3MGUA 5DDJ1 1VBB3 2OUHA 4QQPA 5A3LA 3UJQA 1CPMA 4AFMA 2EXJA 4S2DA 5ACA1 3KCYA 3MDPA 2B7YA 2PQQA 3VBFB 2WNUA 1OA3A 4HKOA 3G7DA 1ULCA 1QXPA 1WBFA 2SBAA 4JVAA 5DG1A 4WVZA 1FV3A 4PF5A 3HN1A 1DGRN 1JW6A 2BUKA 3U10A 1GKBA 2OZJA 4XF0A 1JYIA 1FPN2 4LULA 1HDKA 5GLTA 2C1FA 1MEC3 4QPYA 1AR93 1NXD1 1ENXA 2V5YA 3HMYA 5HI0A 1UIKA 1DZRA 2D40A 4Y20A 1DFQA 1GV9A 5CFDC 1YRZA 4HT1T 5JIAA 4I0BA 1MQTC 4P9WA 1OQDA 1QF3A 2CAUA 3KCXA 1M4WA 4FP2A 2JXAA 1W2UA 2ZZQA 4L92A 5C8WA 3PMEA 3PVNA 4EV0A 4H3WA 1VBC1 2IZWA 1KQRA 3X29B 3OY8A 4Y1YA 2D6NA 4NVPA 1DZTA 4O9EA 1MVQA 3IPVB 4M3CB 3OCPA 2IXJA 4UW5A 4HVOA 2HWB3 5D8AA 2R6QA 3RI9A 2LM3A 2VGDA 3DPRB 5HXVA 2TEPA 1X33A 1T6GC 1LU1A 5K0UC 2B39A 2ETEA 1AR63 4CEYB 5JOZA 4EN8B 2H6BA 3P3NA 1SLTA 3VDDB 2A6ZA 5I8SA 3HAGA 3VZOA 4LO5B 3QLQA 2DCZA 3LOIA 4FVVA 3RJ2X 1QDOA 1BMV2 2GH2A 2RMU1 3N3HA 4X6QB 3EHKA 4BHPA 1PHMA 5ACA2 3MW4A 3ACLA 1Q56A 2IWGB 5JOYA 4MX3A 4NPRA 4KL1A 5BNPA 2VUAA 1QJY2 2EIGA 3KT1A 2PHXA 4HANA 1F31A 1VBE3 3ALQA 1UCXA 1L3JA 4Q1RA 2I07B 4RQPC 3U0ZA 1IS5A 1G9BA 3O0VA 1ND3B 1Q5OA 1PIV3 2B46X 5BPXA 4C90A 2DYCA 2YUEA 3E5QA 3N7MA 1LEDA 2KA3A 4QM8A 2GDFA 4HVRA 5BNNC 4YW1A 3QACA 1BMV1 4NOTA 4BYYA 4KG8A 1RHI3 4AVVA 4IL7A 1GZWA 5CU1A 5J36A 1WBLA 4FXKB 2ATFA 4YLZA 1REDA 3WQ7A 4DB5A 2UY8A 3IT8A 4RS5C 2P3KA 2HWE3 2XBO3 3RDIA 1IHMA 3BOWA 4NWWA 2FZ1A 5JSOA 1Q3EA 3FWEA 4FOQA 3VLBB 2FMDA 3ST7A 1YWKA 2PAMA 3VBSC 1JH5A 1I9RA 3R05A 1WMFA 3WG1A 4HN0A 1R1ZA 4JRAA 4Q4X3 5J7MA 1VBD2 1W0OA 4IEQA 2RM22 4Q4X2 1VBA2 3FHIB 3S0MA 1W6MA 4PLMA 3SCFA 1PMIA 2YMZA 4XXPA 1UD1A 2JECA 3IDBB 5JOXA 3ZN4A 1Q8VA 3BB6A 1CX4A 2G9GA 4XQ4A 3U11A 1Q8QA 3ZXDA 2F6BA 2X5IC 1KS4A 4Q1PA 5B2GB 5C33A 2IXHA 1XQNA 3BOPA 4FPHA 3DF0A 4CEYA 1RJ7A 1PO21 1RJ8A 3PLQA 4Q0PA 4AI0A 5F9TA 2PYTA 2UY9A 4Q4Y1 1OA4A 1ZA4A 4QQ2A 2UWAA 3JBG1 4K40A 1ULGA 4LHNA 4XFGA 5GZFA 3VKFC 3WLUA 4EN0A 1O3RA 1ULFA 3AMMA 2PHUA 1AYM3 3HT1A 1O4ZA 4XJAA 1RUD2 1A78A 3AP4A 1V6JA 2KXLA 3M8LA 2YDEA 1H4GA 1QJU3 2VNGA 4HZFA 4Q4V3 1OFSA 4QPGB 4N53C 4TWTA 1RUJ2 1PO11 2ZMKA 2A5ZA 2P3IA 1D2QA 3WUDA 1GFF2 4P9LA 1CN1A 1V9U2 1EY2A 1QOOA 1EYBA 1HX6A 4CDQA 2D6OX 4YVSC 1SLAA 1EAH3 1ZZ6A 2ZHNA 4DY5A 5DZEA 4AEMA 1QH6A 3I59B 4ZKTB 2A6YA 4BPZA 4LO8A 2D6MA 3MF9A 3OGGA 4YNIA 1NG0A 3ILFA 1MS9A 1Z78A 3TYJA 2FQPA 1PO23 1I1EA 1J3PA 2UYBA 5FPXA 1G9CA 4HKWA 1PNFA 1RINA 1YYNA 1VBE1 3URFA 3VUOA 1C28A 3GBWA 1UMZA 3E6DA 2XKPA 4B8EA 3KMHA 3ZVXA 4HVQA 4Q8KA 1V6IA 1KFUL 5JAXA 1PGW2 4GKXA 4GALA 1MZ5A 3N36A 4KQ7A 1VAKA 1TQ5A 1XNDA 1UN1A 2Y38A 1MR5A 1UPSA 3UL2A 3IDCB 1ZBA3 2BGCA 3JBG2 1WD4A 1QKQA 4F3JA 1MQTB 3V56A 3M1HA 4N9HA 4BM8A 4RD7A 1K5MC 2RHPA 4AWDA 1PO12 1TME1 1XE8A 1ZZCA 3LSDA 5T52A 1WD3A 2ZHMA 1MEC1 4YW3A 3POYA 1C57A 1I6XA 5FO9B 3GHNA 2ZGMA 2ZGNA 1AR92 1U5ZA 4LEJA 4FPGA 1ND2A 1V9U1 1QOTA 4AI3A 1HRI1 4XJ9A 2ARXA 2EA7A 1C8M1 5JZGB 1N1SA 4MSVA 1QDCA 3E5UA 1B35C 1PZ9A 2WJSA 5JPNB 2V09A 3UKNA 5BXXA 3BTAA 1ULDA 1DDLA 2RJKA 4LHLA 3VV1A 4LBQB 3NWKA 1RB8G 1RGSA 1VAVA 1PGW1 2Y0OA 5T5PA 3VBSA 3ZN6A 2BFUL 2MNGA 4FPEA 4QQHA 1FNYA 2H0VA 3WP5A 3WG2A 2NMNA 2Z5WA 4YZ4A 3TRSB 2XVKA 3DUIA 4KU7A 4M0HA 2PHDA 5A33A 2P34A 4L97A 3VKMA 2ET1A 1DQ6A 1UAIA 2A6VA 4KH9A 4XEZA 4GB31 1H0BA 1R1A2 3LA2A 1OI6A 3LCPA 5L36A 4NHKA 2X53S 2BW8A 1U0AA 2R16A 4V1PA 2FZ2A 3R4SA 1SDWA 5CFDA 1RVF2 5T54A 4GWNA 4YM2A 1LGCA 2WS91 5FPZA 1FXZA 1ND2C 1H2LA 4YVSB 4WV8A 3SLIA 1TMF3 3AZYA 4JAAA 3EBRA 2NLRA 2ZGLA 5JPMB 4TZDA 4WM7C 4CDUA 4NR1A 4RGAA 5AVPA 4JC1A 2VMGA 2BWAA 2EXHA 3O14A 1WLCA 3IKWA 2EAAA 3IDEA 4JDOA 4BLJA 5GALA 5CFCC 3B02A 3OGJA 3AB0A 4LO7A 4M00A 5K0UA 3ATGA 4I02A 4XZPA 2CGOA 1POV3 2XLAA 3SH4A 2R041 3CF6E 2ZS6B 4XFAA 1UU5A 5EXOA 3VBUA 1RVF3 1G9DA 5SV5A 5KBFA 2VW0A 3MYXA 4KU8A 1EV11 5L7OC 2AZ5A 3ZYGA 2BNOA 2CL2A 2ZHKA 4XF1A 3QH6A 3RYPA 4AVBA 2JG8B 2PHFA 4OHYA 3T1LA 5BNPC 1IKPA 2VNOA 3WW4A 2XVGA 2BTVC 4I3GA 3ZFEA 4AVCA 1OQEA 1IPKA 3AXDA 1DG6A 3ZSEA 5DUUA 3B94A 3FMGA 1QJX2 1ALYA 1NLRA 3B01A 3EO6A 1B09A 1OD5A 4K8FA 4I2OA 1QJU1 1Q8PA 1FYUA 2R042 4HMZA 4N43A 4NHMA 1DHKB 2UURA 2RS31 1PIV2 2GAUA 3MPBA 2W39A 1LOBA 5CFDB 3PMSA 1Z7S1 4QPGA 2HWC2 2JJ6A 2BEOA 1POV0 4OUSA 5EFUA 1RVF1 5FCCA 3LKJA 1CQ9A 2NQYA 3AMNA 1LB2A 4W65A 3MZHA 4AXOA 1OPOA 4M3CE 2Q4SA 3QOPA 4RA0A 2R063 5GJ6A 2K2SA 4MGYE 4FTEA 2FBEA 2GNMA 2DCTA 3MFCA 4C1XA 3WD5A 3GYDA 2D3PA 1BVVA 3CLPA 3APBA 4AVSA 1QJU2 2CWSA 4CEYC 4LE4A 3VBUC 2WFF1 5FFOC 5IUQA 5ABJA 2ZGTA 4ATFA 3WDUA 1MS1A 1NXMA 1APNA 4MUVA 1UF2C 5HCBA 2YY1A 1CAXA 2Z79A 1Z7S2 1G7YA 3VBHC 1SQ4A 2D98A 2BYVE 4W6XA 3ZIXA 3M3EA 2GZWA 1W6OB 2ZCWA 3MIDA 4MH0E 4QT6A 3O0XA 2B42B 2PAKA 4WBBA 3PVOA 4UBHA 3NV3A 2BNNA 1RUG3 4H55A 4Q4V1 5GM0A 1WMDA 3LA3A 4QX5A 2RS53 1GZWB 1CR7A 2BVVA 4FOWA 4Q26A 5FREA 5FOJB 4AI8A 1S55A 5C6CA 2O8OA 1SLBA 3AJYA 4XJZA 3ES1A 2CGNA 5CAZA 1REFA 1Y3TA 2WZR1 1BKZA 3ZFFB 4COYA 1RUH3 3A4UA 4BQ1A 4YVWA 1FMD1 1HXS1 2PTMA 4LBOA 3TNQA 1V9U3 1PGSA 3RSJA 3ZN6B 5DDJ3 4COWA 2D6KA 3K51A 4FPLA 2R072 1VIWB 4ONUA 2BWCA 3UJOA 1SCRA 3NW4A 1EP0A 1U5IA 2TNFA 2WL1A 5K0UB 4ITCA 1ND2B 1G6NA 2I2SA 3AP5A 4E4ZA 2O1QA 3SISA 3MW3A 1Z0HA 2QDNA 4XJWA 5H9SA 2VOXA 2HWB1 4D3WA 4LBQD 3AMHA 1NCQC 1PIV1 4JTOA 2R062 4DMIA 1UW8A 4G3YC 4X8PA 3FLTA 4MGZE 4YGEA 4OI1A 4S2GA 1RUF3 5JOWA 1RUI1 4MZUA 1BK1A 2W68A 4Z07A 5L73A 4U36A 1H8TB 3N35A 3DPRA 2GC1A 4QQLA 3MF6A 2W0XA 2PELA 4K3UA 3ZO0B 1CIWA 4YG3A 1TME3 1AYN1 3LAGA 5CIRA 2E6VA 3KB5A 1S0FA 2D43A 2YV8A 4XHXA 1OFNA 1R083 3O5SA 2JX9A 4HL0A 4LBKA 2AR6A 1X8MA 4JCKA 4OUMA 2WKKA 1RUD1 3M4FA 1QJY3 1QJX3 1VRH1 2AENA 4CDWC 4KBBA 2WA3A 2Q1MA 3VHRA 5KXBA 5JCTA 4CDXA 3JCIA 5IK8A 2WINB 1DGRA 4Q4W3 4D69A 4XBLA 4ASMB 3AZVA 2WNVB 4JGZB 1RUF1 5FMOL 4I09A 3DPRC 5E1RA 2WZPP 1REEA 3JB8A 4IV3C 3QBQA 3JQWA 5FLHA 1QQP1 1VBA3 2CWMA 4I0AA 4RFT0 1DIWA 4QXKA 4QPIA 2WT2A 3SITA 2ILMA 4GMP3 1SFYA 2I74A 2R30A 4AVAA 4I0WB 3WUCA 3KSCA 4COZA 5J3UA 2ZGUA 1R093 1JHNA 4QGNA 4XQWA 1DQ1A 4LBLA 5DUVA 2YROA 4CEWB 1FPN3 4XFIA 4P9XA 4WM8C 2ZGQA 1BCXA 1YFUA 2OYZA 2WT0A 5A32A 4FBFA 4JDNA 2VQ0A 1DYPA 4JQRA 2ZBJA 1OMIA 3ME2A 1D4VB 1EAH2 1CAXB 5FDBA 2NM1A 2UU8A 1PK6C 4YYOA 1TMF2 4QD2A 4PDWA 1C8M3 2D3SA 1H8TC 4E2SA 4AEDA 2A73B 3GNEA 4GULA 1DF0A 2ZJCA 3O0WA 1IGOA 3D8CA 2C5DA 1N3QA 4FTBA 2ZTNA 1TEIA 4EROA 2HEWF 1QQP3 1VBA1 3TN91 4IEXA 1R092 1RUE1 2E53A 2DU1A 2JICA 3AYEA 5DXDA 5E88A 5E89A 5T50A 3RMYA 5KHHA 2CAVA 4R52A 1V6OA 2DURA 1VBB1 2JG9C 3RZZA 5IK5A 4FAGA 5E8AA 2MEV3 3VZNA 1GR3A 5KHIA 4Q4X1 1H30A 1PO22 3FLRA 1CJDA 3AMPA 3CJIB 1OLQA 4WM7A 3WP3A 3CJIA 2VMIA 1NE4A 3OYWB 5EYYA 2ZACA 3AZWA 4FPJA 4C1WA 1H9WA 3V0AB 5BV6A 2WLQA 3PTYA 1QH7A 2E7TA 4LA3A 2YGMA 3RPQA 4IQPA 2WQZC 3PVEA 1S1AA 3VBRB 2ZMLA 1IKQA 3L2YA 4P9IA 3HIFA 3ZXFA 3FBMA 1Z7S3 4CDQB 5K7PA 3AK0A 4RHV1 3ROUA 4XXAA 3B00A 5T5LA 4AFBA 2HYKA 1NZCA 2HKXA 1YHFA 1CJPA 3CU7A 2GN7A 3ENRA 3DKWA 2JKBA 1DU3D 2TBVA 2XVLA 5AVAA 1JOJA 4OULA 2XPJA 4NHLA 1W6PA 2WNUB 1QHDA 3IMNA 4K20A 4B4PA 3OD4A 4PDWB 3VBFA 5GLUA 4IV1C 1H2MA 5AFBA 4ISRA 3LB9A 5C8CA 3TWIA 1LRHA 3V0BA 3ZXLA 3AYAA 4AI2A 3B5LB 2RJLA 3KQRA 4YZ1A 3IPVA 1VJ2A 4AFDA 4UBGA 4YG6A 3W58A 1UIJA 2X8KA 1YNAA 1V6KA 3LWCA 4CDWA 4DINB 2LALA 1J58A 3PNAA 4A3XA 2BPA2 4AW7A 1HRI3 4B7KA 1TNFA 1F2NA 2E7AA 5HCFA 5DZGA 2HJIA 4FPOB 1RUH2 4ASLA 4RHV2 4NO4A 3JB4C 1V6LA 4FQ4A 1UPIA 3CJIC 1VBB2 3RJRA 2QNKA 4MGKE 1MS3A 5KXEA 2WFPA 3ZMOA 4LA2A 1N1TA 4Z92B 2LUWA 1URXA 4IEUA 3AP9A 3ASIA 4DXZA 5AFEA 3MLLA 1C8M2 1KXGA 1KJLA 1HQWA 1X50A 3UKVA 3TN93 4YGCA 2PLV3 2BBVA 3NAPA 5J98B 5JWPA 1FX5A 4GMP0 4YM3A 3ZSKA 1S0BA 4YZ3A 1QXJA 1AR73 4BCUA 3R0RA 4ZU7A 3WG4A 4JGYC 1ZRCA 4ORFA 2DWRA 1QJY1 4H14A 4OHZA 2D7FA 4RR3B 3JD71 1NA1A 4E4DX 2JENA 3MLJA 1R081 2XUMA 5FMOS 2XJTA 1UKRA 5C9AB 1R1A1 2A6WA 2RS12 3VZMA 2AYHA 1FV2A 5I8TA 1S2KA 4HPKA 1LHWA 5FOBB 2P3JA 5GLZA 4HPKB 3WOGA 2ZGSA 4L99A 3VHOA 1H4HA 1RMU2 4AVTA 1NOVA 2D97A 2WQ4A 4O9GA 4XJ8A 1BXHA 4AQ2A 4MGIE 2CNAA 2VU9A 1COV3 4K6BA 1GNHA 5C8CC 4Q4Y2 2P17A 4YW5A 2VVFA 3WVJA 4BIOA 3KGLA 5C4WA 1Q8OA 1LECA 2ZABA 1BBT2 1VP6A 5I91A 3ZSLA 1ONAA 1Y7BA 2EF6A 4XFHA 5EYXA 1FT9A 2WIIB 2XH6A 1WW6A 3LSEA 5HCAA 3MPPG 2XJQA 2HWD2 1PVC2 4TSVA 2IXKA 1XYOA 1M06G 5DUXA 3ZX7A 3BIWE 3N7LA 1WLTA 3RNSA 3O12A 2H6CA 2DVGA 2GC2A 5AC91 4Y1ZA 2UWCA 4CDQC 1QY4A 4R9AA 4AI1A 1YFWA 4XPVA 1WUVA 1CESA 3N4MA 4SBVA 1QMJA 4CDXC 3ZSMA 4YGDA 3WCSA 3WY6A 3WW3A 2WLPA 4GQ7A 4XETA 3SCHA 2VULA 5CA6A 1EV13 4W6YA 5EZWA 1OOPB 1BBT3 3MIHA 1FI2A 4WM8B 1BJQA 1GYKA 5CG8A 1RUE3 3ZSJA 2OA2A 1PNGA 1AL23 3T2TA 3GF6A 3ECQA 1VAMA 2CY6A 1MS0A 3JD72 3P3PA 5IT6A 4AHYA 5J37A 2SLIA 1OKQA 5KXDA 4N7IA 4A2UA 2PLV2 4L8QA 4M3CF 4A7KA 2VOVA 4X6RB 3ZPYA 3GZTB 3THTA 4B29A 1WLDA 1NQJA 2PN5A 4AGGA 1O5LA 3J4UH 3FFQA 1H8VA 4E27A 2OZ6A 4Q0VA 2FHRA 1G8WA 1FOD2 1RUC3 2ZX3A 3VL8A 3JUUA 4RS5A 3BALA 2K9ZA 1H8TA 3POWA 1RUG1 2XKOA 3GBGA 4MVTA 3NV4A 3JU9A 1BBT1 4G9SB 3SXWA 4DOUA 1SLIA 2VECA 1YI7A 1HIXA 4N90A 1XYPA 3N7KA 5D8AC 1AR83 3AKRA 1ZRFA 4QMAA 5GLVA 4AEDC 3E6CC 4C0BA 1PVC1 3NO8A 1DGLA 3ZXEA 5I93A 1J3RA 5I0SA 3ZXGA 4ZXKA 1PVXA 4XFBA 4F7ZA 4LUMA 1FOD3 4MXWA 4KNCA 3I54A 2R1DA 1O91A 2VVDA 1ASJ2 2QE3A 2ZOEB 1WCKA 3VBHB 2ZX1A 3FUQA 4LR4A 2VVEA 1QNYA 1J1TA 4LLFA 3E6BA 1TE1B 4PCRA 3RQ0A 4I01A 1YUDA 2EXIA 2A3WA 4Q29A 2BFUS 3NKTA 4IERA 5IK4A 3TOJA 2QKDA 2QVSB 4Y22A 1KS5A 3B9CA 1UU4A 1KDKA 4IEZA 1YFYA 4HSLA 4OHXA 3WDWA 3HR9A 3VBOC 2XG3A 4PLOA 4FSJA 2B9UA 4X8NA 2W08A 4KGQA 1MZFA 2Q0AA 2QQPA 4QPGC 4JTNA 4YM1A 4AQ6A 2ZGRA 3KGZA 4GB32 1NE6A 5FLJA 2Q30A 1ASJ3 3JQXA 4N43B 2R49A 5GZCA 3ZYPA 3H7YA 1AZDA 1C1FA 3H3UA 3RYRA 5BNPB 4IV1B 4Y22B 1RUG2 2XL9A 1RTVA 4D7YA 4IETA 3MIGA 3U4XA 4QPIC 1N3PA 2LTNA 3AP7A 2JD4A 3POSA 2A75A 1LOCA 4Q8LA 5D8AB 1O3TA 1YJKA 3USUB 5K9YA 1RUH1 1BZWA 2YGLA 3IN9A 3KD4A 3ZFEB 4JV4A 4WM8A 4Z1VA 5TSWA 1JUHA 2PHWA 4HK9A 1J3QA 1IPJA 4LNVA 2A71A 3AJZA 5FBZA 1VALA 1RMU3 3KT7A 5JSPA 2R061 4Y1XA 2JDZA 5SV8A 4YFZA 3FC0A 1C5HA 1OSGA 2XLGA 2ZHLA 1AR71 4Q0QA 4Y1VA 1YFXA 3T1MA 1GZ9A 1H1MA 2H0BA 1IZ3A 2C0ZA 3H50A 3ZFEC 3H7JA 3AXEA