4QPGB

Crystal structure of empty hepatitis a virus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
204
structure length
204
Chain Sequence
b'GASYFTSVDQSSVHTAEVGSHQIEPLKTSVDKPGSKKTQGEKFFLIHSARWLTTHALFHEVAKLDVVKLLYNEQFAVQGLLRYHTYARFGIEIQVQINPTPFQQGGLICAMVPGDQSYGSIASLTVYPHGLLNCNINNVVRIKVPFIYTRGAYHFKDPQYPVWELTIRVWSELNIGTGTSAYTSLNVLARFTDLELHGLTPLST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Hepatitis A virus and the origins of picornaviruses.
pubmed doi rcsb
molecule tags Virus
total genus 28
structure length 204
sequence length 204
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qpgB00
1RUJ3 4RQPC 2HWC2 4IV1C 2RS51 1BBT1 1HQNA 1COV1 4CEWA 5JZGA 1R093 2VQ0A 1PIV1 1K5MA 1HRI3 1HX6A 1BMV2 4PDWA 5ACA1 3VBSC 2R061 5BNNB 1VBB1 1PGL2 4CDQC 3VBOC 2MEV1 4CDWB 1BEV2 1HXS1 3VBFB 1MQTB 1AL23 1NCQA 4JGZB 4YVSA 5AC92 4CDXC 2BFUS 1K5MC 2XPJA 1RUE1 1MEC1 1VAKA 5J96B 3JBG2 2R073 1SMVA 2BFUL 5CFCC 2R041 1QJX3 5C8CB 5CFDB 1D4M1 1V9U1 3DPRC 5K0UC 5D8AB 4AEDA 5J98B 1ZBA3 1RUJ1 3JB4C 4SBVA 1TME2 4WM8C 4YVWA 1R1A3 2RR13 1NCRA 3ZFFA 4GH4B 4Q4V3 1AR73 1EV13 3ZFGC 1TME1 1H8TC 1RHI3 4CDUC 1EAH3 2WS91 1ND3C 4N43B 1RUC2 3VBRC 1OOPA 2PLV1 1NY71 1AR81 2X5IC 4RS5B 4CEYA 2RS53 3S6PA 1BBT3 1COV3 2RS31 1FPN3 5L7OC 3NAPB 5ABJC 1R082 3TN92 1VBD2 1PIV3 5DDJ3 4N53A 2DF7A 3M8LA 1WCDJ 4RR3A 2R071 5LK7B 1B35A 1OOPC 1ZBE2 1VBD1 2MEV3 1QJU2 2WFF2 3JD72 1C8M1 1HXS3 4QPIB 2Y26A 5BNPB 1PVC2 1NA1B 1POV1 3VDDB 1FOD2 4RQPA 2RR11 4IV1A 1BEV3 2XBO1 1RUE3 1MEC3 1AR71 1AUYA 1E57A 4IV3C 1EV11 3CJIB 2R043 1QQP2 1FOD1 1V9U3 1RHI1 3VBHB 1EAH1 3LOBA 4QPGB 3FBMA 3VBSA 3JBG3 4CDQA 4WM7B 3VBOA 1F2NA 5BNOB 1W39A 1FPN1 1VBA2 5DDJ1 4CDXA 1A6CA 1Z7S2 2HWC1 1TME3 1RB8G 5JZGB 4CEWB 1OHFA 4FTBA 4JGYB 1RUF2 4FTEA 2WS93 4Q4W2 5C4WC 3J8F2 2PLV3 2RM22 5CFCA 1CD3G 1AR83 3VBUC 1TMF2 3DPRA 5K0UA 4QPGC 1BMV1 4PDWB 1AR92 1ND2C 1QJY2 1ASJ2 2RS33 4GB32 4RFT0 1RUH2 1PGL1 4NWWA 2RM21 1RUD2 1PO22 4WM8A 1BEV1 1AR62 2WLPA 4YVSB 5AC91 2RMU2 1FMD2 5A32A 1AYM2 1HRV2 1VBE2 1VBD3 3ZFGA 2GH8A 1H8TA 1C8M3 5BNNC 4CDUA 3JBG1 1ND3A 3VBRA 1ZBE3 4CDWC 1VBE1 1POV3 3VBFC 1MQTC 5FMOS 4JGZC 2X5IA 2WFF3 3JD73 2XBO3 4AEDB 2HWB2 1CJDA 5L7OA 1VRH2 5ABJA 1IHMA 1PVC3 3ZFEB 5FMOL 4YVWB 1FOD3 1R092 3ZFFB 1DDLA 5C8CC 5CFDC 1HRI2 1OPOA 5D8AC 4N43A 1RUC1 4Q4X2 4BCUA 5A33A 2BUKA 4RS5A 2HWC3 4GH4C 4CEYB 2ZTNA 1VBC2 1R081 1VBA3 2QQPA 3TN91 4IV3A 1Z7S3 4N53B 1RUG2 4N43C 2ZZQA 2GSYA 1RUF3 1AYN2 1B35B 1ZBE1 2HWE2 4RS5C 4RHV2 2RM23 2HWD2 1RUG1 1QJU1 2WZR2 2WFF1 1TMF3 3JD71 3NAPC 1NOVA 5FOJB 4NWVA 1PGW2 1AR93 1AYN1 4GB33 1ASJ3 1PO12 5AC93 1PVC1 2RS12 4RHV1 1RUD3 1RMU2 1PO23 2WZR1 4IV1B 4Y5Z0 4Q4V2 5C4WA 1FMD3 2RS11 1QQP1 1VBE3 1RMU1 5C9AB 4QPIC 3VBHA 1VB4A 3VBUA 5BNPC 5GKAC 4QPGA 1M06G 1NA1C 1ND2A 3VDDC 3VBSB 1RUI2 3HAGA 4CDQB 2RS52 2WWSA 1BBT2 1COV2 3VBOB 5BNOA 3CJIC 1VBA1 1X36A 1VRH3 4CDXB 1Z7S1 1K5MB 3VBHC 4GMP1 4JGYA 1RUF1 5ACA2 2R062 4Q4Y2 5BNNA 1RUC3 2FZ1A 4Q4W1 1RVF2 1VBB2 3J8F1 4WM7C 4CDWA 5C9AC 2MEV2 5CFCB 5BNOC 2TBVA 1HXS2 1TMF1 1MQTA 3DPRB 3VBFA 4Z92B 4JGZA 5K0UB 1NCQB 1AR91 4GB31 1QJY1 1ASJ1 4Q4Y1 1RUH1 4Q4X3 1RVF1 1R083 3TN93 1RUD1 2HWF2 1PO21 4CEWC 5JZGC 4WM8B 4JGYC 4FTSA 1RUE2 1MEC2 1AR61 2BBVA 1VBC3 2RMU1 2R042 1FMD1 5C8CA 1AYM1 1HRV1 5A32B 5CFDA 1D4M2 1V9U2 2HWF1 3ZFGB 4PDWC 1POV0 5D8AA 1RUG3 1QJU3 1H8TB 4CDUB 1ND3B 3VBRB 1AYN3 1RUJ2 2HWE3 4RHV3 1NCQC 2X5IB 4GH4A 1NCRB 2HWD3 2WZR3 4YVSC 2HWB1 5L7OB 2ZAHA 1VRH1 1PO13 5ABJB 3ZFEA 4LLFA 2RS13 1QQP3 3JB8A 1RMU3 1R091 2WS92 1AL0G 1OOPB 2PLV2 1GFF2 1NY72 1AR82 1HRI1 2BPA2 1AL22 4AEDC 2RS32 3NAPA 4Q4X1 5A33B 3ZFEC 4YVWC 1RUI3 4Y4YA 1NCRC 3ZFFC 1AL21 4GMP3 2R072 4RR3B 1VBC1 4GMP0 1NG0A 1QJX2 4Q4W3 4IV3B 5DDJ2 3J8F3 4FSJA 1C8M2 4QPIA 1ZBA2 1VB2A 5BNPA 5ACA3 1QJY3 2HWE1 2R063 4Q4Y3 1QJX1 1RUH3 1NA1A 4EJRA 3VDDA 1RVF3 1VBB3 1R1A2 4CEYC 2RR12 4RQPB 1C8NA 2HWD1 2XBO2 1ZBA1 1AR63 1AR72 1PGW1 1PO11 1QJZA 1EV12 3CJIA 2RMU3 4N53C 2FZ2A 1AYM3 1HRV3 1R1A1 2HWF3 1X33A 1RHI2 1EAH2 4RR3C 4Q4V1 1B35C 2IZWA 1F8VA 5C4WB 4WM7A 5C9AA 1D4M3 3IDEA 1FPN2 3VBUB 2HWB3 1ND2B 3ZXAC 1PIV2 1RUI1
chains in the Genus database with same CATH superfamily
1VE0A 3HQUA 4NHLA 4IGOA 5JPMB 2W1WA 1FV3A 3I54A 5C3OA 1CAWA 2RDSA 5FPZA 2XWBB 1SLTA 2PHUA 2PQQA 4YGDA 3H8RA 4INDA 3H1WA 4XTPA 5IAVA 3SCFA 4XOGA 3AMPA 3NRUA 4IXLA 2KM2A 4NIDA 2WC2A 1W9YA 1W0OA 5E6HA 2Q1MA 3UESA 3WQBA 2JICA 2V5YA 2XJTA 4AEMA 1V6LA 3M2MA 2DCZA 3PUHA 1WBFA 1A78A 3POFA 3SC7X 2ZGNA 3VBSC 5JPNB 1WD3A 2R061 2DYCA 5LEJA 3VHNA 1VBB1 3EJKA 4BIFA 5C33A 2E33A 3BYWA 4CDWB 3KGZA 4GIQA 1URXA 4RL7A 5FYTA 1A8MA 2WR9A 3ZN6B 5L19A 4QPYA 2RJKA 3VBFB 3CEWA 1AL23 2W2IA 3ABZA 3N9NA 4COYA 4D3WA 1JI6A 3VB9A 3B69A 2A73B 1GZWA 2JDPA 3OBAA 2W39A 4CP0A 3V64A 3WG2A 2Y6KA 4A45A 5IT6A 3BVCA 1W05A 3RWNA 1FNZA 5FPUA 1KQRA 1WCKA 1XNCA 2CGNA 5FK8A 5FY1A 4P9IA 4TXWA 3T2OA 4EWAA 2YMZA 4IE4A 1CAXB 1MEC1 2WT2A 3RZJA 1ULOA 5CG9A 5GALA 2Z5WA 1NAEA 3H1YA 3IMNA 1SMVA 1EYBA 2BFUL 4XE9A 3N36A 2R041 3RJRA 5IK5A 3THPA 3HIFA 3DPRC 2BU9A 2P37A 1TE1B 1UY0A 5FY7A 3THTA 1XYOA 1Q8PA 2J1AA 2Q30A 2ZJCA 1ACCA 1RUJ1 2ZKLA 2ZACA 3JB4C 4Q1PA 4SBVA 5FYUA 4YGCA 1XNBA 2Y6GA 2XUMA 2DVDA 1GP5A 2VCMA 4YVWA 3WNLA 2Y6HA 3I2IA 5DG1A 2RR13 3FFZA 1JH5A 3RYPA 1ULGA 4LEJA 2PMWB 4XQWA 1V6IA 4R9BA 5IAXA 4DXSA 2G9GA 1W8ZA 1DYOA 3FUQA 1I5ZA 2B8MA 2XG3A 3FLPA 3EB7A 3T09A 3HT1A 4LXLA 1XNTA 2BVBA 4QKNA 4LTAA 5JSOA 2A6XA 4BZ4A 3JQWA 2D5FA 3OSDA 5E1RA 2A3YA 4KNCA 1SFNA 1V0AA 4XJUA 2Z42A 1UYZA 2V4AA 3W21A 4Z92B 2WUHA 1OA4A 1JZ5A 3I2JA 2RS53 3B02A 1BBT3 1DF0A 1COV3 2FMDA 3BTXA 4P00B 3GBWA 4IL7A 3ZIWA 1NZCA 4Q5OA 4E4DX 1HB4A 2ARCA 3E5QA 1RGSA 3JU9A 1XRUA 3AKPA 4WVMA 1VBD2 1MVQA 5FR3A 2D6MA 2AH2A 3LWCA 2Z69A 1W6PA 2YC2A 4Q0UA 2BV4A 1WMFA 4LNVA 1S2BA 2XB6C 2I45A 3P3NA 2R071 1B35A 3I3EA 4YYOA 4TZDA 2FDIA 2JDYA 5LW9A 3LEMA 4WZCA 2ES3A 1A3KA 3TEZA 3N3HA 4XURA 1QJU2 2WFF2 1LKNA 3ATGA 4QPIB 2YZ4A 1W2TA 3IN9A 2Y26A 3LE0A 3NNFA 2ZXQA 4HPKB 5FYSA 4COWA 4KU8A 1H2KA 2EAKA 1MZ5A 1OURA 1POV1 1PZ9A 2UWAA 5IYYA 2J1UA 4D0QA 4XJZA 5J7MA 3UNPA 4ZU7A 3ACHA 5L9RA 3WG3A 5FBJA 4ZZ5A 2BNOA 5KXEA 1O8SA 1ENSA 1W0PA 3OBTA 1OXCA 1QOTA 3WP6A 2GNDA 5A7WA 2CDPA 4FPLA 4XFGA 5FZ0A 3IAQA 3ZYHA 2NYYA 3CJIB 4BXFA 3E6DA 3ETPA 4WVVA 2PAMA 1J1LA 1FOD1 1V9U3 4BDVB 2VNOA 4YRDA 3ZYIB 1G6NA 3ACLA 2R30A 3AYDA 2W87A 2WNUB 3U4SA 3JBG3 3RPQA 5JSPA 2JXAA 3K48A 3H1MA 1WLTA 4XBQA 1JU4A 3LFIA 1BVVA 1I5PA 4FT8A 4CDQA 1FXZA 4WM7B 2UURA 4OI2A 1UW8A 2OZ6A 4L8QA 3MW2A 5A1AA 1VBA2 1O4YA 1S0EA 4AGRA 3WW2A 1JW6A 1CN1A 4CDXA 1A6CA 5FWEA 5FZMA 1RINA 5DPNA 3OPTA 3OUJA 4QHZA 2BOIA 1N1YA 4HSLA 3TWIA 4N8MA 3H8OA 1H6YA 2IVIB 3INAA 4XZUG 4FTEA 1PMIA 2WS93 4Y24A 5EZWA 5EYYA 4XCAA 3WDTA 1G9DA 4Q4W2 1MS9A 1UZWA 3K2OA 3MIDA 4W6YA 5T5JA 5AFBA 4K8FA 4CUGA 2JJ6A 2WNVB 1CD3G 1JXNA 4EN9B 2ZX0A 4NHMA 2DVFA 4MHUA 2VQTA 5EYXA 5K0UA 2UY9A 3RQ0A 3QD6A 1N3OA 3UT0A 5A3UA 3QOPA 1AR92 4GB32 5LCWL 4CPBD 3AVRA 2ZGUA 5A3PA 3R4DB 3O1PA 3DUIA 4NWWA 4ZXEA 1RUD2 4E4SA 2HYKA 2RDNA 4Z2WA 3POBA 1DGWA 3C3VA 4MXWB 3J26N 2WLPA 5T5OA 4EZHA 3WP3A 4YVSB 2J1VA 3H8UA 2RMU2 2D6KA 1FMD2 2C26A 3FC0A 1AXKA 4ZS3A 1HRV2 1TZOA 1VBE2 1FNYA 2FDJA 1ENXA 2VZOA 2VGDA 2GH8A 4XIOA 4DXRA 1S4CA 3ZKUA 3AK0A 4YFWA 4KGGA 3N7MA 4QXHA 1MS3A 3NV1A 3HNMA 2JDKA 2DWRA 5ERLA 3ES1A 1ZBE3 4YG0A 1S0GA 4FXGB 3B94A 4QXKA 5FUPA 2X5IA 4XMAA 5LASA 3DF0A 3I2FA 3BPZA 3NKGA 2DU1A 4P9YA 3AKSA 5L7OA 4FPEA 1VRH2 5ABJA 1PVC3 1UX6A 1VLNA 3ZFEB 4Q29A 4MLOA 1H9WA 4LE4A 4XXPA 3PVBB 1GLHA 1V6JA 2P17A 4LULA 3ZFFB 1MZEA 4XJWA 5JMOA 1ZZ6A 1DDLA 1DQ0A 3NNGA 2JENA 4ZY9A 4CRQA 5FQ0A 1V6MA 2ZGKA 3TNQA 1OPOA 3AMQA 1IS5A 4GXLA 1L3JA 3RZKA 1OVPA 1PNFA 1YQ5A 3J7NA 3L2HA 2PN5A 2OT7A 1MACA 3T1LA 1LHNA 2QQUA 2LALA 3QCWA 3ON7A 4P9LA 1Z78A 4LO8A 5DMYA 1HJGA 3TOJA 4RS5A 5GJ6A 1OI6A 4GH4C 3B7MA 2ZEZA 3LF7A 2MPFA 1TNFA 5F3CA 1FI2A 4ASMB 1OUXA 2XQRA 5CFCC 4IEXA 1GNZA 3C8XA 3M3IA 3VD3A 1ZZ9A 2QQPA 2AEZA 3M1HA 4IV3A 4QT6A 1F35A 3NNLA 1Z7S3 2Q8OA 4QDSA 1HLCA 1XNDA 4TTGA 1V6KA 4HLTA 4FPCA 4RGKA 1G9FA 1F5JA 2H6CA 5CA6A 1S2EA 4QX5A 4LUMA 1ZRCA 3C7EA 5FZ8A 3OUHA 3WDWA 1IKPA 4DFSA 2PAKA 3AP6A 4RS5C 2RM23 4AHZA 1MVEA 4J6GA 3IKWA 1S0BA 1MZ6A 1PVXA 1QJU1 1VAVA 1TMF3 2WFF1 1YJLA 4HKWA 3WDUA 1KFXL 1TG7A 5F3IA 1AYN1 3T3YA 1O4ZA 3OY8B 2DCJA 5FZ4A 3GCXA 3PLQA 3VZOA 1OSGA 2A5ZA 3D82A 3WEZA 4E2QA 5JOXA 3W58A 1BKZA 3ZLIA 3U0ZA 2VUCA 5T54A 2Q5TA 1BZWA 1OLQA 2V4VA 3CLPA 4BISA 2FD8A 3LOIA 5KXCA 2RDRA 4AVBA 5HPOA 2WSVA 3VKLA 1HN1A 5FPAA 5C4WA 3POIA 1SPPA 2VZRA 2ZX1A 4P08A 4H7MA 5C9AB 4IEWA 3MW4A 4ZHNA 2P3IA 2BP6A 2XJVA 3JUUA 2VAUA 2IXLA 4JHTA 4DO0A 5BNPC 5GKAC 1KJLA 3VHPA 3ALQA 1PM4A 3VBSB 5DAPA 3AMHA 4DQAA 4PF1A 2DCTA 1W0NA 1LB2A 1RUOA 2D7FA 3HMYA 5K8SA 1EPWA 2QZ2A 1WCQA 3IIIA 3HNYM 1GOGA 1WGPA 4XTMA 1VBA1 3RZMA 3GZUC 1X36A 4H3WA 3WQ7A 2JWPA 4XUNA 2W52A 4CCNA 4ASLA 4BQ4A 5T50A 2VMHA 3KB5A 4LITA 3BPSA 4BQ3A 1T6GC 3O14A 1H6XA 2CGOA 1X9TA 3WT3A 4QGLA 1RUC3 1UKRA 3M4FA 1JN2P 2JDHA 4Q4W1 3S0MA 1NLSA 2VBPA 1W6OB 1NE4A 4CDWA 4YGEA 1GQHA 4JDNA 3ORJA 4H2AA 3POJA 3ZN6A 1JZ2A 3TEXA 1HXS2 3VBFA 2E51A 3DPRB 3WF1A 4I3PA 4ATEA 2W9XA 1AR91 4GB31 1W6NA 3M3CA 4LBLA 5FRAA 4Q4X3 1GZWB 2JE9A 1C5HA 3ACFA 1J3PA 1RVF1 4Z07A 3M7AA 1Y4WA 1Q5OA 2EALA 3PVEA 1RUD1 3B93A 5JZGC 4CEWC 3O1OA 4OUMA 1ENRA 3DN7A 2WO7A 3OYWB 4Y33A 1YXWA 1CAXA 1TNRA 3F95A 1Q8QA 1XQNA 2ZHKA 4WVZA 1QWRA 4YG6A 5IVEA 3L2YA 2RMU1 2JG8C 1FMD1 1HRV1 2WQZC 4D94A 3I49A 3U4XA 2R1DA 2ZGTA 3LFMA 3NJVA 4PDWC 3I3QA 3N9QA 4BQ2A 4FPHA 1RUNA 4W4ZA 2VQAA 3OB8A 4EN8B 2FHRA 2R49A 3DECA 4FPJA 2HWE3 1LECA 4Y3OA 3ZXEA 2A75A 5LY2A 3WF3A 4HK9A 4RHV3 1W8OA 2DV9A 4URAA 3WZ1A 3ZVXA 1W03A 5CKNA 5JMCA 4MGKE 4BQYA 1RJ8A 1UU4A 1RITA 1VIWB 4JCKA 4IE5A 4O65A 2V73A 3GYDA 2ZAHA 4LKSA 1VRH1 1PO13 4FPFA 4CP1A 1W28A 4AI3A 1HJFA 2WQ4A 3DYPA 3SEPA 4CUBA 4DOUA 1I1EA 1GQGA 1RMU3 3LEKA 4AFBA 4DS0A 1JOPA 2GAUA 2JDMA 2CAVA 3D8CA 3ECQA 1QHDA 5FYZA 2BJSA 2YROA 3AZXA 4AVAA 5DXDA 3A21A 2GMEA 2PLV2 2D97A 2BTVC 1DP0A 4PI2A 4XABA 1AR82 1WMXA 1X50A 4O7XA 4CCOA 3MF6A 1ULFA 3DEMA 2XQXA 1UL9A 4BJ0A 3VGIA 2OPKA 4WVWA 5A33B 1BVP1 5FMBA 4KG8A 3A4UA 4XQDA 1JZ3A 2CWMA 4R4XA 4X6RB 4IETA 3SITA 4FPOB 3FWEA 5FZCA 2YFZA 2BYVE 3UGHA 4COUA 5KXDA 4QXCA 1YNAA 2ARBA 3IMMA 3J8F3 4B4PA 4FSJA 5DAQA 4LHSA 3BB6A 3AMMA 5C5TA 1C8M2 4JV4A 2OUHA 4NPRA 1W8WA 2X10A 1I6XA 4HMZA 4QPIA 4HPKA 2WZPP 4CXXA 3RZGA 1KS5A 1QJY3 3N4MA 2R063 4Q4Y3 4ZONA 1VBB3 2D6OX 3LSEA 4E4HA 2IXCA 3PMEA 2HLEA 1C8NA 4D7YA 2GN7A 2G9ZA 1YFYA 3ZKYA 1ZBA1 3NV2A 3O1UA 3IDBB 4MGYE 4J25A 2C1FA 3SCHA 1OLMA 2VM9A 1QJZA 3CJIA 1A34A 3LA3A 4NPMA 4P14A 4AFAA 2DUQA 2DTYA 4N53C 3I8TA 2AYHA 3ZM8A 5F5IA 3ETQA 5HV4A 4PQ9A 1LJ7A 1Q8VA 5ISLA 5IUQA 2WNUA 4B8EA 3PMSA 4AWDA 1SDWA 1V70A 4XBNA 5KHJA 2PFWA 1YFXA 4Z1VA 4FFGA 2W1SA 4WM7A 4W65A 2E63A 2VOXA 2YGMA 3SISA 4NO4A 3VUOA 4M3CE 4TLGA 5IVJA 2ADEA 2HWB3 4BWOA 4LKDA 1DBNA 4AF9A 2B46X 2QQNA 4G3YC 5DDJ2 1RUJ3 2XVGA 3ZYBA 2HWC2 2P3YA 4LR4A 4IDZA 3FN9A 1WLDA 4CP2A 2K2SA 2R7EB 2P5BA 4UFKA 4BA6A 1R093 3THDA 4RD7A 2GC0A 2WO1A 4H55A 3Q8FA 1PIV1 1K5MA 2HBTA 2WNVA 4HT1T 1OD5A 4MZUA 2XWJB 4NHXA 4UFHA 4JDMA 4M00A 1CAUB 5EJ1B 3DYMA 4B7KA 2IFWA 1W8HA 2VTXA 4L11A 3MO4A 5H9QA 1BMV2 3OTFA 1LAJA 4Q8KA 5T3NA 4AGVA 3R4SA 3ZMOA 4KGQA 4ATFA 1PGL2 4V2VA 1GUIA 5E88A 2BGOA 3FZ3A 4KBZA 4XFBA 1QEXA 1BEV2 1YI9A 3WLUA 1J3QA 1HXS1 3TEYA 1WLCA 4MXWA 4NAOA 3LAGA 4NHKA 4EN0A 1CQ9A 4Q0QA 4RSUA 4D69A 4YVSA 2JEMA 4ISRA 5AC92 2VW0A 1KJRA 3GM8A 3NJXA 1K5MC 4K1YA 2BZDA 4KWJA 4JDOA 2P4EA 4XF3A 2PHRA 1GKBA 3LEGA 1CPMA 5C3PA 1PK6C 1AF9A 4E8CA 3HOBA 4EWDA 4PBPA 4CXYA 2R073 4KG0A 3KMHA 5KC6A 3PUQA 5SV8A 3LD8A 2WYFA 4Q27A 1HV0A 1QJX3 2C24A 2IXJA 4NVPA 5EQUA 2KD7A 4BIOA 4PCRA 3KCXA 4S2FA 4F3JA 4EN7B 1US3A 3I7DA 2DBNA 3N9MA 5JVVA 1JMUB 3AYAA 3CL1A 3U14A 4OI0A 3LQCA 1OUSA 4XUPA 3ZXGA 2C6SA 3HPNA 2WLQA 4BB3A 1CPNA 1IS3A 4UFJA 4UW4A 2J22A 3OEAA 4WM8C 1R1A3 2G19A 2W46A 1NCRA 3ZDSA 3ZFFA 4GH4B 5FTTC 2AC1A 1AHSA 2IUWA 2QVSB 5FQ0B 3GZTB 1JZ8A 3MYXA 4ONUA 5SV5A 1TME1 4BQ1A 3T08A 3T30A 2YDEA 4PLNA 2YU1A 3N7JA 2OXBA 3Q9OA 4UF0B 3MIHA 4IERA 5FYHA 1HB1A 2WNEA 4MGSA 4XMIA 2WKKA 1OOPA 5F39A 2PLV1 1ULDA 4I0WB 4CCMA 3KT4A 2DFBA 1AR81 3WNNA 3T0BA 2W3JA 2Y34A 1C1FA 4RS5B 2G9FA 3S6PA 4NJ4A 4XDPA 2J7MA 3JQXA 4M01A 2E53A 3OD4A 4QGMA 3O1RA 2W47A 5I91A 4LO6B 1R082 1LTEA 3QBQA 5F2SA 4YW4A 4BQWA 1PZ7A 1NX9A 2DF7A 3CF6E 3ZSMA 2P3KA 1XE0A 4A4AA 4IEYA 1QNWA 1MS1A 4RR3A 4Y1ZA 1HB3A 1OOPC 4P5HA 3NJZA 2D3SA 4U36A 5DZFA 4YW2A 1PHMA 1V6OA 3N9OA 4HONA 1E5SA 2VG9A 4XVHA 3E97A 2AUYA 4NHYA 4OHWA 1UY3A 1QOSA 2MEV3 2YXSA 1KXGA 3WP5A 2GZWA 3JD72 4MYEA 3MIFA 1C8M1 5FWJA 5IFTA 3DYOA 2PHTA 3ZIXA 3MV11 3OY8A 3R05A 4UFMA 1H0BA 2EF6A 2EIGA 2XH6A 5BNPB 2VZ3A 2LRPA 4LIVA 2VR4A 3LDRA 3DKWA 5HXVA 3GJAA 1SCSA 1OT5A 4AQ6A 4CUCA 1EP0A 1FOD2 1DLLA 5A3NA 4K7JA 1HN0A 4PIYA 1QXPA 4AG4A 4IEQA 2BBAA 4QMAA 1RUE3 1Y9GA 1W6QB 2AEYA 1MS4A 3BTAA 1PNGA 3K4ZA 3VKOA 3VZLA 2FDKA 1OKOA 5KXBA 1QU0A 1QQP2 3CO2A 5F32A 1OLRA 1REEA 1FX5A 1SPPB 2ZGPA 2BNNA 4HETA 3ILFA 4LK7A 4DINB 5IHRA 3AB0A 4LO5B 3M3QA 4P9JA 3VBSA 1WWYA 3UKTA 1DYKA 5FZ6A 3EO6A 2WO2A 1W6MA 4SLIA 2VXJA 1OF4A 5K9YA 4L2NA 3LZZA 4LHLA 2FMYA 5C71A 4YNIA 1UQXA 3PNAA 2ZHMA 1JYNA 3JZVA 3CQOA 3H3UA 2QQJA 4Y20B 5DDJ1 1UY4A 3KWVA 3N7LA 1KGYA 4LO7A 4B7EA 1JYXA 1JODA 2HWC1 4XQ4A 3SKJE 3OGJA 1JS9A 2ZMKA 5LBBA 4BHPA 3CHXA 4AK3A 5JZGB 4CEWB 3MBWA 4F8AA 1RUF2 2LROA 2Y6JA 1E5HA 4A7ZA 5LA1A 5LATA 2A6WA 4L9BA 2UWBA 1IPKA 1DGLA 1W6OA 5A3WA 2JG8B 3KV9A 1YO8A 1LHOA 1GU3A 2A70A 3VBUC 3DPRA 5FZ1A 4QPGC 2C9KA 5I0TA 1BMV1 4PDWB 3D4KA 3GF6A 1ND2C 1ASJ2 2RS33 4RFT0 2OVUA 5FY9A 1W6NB 4XDQA 5HCFA 1BYHA 1JZ7A 4QB2A 4CSWA 1PGL1 2YU2A 1L7LA 1C1LA 4U2AA 1UOFA 5FZLA 1GWMA 4PJYA 4XF1A 1BEV1 1UYYA 2JDZA 1J3RA 3LEIA 3OYWA 5LRSA 2IVJA 1W06A 2P3JA 3AKTA 1VRBA 1S1AA 2XDVA 3DXUA 1O3SA 4Y1YA 5AC91 4CPBA 1DQ1A 1UZYA 2Z79A 3RJ2X 5BYNA 2J1RA 1OD3A 2J1EA 3KT1A 2MHFA 1VBD3 3DCQA 4HVRA 4XFCA 5GLUA 1N1SA 3P6BA 1S55A 2VVEA 5FZKA 5CISA 5BNNC 3V0BA 5FP9A 4MH0E 3FL7A 3Q8AA 4AL9A 1WW5A 2D93A 4QDQA 5JXHA 4MGTA 2AREA 2EIBA 3KQ4B 5JR2A 1MQTC 2QJVA 3IM0A 5FMOS 4BQXA 3LA7A 1CIWA 4YZ5A 4QKBA 1H1AA 2E9QA 2WFF3 2XBO3 4LA2A 1UYPA 2WT1A 3ZR6A 2CSGA 3FE5A 5DQ0A 4LLOA 4YW3A 1I3HA 1IHMA 2VOTA 3AP5A 3VZKA 4GULA 1UOGA 1OF3A 2PAEA 5DAWA 2QNKA 4QXBA 5TSWA 5LA2A 4AYUA 1WKYA 3IT8A 4S2GA 4XHXA 1QKQA 3OJBA 2QQOA 5FY0A 1OMIA 5IATA 1VALA 2Y8KA 2ILMA 5D8AC 1N3QA 4AR2A 2OYZA 2CY6A 1XXNA 4FXKB 4N43A 3P5BA 3SQOA 2VZUA 2WFPA 1O3RA 5B4NA 5A33A 1YIFA 3AP7A 1LHWA 1OQ1A 1YRZA 3SH5A 2XLAA 5IVVA 1Y3TA 4NAMA 2NPIA 3EMRA 4OMCA 1G9AA 1LOFA 2VZ1A 3RGBA 3AKRA 3GZAA 5IWFA 1SLIA 1VBC2 3LDKA 1R081 1VBA3 3OUIA 2NN8A 3V65A 4FVVA 4E4ZA 2PTMA 1H8VA 4N53B 1YYNA 4O61A 1JZ4A 4N43C 2CWSA 2JDAA 2ZZQA 5DG2A 5EHDA 5FKBA 2HKXA 1AYN2 3U11A 4DPNA 3RI8A 2VUDA 5BNQA 5I8YA 1QXJA 1SZBA 5HCHA 3ROUA 1DQ4A 3WW4A 1BXHA 1LOFC 1GMMA 1RUG1 2IWGB 3JD71 4L97A 3NAPC 5FPLA 1NOVA 5FIXA 2FDGA 4WZFA 4OULA 5KWRA 3POYA 1AJKA 1UXZA 4QB6A 1AR93 2WINB 4GB33 3CJXA 4C0BA 1BK1A 3TBDA 2CL2A 4BPZA 3TYJA 4LHKA 4OMDA 5LB6A 4DEVA 1RUD3 1PX4A 1YUDA 2WZR1 4Y5Z0 3ZX7A 1F4HA 2QCSB 5E8AA 3ZR5A 4CYDA 2O8OA 2XGXA 1GWLA 5FO8B 2IXIA 1FMD3 2RS11 3AXDA 4GZ9A 1QQP1 3MLJA 1VBE3 4AVCA 1U5YA 4XEZA 3BOPA 4BMBA 3MZHA 4BYYA 2X8KA 2JKBA 1SFPA 1GWKA 2OX0A 2QFEA 2VH9A 1PZ8A 2RVAA 3PIGA 5FPVA 2ENRA 3C7FA 2PHWA 2XR4A 1JTZX 1RUI2 1UNBA 4Q0SA 5F3GA 5E89A 1U0AA 2RS52 2WWUA 1YCIA 1BBT2 1LU2A 1COV2 4Z2AA 5BNOA 2PHFA 4W8JA 4BQ5A 5J1XA 1ULCA 3WDXA 4LBNA 2X29A 4IGQA 2J1TA 4GD4A 2BDRA 1UO9A 3Q8CA 3Q8BA 4I3GA 1RTVA 2VPVA 4K1ZA 1GBGA 1VRH3 2CYFA 4QD2A 4XFAA 4I2OA 1VAMA 1IS6A 1K5MB 2R0HA 5EV7A 5IVYA 3IB3A 4GMP1 1CAUA 1EUTA 5KR7A 2YPJA 4D8MA 4FAHA 3AX4A 5FUIA 4IEVA 1RUF1 3RG0A 1WA4A 1PK6B 5I0SA 2AZ5A 2W95A 1RVF2 1GZ9A 1MS8A 2YHJA 4E27A 2P2KA 3ELNA 3PVOA 4HFSA 2XJPA 3RYRA 5CFCB 3RZZA 1ODNA 4XUQA 5BNOC 2F6BA 5IK7A 2B9VA 3AJZA 1ASJ1 1NE6A 3PIJA 4P5YA 4DMIA 1H2LA 2VQUA 3DL3A 4IEOA 5ANQA 5C70A 4LK6A 4MX3A 3TN93 2ID4A 2YGLA 4HKOA 5FXZA 4WM8B 4FFIA 4YM2A 4AOCA 3NNJA 3H0OA 3SMHA 1KEXA 3VD9A 2N7GA 1CX4A 1Y43B 1F15A 3ZYRA 3ZPYA 2NQYA 2B42B 5A32B 1EUUA 1V9U2 1ZX5A 2HWF1 3WY6A 4Y5TA 3SHRA 1GZCA 2ZX2A 1Y9MA 4BM8A 1GZTA 3J7MA 3NV4A 3CZJA 2FBEA 4JKKA 3ZYJB 1N1VA 3HNBM 2Y6LA 2I07B 3WSOA 5A1LA 1ZRFA 3THCA 1NCQC 4AGGA 4JTOA 1ST8A 4V1PA 4GH4A 1NCRB 3N35A 3UKNA 4QDRA 3FFQA 3PURA 3GZEA 4QU1A 3VD5A 3OEBA 1CONA 2W5FA 2X53S 3B00A 1O3TA 1DU3D 1UXXX 3J9SA 1LOGA 3J7LA 2KXLA 2WQ8A 4UF0A 2WS92 3RRDA 3M3OA 5GM0A 2ORXA 4LO4B 1KRIA 2XKOA 1OOPB 1GFF2 1RL3A 1AVBA 2JG9C 4ZU5A 2GNTA 2G4IA 4AEDC 2VW1A 1UYXA 1YWKA 1GP4A 5JR7B 1IQDC 4OHVA 3OGGA 4D7SA 1MS5A 2A6VA 2VMCA 4Y4YA 4YPJA 5J36A 4NN0A 4RGGA 1SBDA 1AL21 4M3CF 5FP8A 4ET7A 4EV0A 4LBOA 4YW7A 4NROA 4RR3B 3KV6A 4DNYA 1VBC1 2E7QA 1NG0A 2WN2A 2D6PA 5F37A 3AXEA 3KVAA 5CNAA 4IEPA 2RG4A 3JXSA 1IG3A 1ZBA2 3N9PA 2AGSA 4LORA 3WHUA 3FHQA 5D21A 1VB2A 5BNPA 4HKLA 4EJRA 1RUH3 4MG2A 1W9SA 2IC1A 2Q8CA 4CEYC 3IDAA 3AM2A 4IQPA 4NUBA 4UFLA 5FFOC 5GLVA 2WBKA 3G6JB 1AR63 1AR72 1W6QA 2VMEA 4YW1A 3S30A 4FQ4A 1EV12 1AXZA 1KDKA 2OW4A 2QQVA 3LCPA 3NNMA 1AYM3 2BW8A 2VC9A 4AI1A 1SLCA 1DGWX 2XJRA 1RHI2 5B4XA 1EAH2 4P9XA 2DDUA 1QJEA 1X9PA 2XLFA 5F1RA 5DAXA 3T2QA 2IZWA 1LGCA 2EXHA 4P9GA 3VZNA 3UETA 2YC0A 4DUVA 1X82A 2ZBJA 4MXVA 1CZVA 1GOFA 1W6MB 1ZZ7A 3I4IA 4DUWA 5JWPA 4PBOA 2O0OA 3MIGA 4C1WA 5I8TA 4HZFA 1OFNA 1FPN2 2XONA 3VBUB 4DXZA 1O5UA 2ZKNA 4K20A 4Y20A 1ND2B 5J37A 1PIV2 4XACA 4BMEA 1RUI1 3PJYA 4PI0A 4URTA 1XE7A 2E31A 2VNVA 4RQPC 4IV1C 3V56A 2RS51 3O7OA 2Q0AA 1BBT1 2JD4A 1COV1 3I2DA 4LOSA 3RFRA 4CEWA 5JZGA 1CWPA 3PTYA 4XJ8A 1GV9A 2WZEA 2Y64A 4RA0A 3WP4A 2ZHLA 3O0WA 5EJZB 4MVTA 4WBBA 3GDBA 1QOOA 1OBNA 2JG8A 1NLQA 1W3XA 1HRI3 1MS0A 4KL1A 4CCEA 3CMGA 2OA2A 3RI9A 1HX6A 1SLBA 4K21A 4JX0A 1Q8OA 3GNEA 4PDWA 3VL9A 1GR3A 5FJHA 3IWZA 5BNNB 2P6HA 1A8DA 2ZOEB 1DQ6A 3BALA 3VBOC 5I0UA 3LGRA 2XJSA 3NKTA 4PIXA 1MQTB 3TRSB 1Q3EA 3KGLA 5K7PA 3EYPA 5FZAA 3I2KA 5H9RA 1LNSA 2DCKA 4CCKA 3VV1A 1Q56A 4PF5A 2RJLA 1VMJA 4BXSV 1W2NA 2BWAA 5BPXA 1GSLA 1LHVA 2JE8A 4TN7A 2A71A 3V0BB 1SHWB 3LA2A 2WAAA 4F83A 3AL5A 4A7YA 1QF3A 4NRMA 1HDKA 3KVBA 5D2AA 5CYYA 4Q0VA 1V9U1 3AMNA 3ACIA 5FY5A 4DIQA 3KHCA 1NQJA 1WD4A 5D8AB 5A3LA 1OVSA 4UWDA 5HV0A 4S2HA 1K5JA 2XJUA 1L7QA 4E2SA 1AJOA 1YQ8A 2XLGA 1TME2 1UZZA 4UW6A 3E5UA 3B01A 3GXUA 3H7YA 4BOWA 4Q4V3 3VZMA 3HR9A 1NT0A 5LZ6A 3ZFGC 3OG2A 1VP6A 1Z0HA 3NQHA 1O7FA 3ZDVA 1O4TA 5FP4A 3UJOA 4XHBA 1H8TC 3H3LA 4QX0A 3K3NA 3POWA 2TUNA 4YZ3A 3DGTA 4CDUC 2WS91 1ND3C 3PJQA 1RUC2 4N43B 3VBRC 4CCCA 4FPKA 4ZS2A 4YZ1A 2XMLA 3MLKA 5CG8A 4PIZA 5I0DA 4QX1A 5JXGA 4QM9A 2Q8EA 3MI8A 3P3PA 5FYBA 5FCCA 2VNGA 4YWAA 4OZXA 1YIPA 1CIYA 4OVEA 1W2AX 3NAPB 3ZOIA 3ILNA 1GICA 3F2ZA 5DUXA 3BGAA 2GP3A 5JAXA 4AW7A 5DDJ3 1S0JA 5C3RA 4N53A 2VZSA 4TSVA 3U37A 4Q26A 4ZKTB 3U78A 2LW8A 5L9BA 1YQ2A 5J09A 2VU9A 2VCCA 5LK7B 4XW3A 3WNPA 4DB5A 1M4WA 3ZSKA 3O5SA 3VHRA 1UZ0A 1ZREA 4N7IA 4AHWA 2D98A 2YB7A 2FCVA 4QHOA 5DABA 4FQZA 5FMCA 3UL2A 3ZYPA 1UY1A 2I74A 3ZXFA 2GC2A 2ZZJA 3IPVB 5F5AA 5M0TA 2GNBA 4S2DA 4XAEA 4JVAA 3RYKA 1JYWA 1LEMA 2B45X 5LBFA 3ZYFA 2Y0IA 2YUEA 4GWIA 1ZZCA 1REFA 3HQRA 3BU0A 1BEV3 2BOJA 4B4RA 3WNOA 1W9FA 1HIXA 3KLSA 1MEC3 1AR71 2ATFA 2Q1FA 4I30A 1O3QA 4CP9B 1EV11 4XF9A 5GZGA 1PMJX 2R043 3A7QA 4PHZA 3L9JT 4NOTA 3I97A 3WUDA 4DY3A 1HQWA 4CDXB 4UAPA 1RHI1 2RHPA 2QZ3A 1EAH1 2OQ6A 2B5HA 3HBKA 2A3WA 5A7SA 4QKFA 5A7NA 3FBMA 1V6NA 1NUKA 4EYUA 4DUXA 4TYSA 1F2NA 5BNOB 1W39A 2W68A 1FPN1 3WF0A 1WMDA 4GKYA 1BLZA 4D6QA 1SLAA 4CCJA 3K4AA 3T0DA 3MFCA 4BH9A 3IZOA 3I3BA 5EXOA 1TVGA 2VOVA 1RB8G 1XBFA 5EPAA 1OHFA 2GN3A 4CA9A 4FTBA 4ASKA 5A6YA 4N90A 4YARA 1PK6A 2CNAA 3ZSEA 1IQAA 2DVBA 3J8F2 3M70A 3ENRA 4OFGA 5CFCA 2MNGA 4NE9A 3E5XA 1S0IA 4I01A 4EZ4A 1N3PA 2B7YA 3CU7A 3GCWA 2QBXA 1HW5A 4AHYA 1QJY2 2YBSA 4OLLA 5JDBA 1DG6A 1LRHA 4DZGA 2VTXJ 1FATA 2VVDA 1UWWA 2RM21 4OI4A 5FDBA 1PO22 3AP4A 1IOAA 2D43A 3IIAA 4QGNA 4WM8A 3O1VA 5FPBA 4LIUA 1UN1A 4C91A 3HQXA 1OKQA 3E1F1 3WR0A 1BHGA 4X8PA 4M4RA 4B3NA 5A80A 2ZX4A 4E2GA 2GC1A 5A32A 2IXHA 3I3MA 4YW6A 2JIJA 3SCGA 4FPGA 4YM1A 3WW1A 3WINE 1R64A 2UYAA 2D3RA 1H2NA 4R8HA 4AVTA 1P8JA 1BJQA 1VMHA 4IUGA 1WCSA 1POV3 3WQ1A 1VMFA 5FKCA 2QDRA 1ZA4A 2JG9B 2X09A 2ZA9A 2ADDA 4JGZC 5DZEA 2HBUA 3JD73 3NO8A 4K6BA 4LKEA 3ZO0B 2HWB2 4AEDB 2VTFA 1CJDA 1UKGA 2A3XA 2ZMLA 3H42B 3QLQA 3ZXDA 2BGCA 2RDQA 2DURA 2EAAA 2GMMA 1LGNA 4QX8A 5L7OC 5FMOL 2ZGMA 1FOD3 1R092 2EXJA 2XKPA 5G04L 5F5QA 1GANA 2CU5A 2DUOA 1PX3A 2Q8DA 2Y0OA 3P1IA 1ZRDA 1O91A 5C8CC 5I0RA 3OGRA 4QQPA 5CFDC 1IG0A 1HKDA 2P1BA 1NXD1 4XYXA 3ZN5A 1JBCA 1RUC1 3NL1A 2GNMA 4GWNA 3WDYA 3WCSA 1YLLA 3PDQA 2NM1A 4CU8A 4OUSA 3K77A 2WJSA 4CZSA 3AKQA 4H14A 3RZLA 2VXRA 2R0FA 2QQWA 3PUAA 4LBQD 3FLRA 1IPJA 1QDCA 4PLOA 4NIIA 4CEYB 4DXTA 1B09A 4A6OA 3UGGA 3AZYA 1E5IA 4AAXA 2ZTNA 5GZCA 3MGUA 3RNSA 5HXMA 2AR6A 5FZ9A 2DUPA 2R1BA 3OGSA 5A7OA 3I3DA 2W94A 1XSRA 4XUOA 1RUG2 4HVOA 4OCTA 4A2UA 5CADA 1AXYA 3C7GA 4GWJA 1RUF3 4Q0PA 4HXCA 2WA4A 4D6RA 1IS4A 1AZDA 2XXZA 2CV6A 3D0SA 2R6QA 2OQ7A 4Y1VA 1S0DA 1XSQA 3GALA 4FOWA 4EE2A 4K8RB 1DFQA 2HWD2 2WZR2 2VECA 3BN6A 4K40A 1JYTA 4YZ2A 1ODMA 3ZSJA 4NWVA 1PGW2 1ASJ3 2VMGA 3N9LA 5FZOB 3ZSLA 5KHGA 4MUVA 2RS12 1LESA 2WIIB 3ITQA 4Z82A 2YY1A 3BODA 4RHV1 5GZFA 1NXMA 3S7EA 4NIHA 4UBGA 3K3OA 5F6LB 5FY8A 2LTNA 3VKFC 3VD7A 1GP6A 1V00A 4IV1B 2H0BA 1YFUA 4HN1A 2ZGLA 3UV9A 4C8DA 3TEWA 3LDBA 3OGVA 5F5CA 3VDBA 3ZN4A 4HN0A 2J42A 5F7UA 4OQ8A 1CAVB 1K12A 5KHIA 1RMU1 2YYOA 4NR1A 3VBHA 1S0CA 4XETA 1VB4A 5CIRA 1YEWA 2DVGA 3VBUA 4ZPIA 4QPGA 4C1XA 2OIIA 1NA1C 1ND2A 2DVAA 3VDDC 4CTEA 3T0AA 2Q4SA 2VNRA 4MGZE 4MGIE 5FZHA 4DY5A 3FBYA 3AP9A 4C90A 1QY4A 4FCAA 3VBOB 1QIQA 4GALA 5HCAA 3D6EA 5T55A 2W08A 4IE7A 3ZMNA 3OOXA 2A1XA 4B1LA 3KT7A 1VJ2A 3GGLA 1XB9A 4AAPA 3VBHC 3PHMA 1G9BA 2B4KA 3MIEA 2OPWA 4JGYA 2ET1A 3PUIA 2CDOA 4FP2A 2WSUA 3LPGA 1CJPA 4AQ2A 5ACA2 5BNNA 5F3EA 2FZ1A 4Y1XA 2B39A 1DCSA 1JUHA 3J8F1 5I93A 5C9AC 2MEV2 1XJAA 4OYUA 4B29A 3DV8A 1U5ZA 2PHXA 1MQTA 2WT0A 3MF9A 3AL6A 4HK8A 5FYYA 5C3QA 5JLVA 4FO9A 5FZ7A 3W5MA 3S5AA 4Y1UA 1D0GA 1QJY1 4Q4Y1 2DTWA 1DQ2A 2ZGRA 4XCBA 4I09A 1JOBA 1DZTA 1ULEA 4ZU4A 1MPXA 1OQEA 2ZX3A 2HWF2 1PO21 3VHOA 2F4PA 1AX1A 4JGYC 4FTSA 1H30A 4M0HA 1KDMA 1RUE2 5FBZA 4AQSA 3MFAA 1HQLA 1GYKA 3ACGA 5ANNA 4D6SA 3PL0A 1VBC3 4FI9A 1CVNA 1ENQA 1WLWA 1D4M2 3ZFGB 1ZZBA 3K51A 4G9SB 2W1UA 1PGSA 1QJFA 1ZRRA 2VBBA 5D8AA 1QJU3 5FXXA 1H8TB 5BY5A 5JOYA 4LOTA 4CDUB 1ZRIA 3B5LB 3WF4A 1ND3B 4GJYA 3VBRB 1AYN3 5FZGA 1SEFA 3TNPB 1S2KA 1RXGA 3POSA 4A41A 3HD8B 2ZEYA 2UU8A 5CVRA 3K4DA 3T4VA 4FBFA 2HWB1 5JOZA 2ZMNA 2UYBA 3VDCA 4LLFA 3U75A 3ZXKA 4LE3A 4L0PA 4AFMA 3BU7A 3WVJA 5FP7A 2BVVA 2HEWF 4AI9A 1R091 1JHNA 2D3PA 2QDNA 3USUB 1US2A 3AC0A 2LS6A 2XL7A 2ZPXA 4RN5A 4X6QB 1FV2A 3A22A 2ZAAA 3LPFA 1QXRA 5LK5A 3BTZA 1NY72 1RC6A 1YJKA 5FZBA 2BPA2 3SKVA 3RSJA 1AL22 5DN2A 1XOYA 3BCWA 1KITA 5FK7A 2RS32 4UBHA 1KD7A 3NAPA 1D2SA 5JXJA 1RJ7A 1BQPA 2A7AA 4H7LA 4YGBA 4AVSA 1X8MA 2VY0A 4YVWC 1RUI3 1VR3A 5FO7B 1T6BX 2SBAA 1UMHA 2GH2A 2BERA 1KFUL 2VO5A 5JIAA 2HEYF 1E5RA 2WYSA 4Q4W3 2BNMA 1DQ5A 4UT5A 2O1QA 3WNXA 3WQ0A 4A44A 4AI8A 3S5QA 2VZTA 1JU3A 2PYTA 4QM8A 4EN6B 3NV3A 4LBQB 5FMDA 2BEOA 3R4UA 5K4LA 5JUVA 2VZQA 3NW4A 2VCAA 1OFSA 4M4PA 3IPVA 2JDUA 4WV8A 3EQEA 1QJX1 5JI7A 3NWKA 4L92A 5FLJA 1RVF3 3KM5A 2WA3A 1J59A 4CUAA 4GA9A 3WX5A 4HANA 2L9LA 1O6UA 2RR12 4R9DA 4XUTA 2HWD1 2XOMA 2WABA 1W8TA 2XBO2 1DZRA 4XAAA 3C2UA 5GLTA 3LIHA 3MICA 1PGW1 4RYDA 2E6VA 4LA3A 4CP9A 3OBRA 5AVPA 4I0AA 2RMU3 1DHKB 3GHMA 3VKMA 3AZZA 2C5DA 4NPLA 1HRV3 2FZ2A 1R1A1 2GU9A 3T2TA 2QQIA 2LUWA 1O8PA 5FREA 3B9CA 1PMHX 1B35C 1F5FA 3BTYA 2KA3A 4ITCA 4QQHA 1H1MA 1XNKA 1UIJA 1Y9QA 1W2OA 3H8XA 4LBJA 2H0VA 1F8VA 2ETEA 2QQLA 1O59A 4OI1A 3WHTA 4FAGA 3BIWE 3WCRA 2GP5A 3IDEA 2EA7A 3H7JA 2Y38A 4XDOA 2ARAA 4KH9A 3T1MA 4LPLA 3WG4A 4LHNA 5C5UA 5DUWA 4O9EA 5HCBA 5A7QA 1ZNPA 4M3CB 3W5NA 2EXKA 4NIAA 3WF2A 3V0AB 3H50A 3N7KA 3I59B 5FLIA 1HQNA 2ZEWA 3NVCA 3MHZA 2WN3A 4CU7A 4AFDA 2XL9A 1QH6A 1ONAA 2EIEA 5F6KA 2VQ0A 2ZS6B 3WV6A 4K9SA 3URFA 4YLZA 3AJYA 2VOWA 3ST7A 5KHKA 2VUAA 4FFHA 2YBPA 4FOYA 4Y22B 1XYNA 2GALA 4YM3A 4QQ2A 2B9UA 5FAXA 4OHZA 3PTRB 4BE3A 1T2XA 5ACA1 5BV6A 4ORFA 1UY2A 1LEDA 4HOOA 4LKFA 1U5XA 4CDQC 2MEV1 2VCBA 4NIGA 1QDOA 4JRAA 2TEPA 5JCTA 2D44A 1SFYA 4TLFA 2JB4A 1WW6A 2HYXA 1NCQA 1G7YA 3AFKA 1NKGA 3LSDA 4GQ7A 4JGZB 4W6WA 4IE6A 1UCXA 4AQTA 4AVVA 1SG3A 1X7NA 2VOKA 4HBNA 4XJ9A 2PHLA 3C7OA 2BFUS 4CDXC 2WO3A 3MW3A 2ZGQA 3G7DA 1F4AA 3UGFA 5T52A 1NZIA 3QH7A 2E32A 2XPJA 2O8QA 3JCIA 5FLHA 5LY1A 1RUE1 1VAKA 2OZJA 3MUZ1 4Y4RA 5J96B 2LM3A 3JBG2 2WZ8A 4X8NA 4CU9A 1SLLA 4IEZA 5C8CB 5CFDB 1D4M1 1R1ZA 1JOJA 1UMZA 2JG9A 2K0GA 5K0UC 3RZHA 1L7RA 2ZHNA 5LA9A 4IGPA 4AEDA 2ZCWA 3EHKA 5J98B 2IXKA 4EWEA 1DLCA 1ZBA3 2EICA 1WZXA 3AFGA 2QQMA 3CIHA 4OUEA 3WNMA 2ARXA 3KV4A 2VZVA 4C0HA 1ALYA 2V72A 1IZ3A 2VMIA 5L36A 5APAA 4IW3A 2JE7A 3SH3A 1W9TA 1UPSA 3O12A 1AR73 1YQ6A 4JQRA 1UOBA 4R52A 3J4UH 4CU6A 1EV13 2AENA 3PVNA 4UOJA 1LCLA 3K75B 3LB9A 1RHI3 3Q8EA 3WUCA 1H2MA 3KZ4C 1EAH3 3RVHA 5IVCA 4RFRB 3O1TA 4A6SA 1OH3A 2D5HA 1WBLA 1YI7A 2XHKA 4COVA 2O14A 1W2UA 2E7TA 1NY71 2EXIA 3OD0A 3S7IA 2XJQA 1C28A 2E7AA 2X5IC 4ARYA 4CEYA 5GLWA 3DXTA 2YBKA 3FX3A 2RS31 2P6CA 1FPN3 1PM7A 4IE0A 3UKVA 3A0KA 4MV2A 5A3TA 5A6XA 2VMDA 5ABJC 1Q8SA 4OHYA 2YPDA 3TN92 3RWKX 4JHZA 3POEA 3KSCA 1PIV3 4QX3A 5LBCA 3W59A 4DRVA 3E6CC 4JKLA 3M8LA 4M0NA 4MOAA 5JIUA 1NQDA 2NP0A 4JC1A 1J83A 1WCDJ 2XVLA 4QX2A 1ZBE2 2HH9A 2Y60A 1REDA 5CU1A 1ZA7A 5C3SA 4AEKA 1VBD1 3B3QE 5T5LA 4G4FA 1S0FA 2W0XA 1CGPA 2VBDA 5IVFA 2ET7A 4N7UA 4MO3M 1HXS3 3EXUA 4LBMA 3AZVA 1EY2A 2R16A 3KS7A 4A7KA 2JDNA 5FZOA 1PVC2 5JXIA 1BK0A 1NA1B 3DKQA 4Q2FA 5EWSA 2QQKA 4GKXA 3VDDB 3E6BA 4RQPA 2RR11 2W91A 4IV1A 4KQ7A 4LMFA 2XBO1 3MLLA 4GAZA 2QUOA 5IK4A 1AUYA 1IGOA 3IDCB 3FHAA 1E57A 4IV3C 1N47A 1KS4A 3BIEA 4BLJA 4QU2A 5FV3A 4BU2A 1CAVA 2NMOA 5CAZA 4BK5A 2JD9A 5C7GA 1NYWA 3J7HA 2Z2SB 4FOVA 4V2WA 3VBHB 1K45A 3ME2A 1XPWA 3LOBA 2UY8A 2BGPA 3KF3A 3MIBA 4QPGB 3WDVA 1GQPA 3ZXJA 5F2WA 5HI0A 4XF4A 4F7ZA 3VD4A 4R9CA 1FAYA 4ZXKA 1JZ6A 3FUOA 5AFEA 1OA3A 5CZKA 3VBOA 3U1XA 2EIDA 4BK4A 2DCYA 2EVXA 1W9WA 3O0XA 4QAWA 4Y5SA 4JKMA 2IFRA 1QH7A 2VJXA 1Z7S2 1W3VA 1TME3 3RMXA 1SBEA 2FQPA 1CAWB 3T2PA 4EROA 4XZPA 1U5IA 4N9HA 1APNA 4JGYB 3WD5A 5LWBA 5IFPA 1J1TA 5C4WC 3MV01 4KWLA 4W50A 4PT6A 1D7PM 1Y7BA 2PLV3 2RM22 4FP3A 5FO9B 3X29B 3SLIA 1AR83 5EP9A 1AX0A 1TMF2 4A3ZA 2F17A 5JSRA 3HN3A 5FP3A 1YFWA 2GDFA 3I2HA 1RUH2 2A6YA 2ZABA 1W8UA 4AI2A 3KHBA 4KU7A 1SACA 2SLIA 5H9SA 1UZVA 2DFCA 4E8DA 2YG0A 4J1WA 1LHUA 4DEQA 2E26A 3CBNA 5CKMA 1AR62 1EPZA 4XF0A 3BKZA 4DRRA 2WAOA 5C6CA 4ISQA 4AFCA 5BXXA 4META 1AYM2 4Y26A 5FPXA 1IKQA 1D0HA 2XUEA 3ZFGA 4QQOA 1LOEA 3PUSA 5A7PA 1UU5A 1H8TA 2QE3A 2H6BA 2WWJA 1C8M3 3BOWA 4CDUA 3JBG1 1ND3A 3VBRA 4UFIA 4XFIA 2Z4FA 3SEEA 4YZ4A 4AZZA 1LULA 2JX9A 2RE9A 2PA7A 4N9IA 4CDWC 1VBE1 3HJRA 4OHXA 4AXOA 3WOGA 2DBIA 3VBFC 2V5DA 2BWCA 3QH6A 3ZPOA 4B4QA 5F9TA 1LOBA 3B9IA 4LT5A 2FCTA 1DYPA 4O9GA 5JOWA 3QACA 4IESA 3A0NA 1OPMA 4P9WA 2VUJA 3KQRA 3MPBA 3RDIA 1H1IA 4CE8A 3LIGA 4R9AA 3WXPA 2ORZA 1UF2C 5DUVA 4YVWB 5EFUA 1CX1A 3FLTA 1FT9A 1JYIA 3USUA 4XXAA 2WL1A 5FZEA 4J1XA 3WW3A 5FZDA 5E16A 5A3OA 5FYCA 4OQ9A 3HBZA 1HRI2 2K46A 4XC9A 5B2GB 3PU8A 1C57A 1ULPA 4XBLA 4ZZ8A 2OKXA 5AVAA 2YV8A 1LGBA 4JRLA 4Q4X2 5GZEA 4BCUA 2FDHA 2BUKA 4JQTA 3VL8A 1WCUA 2WDBA 5KC5A 2RJ2A 2HWC3 1YC61 2JECA 4Q1RA 4LBKA 3U07A 1UX7A 2Y33A 4AEJA 3KV5A 1H4GA 3TN91 1D4VB 2JIGA 3HT2A 4WVMB 1K42A 4QX7A 3GBGA 4K3UA 5I8SA 5L9VA 4LJHA 4HVQA 3NSTA 3I2OA 4LBQA 1LOCA 1JYCA 1W6PB 2GSYA 3H9AA 1ZBE1 1B35B 5T5PA 1O5LA 1C5IA 1ZZ8A 1CESA 2HWE2 2FCUA 2VMFA 3FHIB 3TAYA 2C9AA 4RHV2 5J3UA 1C3HA 1CZSA 1XU1A 2VULA 3GHNA 3ASIA 4QQLA 2JB8A 3FMGA 3GJBA 1OLME 4LUKA 5FZFA 4ES9A 3W9AA 5FOJB 2VE1A 1UAIA 2GC3A 5J48A 1PO12 2ZGSA 5AC93 5HBAA 3U10A 1PVC1 1JYVA 3BUCA 3HN1A 1YQCA 1DGRA 1RMU2 1RIRA 1PO23 3OCPA 4D7TA 3D5OA 3OPWA 4NRPA 4Q4V2 3OPZA 4RGAA 4ARXA 4CVUA 2CGPA 5A7WB 3MEPA 2PQSA 5LRRA 1ZVFA 1POQA 2PHDA 2NZ9A 4XJAA 2W92A 2K9ZA 4QPIC 5FXVA 5LBEA 3MDPA 5FY4A 3KCYA 4P02B 3RS6A 2ERFA 4GWMA 3UK9A 5D1IA 3UYJA 1M06G 5C8WA 4MGQA 3VN4A 1CR7A 4UYBA 1G8WA 2V09A 5IJRA 5A6ZA 3IBMA 1TEIA 1W8FA 4M3CA 1W99A 3V0AA 2VD7A 3AYCA 3HAGA 4JAAA 3I59A 3UJQA 4CDQB 1XNAA 2WWSA 1DGRN 3M3EA 3MPPG 5EJ3A 1XU2A 2QKDA 2VW2A 2CHHA 3CJIC 4MADA 1LOAA 2GMPA 1MR5A 1MZFA 3I2GA 2Q1ZB 1HB2A 1LU1A 2OUJA 1Z7S1 2BQPA 2WRAA 3OBZA 4OZOA 4Y22A 4XILA 4NMIA 4B1MA 3PU3A 4QB1A 5A1FA 4MHRA 2I2SA 2WNUC 1JHJA 3CKHA 4IEUA 4W6XA 5A3MA 5A6QA 4COZA 2R062 4Q4Y2 2QTWB 1VBB2 1J84A 3NJYA 2R32A 1W04A 4WM7C 5JI9A 2XHNA 5CEHA 2TBVA 3GBFA 1OC1A 1TMF1 2PXJA 3K46A 4E9KA 1JUIA 3ILRA 1DIWA 4JGZA 4XPVA 1NCQB 5K0UB 5FZIA 4KWKA 3HWJA 4KI5M 1RUH1 4LQRA 2HJIA 3CZUA 3ES4A 1R083 3R0RA 1GNHA 2RV9A 3W20A 4GJZA 2D6LX 4CXWA 5FUNA 2NMNA 4JZRA 4HG6B 5F8PA 5L73A 1AR61 1MEC2 3VKNA 1OH4A 1I9RA 3HEIA 1C4RA 2Y6FA 2BBVA 5CKQA 1HV1A 1UOJA 4UXAA 2R042 1SQ4A 3EBRA 2WNVC 5IVBA 5C8CA 1AYM1 2UWCA 5CFDA 1IPSA 4HSJA 5FYMA 1UU6A 4YW5A 4ES8A 3AZWA 1X8EA 4NRQA 1H4HA 4A3XA 3MUY1 1VPHA 1POV0 1RUG3 4BLIA 2YC4A 4MSVA 5DUUA 3TB0A 4PLMA 3NMBA 3D0JA 1RUJ2 2OS2A 5IW0A 3SXWA 1D2QA 1QMJA 4QWNA 5BUVA 1DZQA 3KCCA 2F4LA 3O0VA 3VDAA 1SDDB 2X5IB 1RYYA 2HEVF 2HWD3 2WZR3 3CNAA 4XFFA 4YVSC 3T4HB 4TWTA 4AI0A 2C4XA 2ZEXA 5L7OB 5FZ3A 1UMIA 1H9PA 3O1MA 1SBFA 5ABJB 5LA0A 5G05L 3WG1A 3ZFEA 2RS13 4QKDA 3H3ZA 1QQP3 1XYPA 4UW5A 4YG3A 3JB8A 3A23A 5EIYB 4EQVA 4YFZA 1AL0G 1UIKA 2A6ZA 5FXWA 5CBLA 1OQDA 3C7HA 1G9CA 1FYUA 3BI3A 1HRI1 1ZYBA 4L99A 1QNYA 2C0ZA 3CDZB 2X05A 4XIKA 1STMA 4UW3A 3KD4A 4AHXA 1AX2A 1LODA 3LKJA 1XC6A 4Q4X1 1W8NA 3D3AA 5H9PA 3SNMA 4XFHA 3ZFEC 4KWUA 3VLBB 3APBA 1WMEA 1Q43A 4KBBA 4I02A 1NCRC 3ZFFC 1U12A 1LENA 4GMP3 2WNOA 3WNKA 3ZYGA 1TQ5A 2G1MA 2R072 1BCXA 5LEKA 4GMP0 3USSA 3VZJA 4JTNA 1QJX2 3FJSA 1RXFA 4IV3B 4AE2A 4FPYA 3AVSA 2VL4A 2FDFA 5FOBB 3OF1A 1QGLA 1W90A 2DU0A 1K3IA 2D6NA 3KF5A 3RMYA 1F9KA 2JKXA 1UD1A 2CTVA 5FYIA 3SH4A 5KBFA 1NLRA 5A70A 5ACA3 2HWE1 1WW4A 2NLRA 1NA1A 3VDDA 2J1SA 2CAUA 1WA6X 4KMQA 2TNFA 1R1A2 4YM0A 2BRTA 4RQPB 1UPIA 2VVFA 5CB7A 1F31A 2D40A 2XVKA 4I0BA 1WW7A 4CCLA 4A42A 1PO11 5DAVA 1GOHA 2VZPA 1G86A 5DZGA 3S57A 5KHHA 1YHFA 1SCRA 2HWF3 1X33A 3POGA 4FFFA 4HL0A 3IAPA 4R4ZA 1XE8A 3R6SA 4RR3C 4Q4V1 1ZM1A 1N1TA 3O1SA 2ZGOA 4Q8LA 4CCDA 4FOQA 4YSFA 2YFUA 3AYEA 5C4WB 5IK8A 1OA2A 2P34A 4PQQA 4QHBA 4QPWA 5GLZA 3ZXLA 2W1QA 5C9AA 1D4M3 3HVDA 1GNYA 1LR5A 2KR2A 2PELA 2AACA 1WUVA 5FJKA 5GZDA 4Z8BA 1CZTA 1J58A 3ZXAC 5FYVA 4UI9L
chains in the Genus database with same CATH topology
5JPMB 4NHLA 1FV3A 3I54A 1CAWA 5FPZA 2XWBB 1SLTA 2PHUA 2PQQA 4YGDA 4INDA 3H1WA 4XTPA 3SCFA 4XOGA 3AMPA 4IXLA 2KM2A 2WC2A 1W0OA 2Q1MA 2JICA 2V5YA 2XJTA 4AEMA 1V6LA 3M2MA 2DCZA 1WBFA 1A78A 5JPNB 2ZGNA 3VBSC 1WD3A 2R061 2DYCA 5LEJA 3VHNA 1VBB1 3EJKA 4BIFA 5C33A 4CDWB 3KGZA 4GIQA 1URXA 4RL7A 3ZN6B 1A8MA 5L19A 4QPYA 2RJKA 3VBFB 3CEWA 1AL23 4COYA 4D3WA 3B69A 2A73B 1GZWA 2W39A 4CP0A 3V64A 3WG2A 5IT6A 3RWNA 1FNZA 1KQRA 1WCKA 1XNCA 2CGNA 4P9IA 4EWAA 2YMZA 5CG9A 1CAXB 1MEC1 2WT2A 5GALA 2Z5WA 3H1YA 3IMNA 1SMVA 1EYBA 2BFUL 4XE9A 3N36A 2R041 3RJRA 5IK5A 3THPA 3HIFA 3DPRC 2P37A 1TE1B 3THTA 1XYOA 1Q8PA 2Q30A 2ZJCA 1RUJ1 2ZKLA 2ZACA 3JB4C 4Q1PA 4SBVA 4YGCA 1XNBA 2XUMA 2DVDA 4YVWA 5DG1A 2RR13 3FFZA 1JH5A 3RYPA 1ULGA 4LEJA 4XQWA 1V6IA 4R9BA 2G9GA 3FUQA 1I5ZA 2B8MA 2XG3A 3FLPA 3HT1A 2BVBA 5JSOA 4LTAA 2A6XA 4BZ4A 3JQWA 2D5FA 5E1RA 2A3YA 4KNCA 1SFNA 4XJUA 2Z42A 1OA4A 2RS53 3B02A 1BBT3 1DF0A 1COV3 2FMDA 3GBWA 4IL7A 3ZIWA 1NZCA 4E4DX 3E5QA 1RGSA 3JU9A 1XRUA 3AKPA 4WVMA 1VBD2 1MVQA 2D6MA 2AH2A 3LWCA 2Z69A 1W6PA 4Q0UA 1WMFA 4LNVA 1S2BA 2XB6C 2I45A 3P3NA 2R071 1B35A 4YYOA 4TZDA 4WZCA 2ES3A 1A3KA 3N3HA 1QJU2 2WFF2 1LKNA 3ATGA 4QPIB 2YZ4A 3IN9A 4HPKB 2Y26A 4COWA 4KU8A 1H2KA 2EAKA 1MZ5A 1PZ9A 1POV1 2UWAA 4XJZA 5J7MA 4ZU7A 3WG3A 2BNOA 5KXEA 1W0PA 1ENSA 3OBTA 3WP6A 1QOTA 2GNDA 4FPLA 4XFGA 2NYYA 3CJIB 3E6DA 4WVVA 2PAMA 1J1LA 1FOD1 1V9U3 2VNOA 4YRDA 3ZYIB 1G6NA 3ACLA 2R30A 3AYDA 2WNUB 3JBG3 3RPQA 5JSPA 2JXAA 3K48A 3H1MA 1WLTA 4XBQA 1BVVA 4FT8A 4CDQA 1FXZA 4WM7B 2UURA 4OI2A 1UW8A 2OZ6A 4L8QA 3MW2A 1VBA2 1O4YA 1S0EA 4AGRA 3WW2A 1JW6A 1CN1A 4CDXA 1A6CA 1RINA 1N1YA 4HSLA 3TWIA 3INAA 4FTEA 1PMIA 2WS93 4Y24A 5EZWA 5EYYA 3WDTA 1G9DA 4Q4W2 1MS9A 4W6YA 3MIDA 5T5JA 5AFBA 4K8FA 2JJ6A 2WNVB 1CD3G 1JXNA 4EN9B 2ZX0A 4NHMA 2DVFA 5EYXA 5K0UA 2UY9A 3RQ0A 3QD6A 1N3OA 3QOPA 1AR92 4GB32 2ZGUA 3R4DB 3DUIA 4NWWA 1RUD2 4E4SA 2HYKA 4Z2WA 4MXWB 1DGWA 3C3VA 3J26N 2WLPA 5T5OA 3WP3A 4YVSB 3H8UA 2RMU2 2D6KA 1FMD2 3FC0A 1AXKA 1HRV2 1VBE2 1FNYA 1ENXA 2VGDA 2GH8A 4XIOA 3AK0A 4YFWA 4KGGA 3N7MA 1MS3A 3NV1A 2DWRA 3ES1A 1ZBE3 4YG0A 1S0GA 4FXGB 3B94A 4QXKA 2X5IA 4XMAA 3DF0A 3BPZA 3NKGA 2DU1A 4P9YA 3AKSA 5L7OA 4FPEA 1VRH2 5ABJA 1PVC3 1UX6A 1VLNA 3ZFEB 4Q29A 4MLOA 1H9WA 4LE4A 4XXPA 3PVBB 1GLHA 1V6JA 2P17A 4LULA 3ZFFB 1MZEA 4XJWA 1ZZ6A 1DDLA 1DQ0A 2JENA 4CRQA 5FQ0A 1V6MA 2ZGKA 3TNQA 1OPOA 3AMQA 1IS5A 4GXLA 1L3JA 1PNFA 3L2HA 2PN5A 1MACA 3T1LA 1LHNA 4P9LA 2LALA 3QCWA 1Z78A 4LO8A 3TOJA 4RS5A 5GJ6A 1OI6A 4GH4C 3B7MA 2MPFA 1TNFA 1FI2A 4ASMB 4IEXA 1GNZA 3M3IA 1ZZ9A 2QQPA 3M1HA 4IV3A 4QT6A 1Z7S3 2Q8OA 1HLCA 1XNDA 1V6KA 4HLTA 4FPCA 1G9FA 1F5JA 2H6CA 5CA6A 4QX5A 4LUMA 1ZRCA 3WDWA 1IKPA 4DFSA 2PAKA 3AP6A 4RS5C 2RM23 4AHZA 1MVEA 4J6GA 3IKWA 1S0BA 1MZ6A 1PVXA 1QJU1 1VAVA 1TMF3 2WFF1 1YJLA 4HKWA 3WDUA 1KFXL 1AYN1 1O4ZA 3OY8B 2DCJA 3PLQA 3VZOA 1OSGA 2A5ZA 3D82A 4E2QA 5JOXA 3W58A 1BKZA 3U0ZA 5T54A 2Q5TA 1BZWA 1OLQA 3CLPA 3LOIA 5KXCA 4AVBA 2WSVA 3VKLA 5C4WA 2ZX1A 4H7MA 5C9AB 4IEWA 3MW4A 2P3IA 2XJVA 3JUUA 2IXLA 5BNPC 5GKAC 1KJLA 3VHPA 3ALQA 3VBSB 3AMHA 4DQAA 2DCTA 1LB2A 1RUOA 2D7FA 3HMYA 5K8SA 1EPWA 2QZ2A 1WGPA 4XTMA 1VBA1 3GZUC 1X36A 4H3WA 3WQ7A 2W52A 4ASLA 5T50A 2VMHA 3KB5A 1T6GC 3O14A 2CGOA 3WT3A 4QGLA 1RUC3 1UKRA 3M4FA 1JN2P 4Q4W1 3S0MA 1NLSA 1W6OB 1NE4A 4CDWA 4YGEA 1GQHA 4JDNA 3ZN6A 1HXS2 3VBFA 2E51A 3DPRB 4ATEA 4I3PA 1AR91 4GB31 1W6NA 3M3CA 4LBLA 5FRAA 4Q4X3 2JE9A 1GZWB 1C5HA 4Z07A 1J3PA 1RVF1 3M7AA 1Q5OA 2EALA 3PVEA 1RUD1 3B93A 5JZGC 4CEWC 4OUMA 1ENRA 3DN7A 3OYWB 1CAXA 1YXWA 1TNRA 1Q8QA 1XQNA 2ZHKA 4WVZA 1QWRA 4YG6A 3L2YA 2RMU1 2JG8C 1FMD1 1HRV1 2WQZC 4D94A 3U4XA 2R1DA 2ZGTA 4PDWC 1RUNA 4FPHA 2VQAA 4EN8B 2FHRA 2R49A 4FPJA 2HWE3 1LECA 3ZXEA 2A75A 4HK9A 4RHV3 2DV9A 3WZ1A 3ZVXA 5JMCA 4MGKE 1RJ8A 1UU4A 1RITA 1VIWB 4JCKA 2V73A 3GYDA 2ZAHA 1VRH1 1PO13 4FPFA 4CP1A 4AI3A 2WQ4A 4DOUA 1I1EA 1GQGA 1RMU3 4AFBA 4DS0A 2GAUA 3D8CA 2CAVA 3ECQA 1QHDA 2YROA 3AZXA 4AVAA 5DXDA 2GMEA 2PLV2 2D97A 2BTVC 1AR82 1X50A 3MF6A 1ULFA 1UL9A 3VGIA 2OPKA 4WVWA 5A33B 1BVP1 4KG8A 3A4UA 4XQDA 2CWMA 4R4XA 4X6RB 4IETA 3SITA 4FPOB 3FWEA 2BYVE 4COUA 5KXDA 1YNAA 2ARBA 3J8F3 4B4PA 4FSJA 3BB6A 3AMMA 1C8M2 4JV4A 2OUHA 4NPRA 4QPIA 2WZPP 1I6XA 4HMZA 4D7YA 4HPKA 1KS5A 1QJY3 3N4MA 2R063 4Q4Y3 1VBB3 2D6OX 3LSEA 2IXCA 3PMEA 1C8NA 2GN7A 1YFYA 1ZBA1 3NV2A 3IDBB 4MGYE 2C1FA 3SCHA 1QJZA 3CJIA 3LA3A 4P14A 4AFAA 2DUQA 2DTYA 4N53C 3I8TA 2AYHA 3ETQA 4PQ9A 1LJ7A 1Q8VA 5IUQA 2WNUA 4B8EA 3PMSA 4AWDA 1SDWA 1V70A 4XBNA 5KHJA 2PFWA 1YFXA 4Z1VA 4WM7A 4W65A 2E63A 2VOXA 2YGMA 3SISA 4NO4A 3VUOA 4M3CE 2HWB3 4BWOA 1DBNA 4AF9A 2B46X 5DDJ2 4G3YC 1RUJ3 2XVGA 2HWC2 4LR4A 1WLDA 4CP2A 2K2SA 4BA6A 1R093 4RD7A 2GC0A 4H55A 1PIV1 1K5MA 2WNVA 4HT1T 4MZUA 1OD5A 2XWJB 4JDMA 4M00A 1CAUB 4B7KA 2IFWA 4L11A 1BMV2 5H9QA 3OTFA 4Q8KA 5T3NA 4AGVA 3R4SA 3ZMOA 4KGQA 4ATFA 1PGL2 5E88A 3FZ3A 4XFBA 1BEV2 1YI9A 3WLUA 1J3QA 1HXS1 1WLCA 4MXWA 3LAGA 4NHKA 4EN0A 1CQ9A 4Q0QA 4RSUA 4D69A 4YVSA 2JEMA 4ISRA 5AC92 2VW0A 1KJRA 1K5MC 4K1YA 4KWJA 4JDOA 4XF3A 2PHRA 1GKBA 1CPMA 1PK6C 1AF9A 4PBPA 2R073 4KG0A 3KMHA 5KC6A 5SV8A 5CFCC 4Q27A 1HV0A 1QJX3 4NVPA 2IXJA 4BIOA 4F3JA 4PCRA 3KCXA 4S2FA 4EN7B 3I7DA 5JVVA 3AYAA 3CL1A 4OI0A 3ZXGA 2WLQA 1CPNA 1IS3A 4UW4A 4WM8C 1R1A3 1NCRA 3ZDSA 3ZFFA 4GH4B 5FTTC 1AHSA 2QVSB 5FQ0B 3GZTB 3MYXA 4ONUA 5SV5A 1TME1 4BQ1A 2YDEA 4PLNA 3N7JA 3Q9OA 3MIHA 4IERA 2WNEA 4XMIA 2WKKA 1OOPA 2PLV1 1ULDA 4I0WB 3KT4A 2DFBA 1AR81 1C1FA 4RS5B 2G9FA 3S6PA 3JQXA 4M01A 2E53A 3OD4A 4QGMA 5I91A 4LO6B 1R082 1LTEA 3QBQA 4YW4A 1PZ7A 2DF7A 3CF6E 3ZSMA 2P3KA 4IEYA 1QNWA 1MS1A 4RR3A 4Y1ZA 1OOPC 4P5HA 3NJZA 2D3SA 4U36A 5DZFA 4YW2A 1PHMA 1V6OA 2VG9A 3E97A 2AUYA 4OHWA 1QOSA 2MEV3 2YXSA 1KXGA 3WP5A 2GZWA 3JD72 4MYEA 3MIFA 1C8M1 2PHTA 3ZIXA 5BNPB 3OY8A 3R05A 1H0BA 2EF6A 2EIGA 2XH6A 4AQ6A 3DKWA 5HXVA 1SCSA 1EP0A 1FOD2 1DLLA 4K7JA 4PIYA 1QXPA 4AG4A 4IEQA 4QMAA 1RUE3 3VKOA 1W6QB 1MS4A 3BTAA 1PNGA 3VZLA 5KXBA 1QU0A 1QQP2 3CO2A 1OLRA 1REEA 1FX5A 2ZGPA 2BNNA 4HETA 3ILFA 4DINB 3AB0A 4LO5B 3M3QA 4P9JA 3VBSA 3UKTA 1DYKA 3EO6A 1W6MA 4SLIA 5K9YA 4L2NA 3LZZA 4LHLA 2FMYA 4YNIA 3PNAA 2ZHMA 3JZVA 3H3UA 4Y20B 5DDJ1 3N7LA 4LO7A 4B7EA 2HWC1 4XQ4A 3OGJA 2ZMKA 4BHPA 4AK3A 5JZGB 4CEWB 4F8AA 1RUF2 4A7ZA 2A6WA 4L9BA 2UWBA 1IPKA 1DGLA 1W6OA 2JG8B 1YO8A 1LHOA 2A70A 3VBUC 3DPRA 4QPGC 5I0TA 1BMV1 4PDWB 3D4KA 3GF6A 1ND2C 2RS33 1ASJ2 4RFT0 2OVUA 5HCFA 1W6NB 4XDQA 1BYHA 1PGL1 1C1LA 4U2AA 4PJYA 4XF1A 1BEV1 2JDZA 3OYWA 1J3RA 5LRSA 3AKTA 2P3JA 1S1AA 1O3SA 4Y1YA 5AC91 1DQ1A 1UZYA 2Z79A 3RJ2X 5BYNA 3KT1A 2MHFA 1VBD3 4HVRA 4XFCA 5GLUA 1N1SA 1S55A 2VVEA 5BNNC 3V0BA 4MH0E 1WW5A 2D93A 2AREA 1MQTC 2QJVA 3IM0A 5FMOS 3LA7A 1CIWA 4YZ5A 1H1AA 2E9QA 2WFF3 2XBO3 4LA2A 2WT1A 3FE5A 4LLOA 4YW3A 1I3HA 1IHMA 3AP5A 3VZKA 4GULA 2PAEA 2QNKA 5TSWA 4AYUA 3IT8A 4S2GA 4XHXA 1QKQA 3OJBA 1OMIA 1VALA 2ILMA 5D8AC 1N3QA 2OYZA 2CY6A 1XXNA 4FXKB 4N43A 1O3RA 2WFPA 5A33A 1YIFA 3AP7A 1LHWA 1OQ1A 1YRZA 3SH5A 2XLAA 1Y3TA 2NPIA 1G9AA 1LOFA 3AKRA 3GZAA 1SLIA 1VBC2 1R081 1VBA3 2NN8A 3V65A 4FVVA 4E4ZA 2PTMA 1H8VA 4N53B 1YYNA 4N43C 2CWSA 2ZZQA 5DG2A 2HKXA 1AYN2 3U11A 4DPNA 3RI8A 5BNQA 5I8YA 1QXJA 3ROUA 1DQ4A 3WW4A 1BXHA 1LOFC 1RUG1 2IWGB 3JD71 4L97A 3NAPC 1NOVA 4WZFA 4OULA 5KWRA 3POYA 1AJKA 1AR93 2WINB 4GB33 3CJXA 4C0BA 1BK1A 3TBDA 2CL2A 4BPZA 3TYJA 4LHKA 1RUD3 1YUDA 2WZR1 4Y5Z0 3ZX7A 2QCSB 5E8AA 4CYDA 2O8OA 2XGXA 5FO8B 2IXIA 1FMD3 2RS11 3AXDA 4AVCA 1QQP1 3MLJA 1VBE3 1U5YA 4XEZA 3BOPA 4BMBA 3MZHA 4BYYA 2X8KA 2JKBA 2QFEA 2VH9A 1PZ8A 2ENRA 2PHWA 1JTZX 1RUI2 4Q0SA 5E89A 1U0AA 2RS52 1YCIA 1BBT2 1LU2A 1COV2 5BNOA 2PHFA 1ULCA 3WDXA 4LBNA 2X29A 4I3GA 1RTVA 2VPVA 4K1ZA 1GBGA 1VRH3 2CYFA 4QD2A 4XFAA 4I2OA 1VAMA 1IS6A 1K5MB 2R0HA 5EV7A 4GMP1 1CAUA 2YPJA 4FAHA 3AX4A 4IEVA 1RUF1 3RG0A 1WA4A 1PK6B 5I0SA 2AZ5A 1RVF2 1GZ9A 1MS8A 2YHJA 4E27A 2P2KA 3ELNA 3PVOA 4HFSA 2XJPA 3RYRA 5CFCB 3RZZA 5BNOC 2F6BA 5IK7A 3AJZA 1ASJ1 1NE6A 4DMIA 1H2LA 3DL3A 4IEOA 3TN93 4MX3A 2YGLA 4HKOA 4WM8B 4YM2A 3H0OA 3SMHA 2N7GA 1CX4A 1Y43B 3ZYRA 3ZPYA 2NQYA 2B42B 5A32B 1V9U2 1ZX5A 2HWF1 3WY6A 3SHRA 1GZCA 2ZX2A 4BM8A 3NV4A 2FBEA 3ZYJB 1N1VA 2I07B 1ZRFA 1NCQC 4AGGA 4JTOA 4V1PA 4GH4A 1NCRB 3N35A 3UKNA 3FFQA 1CONA 2X53S 3B00A 1O3TA 1DU3D 3J9SA 1LOGA 2KXLA 2WS92 3RRDA 3M3OA 5GM0A 4LO4B 1KRIA 2XKOA 1OOPB 1GFF2 1RL3A 1AVBA 2JG9C 4ZU5A 2GNTA 2G4IA 4AEDC 2VW1A 1YWKA 5JR7B 4OHVA 3OGGA 4D7SA 1MS5A 2A6VA 4Y4YA 5J36A 4NN0A 4RGGA 1SBDA 1AL21 4M3CF 4EV0A 4LBOA 4RR3B 4DNYA 1VBC1 2E7QA 1NG0A 2D6PA 3AXEA 5CNAA 4IEPA 1ZBA2 2AGSA 3WHUA 1VB2A 5BNPA 4HKLA 4EJRA 1RUH3 2IC1A 4CEYC 3AM2A 4IQPA 5FFOC 5GLVA 3G6JB 1AR63 1AR72 1W6QA 4YW1A 3S30A 4FQ4A 1EV12 1AXZA 1KDKA 2OW4A 3LCPA 1AYM3 2BW8A 4AI1A 1SLCA 2XJRA 1DGWX 1RHI2 1EAH2 4P9XA 2XLFA 5F1RA 2IZWA 1LGCA 2EXHA 4P9GA 3VZNA 2YC0A 1X82A 2ZBJA 4MXVA 1W6MB 1ZZ7A 3I4IA 4OHYA 5JWPA 4PBOA 2O0OA 3MIGA 4C1WA 5I8TA 4HZFA 1OFNA 1FPN2 3VBUB 4DXZA 1O5UA 2ZKNA 4K20A 4Y20A 1ND2B 5J37A 1PIV2 4BMEA 1RUI1 3PJYA 4URTA 1XE7A 4RQPC 4IV1C 3V56A 2RS51 3O7OA 2Q0AA 1BBT1 2JD4A 1COV1 3I2DA 4CEWA 5JZGA 3PTYA 4XJ8A 1GV9A 4RA0A 3WP4A 2ZHLA 3O0WA 4MVTA 4WBBA 1QOOA 2JG8A 1HRI3 1MS0A 4KL1A 2OA2A 3RI9A 1HX6A 1SLBA 4K21A 4PDWA 1Q8OA 3GNEA 5BNNB 1GR3A 3IWZA 2ZOEB 1A8DA 1DQ6A 3BALA 3VBOC 5I0UA 3LGRA 2XJSA 3NKTA 4PIXA 1MQTB 3TRSB 1Q3EA 3KGLA 5K7PA 5H9RA 2DCKA 3VV1A 1Q56A 4PF5A 2RJLA 2BWAA 5BPXA 1GSLA 1LHVA 2A71A 3V0BB 3LA2A 4F83A 4A7YA 1QF3A 1HDKA 4EWDA 4Q0VA 1V9U1 3AMNA 1NQJA 1WD4A 5D8AB 5A3LA 4S2HA 2XJUA 4E2SA 1AJOA 2XLGA 1TME2 1UZZA 4UW6A 3E5UA 3B01A 3H7YA 4BOWA 4Q4V3 3VZMA 3HR9A 3ZFGC 1VP6A 1Z0HA 1O7FA 1O4TA 3UJOA 4XHBA 1H8TC 3POWA 2TUNA 4YZ3A 3DGTA 4CDUC 2WS91 1ND3C 3PJQA 1RUC2 4N43B 3VBRC 4FPKA 4YZ1A 3MLKA 5CG8A 4PIZA 4QM9A 3MI8A 3P3PA 5FCCA 2VNGA 4OZXA 1YIPA 4OVEA 3NAPB 3ILNA 1GICA 5DUXA 5JAXA 4AW7A 5DDJ3 1S0JA 4N53A 4TSVA 4Q26A 4ZKTB 5J09A 2VU9A 5LK7B 4XW3A 4DB5A 1M4WA 3ZSKA 3O5SA 3VHRA 1ZREA 4N7IA 4AHWA 2D98A 3ZYPA 3UL2A 4FQZA 2I74A 3ZXFA 2GC2A 2ZZJA 3IPVB 2GNBA 4S2DA 4JVAA 3RYKA 1LEMA 2B45X 2Y0IA 2YUEA 1ZZCA 1REFA 1BEV3 4B4RA 1O3QA 1HIXA 3KLSA 1MEC3 1AR71 2ATFA 4I30A 1EV11 4XF9A 5GZGA 2R043 3L9JT 4NOTA 3WUDA 4DY3A 1HQWA 1RHI1 2RHPA 2QZ3A 1EAH1 2B5HA 2A3WA 3FBMA 1V6NA 4TYSA 1F2NA 5BNOB 1W39A 2W68A 1FPN1 1WMDA 4GKYA 1SLAA 3MFCA 4BH9A 5EXOA 2VOVA 1RB8G 1OHFA 2GN3A 4FTBA 4N90A 4YARA 1PK6A 2CNAA 3ZSEA 1IQAA 2DVBA 3J8F2 3M70A 3ENRA 4OFGA 5CFCA 2MNGA 3E5XA 1S0IA 4I01A 1N3PA 2B7YA 3CU7A 1HW5A 4AHYA