4QPGB

Crystal structure of empty hepatitis a virus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
204
structure length
204
Chain Sequence
GASYFTSVDQSSVHTAEVGSHQIEPLKTSVDKPGSKKTQGEKFFLIHSARWLTTHALFHEVAKLDVVKLLYNEQFAVQGLLRYHTYARFGIEIQVQINPTPFQQGGLICAMVPGDQSYGSIASLTVYPHGLLNCNINNVVRIKVPFIYTRGAYHFKDPQYPVWELTIRVWSELNIGTGTSAYTSLNVLARFTDLELHGLTPLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Hepatitis A virus and the origins of picornaviruses.
pubmed doi rcsb
molecule tags Virus
total genus 28
structure length 204
sequence length 204
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qpgB00
4CEWC 1VRH3 1MQTA 4IV1C 1VB2A 4RQPB 5LK7B 5C9AC 1HXS3 1R092 2RS13 1EV11 1NCQA 4WM7A 2PLV2 1HX6A 2HWB1 4Q4Y3 1OOPB 1MQTC 1RUG2 4IV3B 1RHI3 3JB4C 5ACA1 1X36A 5L7OC 1BMV2 4CDUA 1QJY1 3VBSA 2HWF2 1CD3G 4WM7C 2MEV2 4QPGA 1AR71 2WS92 5K0UB 1PO22 3JD73 1VBB2 5J96B 1COV1 1R1A1 3VBSC 2RS52 4YVWA 4RQPA 2RMU1 4WM8A 4SBVA 1AL23 3M8LA 2HWB2 1ZBE3 1PIV1 2HWE2 4JGZB 1NY71 1FPN1 1RUE1 1A6CA 1OOPA 5ACA2 4YVWC 4RQPC 1Z7S2 5JZGB 1QJY2 4WM8C 1RUD3 1ND3A 1RUF3 1AR72 1TME3 1AYM2 4AEDB 3ZFFA 1VBC3 1AYN1 2R072 1OOPC 4IV3C 1RUI3 1TMF2 1RUC1 4Y5Z0 2VQ0A 4N53A 1B35B 3ZFFC 1AR82 3ZFGA 5C8CB 1FPN2 5K0UC 2BPA2 1QJU3 1RUE2 1ZBA1 4JGZA 1VBA3 1K5MA 1V9U1 5JZGA 4RHV3 2RR13 1RUH1 2Y26A 1HRI3 1AYN2 4JGZC 2WZR3 1RB8G 4QPIA 1K5MC 1RUC2 1OHFA 2WFF1 2TBVA 5JZGC 1POV1 1NCQB 1HXS2 1H8TB 1B35A 3FBMA 4CEYA 4AEDC 2HWD3 1ZBA2 4QPIC 2PLV1 4CDWA 1RVF3 1FOD1 4LLFA 4Q4Y2 2RS31 1D4M3 1R1A3 5BNPB 1VBE3 3CJIB 4GMP3 1V9U2 4CDUB 1C8NA 1RHI2 1B35C 4NWVA 4CEYC 1RUH2 4QPGB 2XBO3 2HWF1 2R043 4NWWA 1BEV1 2RM21 1PO21 4Q4W2 5FMOS 1VBB1 1FMD3 4YVWB 1ND2A 4Q4V1 4Q4X3 2QQPA 4WM8B 3VBHA 1AR63 2RS51 4CDXA 4JGYA 1H8TA 1RUJ3 1AL22 2HWE1 1FOD2 2DF7A 1F8VA 2RS32 1ND2C 5AC91 1PVC1 5DDJ3 3TN93 1RMU3 3NAPA 5ABJA 1Z7S1 1ND3B 5BNPA 3CJIA 4CDXC 1MEC1 1NCQC 1H8TC 3ZFFB 1AYM1 1BEV2 1TME2 2RM22 3ZFEA 2R071 2ZTNA 1VBC2 4Q4V2 4N53B 5BNPC 3CJIC 4CDUC 1TMF1 5BNOB 5CFDB 1NOVA 3VBRB 4FTBA 1VBD1 4QPGC 3ZFGB 1EAH3 4BCUA 1AR81 2R061 4GMP0 5AC92 1PVC2 1K5MB 1BBT3 1HRV3 4CDQB 1PGL1 1MEC2 2HWC1 4EJRA 1QJX3 1R093 3JBG1 3J8F2 4RHV2 1R082 2RR12 4QPIB 1HRI2 4FSJA 1ASJ1 1QQP1 1RUG3 4RS5B 3VDDB 1ND3C 1VBD2 1VRH1 5FMOL 4CEYB 5CFDA 5GKAC 5BNOA 3VBRA 1AR93 1HXS1 5BNNA 4CDWB 2MEV3 2R062 2RS11 1C8M2 1PO13 2GH8A 2WS93 4GB33 2HWD2 1PO23 1VAKA 1PGL2 4N53C 4Q4Y1 4GH4B 5BNOC 5CFDC 2HWC2 4CDQA 3VBRC 1RHI1 1VBE2 5BNNC 3JBG2 1EV13 3ZFGC 3VBUB 2HWB3 1NCRB 2IZWA 1ASJ2 1ND2B 1QQP2 2R042 4Q4W1 5D8AB 4CDQC 2WLPA 3VBHB 3JD71 5ACA3 1FMD2 1VRH2 4RS5A 3VDDA 4Q4X2 4CDXB 1QJY3 4JGYB 2RS12 1AR73 5A32B 1AL21 1COV3 1X33A 1ZBE1 1NA1A 3NAPB 5ABJB 4RS5C 5J98B 3VDDC 1TMF3 5DDJ2 2RMU3 5A33A 4GH4A 1DDLA 1RMU2 4PDWB 1PIV3 3ZFEB 4CDWC 1RUD1 5CFCA 1RUF1 1TME1 1FPN3 3VBUA 1RUE3 1NCRA 4RR3A 3JD72 4Y4YA 1VBC1 4GH4C 5D8AA 1RUI1 2X5IB 3VBUC 2WWSA 3S6PA 1AYN3 1EAH2 1NCRC 1ZBE2 5A32A 3LOBA 5D8AC 4FTSA 1RUC3 3VBHC 1QJU1 1BBT2 1IHMA 4JGYC 1QJZA 1VBA1 1RUD2 4PDWA 1QJX2 1RUF2 1SMVA 3J8F1 4RHV1 5L7OA 1R081 1ZBA3 2RR11 4YVSB 1HRI1 3NAPC 5ABJC 2WZR1 1RUI2 1V9U3 2FZ1A 1WCDJ 5BNNB 4PDWC 1GFF2 4Z92B 1RUH3 1CJDA 3ZFEC 1AR92 2X5IA 2ZAHA 1F2NA 1C8M1 1PO12 2HWD1 4GB32 3VBOB 2WFF3 1QJU2 4Q4W3 3VBFA 3ZXAC 1RVF1 1VBA2 1POV3 1D4M1 1OPOA 1VBE1 4GMP1 2X5IC 1EV12 5C4WB 2PLV3 2XBO1 3VBFC 1FOD3 2RS33 4YVSA 2BFUL 2WZR2 1HQNA 2R041 2BUKA 3HAGA 2GSYA 1FMD1 4RFT0 4N43B 4Q4X1 4IV3A 2HWF3 1AR61 3DPRB 1BEV3 1NA1B 4YVSC 2RM23 1VBB3 1RUJ1 2XPJA 3JB8A 1COV2 1RVF2 4Q4V3 5A33B 3VBOA 1D4M2 5K0UA 1R1A2 2RS53 5DDJ1 3TN91 2RMU2 1RMU1 5CFCB 2XBO2 2BBVA 2HWE3 1PIV2 4RR3B 5AC93 1NY72 1PVC3 5C4WA 5FOJB 3VBOC 3IDEA 1Z7S3 4CEWB 1MEC3 4IV1B 1AR62 5C9AB 4N43A 2FZ2A 1AYM3 3J8F3 5C4WC 1R083 1AUYA 1RUJ2 3DPRA 2R073 1EAH1 1POV0 1PGW1 4AEDA 1MQTB 3TN92 1BBT1 4N43C 1HRV1 1VBD3 2ZZQA 2BFUS 5L7OB 3DPRC 1AR83 2R063 4WM7B 1QJX1 1NA1C 1R091 1C8M3 1AL0G 4FTEA 1VB4A 1W39A 5C8CA 1E57A 1M06G 2HWC3 1RUG1 4CEWA 3VBSB 3JBG3 4IV1A 5CFCC 5C9AA 1BMV1 1NG0A 1AR91 4RR3C 3VBFB 1PGW2 2MEV1 1ASJ3 5C8CC 1QQP3 1PO11 2WS91 4GB31 2WFF2 1HRV2
chains in the Genus database with same CATH superfamily
3FFQA 1VRH3 4FFFA 1NLQA 2QQNA 1G6NA 4BU2A 5C9AC 2XQXA 2AR6A 1H9WA 5D1IA 3S0MA 2IC1A 2SBAA 3JQXA 3S57A 4NJ4A 3S5AA 3KV4A 3LFMA 3K3NA 3MGUA 1PZ9A 1KS5A 1WMDA 2HWB1 4LKFA 2YC0A 4PCRA 1O5UA 4P08A 1QDCA 4Y24A 2DUOA 4AHXA 1YQ5A 4WV8A 4IV3B 4YGDA 1W6MA 4LT5A 2FDFA 3APBA 4C91A 1NXD1 1SFNA 4FP3A 2JKBA 3H7YA 4LBNA 4FT8A 4Y22B 1X36A 3PVNA 5DUUA 1JYNA 5L7OC 1H2MA 1OD3A 1UX7A 5FAXA 1DBNA 1QJY1 2HLEA 3KSCA 4XOGA 4Y3OA 4MHUA 1O59A 3FHAA 4QPGA 5EXOA 1O8SA 5K0UB 2F4LA 4RN5A 2J1EA 3ZKUA 3O12A 1V6JA 1UL9A 3B3QE 4BQXA 4HFSA 3JXSA 4HVRA 4PJYA 3WINE 3A0KA 2ARAA 1I6XA 4OHZA 1DYKA 2KD7A 1O4ZA 2RS52 3Q8EA 2PN5A 4JHTA 2UYAA 1LB2A 4XJ8A 4JVAA 4I0BA 4JCKA 4XJ9A 4Q0SA 3M8LA 4AHYA 3NO8A 3NNFA 5A6QA 2Y6FA 2V4AA 3ST7A 4YGCA 4AEJA 2W08A 3MW3A 1X50A 4TXWA 3N9LA 1A6CA 4QDQA 5ACA2 3H42B 5ISLA 4NPRA 2WFPA 1VIWB 4BH9A 2CYFA 5L36A 1WZXA 2D6LX 1AYM2 2VMHA 4AEDB 1BQPA 2VCBA 2WSVA 3BCWA 2VNRA 1AYN1 4BIOA 3DXTA 3WCSA 2QQJA 3HT2A 1RUI3 4ZKTB 3WUDA 4QQOA 2VQ0A 4LE3A 4XVHA 5FYUA 2Q30A 4FPFA 2RDQA 4A7YA 4QB1A 4JHZA 4MGZE 3HBZA 3VKOA 4XAEA 5BPXA 4D7SA 1SBEA 4JQRA 4MSVA 1QY4A 1KDMA 1G8WA 1QWRA 3I2HA 4F3JA 2WIIB 4HANA 3ZFGA 4CYDA 5C8CB 1FPN2 1MACA 5FXZA 2BPA2 4QPYA 3H8RA 1YQCA 4IDZA 4OUMA 4W4ZA 5F5QA 3ZR6A 3E5XA 1LJ7A 2XLAA 3LEKA 1G9AA 3NNMA 1WW6A 4PI0A 5JAXA 2FDGA 3VZLA 5JZGA 1JYIA 5FTTC 1FYUA 2Y26A 1HRI3 4XDPA 1BK1A 5EQUA 1KFUL 5LA9A 3K4ZA 3OBRA 2WZR3 4H7LA 1IZ3A 3FN9A 1LU1A 1OHFA 4R4ZA 4RA0A 1QH6A 2JE7A 2Q1FA 5JZGC 2Q1MA 1W6PA 4QPWA 5IVJA 4QXKA 2YGMA 2QFEA 3M2MA 1HXS2 1U5IA 2JD9A 1H8TB 1B35A 3H7JA 3FBMA 5FOBB 1BJQA 4CEYA 1TEIA 5CA6A 5JSPA 5C5TA 1AX0A 2HWD3 5E89A 3NNLA 4ASLA 4DMIA 2GU9A 3OPTA 4CDWA 3I3DA 1O3SA 4XZPA 1RVF3 4J1XA 3CNAA 5FZBA 3ZSKA 3WF1A 3CJIB 4CDUB 1V9U2 2V5YA 1DU3D 2JDNA 3IMNA 4CPBD 4ZONA 1B35C 5EJ3A 2LRPA 2YXSA 3AMPA 1CAXA 3B93A 4NWVA 4CEYC 1RUH2 1CX1A 1OSGA 4MXWB 4HN1A 4AVCA 4BXSV 3WQ1A 4AOCA 5LY1A 3B94A 3O14A 1DCSA 2R043 4NWWA 3T4VA 4UFMA 1PVXA 1PO21 1V6NA 1AX1A 3C7OA 4Q4W2 1FMD3 1V6OA 5FBZA 4CP9A 3WF3A 1W28A 4XUPA 5A7OA 5FXWA 4Q4V1 4Q4X3 4ES9A 4XMIA 1CJPA 3O0VA 1LEDA 4YYOA 4GKXA 3ZN4A 3DEMA 2ZMKA 3RYKA 3N36A 1PX3A 2W94A 3A21A 4XUQA 5I0TA 1IQDC 4CDXA 2YB7A 4C0BA 1AL22 5A70A 1QOOA 1CAUB 1F8VA 4K9SA 1GUIA 4RD7A 2OYZA 4AYUA 2QTWB 5DAWA 1SFPA 3T08A 3WNPA 5HCBA 1XSRA 3F2ZA 4XIKA 3ZPOA 1VLNA 2PFWA 3NAPA 5FP4A 2BOJA 4CDXC 1MEC1 1BLZA 2HJIA 1S2KA 2XB6C 1X9PA 3ZFFB 4XXPA 4GA9A 3EXUA 4GJZA 2QDNA 3RZGA 3TRSB 2HEYF 1G7YA 2ZACA 1SBDA 2DUQA 4IEQA 4AAPA 5LZ6A 3HNYM 1W6OA 3ZX7A 4AHWA 3GCXA 3CDZB 4TTGA 1YYNA 4N53B 3L2YA 2Q1ZB 3KCCA 2IFRA 4ZY9A 2B4KA 5CFDB 1E5HA 1NOVA 2WRAA 4M4RA 4FTBA 2Y6LA 4H14A 2HKXA 4CXWA 5LBEA 4QX8A 2W91A 4QKFA 4BQ3A 4BCUA 2B45X 2VM9A 2E33A 1PVC2 1YXWA 4Q5OA 1K5MB 5F2WA 3LDRA 3VD4A 4OZXA 1HRV3 2ES3A 2RDSA 4M01A 4BLJA 2FD8A 3FUQA 1PGL1 2XJVA 4N9HA 5F5CA 2CWMA 1DZQA 1QF3A 1QIQA 2A71A 5F7UA 2Q8OA 4MLOA 2LALA 3LDKA 3JBG1 3J8F2 1KRIA 2C9KA 3IPVB 1R082 4FP2A 5FLJA 2RR12 1HQLA 3OGVA 1CX4A 4C0HA 1IPJA 1Q8SA 4IE4A 1QNWA 4UW5A 5KXBA 1XU2A 4QGMA 2WKKA 4XACA 1J84A 3VHNA 5IWFA 4MGYE 4KI5M 3ME2A 1ND3C 3QLQA 5FMOL 4ZXEA 4BQ5A 4YFWA 1IG3A 3LKJA 5FP7A 1W6NB 1JZ8A 2ZKLA 2R062 3RI9A 3ZYIB 5AVAA 4OVEA 4ISRA 1WCQA 4GZ9A 2WS93 2GH8A 3BTAA 5KR7A 1PO23 5IFPA 4GXLA 1W6QB 3RZHA 3AJZA 3LB9A 3T0BA 3MPBA 2DWRA 3VZMA 3WF2A 4GH4B 2BTVC 1NE6A 2HWC2 2DV9A 4CDQA 2QQMA 1Q5OA 4GWMA 4AI0A 1RHI1 1VBE2 1WKYA 3TEYA 1LENA 1UO9A 4YGBA 4CVUA 1FNZA 1W03A 3AMNA 2Y0IA 3IDBB 4P9IA 2Y0OA 3B02A 4TSVA 2JB4A 1NCRB 2IZWA 2XDVA 3N7JA 4J6GA 3URFA 4EWAA 1ND2B 1FV3A 2JG9B 4KH9A 4CDQC 3VBHB 1UPIA 1QGLA 2J1RA 2CGOA 1VRH2 2E7AA 2X09A 4FOVA 2W39A 4MGQA 2QZ2A 1DGWX 3GDBA 2C24A 3DYMA 4YRDA 1W2AX 1W2OA 3QACA 4X6QB 2I74A 5FK7A 4IEOA 3E6CC 3UKVA 1XXNA 1MS3A 2AREA 4GJYA 4PIXA 3POBA 4Y20B 5K7PA 3OBZA 4YG3A 2D40A 1KFXL 2YPDA 5A33A 1G9CA 3IMMA 3HIFA 2JG8B 2GC0A 2PYTA 2BNNA 1IS4A 2PHUA 1UF2C 1PIV3 2WT1A 3J7MA 1Q8PA 4QKDA 1IQAA 3ZKYA 3SKJE 4K40A 1TME1 2W87A 3VBUA 5A1LA 1RUE3 4RR3A 3AL5A 1UWWA 3ZXDA 5AFBA 1VBC1 3OUIA 4RGKA 2CTVA 2EIBA 3RNSA 1OKQA 3MF6A 4MZUA 3ZYGA 5FZKA 3ELNA 2DCTA 3OGJA 1UY3A 3BIWE 4OMCA 1U0AA 3VBUC 1WMEA 5L9VA 3S6PA 3U10A 3POJA 2P3JA 3BYWA 2F17A 2RJLA 4BMEA 4Z1VA 5GZGA 5FYIA 4NHMA 1JUHA 1UCXA 1UY1A 2ET7A 1I5ZA 4NOTA 1QJU1 2GN3A 3EB7A 4PLOA 4W8JA 2ENRA 2VECA 4A6SA 1IG0A 2J1AA 4JGYC 1VBA1 4OI2A 2PTMA 4UWDA 1EUUA 1HKDA 1CAWA 4LBOA 5EFUA 4E4ZA 1JZ6A 1QJX2 2UURA 4IEZA 4XCBA 4BPZA 4CP2A 5FR3A 2LS6A 1WMFA 5HV0A 3KB5A 5G05L 2Y6KA 2G4IA 3AKTA 3FE5A 2JB8A 4FCAA 3SC7X 4CU6A 5ABJC 5JI9A 4Y1VA 3O1TA 5FUPA 2DTWA 2ERFA 4S2DA 2Q8DA 1RUI2 5LWBA 1OMIA 2LTNA 4P5HA 1DFQA 1URXA 1WMXA 1XYPA 5FJKA 4BQWA 3MPPG 2ID4A 5FBJA 4LXLA 1YCIA 3WNKA 4COVA 3V64A 1PX4A 3POWA 4AI1A 5EYXA 5J7MA 1OT5A 2W1UA 5FY5A 3V0BA 4GWJA 2ZGQA 1D7PM 1H4HA 1KEXA 4FI9A 1V6IA 2WINB 3I97A 4LPLA 2XL9A 5FUIA 4D3WA 3ZYRA 4YARA 2ZGSA 4BQ4A 1LOFA 1H2KA 1ONAA 2YUEA 3M7AA 4GMP1 4HN0A 3AMHA 3RSJA 4DEQA 2DFBA 2UWBA 1H1IA 3O0WA 1MS9A 5FMCA 4LK7A 3M4FA 1ZZBA 1FOD3 2RS33 2YMZA 4HKLA 1UXXX 2WZR2 1HQNA 2GALA 5IVVA 5KWRA 3WVJA 2EIDA 1LOFC 4CPBA 5F5AA 2QQWA 3V56A 4LA2A 2Q4SA 3VHRA 2BNMA 2G1MA 3GZTB 2H0BA 1PK6C 2GC2A 4XIOA 2Q8CA 3AKPA 2ZHKA 1NA1B 2RM23 4R9AA 2R0FA 5GALA 1BKZA 1RUJ1 3FFZA 1A34A 4MGSA 4K6BA 2B42B 1RVF2 2JE8A 5FZ6A 3C3VA 4V2VA 2VZPA 5FYCA 1VJ2A 5DAQA 1JOJA 2RS53 5DDJ1 4OCTA 3N9MA 1JMUB 1DZTA 1RMU1 3SNMA 4FPCA 4Y1XA 2YFUA 3RG0A 1PHMA 1OLME 3EO6A 1YQ8A 2P5BA 1SLAA 1S0JA 4PQQA 2D3PA 1YLLA 1TNFA 2GZWA 3THPA 3ZXEA 2R7EB 2EXJA 4HPKB 4DEVA 5DPNA 2JDMA 3USUB 3HVDA 1D0GA 2VMDA 2D43A 2Y8KA 4PLNA 3ZVXA 5C9AB 2DU1A 4JZRA 2VNOA 3J9SA 3USSA 3W59A 4EE2A 5T52A 4OHVA 1AYM3 2XJUA 1C28A 3E6DA 3VD7A 5IVFA 3KT7A 3PIJA 2R6QA 4D6RA 3MZHA 3OYWA 1POV0 3GJAA 4XABA 1PGW1 4YW4A 1W9WA 2WYSA 3ES1A 4HT1T 2P34A 4Q0PA 5HPOA 1KD7A 2J1VA 2E31A 5HV4A 1VBD3 4UYBA 3AZYA 5L7OB 3RJ2X 2AZ5A 2VCCA 2VC9A 1MPXA 1V70A 1ZZ6A 2QBXA 4B7EA 2DDUA 1W8NA 2OXBA 1AL0G 4W50A 1LGNA 1GWMA 3S7IA 3WW4A 2ZKNA 5CKQA 4WBBA 5CEHA 1E57A 4I3GA 1LECA 1FNYA 1VP6A 2K0GA 5JOWA 1RUG1 3H8OA 3T09A 1GMMA 1H1MA 1DQ5A 4LMFA 1CIWA 2VE1A 3IIIA 4KWUA 4LHSA 3U1XA 5CFCC 1AJKA 1BMV1 1NG0A 2QJVA 3VBFB 1I1EA 5JXIA 2E51A 2ZOEB 4HL0A 4BQ1A 1RUNA 2Z4FA 4AZZA 3EQEA 1QQP3 1ENRA 1K5JA 2BERA 3HJRA 4YSFA 2K9ZA 4QU1A 2BQPA 1HRV2 3ZIXA 3J4UH 1L3JA 1BYHA 4INDA 3POSA 3WG2A 1NKGA 1MQTA 1Y9QA 5LK7B 5JXHA 1HXS3 3PUAA 3ZO0B 5FZIA 1HB1A 4B4PA 2Z2SB 5F3EA 1GOGA 2RS13 5GLUA 1WBLA 1EV11 4DRRA 4QGLA 4OUEA 3B9CA 1NCQA 5CKNA 2FQPA 2YGLA 5FZLA 1HX6A 5LCWL 1J59A 4CCEA 3DV8A 2OUJA 2ZMLA 5IFTA 4JDOA 3MIFA 4EN9B 1MQTC 2P2KA 1O5LA 4K1ZA 4Z82A 3JB4C 3UJOA 4XCAA 1R1ZA 1MS5A 2J1SA 5JOZA 3WD5A 3LA7A 3MUZ1 1W2TA 4EV0A 1ZA4A 3IDAA 2VZQA 4ET7A 1CD3G 1L7RA 2WQZC 3K4DA 3N7KA 4R9DA 2WNOA 4HOOA 3E5QA 1GOFA 1J58A 5J3UA 1AR71 3NJZA 1LHVA 2WS92 3JCIA 4B4RA 4F83A 2ZS6B 2FDHA 1OA3A 4MUVA 1DGLA 1PO22 5LBFA 2OQ6A 2AC1A 1COV1 1LHUA 4XHXA 2BP6A 1JOPA 2XMLA 4BIFA 4YZ5A 1LEMA 1NZCA 3OUHA 4D8MA 5IK7A 5GJ6A 2NMNA 4Q0UA 2PAKA 1KGYA 5JOXA 3U07A 2EXIA 5FKBA 1SCSA 4UT5A 3KWVA 4WZCA 2O14A 1XNCA 1Q8QA 4UF0B 1Q3EA 4NN0A 1UYYA 3VKMA 1AL23 1O3RA 2A3WA 4UFIA 4NAOA 1GSLA 3MLJA 1WCKA 1VMJA 5F9TA 1YIPA 5J37A 5DAVA 2J22A 2V73A 4H2AA 3FLRA 4MHRA 4OFGA 4R4XA 3FMGA 1OC1A 3PJYA 5JMOA 5FZ9A 3VN4A 4XJZA 2MHFA 5FJHA 1A78A 5AFEA 5JZGB 4UFLA 1MZEA 2E6VA 4KU8A 2VQAA 3LGRA 1RUD3 4XURA 3GF6A 2BGOA 3TNQA 2DVDA 4IGOA 3T0DA 2XJTA 1H2LA 1YFYA 3QD6A 1UU5A 3U0ZA 4FPYA 4XJAA 1RUC1 1W6PB 2EIGA 5EYYA 1I9RA 1OH4A 1J1TA 1SPPB 2Y34A 4DS0A 5B4XA 2B46X 3WDUA 3V0AA 1B35B 4ARYA 2QDRA 4GKYA 3UNPA 2P3IA 1MVEA 3LOIA 4I3PA 5JMCA 1TQ5A 3MYXA 3H3LA 4I30A 4ZU5A 3IM0A 1UKGA 4GD4A 4LORA 3WG1A 1W9TA 3RFRA 1RUE2 1NZIA 1ZBA1 2DVFA 5KHGA 3KGLA 2E63A 1ZA7A 5K8SA 3IKWA 2ZX2A 2E7QA 2VNGA 1UX6A 5L19A 1CAXB 3NV2A 2JD4A 1P8JA 1CESA 2HBTA 3VL9A 3MIDA 5FZFA 2RR13 4OI4A 1WUVA 4BA6A 1X82A 1Q8VA 2XOMA 3LIHA 1IS3A 2XR4A 1YUDA 4BZ4A 4CP9B 4JC1A 3TAYA 4QPIA 3AP5A 1D0HA 4BB3A 1VPHA 3DKWA 5JVVA 4ZZ8A 5HI0A 2J1TA 2AEYA 4HVOA 5KHKA 1XJAA 2VZRA 3DCQA 1RITA 2D6NA 4ZS3A 2VH9A 2ET1A 4MO3M 2DBNA 2GN7A 2VNVA 3GM8A 5FYBA 3I2JA 3WW2A 4NRMA 2D7FA 3LE0A 4MYEA 3O7OA 4DUVA 1GZWB 5I8YA 3P3PA 4HZFA 1JH5A 4QPIC 2PLV1 5FYMA 4IL7A 4LOSA 4EROA 3ZDSA 3DUIA 4ONUA 1ZZ9A 1REDA 3AP4A 2QQLA 1VBE3 3LD8A 2RDRA 4C90A 2ZHMA 1RHI2 4U36A 1UY2A 5EWSA 5FQ0B 1K45A 5FZ7A 2VOVA 3OBAA 5DG1A 2BGPA 2X10A 3D4KA 3IWZA 5FZGA 3A4UA 3I3EA 4FVVA 2HWF1 3UK9A 4ARXA 4YZ3A 4IE0A 3K77A 3W5MA 3HBKA 1OI6A 1BEV1 5FYSA 3ZSJA 1LODA 4QB6A 1VBB1 2C1FA 1DGWA 4FPLA 4AI8A 3N9QA 5C3RA 4YVWB 1UY4A 1ULDA 1VAVA 2XG3A 4XFCA 3W58A 1N1SA 3SEEA 2P6HA 4WM8B 3ZXFA 1C57A 2WL1A 4FOWA 4ATFA 1RYYA 4XFHA 2Z69A 5GZFA 1FV2A 4E27A 5ANNA 2CSGA 1GOHA 4CXYA 4YW7A 1H8VA 3UETA 3BPZA 5KBFA 3WQBA 3A23A 1O3QA 1FOD2 2DF7A 1S4CA 2RS32 2QUOA 1ULOA 2WO1A 3OPWA 4ISQA 1JZ5A 5AC91 1JZ7A 3U4SA 4Q0QA 2GMMA 5CG9A 4WVZA 2C5DA 3TN93 3WUCA 4AVVA 1H6YA 3VKNA 2V09A 1ND3B 3AMQA 3NNGA 2VGDA 2BNOA 3T0AA 1YFWA 2RVAA 5BNPA 2VMEA 4HLTA 2PMWB 3B9IA 3SCFA 2J1UA 2VY0A 4DXZA 1OFNA 1TME2 2RM22 2ZGRA 3THCA 3ZFEA 4FFIA 2GMPA 3C7FA 4R52A 4CCJA 1OQEA 4OYUA 1VBC2 2B9UA 3I2FA 3OD0A 3KZ4C 5BNPC 1Q56A 2JDZA 3IAPA 1OVPA 5LBBA 3KQ4B 4UI9L 4QPGC 3HN1A 1QXJA 2TUNA 3VD5A 3WNMA 1UMHA 4FPGA 2D6OX 3N9PA 1AR81 1HW5A 1Q43A 3ILFA 3UKNA 2QKDA 4IGPA 5LBCA 5C5UA 1S0BA 4LKDA 3PJQA 5F39A 2RE9A 5C3PA 4IESA 4CDQB 2WDBA 4DUWA 2VTXA 3IBMA 1I3HA 3GXUA 5F37A 1D2QA 1DQ0A 2Y6HA 3VGIA 4QHOA 4FPKA 1XRUA 5EJZB 1IGOA 1QJX3 1R093 3WOGA 5KXDA 2A6YA 2XQRA 5CAZA 4TZDA 1RXGA 3H1MA 5FPXA 2DVAA 4NROA 1ASJ1 4E2QA 4D94A 1RTVA 3OTFA 4J1WA 4E4DX 4CU7A 3DYOA 3AJYA 1ZVFA 1YHFA 1VBD2 3POGA 1I5PA 1WLDA 3KVBA 4FBFA 2XVLA 2ADDA 3VBRA 4A6OA 4CRQA 4H55A 5BNNA 4NVPA 3U78A 4BMBA 1W04A 4QAWA 4CE8A 2MEV3 1GNHA 5LRRA 4XFGA 2XKPA 4FQ4A 4LO4B 4D7TA 3RZLA 3D3AA 5J09A 5CBLA 3AZVA 2SLIA 1PM7A 1LESA 3UJQA 4Q4Y1 3M3OA 4O61A 3VHOA 1AVBA 4Z8BA 3H8XA 1CAVA 3NKTA 4AQ2A 4G3YC 4I01A 1S0DA 3VBRC 1JXNA 5BNNC 1Z78A 2YBKA 1OQDA 1UIKA 2BVBA 3I2IA 4OI1A 4NIHA 3ZFGC 2VUAA 1LHNA 4L0PA 1KDKA 3DN7A 2HWB3 3VBUB 3HEIA 1ULPA 2W5FA 5CU1A 2VJXA 5GZCA 5FK8A 3B69A 1Z0HA 1LOEA 3ZYPA 1W8WA 2WABA 1QQP2 3IT8A 3MIHA 2A6VA 1TZOA 2UY8A 4LKEA 4OUSA 5C3SA 4CP1A 4GQ7A 4LUKA 3JD71 4RS5A 4CUCA 1U5YA 3C7HA 1QJY3 1O7FA 1S2EA 4JGYB 2OUHA 3WDYA 3WX5A 1KITA 4UFJA 1PZ7A 1S0CA 2RS12 3NNJA 3ZYHA 2Q8EA 1H30A 1ZBE1 4QX3A 4BWOA 2WQ4A 5ABJB 4RS5C 1GLHA 4P00B 5CKMA 5FYVA 1DYPA 5B2GB 5LW9A 5DDJ2 4EQVA 1T6GC 4B1LA 1CAWB 1RMU2 4W6XA 1YQ2A 2VL4A 4CDWC 1NT0A 3WR0A 2AGSA 1BCXA 2JECA 5CISA 3TNPB 3BKZA 2P1BA 5T5JA 5T5PA 1RUF1 1F31A 4EN6B 3LF7A 2IXLA 3OBTA 4XBQA 3M3EA 5A6XA 2O8QA 3HN3A 4HK8A 3J7HA 4RGGA 4XFIA 2Q5TA 1FXZA 1WCUA 3D8CA 5JXJA 1CVNA 4AL9A 1DQ4A 4J25A 4DZGA 3DYPA 4MVTA 2VOXA 3ZXJA 4YW6A 5J36A 3LQCA 2WWSA 1JZ3A 4JTNA 1WW5A 1AYN3 4M0NA 3KHCA 5A32A 4PBOA 4XTMA 5EZWA 2C0ZA 2CAVA 3BVCA 3FUOA 3K4AA 1JTZX 1UYXA 4LIVA 4XFFA 5A7WA 4LIUA 3FL7A 4BQYA 3POFA 1IHMA 1A3KA 2Y6GA 4GIQA 3T2OA 2WT0A 3AMMA 1XNTA 1RUD2 2VD7A 2WNUA 1SFYA 4PDWA 5F2SA 1PK6B 4RHV1 3AXEA 1L7QA 2IXJA 2PAEA 1ZNPA 4JX0A 4R9CA 1AXKA 2ZGUA 3NAPC 4DFSA 4EZ4A 1ZYBA 5FZDA 1XQNA 3NVCA 3PIGA 4AVSA 1WLTA 1DZRA 1JBCA 2EIEA 2LUWA 2O8OA 3MUY1 3O1OA 1JODA 3GALA 2YV8A 4XC9A 2A3YA 2GAUA 4PDWC 1GFF2 3FZ3A 1O4YA 4Z92B 2JDUA 5H9QA 5GLTA 1ZREA 4M3CA 5H9RA 2DCKA 2X5IA 1GWLA 2ZX0A 3WHTA 2UY9A 2ZAHA 1F2NA 5FYTA 4AQSA 2BRTA 4MGIE 1W9SA 3VD3A 3NMBA 1QEXA 4D6QA 3BGAA 4XE9A 2VQTA 5JSOA 3LFIA 5I0SA 2WT2A 3UL2A 1W8HA 4BK4A 1D4M1 1R64A 3B7MA 2WJSA 4BLIA 3PTRB 2X5IC 3THTA 1QOSA 4DY3A 3ETQA 1EV12 4DRVA 2XBO1 1RINA 3PU8A 1W8OA 3GGLA 4LKSA 1ZRFA 2XHNA 3WNNA 3HQXA 4YVSA 3ZN5A 2XONA 1XNBA 1ULFA 5F3GA 2FCUA 2D97A 4IV3A 4JKLA 1AR61 2B39A 5A7NA 4FFGA 1MS4A 2B5HA 2VMIA 2OPWA 5FLHA 5HXMA 1G9BA 3OYWB 1O91A 4B29A 4F8AA 3OOXA 1ENSA 1ZRRA 2XWJB 2VVFA 4YVSC 1HN1A 3NJXA 4I0WB 3A22A 3AM2A 4WVMB 3MV01 4Z07A 3H3ZA 3PUHA 1COV2 4NAMA 2I07B 4Q4V3 2ZGNA 2ZCWA 3VBOA 5LEKA 1UMIA 1VE0A 4HSLA 5K0UA 4YFZA 3I54A 4DXTA 1US3A 1NUKA 1OUXA 2P37A 1T6BX 1APNA 2P6CA 3FHQA 5A3PA 4YM2A 3LEIA 2A6XA 4YGEA 2H6CA 2JE9A 2NQYA 5CFCB 2VO5A 4DOUA 1F9KA 3ITQA 4A4AA 2BBVA 2WN2A 2F6BA 2JX9A 4Q1PA 4TWTA 2W2IA 4IUGA 2QQOA 1LRHA 1HV0A 3N3HA 4LBMA 2BYVE 4M00A 3AZZA 5C4WA 3VBOC 5FOJB 3BTXA 1GYKA 3CO2A 4RYDA 1N1YA 4O9GA 2VCMA 4MADA 4XBNA 4OHYA 4A41A 1GICA 4HKOA 3VL8A 1MEC3 4Q27A 3WV6A 1IPSA 1LULA 4AXOA 3BI3A 4ATEA 2I2SA 4N43A 3UT0A 2E53A 2H0VA 3Q8BA 4XF4A 5HXVA 2XLFA 2FZ2A 1IKPA 3CL1A 2OZJA 2ZJCA 2UWCA 5C4WC 2BV4A 3KCYA 3RJRA 1AUYA 3GZUC 3VZNA 1SG3A 3DPRA 4ZS2A 1BXHA 1EAH1 3AC0A 5FZ3A 3AYDA 5CZKA 3SITA 4LEJA 3GNEA 2DVGA 4LLOA 4AEDA 1NQDA 2NZ9A 2Z42A 1MQTB 3PUIA 2BW8A 3TN92 1BBT1 4N43C 1HDKA 2RJ2A 2ZX1A 3MEPA 4EWDA 1DGRN 5EPAA 3CF6E 3VDAA 2DURA 2WNVA 3NJYA 2W1WA 2BFUS 4JDNA 5I0DA 3DPRC 4Q0VA 4V2WA 5FREA 4CUBA 2OVUA 2J42A 1N3PA 2JDKA 2R0HA 4IERA 4Q2FA 4A7ZA 4D0QA 4I2OA 1GNZA 4Y1YA 2J7MA 5E88A 2UU8A 1FAYA 4LQRA 4A3XA 2MPFA 4BQ2A 5C8CA 3RDIA 2VXRA 2BVVA 2EAAA 2WNVC 4QX7A 3PVBB 4NPLA 1ULEA 2W3JA 4F7ZA 4HG6B 4BK5A 3JBG3 4DUXA 4PHZA 5F32A 1JYWA 3HD8B 4K8FA 3PDQA 4RR3C 1AR91 4S2FA 1YNAA 3VZOA 2JKXA 2DBIA 4CA9A 4X8NA 4ITCA 1ZZCA 2ZEYA 1FX5A 3IB3A 5C8CC 4HMZA 4KGGA 1PO11 2BDRA 1KQRA 2RHPA 4GB31 1ENQA 5FY4A 3I2KA 4XEZA 1EP0A 1OKOA 3N9OA 1VB2A 4OMDA 4OI0A 4W65A 1NQJA 1MZFA 2XJQA 5FY1A 4DPNA 1R092 4LHNA 5CB7A 4MXVA 4Q26A 1DGRA 1OA4A 3UGHA 5T3NA 2JDPA 3OGGA 1DP0A 3ZXGA 3HNMA 1A8DA 5A1FA 5LA0A 1VALA 1T2XA 2PLV2 3MIGA 2BWAA 4L8QA 3VZJA 5A3OA 5JIUA 5IHRA 3KV6A 3ZN6B 4LBQB 3CLPA 3PU3A 4LJHA 2QQKA 5F5IA 4PF1A 4FPJA 5A80A 1RHI3 4NE9A 2DYCA 2ORZA 1TE1B 5ACA1 2CDOA 3QBQA 2IXIA 1YO8A 1ST8A 3IAQA 3TB0A 5DXDA 4CDUA 1JZ2A 1AJOA 2VZUA 3BB6A 2HWF2 1GZTA 1PM4A 4QX2A 3VBSA 4E9KA 2MEV2 2VTFA 3OY8B 1VAMA 3C7EA 4KNCA 4P02B 2XH6A 2EF6A 2TEPA 3RZMA 1VBB2 3E97A 1LGBA 3R4UA 3K51A 4Y33A 5FPVA 3WSOA 2JJ6A 4JKKA 1SCRA 3EYPA 3WP6A 2ZHNA 1D4VB 3CU7A 3MO4A 3PLQA 3MBWA 1GWKA 4QQHA 4LO5B 1ULGA 3VBSC 4RQPA 2RMU1 3VDBA 4A3ZA 4Y5SA 2ZGPA 4IETA 4SBVA 4AE2A 4I0AA 5A3NA 4AEMA 3ROUA 2HWB2 4XF3A 1LU2A 5JI7A 1GANA 5F1RA 2AUYA 4HETA 1FPN1 5T50A 3PTYA 3AFGA 2CGPA 4K3UA 2HYKA 3GJBA 1OOPA 1HN0A 1JW6A 4RQPC 1FT9A 4O7XA 4KWJA 4PLMA 3FJSA 5KHHA 1QJY2 2Z79A 3E6BA 3I59B 3VLBB 1UOGA 3QH7A 3B01A 3GBFA 4QM9A 1TME3 4Y1ZA 1QDOA 3OEBA 2FMYA 4NO4A 3SH3A 4XF9A 3O1PA 3ZLIA 3ZFFA 1DQ1A 3WNOA 1SEFA 1VBC3 5KC5A 3HOBA 1OOPC 2ARBA 1YJLA 4JQTA 2G9GA 1LAJA 3JQWA 1PZ8A 1ACCA 4YNIA 3N7LA 4AR2A 4OZOA 4AF9A 4N53A 2ZHLA 1KS4A 3M70A 3J7NA 3NQHA 2C26A 2D98A 2VW2A 4IGQA 3ZFFC 1RXFA 1OD5A 2VUDA 5I93A 3OGRA 3T1MA 3VUOA 1AR82 4YG0A 5JCTA 1C3HA 4LE4A 1WA4A 1QJU3 2C4XA 3FLTA 4JGZA 4CCMA 5CNAA 2VUJA 1UYPA 1GU3A 4LR4A 3SCHA 4AGGA 5I8TA 4NRQA 1VBA3 5FZAA 3P3NA 4LHKA 1K5MA 3MV11 4AEKA 2CHHA 5DABA 1V9U1 4RL7A 1XE8A 5CIRA 5C6CA 3HT1A 4URAA 2YDEA 2P4EA 1RUH1 3IN9A 3ZYJB 4EYUA 1HB4A 3LDBA 1AYN2 4JGZC 4JRAA 2NMOA 4JDMA 4RGAA 3WQ7A 4EN0A 2EXKA 2C6SA 2OW4A 3ACHA 3IPVA 5IW0A 1RB8G 1XOYA 3NL1A 5BNQA 1K5MC 5JWPA 4YZ4A 4WVVA 1FATA 2WFF1 2TBVA 4JKMA 1W3VA 1WD3A 3R05A 2YROA 2WZ8A 3SXWA 1F4AA 1POV1 2ZGMA 4P9JA 4YLZA 1E5IA 4QQ2A 1W0OA 2BOIA 3GBWA 1QH7A 4W6YA 3J26N 5GZEA 1OF4A 3NV3A 3MFCA 3J7LA 4CCCA 2JIJA 5LA1A 2NYYA 4H7MA 4C1WA 1K3IA 1W6NA 4AK3A 4UXAA 1W6MB 4XMAA 4OQ9A 1S55A 3BU0A 3ACLA 3N4MA 4Q4Y2 3CMGA 1UW8A 1MS0A 2P17A 4QX0A 5GLVA 3CZJA 3H1WA 5BNPB 1C5HA 4GMP3 5B4NA 3BTZA 1QOTA 3N7MA 3MLLA 1US2A 1ULCA 1JI6A 4D6SA 4FPHA 3T2QA 4QPGB 4UFHA 2OX0A 1JYVA 4AGRA 1AX2A 3D5OA 3NWKA 4FO9A 3WDWA 1Y43B 3ABZA 5LY2A 3WDVA 3HR9A 1PGSA 2WR9A 1Y7BA 3GBGA 2RJKA 5FMOS 1CPNA 2EICA 3Q8CA 3TOJA 1ND2A 2ZEWA 2QQPA 1CPMA 3LAGA 1W99A 4ZPIA 3VBHA 4WVWA 1UY0A 2KR2A 1KXGA 2WC2A 3T30A 3INAA 2YC2A 2VULA 4META 1CR7A 1HLCA 1N1TA 1YFUA 1RUJ3 3M3IA 3O1RA 4KBBA 2HEWF 1SACA 2HWE1 2W1QA 4X8PA 3GHNA 1UIJA 1S0EA 3LPFA 5JSRA 1ND2C 1PVC1 1W90A 1GZCA 3WNXA 4I09A 2VMGA 3IIAA 4PQ9A 4WZFA 5DDJ3 2ORXA 4Y20A 1H6XA 4IW3A 1RMU3 1Z7S1 4XW3A 1QKQA 1NCQC 3Q9OA 4GWNA 4LBJA 1YJKA 2DU0A 1Y3TA 2VZ1A 1OXCA 2UYBA 2VZVA 3WEZA 4P9XA 4A7KA 4L99A 2R071 2PHXA 2JDAA 1S1AA 4A44A 4Q4V2 3UESA 1MS1A 5LB6A 2YHJA 3D0SA 1AXZA 1TMF1 4L92A 1LKNA 3WZ1A 1AHSA 3VBRB 4LOTA 4G9SB 3SH4A 3SQOA 1Y9GA 3I4IA 3ZFGB 1CONA 3PMEA 3R6SA 2FHRA 4TN7A 5FPUA 1REFA 2R061 2W0XA 3DXUA 3KF3A 5FXXA 3L9JT 3SCGA 5LASA 5LA2A 2O1QA 2VAUA 3KV9A 1CAVB 1UAIA 5FZ4A 2V72A 4MGKE 1MEC2 2A1XA 3KGZA 1OLRA 2HWC1 4YG6A 4EJRA 2JEMA 1NX9A 3KQRA 3OEAA 4NR1A 3WP4A 2WAOA 2XL7A 4RHV2 3PUQA 4FFHA 5E16A 1F15A 2ZGKA 5FP3A 4YM1A 1ZRCA 2DVBA 1G9FA 4FSJA 1SDDB 2DTYA 5JIAA 5FDBA 2UWAA 1JYXA 1STMA 2ETEA 1RUG3 4RS5B 2PQSA 3H3UA 1J3RA 5BV6A 5CADA 1N3QA 1VRH1 2XKOA 4CEYB 3ALQA 5BNOA 5IK4A 4XUTA 5D2AA 3M3QA 4CDWB 3D0JA 1K12A 2HH9A 3WW3A 5L9RA 4KMQA 1IKQA 3ES4A 5FYYA 5KXCA 1VAKA 1DF0A 3C2UA 2D93A 1PGL2 3KHBA 2JXAA 3U11A 2VPVA 2A73B 3PNAA 2VCAA 3HWJA 5BNOC 2YPJA 2ZAAA 2E7TA 5DG2A 5J1XA 3OGSA 3JBG2 2JDHA 1EV13 3ZXLA 2HEVF 4OLLA 4X6RB 1YIFA 1QMJA 2GNTA 4B1MA 3KLSA 1OA2A 3ILNA 4IE5A 4MX3A 3K48A 3NW4A 5C71A 1J3QA 1RUOA 5DN2A 5F3IA 3VDDA 3KCXA 4GWIA 4CDXB 5F6LB 4W6WA 5FZEA 1B09A 1OLMA 4XDQA 1QU0A 4XDOA 4BJ0A 5HCFA 4BISA 1AR73 4FOQA 4Z2WA 5A32B 3ZR5A 1CZVA 4CCNA 1XNDA 3POIA 1COV3 1SLIA 1X33A 4XF0A 5L73A 3HNBM 4K8RB 1NA1A 3NAPB 1WLWA 4LUMA 3VDDC 2FDIA 1TMF3 1S0GA 1W05A 4CP0A 5A3LA 1BK0A 2YZ4A 1UZYA 1DDLA 2WLQA 4CCDA 4PDWB 1RL3A 2JIGA 3T1LA 2VOTA 4YPJA 3O5SA 5FZOA 1C1FA 1W9FA 1W6OB 1C5IA 1JHNA 5EIYB 3AYAA 3KMHA 2BBAA 5DZEA 2V5DA 4AI2A 4CZSA 4Y4YA 3LEMA 3ZSLA 1AXYA 4UW3A 2Y6JA 3GYDA 4XETA 5D8AA 4HPKA 4YW5A 3VD9A 1EPZA 3W21A 1RUI1 1NAEA 1XNAA 1DLLA 1RGSA 3USUA 2X5IB 2D6PA 3PURA 4COUA 1POQA 4XILA 2ZX3A 1EAH2 5T5OA 2GC1A 2ILMA 5D8AC 1RUC3 2R1DA 5IAVA 1BBT2 5K9YA 1WCSA 2YYOA 2G9ZA 5FPAA 5E8AA 4B7KA 3I2OA 4LK6A 1QJZA 1L7LA 3O1SA 2ZA9A 5FLIA 2ZABA 3RPQA 2OT7A 5L7OA 1CGPA 1ZBA3 4YVSB 4QU2A 1KJRA 4M3CE 1IS5A 1HRI1 2RDNA 3CEWA 3OSDA 3D6EA 3R0RA 4DXSA 2I45A 1OBNA 1OH3A 4BDVB 2WZR1 2X53S 2YG0A 4DIQA 5A1AA 1DYOA 3W9AA 1GQGA 4YW2A 2GNBA 5FP8A 3AKQA 3D82A 1WCDJ 1X8EA 2ZEZA 2WBKA 3C8XA 3O1VA 1CJDA 1E5RA 2MNGA 3M1HA 3ZFEC 4QMAA 1AR92 1W8TA 2OIIA 4S2GA 2ATFA 2EALA 1C8M1 3S30A 5FY8A 1PO12 2HWD1 2XVGA 4GB32 1WD4A 1QJU2 2ZXQA 3BU7A 4OULA 3VBOB 3VBFA 2D5HA 1RVF1 4E2GA 1XC6A 1LOCA 1VBA2 3AVRA 1OPOA 5T54A 2PHRA 1UKRA 2QCSB 3NV4A 3K2OA 1UU6A 5I91A 4GAZA 1DG6A 1OFSA 1XE7A 5C4WB 2PLV3 2CGNA 1BZWA 4XBLA 3VBFC 4BM8A 3ORJA 5JUVA 2VZSA 1XE0A 3G6JB 3E5UA 4JRLA 2KM2A 4ES8A 2BFUL 2PXJA 4AFAA 2BEOA 2R041 5FPBA 2PHLA 1UOFA 1W0NA 2QQUA 3OF1A 3FC0A 4RFT0 1FMD1 5KXEA 1YEWA 2CL2A 2A70A 2W52A 4N43B 2VBBA 5A7SA 1QXRA 4Q4X1 3PVOA 2BWCA 2HWF3 2XLGA 4QXHA 2ZGLA 4AWDA 2CAUA 5HCHA 4D7YA 3RZJA 3DPRB 4QDSA 3FHIB 1OF3A 3WHUA 1BEV3 4LULA 4MV2A 5JDBA 1VBB3 1UOJA 4TLFA 2W92A 2AH2A 2XPJA 3JB8A 4QM8A 4CCOA 3HPNA 4N7UA 5A33B 4UW6A 3MW2A 3DL3A 2XXZA 5C3QA 2WNVB 3CHXA 4QDRA 4FAGA 1JUIA 1WBFA 2RMU2 1REEA 1Q8OA 4AVBA 3I7DA 1PMIA 4K20A 5FY0A 4RR3B 1ODMA 5FFOC 5FPZA 5GLZA 5AC93 4UF0A 2WA4A 3TEWA 3RS6A 4YWAA 1U5XA 4KG0A 4URTA 4OQ8A 3PMSA 2WZPP 3LCPA 2GC3A 4B3NA 3QCWA 4LO7A 3RMYA 5A3UA 1GBGA 5JPMB 2YU1A 4SLIA 5DUXA 5A7QA 4EZHA 4PI2A 1LHWA 3B00A 3WF4A 2R49A 3FLPA 4N8MA 5F6KA 2ZGOA 3BALA 3NSTA 1HB2A 3ETPA 1RUJ2 3KD4A 1O4TA 5G04L 3X29B 5C70A 5A3MA 4CCLA 5BYNA 2WWUA 4QKNA 1YQ6A 2WO7A 2HYXA 2NN8A 1SQ4A 5KHIA 4N9IA 3JZVA 1HRV1 1H2NA 1UYZA 2ZZQA 5DAPA 4RFRB 2WO2A 1SPPA 3ENRA 1W8UA 3UV9A 5JXGA 1CWPA 1AR83 2VUCA 2XHKA 1C8M3 1GZ9A 4FQZA 4DXRA 3AL6A 3VHPA 4XQDA 1XU1A 1MVQA 1W39A 1LCLA 4AI3A 2GP5A 3BN6A 2FDKA 1H1AA 2X8KA 3OB8A 5KC6A 2JWPA 2ZEXA 3W5NA 1UNBA 3I49A 4P14A 2N7GA 3TEXA 2VW1A 3VBSB 2Y38A 4CEWA 3DGTA 4IV1A 3RVHA 3I2DA 3MHZA 4M0HA 1U12A 2XUMA 4QQLA 2D6KA 4FPEA 3PUSA 3MLKA 4HONA 3V0BB 1BVVA 1PGW2 2R16A 1ZZ8A 4IEXA 1LHOA 1ASJ3 2W9XA 1OQ1A 2A3XA 1NXMA 2WS91 1XSQA 5IYYA 4PT6A 5FRAA 1EYBA 2WFF2 2R32A 4CEWC 1NLSA 4QGNA 1LTEA 1GQPA 3ATGA 2XJPA 4IV1C 1NYWA 4RQPB 4XHBA 4NIIA 3OJBA 4CCKA 4Z2AA 2E9QA 1XNKA 4R9BA 2CU5A 1DQ2A 1GR3A 5JR2A 4WM7A 4CU9A 4YZ1A 4Q4Y3 1YRZA 2CNAA 4LO6B 5SV5A 2DFCA 1OOPB 3RRDA 1GZWA 1OLQA 3RMXA 1RUG2 1W8ZA 4E4SA 4JAAA 5HBAA 2WNUC 2D5FA 3WCRA 1F5JA 1F35A 2IFWA 4KG8A 4AG4A 1SZBA 1HJFA 1BMV2 3SMHA 4ORFA 2E32A 1TVGA 1UQXA 5FWJA 5JPNB 4WM7C 5FKCA 5FQ0A 1PNGA 3U75A 3AK0A 2OKXA 1XB9A 5FYZA 5GM0A 2WN3A 2GDFA 3JD73 1F4HA 4NMIA 3ZYFA 5J96B 1N47A 1CZSA 4HKWA 4DB5A 5FZ8A 2Z5WA 1QJEA 3AZXA 1R1A1 2BZDA 2A5ZA 3H0OA 1H9PA 4IEVA 4UBGA 5FUNA 2E26A 4YVWA 1PNFA 2P3KA 4IEWA 4WM8A 3WT3A 3WNLA 2TNFA 3U14A 2NM1A 1ZBE3 1PIV1 1UZ0A 2HWE2 4JGZB 2KA3A 1NY71 3H9AA 1J83A 4NIDA 1JYTA 1W2NA 2OS2A 2W68A 4PIZA 3VDCA 3RYRA 1RUE1 4XTPA 2VU9A 3NRUA 4YVWC 4IEYA 2GH2A 1Z7S2 3CZUA 3BIEA 1W9YA 4LHLA 4WM8C 3SEPA 4Y22A 4PBPA 2OQ7A 2ZMNA 4LITA 4QX5A 2IXHA 5ANQA 2WA3A 1EPWA 3WP3A 1ND3A 5FPLA 1RUF3 1AR72 4XQ4A 1JYCA 4C8DA 2P3YA 4TYSA 5A7PA 3IZOA 2B9VA 4MH0E 1JU3A 2IWGB 2R072 3F95A 4B4QA 3A0NA 4NUBA 3GZEA 1FI2A 1YC61 4IV3C 1UD1A 3O0XA 5FMDA 3V65A 1TMF2 3I8TA 3M3CA 4Y5Z0 4QXBA 1MR5A 4YM0A 1X8MA 4P9YA 1HJGA 3PVEA 4XFBA 2XVKA 3BOWA 4NHYA 3NKGA 5K0UC 4MGTA 4GULA 3DF0A 4XFAA 2ZPXA 5GLWA 5DUVA 4N90A 4P9LA 2OPKA 1GP4A 2ADEA 2RG4A 3RYPA 5C8WA 3POYA 2H6BA 1W06A 3QH6A 2AEZA 2VG9A 4K7JA 4BYYA 4Y26A 2ZGTA 4S2HA 1LR5A 3KM5A 4COWA 4YZ2A 2KXLA 4RHV3 3BUCA 2CY6A 3S7EA 3MF9A 1SDWA 1UZVA 5M0TA 2A6WA 3P6BA 4NPMA 5FWEA 4I02A 1LOAA 1HQWA 1DHKB 3WY6A 3RQ0A 1RUC2 1AZDA 3JU9A 4XZUG 2FBEA 4L11A 3ASIA 1M4WA 5FO7B 5KHJA 3ZMOA 3HMYA 1SLLA 1NCQB 3CBNA 3WQ0A 4DNYA 2QVSB 1O6UA 1MZ6A 4ZHNA 5H9SA 4AEDC 2WAAA 5K4LA 3O1UA 4UBHA 3AP7A 4QQPA 3TYJA 1ZBA2 5A6YA 1VRBA 5BUVA 3N35A 1TG7A 3ACFA 3H8UA 1FOD1 2EXHA 4LLFA 2RS31 4PF5A 3NV1A 4R8HA 1D4M3 2VR4A 5DUWA 4AVTA 3MFAA 2JICA 1R1A3 4PIYA 4MG2A 3CQOA 1GKBA 1C8NA 1TNRA 3I3BA 4LBQD 4UW4A 3PHMA 3RZZA 2XBO3 4NRPA 4LBLA 4BOWA 2JDYA 3MICA 3ACIA 4MOAA 4UAPA 4DY5A 2GNDA 3KVAA 1Y4WA 2F4PA 2FMDA 2PAMA 1QNYA 2FCTA 2RM21 3OD4A 4FXGB 4LO8A 5FV3A 2EVXA 2X29A 3EMRA 3K3OA 4Y1UA 4DQAA 4QWNA 3SLIA 4BHPA 4D69A 3K75B 1AR63 2Y60A 4QHZA 4QT6A 3T2TA 2RS51 1RC6A 4LNVA 5JOYA 3AVSA 1ZRIA 4JGYA 3UYJA 1H0BA 4AGVA 3OCPA 3SH5A 2YC4A 1H8TA 3VKLA 1J3PA 5C33A 1G9DA 3WP5A 5IT6A 2K46A 4BE3A 3Q8FA 4AQTA 3BODA 2DCZA 3ZDVA 5SV8A 4AVAA 4CU8A 1WA6X 5FY9A 1IPKA 4XF1A 3MIEA 2NPIA 2PHTA 1JU4A 5ABJA 3AP9A 3CJIA 5DAXA 4IQPA 1UU4A 1HB3A 4XUNA 1H8TC 2VOKA 1XYNA 4M4PA 1UN1A 3H1YA 3RWNA 1X7NA 4MXWA 1BVP1 3WDXA 1AYM1 4FXKB 1BEV2 2PHDA 2XGXA 1UOBA 2XUEA 1D2SA 1WW4A 4Y5TA 2ZTNA 4GALA 4IXLA 4JTOA 4BXFA 1PMHX 3V0AB 4B8EA 3CJIC 3T3YA 3G7DA 4CDUC 5IVEA 4EWEA 3AP6A 2WYFA 1C1LA 2DCJA 5BNOB 1WGPA 5FYHA 4Q29A 3VV1A 2ARCA 5IK5A 1VBD1 2PHFA 1XBFA 2B8MA 3POEA 3AYCA 5DZGA 4E4HA 1EAH3 1C4RA 1W3XA 2CV6A 2RV9A 2VTXJ 5IVYA 4FAHA 5C3OA 4GMP0 5AC92 5I8SA 1U5ZA 2LM3A 1G86A 1CAUA 2WSUA 3LEGA 1BBT3 3ZIWA 1GQHA 1QHDA 5LRSA 1SHWB 1ZX5A 1V00A 3GCWA 4N7IA 4Q8KA 3LA2A 3B5LB 3KT4A 5AVPA 4G4FA 4AQ6A 1OURA 2OA2A 2VW0A 4V1PA 2IXCA 5A6ZA 4KGQA 4E8CA 4YW1A 4QPIB 1HRI2 1H4GA 1IOAA 1PK6A 4Q8LA 3THDA 5FO9B 3ZXKA 4ZU4A 1QQP1 2W1SA 3VDDB 1QJFA 1LOGA 5CFDA 1VMHA 1PMJX 4QXCA 3AB0A 5GKAC 5IATA 1AR93 2WQ8A 4P9WA 1HXS1 3GHMA 4A45A 4EN7B 2WZEA 1F5FA 1KJLA 4P9GA 2NLRA 2RS11 1C8M2 2AYHA 1PO13 1GV9A 3LZZA 1UZZA 1QXPA 1VMFA 1CN1A 1CIYA 1V6LA 2HWD2 4GB33 5EP9A 2YFZA 5I0UA 2WWJA 2FCVA 2GMEA 3Q8AA 4KL1A 4LTAA 4N53C 1GP6A 3ZMNA 1GNYA 5CFDC 4XAAA 3HQRA 4E8DA 5FZOB 4DINB 3VB9A 2D3SA 4ZZ5A 1JN2P 5JLVA 2GNMA 3IDCB 4XQWA 5F3CA 1ASJ2 2XJSA 5A3TA 2R042 1RJ8A 1O8PA 2LROA 4Q4W1 2Q0AA 5D8AB 5FCCA 5A3WA 2WLPA 1W8FA 3UGFA 5ACA3 1FMD2 1ODNA 2VVEA 3CKHA 3CIHA 4FPOB 1ZRDA 1UXZA 1CZTA 3P1IA 4Q4X2 4KWKA 5FZ1A 3WW1A 3RWKX 2VQUA 2XWBB 3K46A 5HCAA 1WWYA 4ZXKA 4XXAA 5L9BA 4CSWA 1AL21 1YI7A 2L9LA 2YU2A 1YI9A 3I3MA 5J98B 4XUOA 1W6QA 3L2HA 4WVMA 1LOBA 3AKRA 4QKBA 1LNSA 5FZCA 2RMU3 4GH4A 2Y64A 1XYOA 3LPGA 3MI8A 4IE6A 5FY7A 2VXJA 3H50A 2IUWA 1OPMA 2JENA 3ZFEB 4HBNA 5IVBA 1RUD1 5CFCA 1FPN3 3KF5A 4COYA 2EA7A 1BHGA 5DZFA 2DUPA 3WG3A 4QD2A 1NCRA 5FP9A 3JD72 3FBYA 1A8MA 3AKSA 5IAXA 5J48A 3HQUA 1VR3A 4GH4C 2JG9A 4RSUA 5FXVA 5JR7B 4EN8B 3KS7A 2IXKA 2AACA 4QB2A 2OZ6A 3EHKA 2GP3A 4HXCA 2NP0A 4Q1RA 1WW7A 2YY1A 2QQIA 2WUHA 2X05A 1RJ7A 2FDJA 4AFBA 4ASKA 3R4SA 4L9BA 2W47A 1ZBE2 1NCRC 3LOBA 2JG9C 3FX3A 5FO8B 4FTSA 5IK8A 3VBHC 3BPSA 3RZKA 4IEPA 1Y9MA 2CWSA 5LEJA 3ZSMA 3ZOIA 2K2SA 3MDPA 4AAXA 4UFKA 2QE3A 2D3RA 1IS6A 1LGCA 4A42A 3SISA 5I0RA 2D44A 2QQVA 2QNKA 2DCYA 4KBZA 2VMFA 4IEUA 1JZ4A 2JG8A 4P5YA 5E6HA 3TBDA 1RUF2 1SMVA 2VBDA 3J8F1 2VBPA 4KWLA 1R081 2ARXA 3MW4A 2RR11 1W0PA 4L2NA 2YBPA 1MS8A 4CUGA 3DKQA 3OUJA 4HK9A 3ZXAC 4A2UA 3LA3A 3T4HB 1HV1A 2V4VA 2C9AA 3WG4A 2ZX4A 1V9U3 2FZ1A 3ZSEA 4CXXA 3N9NA 3I2GA 4E2SA 5BNNB 1SLCA 1YFXA 4AHZA 2JG8C 5IUQA 2CDPA 3TEZA 4YM3A 1RUH3 2W95A 2VMCA 5BY5A 2VOWA 1N1VA 3ZM8A 5CVRA 3U4XA 1UPSA 3LSDA 4KQ7A 3ZYBA 4NHXA 5D21A 4QHBA 1UMZA 5IVCA 1K42A 1RIRA 1W2UA 2WFF3 4Q4W3 3ACGA 1CQ9A 5DMYA 3SHRA 3TWIA 2O0OA 3OPZA 5FMBA 4NIAA 2A7AA 3RGBA 3S5QA 1POV3 3WDTA 3MIBA 1N3OA 3AYEA 1OUSA 4LA3A 2EAKA 5TSWA 1VBE1 2BGCA 2IVJA 1O3TA 2W46A 2QZ3A 1ALYA 2Y33A 3I3QA 1V0AA 1X9TA 1V6MA 4H3WA 2BJSA 2WO3A 5FIXA 2BU9A 2R1BA 2AENA 5EHDA 1J1LA 5FZMA 3C7GA 2BUKA 3AX4A 3HAGA 2GSYA 3NJVA 3ZN6A 3KV5A 4L97A 3A7QA 4LBQA 1SLTA 5LK5A 3RI8A 4O65A 5BXXA 2ZZJA 1EY2A 5EJ1B 3WXPA 3ILRA 2VZOA 1ZM1A 4K21A 4NHLA 5DQ0A 3T2PA 5C7GA 2WNEA 3AZWA 3ON7A 4OHWA 4AI9A 2VZ3A 3OY8A 2B7YA 3LWCA 5FZHA 2G9FA 1NLRA 5F8PA 4ZU7A 4TLGA 1D4M2 2LW8A 1R1A2 3TN91 1SLBA 3EBRA 2PQQA 4XYXA 5E1RA 2XBO2 4O9EA 4DO0A 4UOJA 4ASMB 2HWE3 1PIV2 1JHJA 3R4DB 5ERLA 1NY72 1PVC3 1S2BA 1DIWA 4XJUA 3WLUA 4C1XA 4CTEA 3DECA 5CYYA 2D6MA 3IDEA 3FWEA 1S0FA 3CJXA 4LBKA 1NE4A 1Z7S3 2YBSA 4M3CF 5FZ0A 4CEWB 2PELA 4AFCA 1XPWA 2ZBJA 4IV1B 1ENXA 4CUAA 1AR62 1V6KA 3U37A 4HVQA 3J8F3 2A75A 3I59A 1R083 4FOYA 3JUUA 3SKVA 4HSJA 2R073 4IE7A 4AW7A 4AFMA 3AFKA 3QOPA 5A7WB 1JS9A 5LATA 4OHXA 5APAA 4Y4RA 4AFDA 1DQ6A 2PA7A 3AXDA 1S0IA 5GZDA 1YWKA 2WNUB 4COZA 5IJRA 2PHWA 2IVIB 1UZWA 3ECQA 5EV7A 5H9PA 3VKFC 5CG8A 3O1MA 4NHKA 2VZTA 1MZ5A 2XJRA 3W20A 2R063 4WM7B 4KU7A 1QJX1 1NA1C 1R091 1SBFA 4QX1A 2A6ZA 3UGGA 1AF9A 1JOBA 5T55A 4JV4A 3KT1A 3PL0A 5T5LA 2R30A 4FTEA 1VB4A 2VVDA 1E5SA 1HIXA 1M06G 4K1YA 2HWC3 3P5BA 3LSEA 4M3CB 4U2AA 1WLCA 3WF0A 4XPVA 3LIGA 2G19A 3VZKA 5C9AA 4YW3A 1EUTA 3BOPA 3GZAA 3E1F1 1ZZ7A 3EJKA 2MEV1 1GP5A 3ZPYA 1OVSA 4XJWA 3UKTA 3OG2A 3BTYA 1DLCA 4NIGA 2HBUA
chains in the Genus database with same CATH topology
3FFQA 1VRH3 1G6NA 5C9AC 3S0MA 2AR6A 1H9WA 5D1IA 2IC1A 2SBAA 3JQXA 3MGUA 1PZ9A 1KS5A 1WMDA 2HWB1 2YC0A 4PCRA 1O5UA 1QDCA 4Y24A 2DUOA 4AHXA 4WV8A 4IV3B 4YGDA 1W6MA 4LT5A 3APBA 4C91A 1NXD1 1SFNA 4FP3A 2JKBA 3H7YA 4LBNA 4FT8A 4Y22B 1X36A 3PVNA 5DUUA 5L7OC 1H2MA 5FAXA 1DBNA 1QJY1 3KSCA 4XOGA 5EXOA 4QPGA 5K0UB 3O12A 1V6JA 1UL9A 3B3QE 4HFSA 3WINE 4HVRA 4PJYA 3A0KA 1I6XA 4OHZA 1DYKA 1O4ZA 2RS52 2PN5A 2UYAA 1LB2A 4XJ8A 4JVAA 4I0BA 4JCKA 4XJ9A 4Q0SA 3M8LA 4AHYA 3NO8A 3ST7A 4YGCA 4AEJA 2W08A 3MW3A 1X50A 1A6CA 5ACA2 4NPRA 2WFPA 1VIWB 4BH9A 2CYFA 5L36A 2D6LX 1AYM2 2VMHA 4AEDB 1BQPA 2WSVA 3BCWA 2VNRA 1AYN1 4BIOA 3WCSA 3HT2A 1RUI3 4ZKTB 3WUDA 4QQOA 2VQ0A 4LE3A 4A7YA 2Q30A 4FPFA 4MGZE 3HBZA 3VKOA 5BPXA 4D7SA 1SBEA 4JQRA 4MSVA 1QY4A 1KDMA 1G8WA 1QWRA 4F3JA 2WIIB 4HANA 3ZFGA 4CYDA 5C8CB 1FPN2 1MACA 2BPA2 4QPYA 4OUMA 5F5QA 3E5XA 1LJ7A 2XLAA 1G9AA 5JAXA 1WW6A 3VZLA 5JZGA 1JYIA 5FTTC 1FYUA 2Y26A 1HRI3 1BK1A 1KFUL 3OBRA 2WZR3 4H7LA 1IZ3A 4R4ZA 1LU1A 1OHFA 4RA0A 1QH6A 2JE7A 5JZGC 2Q1MA 1W6PA 4QXKA 2YGMA 2QFEA 3M2MA 1HXS2 1U5IA 1H8TB 1B35A 3H7JA 3FBMA 5FOBB 1BJQA 4CEYA 1TEIA 5CA6A 5JSPA 1AX0A 2HWD3 5E89A 4DMIA 4ASLA 2GU9A 4CDWA 1O3SA 4XZPA 1RVF3 4J1XA 3CNAA 3ZSKA 3CJIB 4CDUB 1V9U2 2V5YA 1DU3D 3IMNA 1B35C 5EJ3A 2YXSA 3AMPA 1CAXA 3B93A 4NWVA 4CEYC 1RUH2 1OSGA 4MXWB 4HN1A 4AVCA 3WQ1A 3B94A 3O14A 2R043 4NWWA 1PVXA 1PO21 1V6NA 1AX1A 4Q4W2 1FMD3 1V6OA 5FBZA 4Q4V1 4Q4X3 4ES9A 4XMIA 1CJPA 3O0VA 1LEDA 4YYOA 4GKXA 3ZN4A 2ZMKA 3RYKA 3N36A 5I0TA 4CDXA 4C0BA 1AL22 1QOOA 1CAUB 1F8VA 4K9SA 4RD7A 2OYZA 4AYUA 5HCBA 4XIKA 1VLNA 2PFWA 3NAPA 4CDXC 1MEC1 2HJIA 1S2KA 2XB6C 3ZFFB 4XXPA 4GA9A 3EXUA 2QDNA 3TRSB 2HEYF 1G7YA 2ZACA 1SBDA 2DUQA 4IEQA 4AHWA 1W6OA 3ZX7A 1YYNA 4N53B 3L2YA 2Q1ZB 3KCCA 2IFRA 5CFDB 1NOVA 4FTBA 4H14A 2HKXA 4BCUA 2B45X 1PVC2 1YXWA 1K5MB 4OZXA 1HRV3 2ES3A 4M01A 4BLJA 1PGL1 3FUQA 2XJVA 4N9HA 2CWMA 1DZQA 1QF3A 2A71A 2Q8OA 4MLOA 2LALA 3JBG1 3J8F2 1KRIA 3IPVB 4FP2A 1R082 5FLJA 2RR12 1HQLA 1CX4A 4C0HA 1IPJA 1Q8SA 1QNWA 4UW5A 5KXBA 1XU2A 4QGMA 2WKKA 3VHNA 4MGYE 3ME2A 1ND3C 3QLQA 5FMOL 4YFWA 3LKJA 1W6NB 2ZKLA 2R062 3RI9A 3ZYIB 5AVAA 4OVEA 4ISRA 2WS93 2GH8A 3BTAA 1PO23 4GXLA 1W6QB 3AJZA 3LB9A 3MPBA 2DWRA 3VZMA 4GH4B 2BTVC 1NE6A 2HWC2 2DV9A 4CDQA 1Q5OA 4GWMA 4AI0A 1RHI1 1VBE2 1LENA 4YGBA 1FNZA 3AMNA 2Y0IA 3IDBB 4P9IA 2Y0OA 3B02A 4TSVA 1NCRB 2IZWA 3N7JA 4J6GA 3URFA 4EWAA 1ND2B 1FV3A 2JG9B 4KH9A 4CDQC 3VBHB 1UPIA 1QGLA 2CGOA 1VRH2 2E7AA 4FOVA 2W39A 2QZ2A 1DGWX 4YRDA 3QACA 4X6QB 2I74A 4IEOA 3E6CC 3UKVA 1XXNA 1MS3A 2AREA 4PIXA 4Y20B 5K7PA 4YG3A 2D40A 1KFXL 5A33A 1G9CA 3HIFA 2JG8B 2GC0A 2PYTA 2BNNA 1IS4A 2PHUA 1UF2C 1PIV3 2WT1A 1Q8PA 1IQAA 4K40A 1TME1 3VBUA 1RUE3 4RR3A 3ZXDA 5AFBA 1VBC1 2CTVA 3RNSA 1OKQA 3MF6A 4MZUA 3ZYGA 3ELNA 2DCTA 3OGJA 3BIWE 1U0AA 3VBUC 1WMEA 3S6PA 3U10A 2P3JA 2RJLA 4BMEA 4Z1VA 5GZGA 4NHMA 1JUHA 1UCXA 2ET7A 1I5ZA 4NOTA 1QJU1 2GN3A 4PLOA 2ENRA 2VECA 4JGYC 1VBA1 4OI2A 2PTMA 1HKDA 1CAWA 4LBOA 5EFUA 4E4ZA 1QJX2 2UURA 4IEZA 4BPZA 4CP2A 1WMFA 3KB5A 5JI9A 2G4IA 3AKTA 3FE5A 5ABJC 4FCAA 4Y1VA 2DTWA 2ERFA 4S2DA 1RUI2 1OMIA 2LTNA 4P5HA 1DFQA 1URXA 1XYPA 3MPPG 1YCIA 4COVA 3V64A 3POWA 4AI1A 5EYXA 5J7MA 3V0BA 2ZGQA 1H4HA 1V6IA 2WINB 2XL9A 4D3WA 3ZYRA 4YARA 2ZGSA 1LOFA 1H2KA 1ONAA 2YUEA 3M7AA 4GMP1 4HN0A 3AMHA 3RSJA 2DFBA 2UWBA 1H1IA 3O0WA 1MS9A 3M4FA 1ZZBA 1FOD3 2RS33 2YMZA 4HKLA 2WZR2 1HQNA 2GALA 5KWRA 3WVJA 1LOFC 3V56A 4LA2A 2Q4SA 3VHRA 2BNMA 3GZTB 2H0BA 1PK6C 2GC2A 4XIOA 3AKPA 2ZHKA 1NA1B 2RM23 4R9AA 2R0FA 5GALA 1BKZA 1RUJ1 3FFZA 4K6BA 2B42B 1RVF2 3C3VA 1VJ2A 1JOJA 2RS53 5DDJ1 1DZTA 1RMU1 3SNMA 4FPCA 4Y1XA 3RG0A 1PHMA 3EO6A 1SLAA 1S0JA 2D3PA 1YLLA 1TNFA 2GZWA 3THPA 3ZXEA 2EXJA 4HPKB 3USUB 1D0GA 2D43A 4PLNA 3ZVXA 5C9AB 2DU1A 2VNOA 3J9SA 3USSA 3W59A 5T52A 4OHVA 1AYM3 2XJUA 1C28A 3E6DA 3KT7A 2R6QA 3MZHA 3OYWA 1POV0 1PGW1 4YW4A 3ES1A 4HT1T 2P34A 4Q0PA 1KD7A 1VBD3 3AZYA 5L7OB 3RJ2X 2AZ5A 1ZZ6A 1V70A 4B7EA 3S7IA 1AL0G 1LGNA 3WW4A 2ZKNA 4WBBA 1E57A 4I3GA 1LECA 1FNYA 1VP6A 2K0GA 5JOWA 1RUG1 1H1MA 1DQ5A 1CIWA 5CFCC 1AJKA 1BMV1 1NG0A 2QJVA 3VBFB 1I1EA 2E51A 2ZOEB 4HL0A 4BQ1A 1RUNA 3EQEA 1QQP3 1ENRA 4YSFA 2K9ZA 2BQPA 1HRV2 3ZIXA 3J4UH 1L3JA 1BYHA 4INDA 3POSA 3WG2A 1MQTA 1Y9QA 5LK7B 1HXS3 3ZO0B 4B4PA 2Z2SB 2RS13 5GLUA 1WBLA 1EV11 4DRRA 4QGLA 3B9CA 1NCQA 2FQPA 2YGLA 1J59A 1HX6A 3DV8A 2OUJA 2ZMLA 4JDOA 3MIFA 4EN9B 1MQTC 2P2KA 1O5LA 4K1ZA 4Z82A 3JB4C 3UJOA 1R1ZA 1MS5A 5JOZA 3WD5A 3LA7A 4EV0A 1ZA4A 1CD3G 2WQZC 3N7KA 4R9DA 3E5QA 1J58A 5J3UA 1AR71 3NJZA 1LHVA 2WS92 3JCIA 4B4RA 4F83A 2ZS6B 1OA3A 4MUVA 1DGLA 1PO22 4XHXA 1COV1 1LHUA 4BIFA 4YZ5A 1LEMA 1NZCA 5IK7A 5GJ6A 2NMNA 4Q0UA 2PAKA 5JOXA 3U07A 2EXIA 1SCSA 4WZCA 1XNCA 1Q8QA 1Q3EA 4NN0A 3VKMA 1AL23 1O3RA 2A3WA 1GSLA 3MLJA 1WCKA 5F9TA 1YIPA 5J37A 2V73A 3FLRA 4OFGA 4R4XA 3FMGA 3PJYA 3VN4A 4XJZA 2MHFA 5AFEA 1A78A 5JZGB 1MZEA 2E6VA 4KU8A 2VQAA 3LGRA 1RUD3 3GF6A 3TNQA 2DVDA 2XJTA 1H2LA 1YFYA 3QD6A 1UU5A 3U0ZA 4FPYA 4XJAA 1RUC1 1W6PB 2EIGA 5EYYA 1I9RA 4DS0A 1J1TA 2B46X 3WDUA 3V0AA 1B35B 2QDRA 4GKYA 2P3IA 1MVEA 3LOIA 4I3PA 5JMCA 1TQ5A 3MYXA 4I30A 4ZU5A 3IM0A 1UKGA 3WG1A 5KHGA 1RUE2 1ZBA1 2DVFA 3KGLA 2E63A 5K8SA 3IKWA 2ZX2A 2E7QA 2VNGA 1UX6A 5L19A 1CAXB 3NV2A 2JD4A 1CESA 3VL9A 3MIDA 2RR13 4OI4A 1WUVA 4BA6A 1X82A 1Q8VA 1IS3A 1YUDA 4BZ4A 4JC1A 3TAYA 4QPIA 3AP5A 1D0HA 3DKWA 5JVVA 5HI0A 4HVOA 5KHKA 1RITA 2D6NA 2VH9A 2ET1A 2GN7A 3WW2A 2D7FA 4MYEA 3O7OA 5I8YA 1GZWB 3P3PA 4HZFA 1JH5A 4QPIC 2PLV1 4IL7A 4EROA 3ZDSA 3DUIA 4ONUA 1ZZ9A 1REDA 3AP4A 1VBE3 4C90A 2ZHMA 1RHI2 4U36A 5EWSA 5FQ0B 2VOVA 5DG1A 3D4KA 3IWZA 3UK9A 3A4UA 4FVVA 2HWF1 4YZ3A 1OI6A 1BEV1 3ZSJA 1LODA 1VBB1 2C1FA 1DGWA 4FPLA 4AI8A 4YVWB 1VAVA 1ULDA 2XG3A 4XFCA 3W58A 1N1SA 4WM8B 3ZXFA 1C57A 2WL1A 4FOWA 4ATFA 4XFHA 5GZFA 2Z69A 4E27A 1FV2A 1H8VA 3BPZA 5KBFA 1O3QA 1FOD2 2DF7A 4ISQA 2RS32 2QUOA 5AC91 4Q0QA 2GMMA 5CG9A 4WVZA 2C5DA 3TN93 3WUCA 4AVVA 3VKNA 2V09A 1ND3B 3AMQA 5BNPA 2VGDA 2BNOA 1YFWA 4HLTA 3B9IA 3SCFA 2VY0A 4DXZA 1OFNA 1TME2 2RM22 2ZGRA 3ZFEA 4R52A 2GMPA 1OQEA 1VBC2 2B9UA 3OD0A 3KZ4C 5BNPC 1Q56A 2JDZA 4QPGC 3HN1A 1QXJA 2TUNA 4FPGA 2D6OX 1AR81 1HW5A 1Q43A 3ILFA 3UKNA 2QKDA 1S0BA 3PJQA 2RE9A 4IESA 4CDQB 3IBMA 1I3HA 1D2QA 1DQ0A 3VGIA 4FPKA 1XRUA 1IGOA 1QJX3 1R093 3WOGA 5KXDA 2A6YA 5CAZA 4TZDA 3H1MA 5FPXA 2DVAA 1ASJ1 4E2QA 4D94A 1RTVA 3OTFA 4J1WA 4E4DX 3AJYA 1ZVFA 1YHFA 1VBD2 4FBFA 1WLDA 2XVLA 3VBRA 4CRQA 4H55A 5BNNA 4NVPA 4BMBA 2MEV3 1GNHA 5LRRA 4XFGA 2XKPA 4FQ4A 4LO4B 4D7TA 5J09A 5CBLA 3AZVA 2SLIA 1PM7A 1LESA 3UJQA 4Q4Y1 3M3OA 3VHOA 1AVBA 4Z8BA 1CAVA 3NKTA 4AQ2A 4G3YC 4I01A 1S0DA 3VBRC 1JXNA 5BNNC 1Z78A 1OQDA 1UIKA 2BVBA 4OI1A 3ZFGC 2VUAA 1LHNA 1KDKA 3DN7A 2HWB3 3VBUB 5CU1A 5GZCA 3B69A 1Z0HA 1LOEA 3ZYPA 1QQP2 3IT8A 3MIHA 2A6VA 2UY8A 4OUSA 4CP1A 4GQ7A 4LUKA 3JD71 4RS5A 1U5YA 1QJY3 1O7FA 4JGYB 2OUHA 3WDYA 3WX5A 1KITA 1PZ7A 1S0CA 2RS12 1H30A 1ZBE1 4BWOA 2WQ4A 5ABJB 4RS5C 1GLHA 1DYPA 5B2GB 5DDJ2 1T6GC 1CAWB 1RMU2 4W6XA 4CDWC 3WR0A 2AGSA 1BCXA 2JECA 3TNPB 5T5JA 5T5PA 1RUF1 1F31A 4EN6B 2IXLA 3OBTA 4XBQA 3M3EA 2O8QA 4HK8A 4RGGA 4XFIA 2Q5TA 1FXZA 3D8CA 1CVNA 1DQ4A 4DZGA 4MVTA 2VOXA 3ZXJA 5J36A 2WWSA 4JTNA 1WW5A 1AYN3 4M0NA 5A32A 4PBOA 4XTMA 5EZWA 2C0ZA 2CAVA 3FUOA 4XFFA 1JTZX 1IHMA 1A3KA 4GIQA 2WT0A 3AMMA 1RUD2 2WNUA 4PDWA 1SFYA 1PK6B 4RHV1 3AXEA 2IXJA 2PAEA 1ZNPA 4R9CA 4DFSA 1AXKA 2ZGUA 3NAPC 1ZYBA 1XQNA 3NVCA 4AVSA 1WLTA 1DZRA 1JBCA 2O8OA 2LUWA 3GALA 2YV8A 2A3YA 2GAUA 4PDWC 1GFF2 3FZ3A 1O4YA 4Z92B 5H9QA 5GLTA 1ZREA 4M3CA 5H9RA 2DCKA 2X5IA 2ZX0A 3WHTA 2UY9A 2ZAHA 1F2NA 4AQSA 4MGIE 4XE9A 5JSOA 5I0SA 2WT2A 3UL2A 1D4M1 3B7MA 2WJSA 4BLIA 3THTA 2X5IC 1QOSA 4DY3A 3ETQA 1EV12 4DRVA 2XBO1 1RINA 1ZRFA 3HQXA 4YVSA 3ZN5A 1XNBA 1ULFA 2D97A 4IV3A 1AR61 2B39A 5FLHA 1MS4A 2B5HA 2VMIA 1G9BA 3OYWB 1O91A 4B29A 4F8AA 1ENSA 1ZRRA 2XWJB 2VVFA 4YVSC 4I0WB 3AM2A 4WVMB 4Z07A 3H3ZA 1COV2 2I07B 4Q4V3 2ZGNA 2ZCWA 3VBOA 5LEKA 4HSLA 5K0UA 4YFZA 3I54A 2P37A 1APNA 4YM2A 4YGEA 2A6XA 2H6CA 2JE9A 2NQYA 5CFCB 4DOUA 1F9KA 2BBVA 2F6BA 2JX9A 4Q1PA 4TWTA 4LBMA 1LRHA 1HV0A 3N3HA 4M00A 2BYVE 5C4WA 3AZZA 3VBOC 5FOJB 1GYKA 3CO2A 1N1YA 4O9GA 4XBNA 4OHYA 1GICA 4HKOA 3VL8A 1MEC3 4Q27A 3WV6A 4AXOA 1LULA 4ATEA 2I2SA 4N43A 2E53A 2H0VA 4XF4A 5HXVA 2FZ2A 2XLFA 1IKPA 3CL1A 2OZJA 2ZJCA 2UWCA 5C4WC 3RJRA 3KCYA 1AUYA 3GZUC 3VZNA 3DPRA 1BXHA 1EAH1 3AYDA 3SITA 4LEJA 3GNEA 2DVGA 4LLOA 4AEDA 1NQDA 2NZ9A 2Z42A 1MQTB 2BW8A 3TN92 1BBT1 4N43C 1HDKA 2ZX1A 3MEPA 4EWDA 1DGRN 3CF6E 2DURA 2WNVA 2BFUS 4JDNA 3DPRC 4Q0VA 5FREA 2OVUA 1N3PA 4IERA 2R0HA 4Q2FA 4A7ZA 4I2OA 1GNZA 4Y1YA 5E88A 2UU8A 1FAYA 4A3XA 2MPFA 5C8CA 3RDIA 2VXRA 2BVVA 2EAAA 2WNVC 3PVBB 1ULEA 4F7ZA 3JBG3 3HD8B 4K8FA 4S2FA 4RR3C 1AR91 1YNAA 3VZOA 4X8NA 4ITCA 1ZZCA 1FX5A 5C8CC 4HMZA 4KGGA 1PO11 4GB31 1KQRA 2RHPA 1ENQA 4XEZA 1EP0A 1VB2A 4OI0A 4W65A 1NQJA 1MZFA 2XJQA 4DPNA 1R092 4LHNA 5CB7A 4MXVA 4Q26A 1DGRA 1OA4A 2NP0A 5T3NA 3OGGA 3ZXGA 1A8DA 1VALA 2PLV2 3MIGA 2BWAA 4L8QA 3VZJA 5JIUA 3ZN6B 4LBQB 3CLPA 4FPJA 1RHI3 2DYCA 1TE1B 5ACA1 3QBQA 2IXIA 1YO8A 3TB0A 5DXDA 4CDUA 1AJOA 3VBSA 3BB6A 2HWF2 4E9KA 2MEV2 3OY8B 1VAMA 4KNCA 2XH6A 2EF6A 2TEPA 1VBB2 3E97A 1LGBA 3R4UA 3K51A 2JJ6A 1SCRA 3WP6A 2ZHNA 1D4VB 3CU7A 4QQHA 3PLQA 3VBSC 4LO5B 1ULGA 4RQPA 2RMU1 2ZGPA 4IETA 4SBVA 4AE2A 4I0AA 4AEMA 3ROUA 2HWB2 4XF3A 1LU2A 5JI7A 1GANA 5F1RA 2AUYA 4HETA 1FPN1 5T50A 3PTYA 3AFGA 2CGPA 4K3UA 2HYKA 1OOPA 1JW6A 4RQPC 1FT9A 4KWJA 4PLMA 3FJSA 5KHHA 1QJY2 2Z79A 3E6BA 3I59B 3VLBB 3QH7A 3B01A 3GBFA 4QM9A 1TME3 4Y1ZA 1QDOA 4NO4A 2FMYA 3SH3A 4XF9A 3ZFFA 1DQ1A 1SEFA 1VBC3 5KC5A 1OOPC 2ARBA 1YJLA 2G9GA 3JQWA 1PZ8A 4YNIA 3N7LA 4AF9A 4N53A 2ZHLA 1KS4A 3M70A 2D98A 2VW2A 3ZFFC 1OD5A 5I93A 3T1MA 3VUOA 1AR82 4YG0A 5JCTA 1C3HA 4LE4A 1WA4A 1QJU3 3FLTA 4JGZA 5CNAA 2VUJA 4LR4A 3SCHA 4AGGA 5I8TA 1VBA3 3P3NA 4LHKA 1K5MA 4AEKA 1V9U1 4RL7A 1XE8A 5CIRA 5C6CA 3HT1A 2YDEA 1RUH1 3IN9A 3ZYJB 1AYN2 4JGZC 4JRAA 2NMOA 4JDMA 4RGAA 3WQ7A 4EN0A 2EXKA 2OW4A 3IPVA 1RB8G 3NL1A 5BNQA 1K5MC 5JWPA 4YZ4A 4WVVA 1FATA 2WFF1 2TBVA 1WD3A 3R05A 2YROA 3SXWA 1POV1 2ZGMA 4P9JA 4YLZA 4QQ2A 1W0OA 3GBWA 1QH7A 4W6YA 3J26N 5GZEA 3NV3A 3MFCA 2NYYA 4H7MA 4C1WA 1W6NA 4AK3A 4UXAA 1W6MB 4XMAA 3N4MA 1S55A 3ACLA 4Q4Y2 1UW8A 1MS0A 2P17A 5GLVA 3H1WA 5BNPB 1C5HA 4GMP3 1QOTA 3N7MA 3MLLA 1ULCA 4FPHA 4QPGB 4AGRA 1AX2A 3D5OA 3NWKA 4FO9A 3WDWA 1Y43B 3WDVA 3HR9A 1PGSA 1Y7BA 3GBGA 2RJKA 5FMOS 1CPNA 3TOJA 1ND2A 2QQPA 1CPMA 3LAGA 3VBHA 4WVWA