4QPGB

Crystal structure of empty hepatitis a virus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
204
structure length
204
Chain Sequence
GASYFTSVDQSSVHTAEVGSHQIEPLKTSVDKPGSKKTQGEKFFLIHSARWLTTHALFHEVAKLDVVKLLYNEQFAVQGLLRYHTYARFGIEIQVQINPTPFQQGGLICAMVPGDQSYGSIASLTVYPHGLLNCNINNVVRIKVPFIYTRGAYHFKDPQYPVWELTIRVWSELNIGTGTSAYTSLNVLARFTDLELHGLTPLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hepatitis A virus and the origins of picornaviruses.
pubmed doi rcsb
molecule keywords Capsid protein VP1
molecule tags Virus
total genus 28
structure length 204
sequence length 204
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qpgB00
4PDWA 4N53C 2HWD2 4GB33 2X5IA 1NCRB 4CEWB 5C9AC 1RUH1 2XBO2 2HWF3 2ZTNA 4Q4V3 1RUI3 5CFCC 5BNNC 4GB31 1QQP3 1SMVA 1AR93 4CDQA 2HWF1 2R043 1VBE2 4WM8B 4YVWA 4Q4V1 5ACA3 1RUI1 4N43A 4IV3A 1VBD3 1QQP1 4GH4A 2GSYA 1AR91 1HXS3 2R041 2WWSA 5ACA1 4QPIB 4Q4W3 4AEDC 1NG0A 3VBSA 4NWVA 4RHV2 4CDXC 3TN93 5D8AC 1VBD1 1RMU3 1QJU3 1HXS1 1H8TA 2ZZQA 4Q4W1 4CDWB 1R1A3 3ZFFC 4CEYB 5K0UC 3TN91 1VBB3 4Q4Y2 1RMU1 1QJU1 1WCDJ 2MEV3 3VBRA 5AC93 1RVF3 4PDWC 1NA1C 1RHI3 1R1A1 5BNOA 1VBB1 2X5IC 5AC91 2MEV1 4RS5A 1B35B 5A33B 1RVF1 4PDWB 1NA1B 2QQPA 1RHI1 2HWD3 4YVSB 5ABJB 1HX6A 1VB2A 2XBO3 1VRH3 4CDQC 4JGZA 4YVWC 3VBHA 1NCQA 1QJZA 2HWD1 5JZGB 3VBOA 4N43C 4IV3C 4FSJA 1MEC2 3S6PA 2R042 2XBO1 1VRH1 1VBE3 1ND2B 5ACA2 3ZFEA 4IV1C 4N43B 4FTEA 3VBSC 1VBD2 1DDLA 4CDUA 1OPOA 1H8TC 5BNPB 1RUF3 4IV1B 4RHV3 1OOPB 4Q4X1 3TN92 1PO22 1VBA2 1RMU2 1NY72 3VBRC 1H8TB 1RUF1 5L7OA 1M06G 1X36A 4RHV1 1VBB2 5BNOC 4RS5C 5A33A 1RVF2 1AL0G 2WS93 1FOD1 4JGYA 1ND3A 2RM23 1RUE3 1AL22 1BBT3 2WS91 4JGZC 3VBHC 1NCQC 1QJX3 1NOVA 3VBOC 1HRI2 1MQTA 3ZFGA 2RM21 5CFDA 1A6CA 1RUE1 1VRH2 1BBT1 4N53B 2PLV2 1VAKA 4JGZB 5FMOS 2RR12 3ZFEC 1NCQB 1PVC3 1QJX1 3VBOB 5C9AB 1MEC3 1IHMA 4Y4YA 3VBUA 4CDUC 5C4WA 5CFCB 1CD3G 1PVC1 4Q4X2 5BNNB 2TBVA 1MEC1 4CDUB 1RUF2 1RUC2 2RS12 5L7OC 1AR82 1PO23 1VBA3 2Y26A 1FOD2 4AEDB 5L7OB 2ZAHA 4CDXB 4JGYC 5D8AB 1PO21 4SBVA 1VBA1 1NY71 2WS92 3VBFA 3NAPA 1EV12 3ZFFB 5K0UB 3VDDA 2HWE2 2WFF2 2RM22 1MQTC 3JBG2 1RUE2 5A32A 3ZFGC 5FOJB 4RQPA 1BBT2 1AL23 4NWWA 5CFDC 3ZXAC 1QJX2 1PO13 1OHFA 1HRI3 2X5IB 1MQTB 3VBUC 1AL21 1V9U1 2VQ0A 5C4WC 2PLV3 5C8CA 2RR13 1PVC2 1PGW2 1PO11 1PGL2 1D4M2 1HRI1 4GH4C 4CDQB 1BMV2 4YVWB 2PLV1 2RR11 1RUD2 3JB4C 4Q4X3 4IV3B 4FTBA 4CEWA 1TME1 4GH4B 4QPGA 4Z92B 1RUC3 2RS13 3VBSB 1EAH2 1AR83 1CJDA 5J98B 1TMF2 2RMU1 1ASJ3 2HWB3 4WM8A 1RB8G 1COV3 4Y5Z0 1FOD3 1RUC1 2RS11 2R072 1AYN2 3VBFC 1Z7S2 3NAPC 2RS53 3VDDC 1AR81 4RR3A 3JB8A 1HRV2 3J8F3 1ASJ1 3VBRB 2HWB1 4QPIA 4RQPC 1COV1 1EV13 2R063 3NAPB 3VBFB 2HWE3 1FMD2 2RS51 3VDDB 5BNOB 2WFF3 3J8F1 2FZ2A 1RUJ3 3JBG3 4RS5B 5A32B 1V9U2 4RQPB 4CDWA 1POV0 4CEYA 1EV11 2R061 5C8CC 2HWE1 1K5MA 1PO12 3JD72 2WFF1 2IZWA 3IDEA 1RUJ1 3JBG1 3VBHB 2HWC3 1TME2 4LLFA 4CEWC 1BEV2 1D4M3 1B35A 4QPGC 1F2NA 1POV3 3M8LA 1NA1A 4GMP0 1AYM3 1FPN3 3ZFEB 1RUD3 4YVSA 1ZBA2 1PGW1 5ABJA 2HWC1 1PGL1 1D4M1 2RMU2 1W39A 1AR62 1F8VA 1VB4A 4QPGB 1POV1 5DDJ2 4WM8C 1AUYA 1BMV1 1AYM1 1ZBE2 1FPN1 5JZGA 1RUD1 4WM7A 1QJY3 1EAH3 4RR3C 4GMP3 1ASJ2 1TMF3 2BFUS 2HWB2 1ND2A 1COV2 4EJRA 4QPIC 1C8M2 2R073 2BBVA 1VBC3 2RS52 1AYN3 1Z7S3 3CJIA 1QJY1 3DPRA 1EAH1 2RS33 1ND3C 2FZ1A 3J8F2 4RR3B 1AR73 4GMP1 1HRV3 1TMF1 3FBMA 1RUG3 5BNPA 3HAGA 2WZR2 4IV1A 4CDWC 1C8NA 1OOPA 2R062 1R082 2R071 1AYN1 1VBC1 4JGYB 1Z7S1 4RFT0 1FMD3 4CEYC 2RS31 1K5MC 1GFF2 1ND3B 1AR71 1HRV1 1RUJ2 1RUG1 1V9U3 1R092 1FMD1 2WLPA 5J96B 1K5MB 3JD73 2BPA2 3ZFGB 1B35C 3LOBA 5CFDB 5FMOL 4YVSC 2HWC2 1PIV3 5ABJC 1TME3 3JD71 1BEV3 1RUH2 3VBUB 5C4WB 1AYM2 1FPN2 2DF7A 5JZGC 4GB32 4WM7C 1NCRA 1ZBA3 1PIV1 1BEV1 1AR63 2RMU3 5GKAC 2HWF2 4N53A 4Q4V2 5DDJ3 1RUI2 1ND2C 2GH8A 1ZBE3 1QJY2 4WM7B 1QQP2 1ZBA1 3CJIC 5C9AA 3DPRC 1AR92 1AR61 2BFUL 5DDJ1 5CFCA 5BNPC 1ZBE1 1C8M3 1VBC2 5BNNA 1OOPC 3CJIB 2RS32 3DPRB 1AR72 1HXS2 5LK7B 4BCUA 1RUG2 1VBE1 4Q4W2 1E57A 2WZR3 1C8M1 1R083 1QJU2 4AEDA 2WZR1 1R1A2 4CDXA 1R081 5D8AA 1R093 1X33A 2BUKA 5AC92 2MEV2 4Q4Y3 1RHI2 5K0UA 3ZFFA 5C8CB 4FTSA 1R091 1PIV2 1NCRC 4Q4Y1 1HQNA 2XPJA 1RUH3
chains in the Genus database with same CATH superfamily
5DN2A 3KS7A 4XILA 4CVUA 3D0SA 1J59A 1E5IA 2WJSA 4K9SA 3OBRA 3BTAA 4L92A 2X5IA 5C9AC 3UGGA 3BVCA 4INDA 2HWF3 2ZTNA 4ZS2A 3N4MA 3VKLA 3M3OA 2EXJA 2JG8A 2UYBA 2V4VA 3PIGA 1YWKA 4F7ZA 2ZABA 3OTFA 5FMDA 1GANA 5FYIA 2CGPA 1OA3A 3BGAA 1QQP3 3W21A 4AL9A 1ULOA 3WUCA 1DGRN 4CP2A 1QJFA 3JQWA 3ZR6A 4WM8B 1MR5A 5ACA3 1XJAA 3WDYA 4YW6A 4N43A 1W8WA 1GNYA 3CHXA 3VZOA 1CR7A 2W39A 1S4CA 3EO6A 2XL9A 4N90A 3MPPG 3D5OA 1AR91 2E63A 3PNAA 4HLTA 4O7XA 3RS6A 2W1UA 4YARA 3K2OA 2R041 3I2HA 2PELA 3PDQA 2WWSA 5A7WA 5FUIA 3ZYIB 1JZ5A 4Q4W3 4QPYA 3OCPA 4R9CA 4XIOA 3H7JA 4XPVA 5FY0A 3VBSA 5I0TA 3WF4A 5FR3A 4NE9A 1QJU3 1HXS1 5FRAA 5C3QA 1H8TA 1UZ0A 4XUNA 2ES3A 3N9OA 3WOGA 3VHPA 2ZZQA 1CVNA 3OPWA 4XCAA 2XJSA 5DUXA 1DBNA 3MLLA 4CDWB 5A7PA 2JG9A 3LEGA 4PF5A 3TN91 3I3BA 5JXJA 1VBB3 5CB7A 4MHRA 3IPVB 4Q4Y2 4D7TA 1V70A 1RVF3 2HEVF 4P14A 1KGYA 1VPHA 2C24A 1RHI3 1YIFA 4QXBA 4DPNA 5EJ1B 1W8FA 2A1XA 2BNOA 2EXHA 2VZPA 4DMIA 4AI8A 1V6OA 1ZRIA 4RS5A 5FY9A 1T2XA 4LBNA 1B35B 4FPKA 4AEKA 4X8PA 2E32A 4HVOA 2A3YA 1NA1B 2QQPA 3ELNA 5IJRA 1IZ3A 2K2SA 4QX7A 1WW7A 1GNZA 5FYSA 1YEWA 2YY1A 4K8FA 1S0DA 2D6OX 5ABJB 4QGLA 5HCBA 2C5DA 4J6GA 4NRPA 5I0RA 1JYWA 1VB2A 1UY2A 5LW9A 4YZ1A 1AXKA 4FPGA 4YVWC 3VBHA 4KWUA 5C5TA 3TEZA 4CCLA 1V00A 2XJUA 3QD6A 2IXKA 2JG8B 4B4RA 3VBOA 1ZZBA 4PJYA 5I91A 4NAOA 5FV3A 5EP9A 3PVEA 1QDOA 3WF3A 2RJLA 5FDBA 1VRH1 1ND2B 1W6QA 1X8EA 3GXUA 4WVMA 2XJQA 3F2ZA 3ILFA 4CRQA 4N43B 5JR2A 1JUIA 4F3JA 2BW8A 1XE8A 2WZ8A 3AKQA 1GV9A 5FYCA 1ULPA 3GJBA 4P08A 1K42A 2WR9A 1S55A 4COVA 1GQGA 3GCWA 1EY2A 3EB7A 2ZGRA 1IGOA 3N7LA 3N7MA 4L11A 2KM2A 4NRMA 4DXSA 5HPOA 4Q4X1 1Y43B 3E6DA 2YBPA 1VBA2 4BYYA 1VP6A 4DNYA 1DZRA 4R9DA 5GLUA 2DTYA 4CXYA 1NY72 1UOFA 1ENSA 4XXPA 5LB6A 3VBRC 3AYDA 1H8TB 4BOWA 4C0BA 4QXHA 4LIVA 5JXIA 4XHXA 1VRBA 1AX2A 4MXVA 1LESA 5FZHA 5BNOC 5GJ6A 2PHUA 1JOPA 5FAXA 3V0AA 4XXAA 5F2WA 4A6OA 3H42B 2GMEA 1AL0G 5DAXA 1E5HA 3E5UA 3POEA 4XCBA 2EIEA 1RUNA 4GULA 4KWLA 1L3JA 2E53A 2EVXA 1C28A 5FPZA 5A1FA 2RM23 2A6ZA 4Q29A 1GICA 5CEHA 1XNCA 3HR9A 3SEPA 1WMEA 1SFYA 4JGZC 1NCQC 1QIQA 3T1MA 1DLLA 4I0WB 4Y1YA 3W9AA 1LHVA 1A6CA 2FMYA 4LLOA 5LA0A 1LOEA 1QNYA 2ADDA 3K75B 5F6KA 2GC1A 3T09A 3UT0A 5FMOS 2NMOA 2X10A 3VBOB 5L9RA 4OQ8A 1H2MA 1PK6C 2ZOEB 3OUJA 3P1IA 4UI9L 3VBUA 4Y4YA 3DN7A 3P3NA 1GZCA 5C4WA 2Y6FA 2DCYA 4B4PA 2VAUA 2XOMA 5CFCB 1X7NA 4IEYA 4WVMB 2DU0A 5FWEA 1LHNA 1VE0A 1IG3A 3CIHA 4P02B 3N9LA 5T3NA 1W0OA 1MPXA 3NJYA 5APAA 1IOAA 2ZS6B 4PIYA 5B4NA 4J1WA 1RUF2 3FN9A 4I30A 1RUC2 2VVEA 2VQUA 3C3VA 5DAVA 1JZ4A 4ET7A 3UGHA 5T5PA 4BISA 2V73A 1MS8A 3NJXA 3CQOA 4JKKA 4MX3A 1VBA3 2YG0A 4OZXA 1ZREA 3I8TA 3WR0A 5SV8A 3O1UA 3FMGA 2BWCA 2FDKA 4AXOA 2IXLA 1WMFA 3L2YA 1UW8A 2GH2A 2YXSA 3WUDA 2ZCWA 4AEDB 4E4ZA 1W9FA 3UKTA 3H0OA 3V64A 5I0DA 5JVVA 1UL9A 2R30A 3I2DA 4FXKB 3I2JA 4XF1A 3V0AB 1DZQA 1LU2A 1IPKA 3IDBB 4H7MA 5HXMA 4KWJA 1EV12 1SBFA 4DFSA 5K0UB 1UPIA 1UYZA 1JI6A 3APBA 3U75A 4DRVA 1DU3D 5IVFA 3R4UA 2C26A 1HQWA 2ZAAA 4BQ3A 2XUEA 1RUE2 3JBG2 1Q5OA 4WBBA 2WYFA 2JB8A 1MZ6A 3USUA 4Q8KA 5CFDC 3LFMA 1QJX2 4YWAA 3BOWA 3FZ3A 1OHFA 4QXKA 3WP6A 3B9CA 5JDBA 3MIFA 5CNAA 1KITA 1AL21 3NKTA 5FP4A 4A2UA 2ZGUA 5JSPA 5F3GA 1ZM1A 2FD8A 4XFCA 2QQJA 5C8CA 1PVC2 4LHSA 5JLVA 2ZGMA 5JWPA 1G9DA 5FK8A 1HRI1 1WD3A 4RGKA 4CCJA 2QDNA 4FPCA 1CX1A 4CDQB 3AZZA 4F8AA 4M3CB 4PBPA 4DOUA 2VBBA 4OI2A 5FY5A 4AVSA 3ES4A 1ZZ6A 4BK5A 2ZGPA 2RR11 1JYCA 4QQ2A 3IMNA 4GH4B 2Y0OA 3MUZ1 4AHYA 3WW3A 4EYUA 5FZBA 4FOQA 1PM7A 1YHFA 1RTVA 4Z92B 4D94A 1RUC3 3ZO0B 4Y26A 4E8CA 1DG6A 1MZEA 3OY8A 5C3PA 1CJDA 2UURA 5J98B 5FYBA 4CCNA 4K20A 3ZKUA 2HWB3 2WO7A 2XVLA 4EE2A 1RB8G 2BVVA 1OLMA 4HFSA 1LEMA 2W2IA 4Y5Z0 5F8PA 2J42A 1A8DA 1OH3A 2RS11 4W6XA 1DQ6A 1AYN2 1BQPA 1RJ8A 3C7EA 3NAPC 1W9SA 1W0PA 2FMDA 5DG2A 5T52A 4KGQA 1NE4A 1AR81 3VDDC 5LATA 1GU3A 1REEA 1VJ2A 5TSWA 4XUPA 5IVYA 1QXRA 4B3NA 1UX6A 3AP4A 2XWBB 3PMEA 1EV13 2BYVE 2C4XA 2VD7A 4HK8A 4AR2A 2YPDA 3VZKA 4BIFA 4CU8A 1N47A 4HPKA 3K4DA 4XF0A 3IIAA 4DEQA 5IFTA 2XKOA 2JIJA 1CAUB 3KB5A 1GP6A 1OLME 3JBG3 4LHNA 1U5ZA 1V9U2 4B1MA 4CP9A 3USUB 2JWPA 2XJRA 2PA7A 5C3RA 5JOZA 3TB0A 4MXWB 4CEYA 1CIYA 2R061 1RC6A 3EBRA 1K5MA 3Q8CA 4NHXA 4OMDA 1OLRA 1PO12 1H6XA 4XHBA 3IDEA 4M0NA 1RUJ1 2VNRA 3WQ7A 2DCJA 2WWJA 4P9GA 5LA9A 2PAEA 3AXDA 2HWC3 1IS4A 4GD4A 1O8SA 1K3IA 2CYFA 1BEV2 4GKYA 3WX5A 1OA4A 4QPGC 4UYBA 1DIWA 3M8LA 3NVCA 3WG3A 2Z42A 4YG3A 3ZFEB 4PIZA 4UFIA 4W50A 4YW7A 2WUHA 1N1SA 4G3YC 4XJZA 4YGCA 4OUEA 2WAOA 4XJUA 1PGL1 1D4M1 1W39A 4Q5OA 5FZOA 1VB4A 1F8VA 4CSWA 4V2VA 5DDJ2 3WDVA 4WM8C 1AYM1 5A7OA 3OBZA 4P5HA 5JZGA 3RNSA 4I01A 1UYXA 4ZONA 2LUWA 2CNAA 3OY8B 2O8QA 2VNGA 1UMHA 3I3QA 2QZ2A 4N9IA 5H9RA 4FBFA 4S2DA 1COV2 2E7TA 2LROA 2QZ3A 1C8M2 1YFWA 4HSJA 1DHKB 4TLFA 1AYN3 1SLBA 1VBC3 2RS52 5FO8B 3DPRA 2RS33 2ZHMA 4AVAA 2FZ1A 2OPKA 2WSUA 3J8F2 4GMP1 4JVAA 1PX4A 2PAKA 3WW2A 1OLQA 3S30A 4AG4A 4CDWC 2FDIA 4GWJA 1FAYA 1OOPA 2R071 2OA2A 4XW3A 3UYJA 4XQ4A 4L8QA 5SV5A 2G4IA 2WN2A 4HBNA 1ND3B 3TBDA 4HPKB 3CZJA 3LDRA 3T2OA 3WP3A 2QDRA 1HRV1 5HCAA 2CAUA 3BU7A 1W8UA 4XBLA 3FUQA 3VHOA 4RYDA 5G05L 1V9U3 2NLRA 3UKVA 3VZMA 3IAQA 4CXWA 4QB6A 1UYYA 5LA1A 2QE3A 4ZU7A 5J96B 1VIWB 4XQWA 1K5MB 4IE5A 2AH2A 1CPMA 3VKMA 1B35C 3ZFGB 2B8MA 3HMYA 4HONA 4K1ZA 4EN7B 2I07B 4AE2A 2Y33A 1YQ2A 3QOPA 5C8WA 2BRTA 2G19A 2PQQA 4E9KA 4CEYC 1V6KA 5ABJC 4MGTA 2IWGB 3JD71 1BEV3 5F3IA 2CWSA 3LDKA 1O4YA 5FJHA 2DURA 5CKMA 4IEZA 3KLSA 5IYYA 1AF9A 1GZWA 3WG2A 4BB3A 2V4AA 3R0RA 5A7QA 1XYPA 1PIV1 4TZDA 4PT6A 2PN5A 5FZMA 4EN8B 1M4WA 5FZOB 3SITA 1DP0A 1N3OA 5DDJ3 2BEOA 5KHGA 1ND2C 4CP1A 4ASLA 4R8HA 4OLLA 2VUJA 1QJY2 1DGWA 3GDBA 4Y1UA 2VZQA 4NHMA 3B94A 4AFCA 5KBFA 1AR92 4XF4A 5LEKA 1AR61 1NZCA 1W3XA 1HIXA 4ORFA 4XEZA 3UJQA 2JKXA 3BIEA 1OF4A 2B45X 4CCEA 1SPPA 4Y24A 1JS9A 1MACA 3E1F1 1C8M3 5BNNA 3NL1A 4BM8A 1JBCA 1JXNA 2XR4A 3ETPA 4CE8A 5A3MA 3DPRB 4B8EA 1AR72 1HXS2 5LK7B 3PMSA 1RUG2 2Y60A 2IVIB 3ASIA 1VBE1 1UNBA 3WG4A 1E57A 4FPOB 5E16A 2EIDA 2PQSA 3RG0A 3GHNA 3AZXA 1F4HA 4FPJA 2WT0A 4D7YA 1CAWA 1DYPA 5L73A 1US3A 2RG4A 2P6HA 3AM2A 2MHFA 4Y22A 2VZVA 4J25A 4QX8A 3WZ1A 5CG8A 3LA7A 1RINA 1R081 4HKLA 5D8AA 2ZX2A 4IGOA 3PTYA 2KA3A 2P34A 3HD8B 3K4ZA 3MDPA 3NMBA 1X33A 2JX9A 3P3PA 4MO3M 3EHKA 2UWAA 5K4LA 4SLIA 2G9ZA 1GMMA 3I2IA 1F9KA 4D6QA 1UZZA 3ZFFA 3R4SA 4Y3OA 4WZFA 3WQ1A 4FTSA 3D8CA 5H9PA 1WZXA 3VD5A 2R1BA 4UAPA 1NCRC 4Z07A 4XF3A 4DUVA 1PHMA 4NHKA 2F17A 3I7DA 2E26A 3KM5A 3O0WA 2W91A 1V6MA 4KL1A 4COUA 3TWIA 2GP5A 1GZWB 2NMNA 3LPGA 1XNBA 5IHRA 2V5YA 5EHDA 2QQMA 1PMJX 4EWDA 2Q8OA 3ZXGA 2YB7A 2HLEA 5JOWA 1RUH1 1OFNA 1MZFA 1CZSA 5CFCC 3ACGA 2A6VA 5JOYA 1UY4A 2WLQA 2AYHA 3VUOA 2BJSA 2LW8A 5KR7A 3UNPA 4LBQA 4H2AA 1W6MB 2ZEYA 5FLJA 5J3UA 4JHZA 1AR93 2EXKA 3LKJA 5GZGA 2VZUA 2WO3A 2R043 4S2GA 4AAXA 4FFFA 4OFGA 1RUI1 3R05A 5FZGA 3SKVA 2ZJCA 4YNIA 1XNTA 1SPPB 3DUIA 3FHIB 5DUUA 5JCTA 4IV3A 4C1XA 2VVDA 4LKEA 1FT9A 3KGLA 4IEUA 1NQJA 2IVJA 1CX4A 2CTVA 3WQ0A 1PNGA 1HXS3 2W1WA 3IIIA 2QKDA 4ATFA 4RN5A 5FXXA 3ZYFA 2BOJA 4C0HA 3OEBA 3U78A 4QPIB 3H8RA 3FL7A 4AEDC 4BJ0A 2QQNA 2GNMA 5T5OA 4FOWA 1BVP1 1LJ7A 1T6GC 3B7MA 3TN93 3BU0A 1VBD1 2Y0IA 4KG8A 2VW2A 5ISLA 2XJPA 4NAMA 4YFWA 2IXJA 3FHQA 4Z1VA 3P5BA 4ISRA 4RD7A 1K45A 4NPLA 2A3WA 1MS0A 5FUPA 1MS9A 4YGDA 1FATA 5K0UC 3KZ4C 4BQ5A 1EPWA 5L36A 1YQ8A 2CGNA 4C91A 5HV0A 2D98A 2VMIA 5JI9A 2BU9A 1RMU1 1WCDJ 2P6CA 2WINB 5FYUA 2CSGA 4LBMA 1W3VA 4CUBA 5IVBA 1F31A 4PDWC 4CTEA 1XE7A 2JICA 2DUQA 1R1A1 2A75A 2D3RA 4BXSV 2UY8A 3C7OA 2FDHA 5FYYA 4IUGA 4HN0A 2VU9A 3A23A 4BU2A 2ZKLA 3OYWA 2MEV1 3ZKYA 2IXHA 3MLKA 4HG6B 3AP5A 5FZ0A 1SZBA 1C3HA 1DGRA 1OURA 1SDWA 3SLIA 3ZSLA 1JMUB 4CXXA 2W5FA 2XVGA 3POBA 4JTOA 2P2KA 1LB2A 1Y9GA 1REFA 3AMMA 3Q8AA 1A78A 1LGNA 1VRH3 4K40A 4CDQC 2JB4A 5A7SA 2Y6GA 5DZEA 4I0BA 1UU6A 2HWD1 1QJZA 1ST8A 2VGDA 3FX3A 1AX0A 3N9QA 5FY1A 3S7EA 3VDBA 1LGBA 2ZACA 2A71A 5FMBA 1T6BX 1FV2A 3WY6A 1KDKA 2G1MA 3MIEA 2J1AA 3CL1A 1GNHA 5H9QA 1RYYA 5ACA2 1F4AA 1XYOA 4H3WA 2QCSB 4IV1C 1F5FA 1UCXA 2VM9A 3QH7A 3ZMOA 3HT1A 1VMHA 4IETA 1W90A 1DDLA 5L9VA 3SNMA 1LULA 4UOJA 4B7EA 5FBJA 1J1LA 4OHWA 1H1AA 2VQTA 1SACA 2W0XA 2VNVA 2WNVB 2ZA9A 2GALA 2VUCA 4NN0A 3SC7X 4DY3A 2W92A 3C7FA 4IE0A 1JYIA 3W58A 1S2KA 1PVXA 3AKSA 4CUGA 1JH5A 3BALA 2EF6A 5F5QA 3CF6E 4IE7A 4CCDA 3GZEA 1AX1A 1UU4A 4UFJA 4XAEA 1ENRA 2ZGQA 4XE9A 5LBFA 5L7OA 5E1RA 1S2EA 1H1MA 2JE7A 1X36A 2W1SA 2Q30A 3OD4A 4O9EA 5HBAA 5FZLA 3OUHA 4OMCA 2D6NA 3VV1A 1IKPA 3WF1A 1VBB2 3UETA 5A1LA 4QM9A 2NYYA 2V09A 3AL6A 5IK4A 4CPBD 1RVF2 2IUWA 4UW3A 3JXSA 1ZVFA 3ZXFA 3RZKA 5FMCA 1X50A 2Q0AA 3MGUA 4JGYA 2WT2A 5J48A 2O1QA 1DYOA 3MIGA 4YM0A 4KWKA 3VL8A 4UFKA 3OYWB 4QMAA 1AL22 3T2PA 1UMZA 5JAXA 2WS91 1KJLA 5KHJA 5IK5A 2PTMA 4GJZA 2X05A 3D0JA 3RQ0A 4E2GA 2JDNA 4KBZA 4NOTA 4H14A 1HRI2 4AGVA 1PZ8A 5FK7A 3TOJA 5FZ6A 4W6WA 2J22A 5AFEA 1BBT1 1XQNA 4N53B 4BLIA 4XACA 2RR12 2J7MA 3ME2A 4XUOA 3ZFEC 5DZFA 1UKRA 5CKNA 2ZEZA 3Q8EA 5K9YA 3BCWA 3ZR5A 4NJ4A 1PZ7A 1U5YA 2Y6HA 3AVSA 5FZ7A 4TTGA 4CDUC 1W03A 1IS3A 2ZGTA 3I3MA 4YW4A 3WG1A 5L9BA 2E7QA 4OI4A 3ZSKA 3V56A 2WRAA 2TBVA 4Q27A 1MEC1 4XJ8A 2JDAA 1Q8QA 2OZ6A 2R16A 1I5PA 1SCRA 2JDYA 3PU3A 3GZTB 1W8OA 5I0SA 5JPMB 2RS12 4AGGA 1LGCA 3VD4A 2AACA 3TNPB 5BYNA 2OKXA 1AR82 2LRPA 4XJWA 2JDMA 2Q4SA 4NRQA 3LGRA 4QX3A 3I97A 2E9QA 3RPQA 2A6WA 3ZYPA 3NNFA 5ANQA 1FOD2 1S0IA 2J1EA 3GJAA 3UJOA 5JSRA 5L7OB 1ZRDA 3RWNA 4CDXB 4HANA 3AK0A 3A0NA 2VJXA 3AZWA 2GNBA 4QX0A 3MFAA 1LECA 2AENA 2VMHA 3HN3A 4YGEA 1Q8OA 4K1YA 4NROA 2O14A 3CNAA 3K77A 3VBFA 1SLIA 1GBGA 1EUUA 2BNNA 4R4XA 4YLZA 2A3XA 2QUOA 5F3EA 1IKQA 3U07A 4B7KA 1W9YA 2IC1A 5A3LA 5GZCA 3N3HA 5J1XA 2RM22 3WNPA 1MQTC 1ZA7A 4JKLA 3ZFGC 4RQPA 1AL23 4AI3A 4IESA 4LBKA 2Y38A 2VXRA 3DYOA 3BTYA 1PNFA 5CIRA 1BVVA 3T2QA 4BLJA 5DQ0A 1HRI3 2X5IB 5IVCA 1W2NA 2OIIA 1G9CA 1VR3A 5CG9A 3VHNA 2VQ0A 4MVTA 5LEJA 3MW2A 3S7IA 2RR13 1IS6A 1UPSA 3ZN4A 1DQ0A 3E5XA 3DCQA 2Q8EA 2DVFA 1PGL2 1D4M2 3PIJA 5JR7B 2JDPA 1GOHA 2PHFA 4W6YA 5IAVA 2WDBA 2VXJA 4M4RA 3BODA 2AEYA 2QQUA 4Z82A 2BP6A 1WLDA 4XBQA 1GLHA 4CEWA 1TME1 3ZYRA 4XDPA 1G9BA 2Y6JA 4YZ3A 2DBNA 5IVEA 1W9WA 3A21A 5A7WB 3CKHA 4E27A 3ZN6A 2V5DA 2RS13 1RIRA 1YO8A 4XDOA 5CVRA 1ODMA 2JKBA 3VBSB 3WINE 1HB3A 4LO5B 1W99A 1AR83 2BTVC 3RJRA 4ZY9A 2RMU1 2VCBA 3J26N 4QD2A 4COYA 5FOBB 3ZX7A 3O0XA 4KGGA 2RDNA 1FOD3 4LOSA 1WCKA 4MH0E 4NO4A 3WDUA 3TYJA 2R072 4DB5A 2RDQA 3U37A 3DL3A 3MW3A 2JG9B 4U36A 4AK3A 1OUSA 4RR3A 2VE1A 3ETQA 2HYXA 1BHGA 3JB8A 1HRV2 4QQPA 4OZOA 4TYSA 5ANNA 3BPSA 1ASJ1 2W3JA 3KVAA 4UW4A 4ZS3A 5KHHA 4D7SA 1APNA 3ZSMA 2ILMA 1KFXL 3VBFB 2R063 1K12A 3USSA 4FPEA 2E31A 1TEIA 2O0OA 1GSLA 2WAAA 4FOVA 2W08A 4LOTA 4IGPA 4XFAA 2VTXJ 2JDKA 1U12A 2XONA 3M7AA 1RUJ3 4K3UA 3H9AA 4RS5B 3RWKX 4WV8A 1BJQA 2HKXA 2R1DA 4RQPB 3RYKA 1STMA 2PYTA 1LTEA 3RMXA 2B9VA 1HDKA 2BBAA 5EYYA 2HWE1 2YDEA 1BK0A 1V0AA 4AFDA 1G7YA 1GWMA 4I0AA 3OOXA 1OQEA 4OVEA 4XJAA 3JD72 5FP3A 2WFF1 4AI1A 3FHAA 3Q8BA 4AOCA 2ZHKA 1OH4A 3VBHB 1NLRA 2ARAA 1AVBA 3N36A 4UFLA 2XG3A 3V0BA 3DGTA 2VW1A 1SQ4A 1LENA 2VULA 3LIGA 1D4M3 3POIA 4KH9A 3VKNA 2R0FA 1C1LA 4GMP0 1AYM3 3M3EA 5A7NA 3KV5A 1JZ2A 1W6QB 4HETA 4YG6A 4P00B 5FCCA 2WO2A 4YVSA 2UWCA 3ROUA 3R4DB 4P5YA 4HOOA 5KXBA 1HB2A 5FPLA 3H8XA 3MFCA 4JV4A 1AR62 1OFSA 4URTA 1NXD1 5J36A 1POV1 1W05A 5GZFA 1AUYA 1NAEA 4I3GA 5FP9A 3FBYA 1FPN1 3OJBA 1LNSA 3ZN6B 3U10A 1RUD1 3HQXA 3I3EA 4WM7A 5LBEA 4LKFA 5D21A 4FO9A 3ZN5A 3VHRA 2PHLA 3IM0A 4UBHA 4QKFA 1X9PA 3THTA 1CQ9A 4GMP3 2BFUS 2HWB2 1UF2C 1XYNA 5B4XA 3KSCA 4GWIA 4QPIC 3WDWA 5F37A 4BMBA 2VZTA 2AEZA 2GMMA 2ZGNA 1AHSA 2R073 1YFXA 3HBZA 1KQRA 3NV3A 1KRIA 4AEMA 1V6LA 2RHPA 4RR3B 2P3KA 3H3LA 1HRV3 1TMF1 4URAA 2VECA 2ERFA 5BNPA 4LXLA 2BQPA 3RDIA 4QGMA 3IN9A 4YZ4A 3WVJA 5A6XA 4IV1A 1R082 3BN6A 3CLPA 1UIJA 1UXXX 1Z7S1 1J3PA 1SLAA 1UOBA 2EALA 2O8OA 3M3QA 2I74A 5C33A 1NKGA 3HN1A 3OSDA 4BQ1A 1FYUA 5FYTA 1DZTA 1XPWA 3UESA 4LE3A 1JZ6A 5C71A 3BIWE 1UMIA 3ILRA 4NIGA 3ZDSA 1O59A 2OYZA 3JD73 3LCPA 2D5FA 1QOTA 1YJKA 3RZJA 1AXYA 5LY2A 3BPZA 3DXUA 5FMOL 5FIXA 2WNUA 3OB8A 1OBNA 1UOJA 2HWC2 5FXZA 1SDDB 1PIV3 1UY0A 1WD4A 5KC6A 1W6OA 4XETA 1GWKA 1RUH2 4IEQA 3NNGA 3NNLA 2VOXA 3M2MA 3VBUB 4LJHA 3WHTA 4CP0A 2EIBA 2YC0A 3TEXA 5C4WB 1GOFA 1NYWA 2CWMA 3RVHA 2A5ZA 3WW1A 4D3WA 5FP7A 4Z8BA 2AZ5A 1S0FA 2QFEA 4ITCA 3HNBM 4ARXA 1AR63 1HN0A 2ZXQA 4XURA 4AFBA 3Q8FA 1RUI2 3O5SA 5LK5A 3KF5A 4QX1A 1CN1A 3MF6A 3KCYA 4KI5M 2JIGA 1FNZA 3OBAA 1RL3A 2ZMNA 3ORJA 3OPZA 4WM7B 3CJIC 4UW5A 5C9AA 5I93A 4GWNA 4XVHA 5IVVA 2XJVA 3I2GA 2B9UA 2BFUL 1CAVA 1UZWA 1XNDA 1L7LA 1Q8PA 2WNVC 2OX0A 3KGZA 3ZM8A 4OI1A 4UBGA 1VBC2 4NVPA 2CDOA 2P17A 5I8SA 2RS32 4AQTA 3HEIA 1W0NA 4LO8A 3W5MA 1BCXA 2IFWA 1HJFA 3OGSA 1VALA 1DYKA 1NUKA 1R083 2VMEA 4LBOA 4FAGA 5FWJA 1OA2A 2VL4A 4IEOA 4ASMB 3ACIA 5C7GA 2VCAA 5FZ4A 2AGSA 5DUVA 2OQ6A 5T54A 2WZR1 3K51A 4ZZ8A 3AX4A 1PMHX 1R1A2 3SQOA 3WLUA 3N7JA 3J9SA 3CBNA 1XNKA 3MIHA 3RYRA 2ZPXA 5JI7A 1W28A 1CZVA 4CU9A 3PTRB 2MEV2 5LASA 2YBKA 2C9KA 4K21A 5GLWA 2A73B 4LK7A 4YW3A 1LODA 3LPFA 1GP5A 1JHJA 2EXIA 4LITA 4P9WA 5I0UA 3RZZA 5I8TA 3SKJE 5C8CB 5HCHA 3NNMA 2ENRA 3O14A 4D69A 5FQ0A 2F4LA 2WNUB 4LK6A 1GYKA 1WMXA 2UY9A 1E5RA 4Q4Y1 5A33A 1YJLA 1RUH3 5E8AA 2HBTA 2VR4A 2ADEA 1H1IA 4GJYA 3KV9A 4N53C 1WCSA 5K7PA 4FQZA 1PZ9A 2HWD2 2NZ9A 5EFUA 5HXVA 5FREA 5IWFA 4DRRA 1G9AA 1JU4A 1N1VA 3UL2A 1H30A 2AC1A 5F5IA 4A45A 1I6XA 2Z5WA 2H0BA 2W47A 3AP7A 2WQ4A 4LIUA 1XNAA 4AQSA 2VTFA 4MGSA 4DXZA 1H2LA 1ZRCA 1RUI3 2Z69A 3KCXA 1CIWA 4KU8A 4PIXA 3VD9A 4GB31 1WWYA 4E4SA 2FCUA 2CDPA 1OF3A 2WNOA 3DYMA 3LB9A 4XOGA 5F39A 2JDZA 2Q8CA 5A3OA 3IAPA 4YVWA 4QHZA 4CCMA 4Q4V1 1LOGA 4BE3A 5FLIA 5DG1A 1LU1A 5FP8A 3LAGA 4HL0A 4EWAA 5C6CA 1ULFA 5EXOA 3ZYBA 1VBD3 4I02A 2VVFA 4QAWA 4HK9A 3WNNA 5KC5A 4IEPA 2WQZC 3AJYA 2JJ6A 3ZXJA 4N8MA 2Q1ZB 3DYPA 2B4KA 1NG0A 3UGFA 3O1OA 4CDXC 3S5AA 4XJ9A 3W20A 1RMU3 1C1FA 1LCLA 1TG7A 2TEPA 1ULDA 1KDMA 2B7YA 1H2KA 2SLIA 3C7GA 3ECQA 4CP9B 1LOFC 3WNMA 1US2A 1WLCA 1R1A3 2L9LA 2W9XA 4CEYB 2QJVA 3EJKA 5HCFA 4QB1A 5LY1A 1CJPA 4FP2A 1QJEA 1I9RA 4Q2FA 1YRZA 2W94A 4QU1A 3VBRA 2MEV3 1SLTA 3J7MA 3HBKA 4ZHNA 1NA1C 2ZHNA 1HB4A 4Q0PA 4ZZ5A 2QQOA 5BNOA 5FQ0B 2E7AA 2ORXA 4RGAA 5FPAA 3S57A 2TUNA 5EJ3A 2X5IC 5AC91 3CEWA 4MOAA 5A33B 2H6BA 1IG0A 3OGJA 4QU2A 5IK7A 5FYMA 3I49A 1ODNA 4DS0A 3X29B 2HWD3 1N1TA 2JG8C 2ZMLA 4E4HA 1Q8VA 3WNLA 2WABA 3LEMA 3FUOA 4NHYA 5JSOA 2P3YA 1HX6A 1XU2A 4CA9A 3SHRA 4S2HA 1GR3A 1QGLA 3OEAA 4QQHA 5EZWA 3O1MA 2XXZA 4JGZA 3I3DA 1NCQA 4HN1A 4YRDA 5JZGB 4N43C 3RJ2X 1W8TA 2J1RA 1SCSA 2PXJA 1MEC2 1REDA 3ENRA 1O5UA 3OG2A 2PHDA 2P3JA 2R042 2XBO1 4YSFA 2GN7A 4LULA 4ZU4A 1ENXA 5DMYA 2CV6A 1DFQA 2ID4A 1ZRFA 4FQ4A 2RDSA 3VBSC 1PK6A 3RZGA 4XDQA 1W6NA 5FTTC 3VN4A 3ZXLA 2P37A 1F35A 3WNXA 4DQAA 1ACCA 3IZOA 5F32A 1F15A 1OPOA 3WCSA 1H8TC 4YM2A 3PURA 3AVRA 1ENQA 5DXDA 5FXVA 5FO9B 3O1PA 5FYHA 4EZ4A 4Z2WA 5CISA 1OOPB 5C70A 3TN92 3LF7A 2JG9C 5GLTA 4OQ9A 1FI2A 2FDJA 1ZZ8A 1URXA 1UKGA 2Q1MA 1UX7A 1QOSA 1RUF1 2BGPA 1S1AA 4MGQA 4OHVA 3NNJA 4DY5A 1M06G 3NJVA 3GHMA 1BLZA 1LHOA 4H55A 4RHV1 3U4XA 2BWAA 3T0BA 1WKYA 2XMLA 4LQRA 3ZPOA 1O3QA 1TVGA 1HB1A 1JTZX 4ZU5A 4EN9B 2W46A 3QH6A 4RS5C 1WLWA 1V6IA 3ABZA 4MGIE 2YBSA 2WS93 3WF0A 1W04A 1DLCA 1QKQA 2KD7A 1DQ4A 2OS2A 3WNKA 4C90A 3GALA 1UD1A 3M4FA 3UKNA 4WVVA 1ZA4A 4HXCA 4AYUA 3CU7A 1BBT3 2X8KA 1W2UA 4QHOA 5DAWA 5GZDA 5FY7A 3VBHC 2X53S 2KR2A 1ALYA 1Y3TA 4OUSA 3VBOC 3NW4A 3ZVXA 1OKQA 2EAAA 3B69A 3E5QA 3ZMNA 3OF1A 4L97A 4IEXA 1RUE1 2E51A 1VRH2 5CFDA 2XWJB 4AHWA 4Q8LA 2GZWA 4JGZB 4NPMA 4JX0A 1NCQB 1UU5A 4NPRA 4E2SA 1QJX1 2P3IA 1OC1A 3KQ4B 2D3PA 3WD5A 5KXDA 2OUHA 5A3NA 1MEC3 4CCCA 3URFA 1IHMA 1OQ1A 1ZZ7A 3POSA 1G86A 2EAKA 2PMWB 5LCWL 1PX3A 4MHUA 3NSTA 5ERLA 3C7HA 3IKWA 1PVC1 4Q4X2 3O7OA 5BNNB 4GZ9A 4DUWA 1RXFA 1W6NB 3IMMA 4YM3A 4LT5A 4JRAA 4AVBA 1U0AA 3EYPA 1W8NA 1CAXA 2GNTA 1SLLA 4Y20A 5FKCA 3QBQA 3HVDA 5FZEA 3HJRA 4TWTA 3D82A 1YC61 3FLPA 3Q9OA 4QPWA 4YGBA 3J7NA 2Y26A 1CAWB 2J1TA 3GZAA 1OUXA 5E88A 2IFRA 2VC9A 5EWSA 4Y22B 1F5JA 1LKNA 4XTPA 3W5NA 4FPHA 4IE6A 1O8PA 3UK9A 2GAUA 5D8AB 5FPXA 4MG2A 1PO21 1ZNPA 5DUWA 1NLSA 5FZ1A 4RSUA 2X29A 3M3CA 1P8JA 2V72A 3N9PA 3AKTA 2DDUA 4QGNA 2VW0A 3NAPA 3ZFFB 1E5SA 3VDDA 2HWE2 4ZPIA 2SBAA 3L9JT 1QHDA 3RGBA 4UF0A 4TN7A 1H4HA 3LEKA 2WFF2 1QOOA 1WGPA 3VKFC 3T3YA 5FOJB 4OUMA 1WMDA 3EQEA 3OD0A 4NWWA 3HT2A 4AQ6A 4YZ2A 4I2OA 1WUVA 2D43A 5FZKA 3ZXAC 5JOXA 5FJKA 1DQ1A 4QX5A 4QQOA 4W4ZA 3T0DA 3N7KA 3SCGA 5JUVA 1QH6A 4XFFA 4D0QA 3VBUC 4CYDA 1V9U1 1DQ5A 5C4WC 2VMFA 1KS4A 2ZKNA 1YFUA 4X6RB 4HKOA 2E6VA 4A41A 2W95A 2DUPA 4YFZA 1PO11 4LBQB 3VB9A 4GH4C 4PLNA 4Y5SA 2EIGA 1ZZCA 4Q0UA 3B01A 4WZCA 2QVSB 2PLV1 3VD7A 4LA2A 2DFCA 4FAHA 2DVGA 4I09A 3L2HA 2Q1FA 1RUD2 3DKWA 1YQ5A 2VZOA 3JB4C 4Q4X3 4IV3B 2VBDA 5FPUA 1GWLA 4DZGA 3A0KA 4CCOA 1XXNA 3DXTA 2QNKA 4FCAA 4QPGA 2ZZJA 2WN3A 2XH6A 3MZHA 1IQAA 5LWBA 3PVOA 1LOAA 4P9JA 4Y20B 5F7UA 3WXPA 2A6XA 2ZGSA 3AMNA 1AZDA 3WNOA 4BQ4A 2VZRA 2DV9A 2WWUA 4LEJA 1HW5A 1TMF2 3M70A 4A44A 1ASJ3 4WM8A 4ZXEA 1KJRA 1Y9QA 3K46A 1WW4A 2ZMKA 4X8NA 4JQRA 3EMRA 1Z7S2 4AHZA 2AREA 5EIYB 2D93A 2Z4FA 3NJZA 4Y1VA 4NIAA 4MSVA 3U14A 2X09A 4Q0QA 3HWJA 4R9AA 1MVQA 2LM3A 2A6YA 1COV1 2IXIA 5A3UA 1V6JA 1Q56A 5F6LB 1OMIA 3KT7A 1Z78A 4YW2A 3LFIA 4CUCA 1LR5A 3NAPB 5M0TA 2HWE3 2RS51 3VDDB 3OGRA 2Y34A 4UFHA 2WBKA 2W87A 1U5XA 2WFF3 2JDUA 3J8F1 5CU1A 3MPBA 1HN1A 4BHPA 2F6BA 4CDWA 1LAJA 1SEFA 2R32A 1POV0 4AI0A 1MS5A 3WP5A 1D2SA 5A70A 3H1YA 4LBJA 5C8CC 4I3PA 4AWDA 4E2QA 1S0EA 2W1QA 1OT5A 3J7HA 2VMDA 5GM0A 2BZDA 2OUJA 4PLMA 1X9TA 3VLBB 3AKPA 2YFUA 2EA7A 2MPFA 5FPBA 2NP0A 1C5IA 1W2TA 5F1RA 5T5JA 4LLFA 4FOYA 1B35A 1C57A 3T1LA 4QDSA 1POV3 1NLQA 2YUEA 3KWVA 3C8XA 1O91A 1NA1A 1RITA 2GMPA 4IEVA 5LRRA 5BY5A 1RUOA 1FPN3 2ZGKA 4XTMA 5KWRA 2VZ1A 5I8YA 2Z2SB 1O4ZA 5JXGA 3BI3A 1RUD3 2GU9A 3A4UA 5ABJA 1PGW1 3LOIA 1IQDC 4XIKA 2I45A 2B39A 3I2KA 3DF0A 1WW6A 4QPGB 1YQ6A 2LS6A 1H2NA 4BK4A 1BMV1 1O5LA 1H9WA 3H1MA 4DXTA 4NHLA 2JD9A 3PLQA 3A7QA 1JOJA 4Y4RA 4RFRB 5FYVA 1I3HA 3S0MA 2E33A 1I5ZA 1WBFA 5A3TA 4GAZA 2C1FA 2HJIA 3POGA 4NMIA 2WO1A 1NT0A 3ZYHA 2Q5TA 1JU3A 3D3AA 4MGKE 4M00A 1TMF3 2WL1A 5KXEA 4TLGA 4M0HA 4LR4A 1ND2A 3VGIA 4EZHA 4OHYA 1POQA 3SCFA 1O3SA 4JDMA 4LA3A 4HVQA 2ZX1A 2BBVA 1Z7S3 1OPMA 1QJY1 2BERA 1EAH1 3ZOIA 4Q26A 4QHBA 1ND3C 1XU1A 4PF1A 4A6SA 2N7GA 3FBMA 1O3TA 3H1WA 2Y64A 4BQYA 1HQLA 4Z2AA 2WZR2 5BV6A 4A42A 2D97A 4WVZA 4OI0A 2R062 3ZXDA 1CPNA 4NR1A 2OVUA 2ZEWA 4JGYB 4RFT0 5D2AA 2YPJA 5FZDA 4B29A 3PJYA 4META 1K5MC 4LPLA 1AR71 1RUJ2 3THDA 1RUG1 4EQVA 1YI9A 1JW6A 5FY8A 3O12A 2A7AA 3WDTA 5KHIA 4RA0A 5GLVA 2ET7A 1FMD1 1KEXA 3NO8A 3PUQA 4MUVA 2GC3A 2D7FA 1Q8SA 3WP4A 3TEWA 3SCHA 4AVTA 5F5AA 5CKQA 4DIQA 5FPVA 1JHNA 2ZBJA 3JCIA 2JE9A 2VO5A 1G9FA 4AFMA 3MV01 5KHKA 1AJKA 1ULGA 2RJ2A 1Z0HA 2JXAA 1JYVA 3FE5A 3FLRA 4FT8A 3LE0A 1AYM2 2PHTA 2VUDA 3LEIA 2WZPP 2ZHLA 5JZGC 3MW4A 4K6BA 5BUVA 3KD4A 4GB32 2CY6A 2ZGOA 1NCRA 3MICA 1XRUA 3AJZA 3FLTA 3NKGA 1JODA 5GKAC 1FV3A 1Q43A 4Q4V2 3EXUA 2DCTA 2GH8A 5IT6A 2D6LX 4YW1A 4COWA 2QTWB 3WHUA 1WW5A 1J83A 3AMHA 3H50A 3BOPA 3WCRA 1ZBA1 4QB2A 1TNRA 1SLCA 3DPRC 4Q0VA 2VCCA 2VG9A 4EWEA 5FBZA 4BA6A 2HEWF 5FZ9A 2GNDA 5CFCA 4L99A 2ARBA 2CHHA 1ZBE1 4LE4A 3MYXA 1OVPA 3H8UA 2ORZA 3ES1A 4BWOA 2YFZA 4JTNA 2JDHA 1OOPC 3QCWA 1JUHA 3LD8A 4BQ2A 1NX9A 1VMJA 3POJA 2A70A 4BCUA 2XLGA 5A6YA 2BDRA 4XFIA 2DVDA 5FZCA 5L19A 3CMGA 2WZR3 2FDFA 1D2QA 3KQRA 4C8DA 1QXPA 2LTNA 4ZKTB 4W8JA 2VCMA 2XB6C 4MV2A 1OD3A 3WF2A 2AR6A 4P9YA 1EPZA 1LOBA 1U5IA 2XDVA 3POYA 1GP4A 3D6EA 4LMFA 2FBEA 4LUMA 4JKMA 4AEDA 2WYSA 2YMZA 3THCA 4K7JA 3MIBA 4IXLA 4LO6B 4PI2A 2DTWA 4Q0SA 2XJTA 1DGWX 5GALA 4K8RB 4YYOA 4ES8A 2YU1A 4XAAA 3ZSJA 2BUKA 5AC92 4Q4Y3 3O0VA 5FO7B 1MS1A 1LOCA 1AJOA 5JIAA 5BXXA 2AUYA 4FXGB 3TEYA 1MZ5A 3G6JB 5K0UA 2XLAA 4PQ9A 4IGQA 4CU7A 3ZPYA 1R091 3ZIXA 1PIV2 2DFBA 4FFGA 2XPJA 4QKNA 4PDWA 3RMYA 3MV11 1ULEA 1SHWB 3CO2A 1G8WA 4CPBA 3IWZA 1CONA 3AC0A 4GB33 5FXWA 1NCRB 4KU7A 4CEWB 3K4AA 1DQ2A 3NV4A 4JZRA 5DAPA 1LEDA 2XBO2 1O4TA 3LIHA 2YGLA 1BK1A 2XGXA 3ACHA 2DVAA 1WA4A 2OT7A 3IDCB 4OULA 4Q4V3 5FYZA 3MLJA 2W52A 1QF3A 1JOBA 3AMQA 4D8MA 1BKZA 3QLQA 1XSQA 3F95A 5BNNC 2PHRA 4QDRA 1SMVA 3HOBA 5T50A 4CDQA 1IS5A 2HWF1 1W9TA 1VBE2 4M3CA 1YLLA 2D6KA 3TNQA 5CADA 1VAMA 3E6CC 3IB3A 2Y6LA 3LSEA 4XBNA 5IVJA 2XHKA 3AP6A 1J3QA 4N7UA 1QQP1 4GH4A 3SH4A 2VZSA 3NRUA 4NUBA 2GSYA 2K9ZA 4PI0A 5A1AA 3AZVA 4GALA 4COZA 3S5QA 4M01A 5ACA1 2QQLA 2YHJA 2WKKA 3DEMA 2VY0A 1RXGA 1UYPA 4NWVA 4RHV2 3U0ZA 3WDXA 3BB6A 5DAQA 3GGLA 4YPJA 5D8AC 5AVPA 5CAZA 3HIFA 5CZKA 3GBFA 4M3CE 4KBBA 4A7KA 1GQPA 1RJ7A 4XFGA 5FZFA 3KMHA 4Q4W1 5KXCA 3DECA 3ZFFC 4X6QB 4EV0A 4JQTA 4V2WA 1ZZ9A 5GLZA 4S2FA 5AC93 1QJU1 1FX5A 3MHZA 4Y1XA 4C1WA 3GBGA 4XFHA 1UIKA 2K0GA 2P5BA 4IQPA 4BPZA 1D0HA 4PHZA 3NQHA 5FZAA 3AXEA 3V0BB 2YROA 5F3CA 5IATA 4QX2A 1DGLA 1VBB1 4YW5A 4UW6A 1CAUA 3T2TA 3BTZA 4DINB 3GCXA 1H4GA 2Q8DA 3MO4A 1RVF1 1VMFA 4PDWB 3INAA 4N7IA 4MXWA 1RHI1 3MF9A 3A22A 4YVSB 2Y6KA 3AZYA 2UU8A 1QDCA 1J3RA 3B9IA 4XUTA 2DUOA 2QQVA 2XBO3 4GIQA 1GQHA 2ZGLA 4Q1RA 3CDZB 1SBEA 4XF9A 4IV3C 4FSJA 3RZLA 2RVAA 3RSJA 4IDZA 1TZOA 4LTAA 3S6PA 2XUMA 4AI9A 4JHTA 3PHMA 1JYNA 4XMIA 3M1HA 4Y1ZA 1VBE3 2XLFA 4XFBA 3ZFEA 3TAYA 4KQ7A 4EROA 4FP3A 4FVVA 3JQXA 5A3PA 4FTEA 2JEMA 4O65A 1VBD2 3W59A 2ATFA 1UZVA 2VUAA 4CDUA 2WFPA 3VD3A 4E4DX 1RUF3 2R7EB 4XQDA 5BNPB 1UY1A 5CYYA 5JMOA 3WT3A 3FFQA 2B5HA 2XHNA 2BVBA 2C0ZA 4IV1B 1ZX5A 4AVVA 3SH3A 3BTXA 3H7YA 4G9SB 3HNYM 3N9NA 1L7RA 4RHV3 1NE6A 1PO22 4O61A 1A8MA 1H6YA 4OHXA 4JAAA 1RMU2 1GOGA 2LALA 3ON7A 1W8HA 5EQUA 3O1TA 3LSDA 2D5HA 4QQLA 1CZTA 3KF3A 1VAVA 2DU1A 5CA6A 3GBWA 4N9HA 2OZJA 3IDAA 2OQ7A 1I1EA 1W2AX 5B2GB 3AFKA 3ST7A 5IFPA 1TQ5A 4MLOA 3H8OA 4QKBA 2Y8KA 3BYWA 3GF6A 3T4VA 2BNMA 2XVKA 4Q1PA 4P9XA 4Y5TA 3KCCA 2CL2A 3JZVA 4ONUA 1FOD1 2C6SA 3KHCA 1UOGA 2J1SA 4XZUG 2YZ4A 1XOYA 2NM1A 3C2UA 4GKXA 1Y9MA 1ND3A 1ULCA 2RDRA 2RJKA 4G4FA 5LBCA 2B42B 1W6OB 3AYAA 1J84A 1RUE3 4LBQD 1GUIA 3AB0A 1K5JA 1OI6A 2QQIA 4EN6B 1XSRA 1UWWA 1JYXA 1QJX3 4BQXA 1NOVA 4LKDA 1JYTA 3KV6A 2VQAA 2FHRA 3N9MA 1MQTA 2BOIA 4PQQA 4TSVA 3WQBA 3ZFGA 2RM21 4JC1A 3ZIWA 2WSVA 3HQUA 5CBLA 1W06A 2UWBA 2PLV2 1UXZA 1VAKA 3PU8A 3CZUA 2QQKA 1HLCA 1PVC3 1BYHA 1S0JA 2VNOA 4A7ZA 4MGZE 2BGOA 4YZ5A 1N3PA 5C9AB 2R0HA 1JN2P 1QU0A 1UQXA 4BDVB 5C5UA 3I59A 4KG0A 4Y33A 1CAVB 3V65A 3FJSA 4UT5A 2BV4A 3GM8A 1CD3G 4KNCA 1OVSA 5EV7A 1MS3A 1KFUL 2OPWA 2ZX0A 4OHZA 4CU6A 3RZHA 1HV1A 1NXMA 3E97A 2GDFA 1BXHA 2IXCA 2GC2A 4J1XA 4FFIA 1C5HA 1FNYA 4R9BA 4XZPA 5E6HA 5GZEA 3WW4A 4CDUB 1W6PA 4W65A 1S0BA 5L7OC 1CGPA 2GP3A 4LBLA 2RE9A 4RGGA 5A6QA 1S2BA 3AYCA 4LHKA 1PM4A 1PO23 4HMZA 3KVBA 4AGRA 2WIIB 3ZLIA 2VPVA 1NZIA 4HT1T 3K3NA 1FXZA 3HNMA 2XQRA 3LA2A 5AVAA 3ATGA 3WV6A 4GXLA 3N35A 3T08A 2ZAHA 1EUTA 3GZUC 3NWKA 1V6NA 2NQYA 3FFZA 4JGYC 2EICA 4LUKA 2F4PA 4IW3A 1VBA1 4SBVA 4BZ4A 4FPFA 4ARYA 1NY71 3RI9A 1BZWA 1OQDA 4RL7A 1YQCA 2WS92 2H6CA 3B3QE 4LO4B 4TXWA 3SMHA 5F2SA 4A4AA 5IUQA 3ACFA 2ARCA 5K8SA 3AKRA 3ITQA 5F9TA 3MBWA 2VZ3A 4AEJA 2HEYF 5A32A 2VTXA 4DXRA 1BBT2 4AF9A 5DABA 3SEEA 2K46A 1W8ZA 1S0GA 1YI7A 2JENA 2OXBA 3FC0A 3K3OA 3TRSB 3VZJA 2XQXA 1YYNA 3NV2A 5JPNB 3JU9A 1PO13 1MQTB 1OD5A 2JE8A 4NIDA 4FPLA 4NIHA 2WT1A 1VLNA 1YCIA 2PLV3 3G7DA 2VH9A 3RZMA 3M3IA 4IL7A 4XABA 4WVWA 1PGW2 3OGVA 4QM8A 2FCVA 2ET1A 4HSLA 4AW7A 1SBDA 4M4PA 1HJGA 3I59B 1TNFA 3KT4A 4YVWB 2ETEA 4R52A 1BMV2 3LWCA 2J1UA 1ONAA 5IW0A 1N1YA 5T55A 5EJZB 1HKDA 2ZX4A 5AFBA 4FTBA 1RGSA 3ACLA 1O7FA 3H3ZA 3MUY1 1LRHA 1CWPA 2FCTA 3RI8A 1W6PB 1GZ9A 1UY3A 3SH5A 3PUSA 3LA3A 4YG0A 1TE1B 4AQ2A 1QWRA 4ZXKA 2CGOA 2WC2A 2YV8A 3WEZA 1EAH2 3DV8A 4A3ZA 1W6MA 4CCKA 3BUCA 5JXHA 4LORA 2VMGA 5BPXA 1COV3 3PUAA 1EYBA 3JUUA 4BIOA 1RUC1 4KMQA 5FZIA 1MS4A 4P9LA 3KT1A 4O9GA 2YC4A 3VBFC 4L9BA 1DF0A 2RS53 2WA3A 2YYOA 3GYDA 1YFYA 3J8F3 1Y4WA 1IPJA 4GWMA 3VBRB 2HWB1 1LHUA 4QPIA 3OGGA 2OW4A 4GA9A 4M3CF 4RQPC 1AXZA 1QNWA 1ZRRA 5A3WA 2HBUA 1YXWA 1FMD2 1WLTA 5J7MA 4BQWA 4BXFA 1A34A 5BNOB 2B46X 3VZNA 4QWNA 5FY4A 4XMAA 2W68A 1XE0A 5G04L 4D6SA 4L0PA 5A32B 3O1VA 2Z79A 4A3XA 4PCRA 5FUNA 3ZXEA 2H0VA 5HI0A 1EV11 2VMCA 4AI2A 4R4ZA 1N3QA 3LZZA 4LHLA 4OCTA 1H8VA 3PL0A 3VDAA 3NV1A 2IZWA 2NPIA 1O6UA 3JBG1 4CZSA 3LQCA 2DCZA 4IEWA 5J09A 4AHXA 5JIUA 1PGSA 2PHWA 4MZUA 2UYAA 2ZX3A 2PAMA 4JDNA 4DUXA 1TME2 3PVBB 2HH9A 2WZEA 4CEWC 1H0BA 1XBFA 2DCKA 1F2NA 4UXAA 1W2OA 2G9GA 4BH9A 2WQ8A 4ISQA 3RFRA 1D7PM 3I2FA 1G6NA 2PHXA 1ZBA2 1PK6B 2HWC1 4XYXA 4H7LA 2VOVA 4A7YA 4EN0A 5F5CA 2RMU2 1UAIA 3QACA 2JECA 4AAPA 1SG3A 3FWEA 4XUQA 3B02A 3J7LA 5EYXA 4FI9A 5HV4A 3OUIA 2ARXA 1ZBE2 1UN1A 3AP9A 3ZXKA 3SISA 1KXGA 2DWRA 2D6MA 5FKBA 3LDBA 5FFOC 1QJY3 1S0CA 2YGMA 5DPNA 1EAH3 3SXWA 1XB9A 2D3SA 5C3SA 2CAVA 5EPAA 4DO0A 3PUHA 1SFNA 2RV9A 2GC0A 1ASJ2 2DBIA 4RR3C 2XL7A 1ZYBA 5DZGA 2VOKA 3MEPA 2VOWA 4FFHA 4EJRA 4IERA 5IAXA 3ILNA 1Y7BA 4JRLA 1UO9A 1JZ7A 4QXCA 3BKZA 4JDOA 2DVBA 5LA2A 3VZLA 3AMPA 2VBPA 3CJIA 4QKDA 2DYCA 3DKQA 1XC6A 3RRDA 2R49A 4MADA 1X82A 1AR73 4UFMA 3ZYGA 3O1SA 1RUG3 4AVCA 2WNVA 3HAGA 3HQRA 4LKSA 4YM1A 2D44A 5T5LA 1OXCA 1C8NA 5J37A 1AYN1 1VBC1 4GQ7A 4L2NA 1FMD3 1MVEA 1Q3EA 3HPNA 2RS31 1GFF2 4U2AA 1EP0A 2P1BA 4LNVA 1R1ZA 1YUDA 4JCKA 4NIIA 5LRSA 1OSGA 5FZ3A 1J58A 3IBMA 5A6ZA 2ZEXA 3U1XA 3GNEA 1R092 2WLPA 3MIDA 4V1PA 4F83A 5D1IA 3VL9A 3IT8A 3I54A 1X8MA 2BPA2 2FZ2A 3LOBA 1WCUA 4LO7A 5CFDB 3B00A 5E89A 3ZSEA 2KXLA 1GZTA 3ALQA 3KHBA 1YNAA 3KV4A 4FPYA 3ZDVA 1QMJA 4YVSC 5FZ8A 2CU5A 2I2SA 1TME3 3T30A 3H3UA 1WA6X 2D40A 1SFPA 3AYEA 3OBTA 5IK8A 1FPN2 2DF7A 4BMEA 1A3KA 1QEXA 2J1VA 2BGCA 4XC9A 2MNGA 2TNFA 3B93A 3VDCA 4WM7C 1YIPA 1ZBA3 4ATEA 4ASKA 4UWDA 4B1LA 1BEV1 2RMU3 4QDQA 2HWF2 4N53A 3POWA 3D4KA 3AL5A 1CAXB 3PUIA 1UZYA 1ZBE3 4HKWA 3K48A 3U11A 1C4RA 1JZ8A 4HZFA 4HVRA 4PBOA 3AFGA 3I2OA 4E8DA 1QQP2 2XKPA 2PFWA 2P4EA 1DCSA 2C9AA 2QBXA 3O1RA 3OPTA 3U4SA 1JZ3A 4P9IA 5DDJ1 2VOTA 5BNPC 2NN8A 3UV9A 4QT6A 3P6BA 5A80A 3CJIB 5FLHA 4CUAA 2R6QA 4MGYE 1KS5A 3CJXA 4PLOA 4AFAA 2FQPA 1NQDA 5C3OA 4Q4W2 1GKBA 1KD7A 1WBLA 1D4VB 1C8M1 3PVNA 4DEVA 1B09A 4B4QA 5JMCA 3B5LB 2FDGA 1R64A 1QJU2 4UF0B 4OYUA 3T0AA 1H9PA 2YU2A 5LZ6A 3VKOA 1PMIA 1WCQA 4CDXA 4AZZA 4IE4A 3MI8A 3R6SA 2WA4A 2YC2A 3ZYJB 1R093 2WNUC 3POFA 4D6RA 3IPVA 1D0GA 5LBBA 3RYPA 1QXJA 1J1TA 5H9SA 1LOFA 3THPA 1O3RA 1OKOA 1CESA 2GN3A 3PJQA 4ES9A 3E6BA 1RHI2 2HYKA 3J4UH 3I4IA 2WNEA 1LHWA 4MYEA 5BNQA 3T4HB 3WSOA 1L7QA 2G9FA 1QY4A 2QQWA 1HV0A 1IPSA 1HQNA 2D6PA 1QH7A 2JD4A
chains in the Genus database with same CATH topology
3KS7A 4XILA 3D0SA 1J59A 2WJSA 4K9SA 3OBRA 3BTAA 4L92A 2X5IA 5C9AC 4INDA 2HWF3 2ZTNA 3N4MA 3VKLA 3M3OA 2EXJA 2JG8A 2UYBA 1YWKA 4F7ZA 2ZABA 3OTFA 1GANA 1OA3A 1QQP3 3WUCA 1DGRN 4CP2A 3JQWA 4WM8B 1MR5A 5ACA3 3WDYA 4N43A 3VZOA 1CR7A 2W39A 3EO6A 2XL9A 4N90A 3MPPG 3D5OA 1AR91 2E63A 3PNAA 4HLTA 3RS6A 4YARA 2R041 2PELA 2WWSA 3ZYIB 4Q4W3 4QPYA 3OCPA 4R9CA 4XIOA 3H7JA 4XPVA 3VBSA 5I0TA 1QJU3 1HXS1 5FRAA 1H8TA 2ES3A 3WOGA 3VHPA 2ZZQA 1CVNA 4CDWB 5DUXA 2XJSA 1DBNA 3MLLA 2JG9A 4PF5A 3TN91 1VBB3 5CB7A 3IPVB 4Q4Y2 4D7TA 1V70A 1RVF3 2HEVF 4P14A 1RHI3 1YIFA 4DPNA 2BNOA 2EXHA 4DMIA 4AI8A 1V6OA 4AEKA 4RS5A 4LBNA 1B35B 4FPKA 4X8PA 4HVOA 2A3YA 1NA1B 2QQPA 3ELNA 1IZ3A 2K2SA 1WW7A 1GNZA 2YY1A 4K8FA 1S0DA 2D6OX 5ABJB 4QGLA 5HCBA 2C5DA 4J6GA 5I0RA 1VB2A 4YZ1A 1AXKA 4FPGA 4YVWC 3VBHA 1V00A 2XJUA 3QD6A 2IXKA 2JG8B 4B4RA 3VBOA 1ZZBA 4PJYA 5I91A 3PVEA 1QDOA 2RJLA 5FDBA 1VRH1 1ND2B 1W6QA 1X8EA 4WVMA 2XJQA 3ILFA 4CRQA 4N43B 1JUIA 4F3JA 2BW8A 1XE8A 3AKQA 1GV9A 1S55A 4COVA 1GQGA 1EY2A 2ZGRA 1IGOA 3N7LA 3N7MA 4L11A 2KM2A 4Q4X1 1Y43B 3E6DA 1VBA2 4BYYA 1VP6A 4DNYA 1DZRA 4R9DA 5GLUA 2DTYA 1NY72 4XXPA 1ENSA 3VBRC 4BOWA 3AYDA 1H8TB 4C0BA 4XHXA 1AX2A 4MXVA 1LESA 5BNOC 5GJ6A 2PHUA 5FAXA 3V0AA 4XXAA 2GMEA 1AL0G 3E5UA 1RUNA 4GULA 4KWLA 1L3JA 2E53A 2EVXA 1C28A 5FPZA 2RM23 2A6ZA 4Q29A 1GICA 1XNCA 3HR9A 1WMEA 1SFYA 4JGZC 1NCQC 3T1MA 1DLLA 4I0WB 4Y1YA 3W9AA 1LHVA 1A6CA 2FMYA 4LLOA 1LOEA 1QNYA 5F6KA 2GC1A 5FMOS 2NMOA 3VBOB 1H2MA 1PK6C 2ZOEB 3VBUA 4Y4YA 3DN7A 3P3NA 1GZCA 5C4WA 2DCYA 4B4PA 5CFCB 1X7NA 4IEYA 4WVMB 2DU0A 1LHNA 5T3NA 1W0OA 1IOAA 2ZS6B 4PIYA 4J1WA 1RUF2 4I30A 1RUC2 2VVEA 3C3VA 5T5PA 2V73A 1MS8A 4MX3A 1ZREA 1VBA3 4OZXA 3I8TA 3WR0A 5SV8A 3FMGA 2BWCA 4AXOA 2IXLA 1WMFA 3L2YA 1UW8A 2GH2A 2YXSA 4AEDB 2ZCWA 4E4ZA 3UKTA 3H0OA 3V64A 5JVVA 1UL9A 2R30A 3I2DA 4FXKB 4XF1A 3V0AB 1DZQA 1LU2A 1IPKA 3IDBB 4H7MA 4KWJA 1EV12 1SBFA 4DFSA 5K0UB 1UPIA 3APBA 4DRVA 1DU3D 3R4UA 1HQWA 2ZAAA 3JBG2 1RUE2 1Q5OA 4WBBA 3USUA 1MZ6A 4Q8KA 5CFDC 1QJX2 3BOWA 3FZ3A 1OHFA 4QXKA 3WP6A 3B9CA 5JDBA 3MIFA 5CNAA 1KITA 1AL21 3NKTA 4A2UA 2ZGUA 5JSPA 1ZM1A 4XFCA 5C8CA 1PVC2 5JLVA 2ZGMA 5JWPA 1G9DA 1HRI1 1WD3A 2QDNA 4FPCA 4CDQB 3AZZA 4F8AA 4M3CB 4PBPA 4DOUA 4OI2A 4AVSA 3ES4A 1ZZ6A 2ZGPA 2RR11 1JYCA 4QQ2A 3IMNA 4GH4B 2Y0OA 4AHYA 3WW3A 4FOQA 1PM7A 1YHFA 1RTVA 4Z92B 4D94A 1RUC3 3ZO0B 4Y26A 1DG6A 1MZEA 3OY8A 1CJDA 2UURA 5J98B 4K20A 2HWB3 2XVLA 1RB8G 2BVVA 4HFSA 1LEMA 4Y5Z0 1A8DA 2RS11 4W6XA 1DQ6A 1AYN2 1BQPA 1RJ8A 3NAPC 5T52A 2FMDA 1W0PA 5DG2A 3VDDC 5CAZA 4KGQA 1NE4A 1AR81 1REEA 1VJ2A 5TSWA 1QXRA 4B3NA 1UX6A 3AP4A 2XWBB 3PMEA 1EV13 2BYVE 4HK8A 3VZKA 4BIFA 1N47A 4HPKA 4XF0A 3IIAA 2XKOA 1CAUB 3KB5A 3JBG3 4LHNA 5JIUA 1U5ZA 1V9U2 3USUB 2XJRA 2PA7A 5JOZA 3TB0A 4MXWB 4CEYA 2R061 1RC6A 3EBRA 1K5MA 1OLRA 1PO12 4XHBA 3IDEA 4M0NA 1RUJ1 2VNRA 3WQ7A 2DCJA 4P9GA 2PAEA 3AXDA 2HWC3 1IS4A 2CYFA 1BEV2 4GKYA 3WX5A 1OA4A 4QPGC 1DIWA 3M8LA 3NVCA 3WG3A 2Z42A 4YG3A 3ZFEB 4PIZA 4G3YC 1N1SA 4XJZA 4YGCA 4XJUA 1PGL1 1D4M1 1W39A 1F8VA 1VB4A 5DDJ2 3WDVA 4WM8C 1AYM1 4P5HA 5JZGA 3RNSA 4I01A 2LUWA 2CNAA 3OY8B 2O8QA 2VNGA 4N9IA 2QZ2A 5H9RA 4FBFA 4S2DA 1COV2 2E7TA 2QZ3A 1C8M2 1YFWA 4HSJA 1DHKB 4TLFA 2RS52 1AYN3 1SLBA 1VBC3 3DPRA 2RS33 2ZHMA 4AVAA 2FZ1A 2OPKA 2WSUA 3J8F2 4GMP1 4JVAA 2PAKA 3WW2A 1OLQA 3S30A 4AG4A 4CDWC 1FAYA 1OOPA 2R071 2OA2A 4XW3A 4XQ4A 4L8QA 2G4IA 3WUDA 4HBNA 1ND3B 3TBDA 4HPKB 3WP3A 5HCAA 2QDRA 1HRV1 2CAUA 3BU7A 4XBLA 3FUQA 3VHOA 1V9U3 2NLRA 3UKVA 3VZMA 2QE3A 4ZU7A 5J96B 1VIWB 4XQWA 1K5MB 2AH2A 1CPMA 3VKMA 1B35C 3ZFGB 2B8MA 3HMYA 4K1ZA 4EN7B 2I07B 4AE2A 3QOPA 2PQQA 4E9KA 1V6KA 5ABJC 2IWGB 3JD71 1BEV3 2CWSA 1O4YA 2DURA 4IEZA 3KLSA 1AF9A 1GZWA 3WG2A 3R0RA 1XYPA 1PIV1 4TZDA 2PN5A 4EN8B 1M4WA 3SITA 1N3OA 5DDJ3 2BEOA 5KHGA 1ND2C 4CP1A 4ASLA 4R8HA 4OLLA 2VUJA 1QJY2 1DGWA 4Y1UA 4NHMA 4AFCA 3B94A 5KBFA 1AR92 4XF4A 5LEKA 1AR61 1NZCA 4XEZA 1HIXA 4ORFA 3UJQA 2B45X 4Y24A 1MACA 1C8M3 5BNNA 3NL1A 4BM8A 1JBCA 1JXNA 5A3MA 3DPRB 4B8EA 1AR72 1HXS2 5LK7B 3PMSA 1RUG2 3ASIA 1VBE1 3WG4A 1E57A 4FPOB 5E16A 3RG0A 3GHNA 3AZXA 4FPJA 2WT0A 4D7YA 1CAWA 1DYPA 5L73A 3AM2A 2MHFA 4Y22A 3WZ1A 5CG8A 3LA7A 1RINA 1R081 4HKLA 5D8AA 2ZX2A 3PTYA 2KA3A 2P34A 3HD8B 3MDPA 3P3PA 1X33A 2JX9A 3EHKA 2UWAA 4SLIA 1F9KA 1UZZA 3ZFFA 3R4SA 4WZFA 3WQ1A 4FTSA 3D8CA 5H9PA 2R1BA 1NCRC 4Z07A 4XF3A 1PHMA 4NHKA 3I7DA 3KM5A 3O0WA 1V6MA 4KL1A 4COUA 3TWIA 2NMNA 1GZWB 1XNBA 2V5YA 4EWDA 2Q8OA 3ZXGA 5JOWA 1RUH1 1OFNA 1MZFA 5CFCC 2A6VA 5JOYA 2WLQA 2AYHA 3VUOA 4LBQA 1W6MB 5FLJA 5J3UA 1AR93 2EXKA 3LKJA 5GZGA 2R043 4S2GA 4OFGA 1RUI1 3R05A 2ZJCA 4YNIA 3DUIA 3FHIB 5DUUA 5JCTA 4IV3A 4C1XA 2VVDA 1FT9A 3KGLA 4IEUA 1NQJA 1CX4A 2CTVA 3WQ0A 1PNGA 1HXS3 2QKDA 4ATFA 4C0HA 4QPIB 4AEDC 2GNMA 5T5OA 4FOWA 1BVP1 1LJ7A 1T6GC 3B7MA 3TN93 1VBD1 2Y0IA 4KG8A 2VW2A 2XJPA 4YFWA 2IXJA 4Z1VA 4ISRA 4RD7A 2A3WA 1MS0A 1MS9A 4YGDA 1FATA 5K0UC 3KZ4C 1EPWA 5L36A 2CGNA 4C91A 5JI9A 2D98A 2VMIA 1RMU1 1WCDJ 2WINB 4LBMA 1F31A 4PDWC 4CTEA 1XE7A 2JICA 2DUQA 1R1A1 2A75A 2D3RA 2UY8A 4HN0A 2VU9A 2ZKLA 3OYWA 2MEV1 2IXHA 3MLKA 3AP5A 1C3HA 1DGRA 1SDWA 3SLIA 3ZSLA 5FO8B 2XVGA 4JTOA 2P2KA 1LB2A 1REFA 3AMMA 5C8WA 1A78A 1LGNA 1VRH3 4K40A 4CDQC 5DZEA 4I0BA 1UU6A 2HWD1 1QJZA 3S7EA 2VGDA 3FX3A 1AX0A 1LGBA 2ZACA 2A71A 1FV2A 3WY6A 1KDKA 3MIEA 3CL1A 5H9QA 1GNHA 5ACA2 1XYOA 4H3WA 2QCSB 4IV1C 1F5FA 1UCXA 3QH7A 3ZMOA 3HT1A 4IETA 1DDLA 3SNMA 1LULA 4B7EA 1J1LA 4OHWA 1H1AA 2WNVB 1SACA 2W0XA 2ZA9A 4NN0A 2GALA 4DY3A 1JYIA 3W58A 1S2KA 1PVXA 3AKSA 1JH5A 3BALA 2EF6A 5F5QA 3CF6E 1AX1A 1UU4A 4XE9A 1ENRA 2ZGQA 5L7OA 5E1RA 1H1MA 2JE7A 1X36A 5HBAA 2Q30A 3OD4A 4O9EA 2D6NA 3VV1A 1IKPA 1VBB2 4QM9A 2NYYA 2V09A 5IK4A 1RVF2 4UW3A 1ZVFA 3ZXFA 1X50A 2Q0AA 3MGUA 4JGYA 2WT2A 5J48A 2O1QA 3MIGA 4YM0A 4KWKA 3VL8A 3OYWB 4QMAA 1AL22 5JAXA 1UMZA 2WS91 1KJLA 5KHJA 5IK5A 2PTMA 3RQ0A 3D0JA 4E2GA 4NOTA 4H14A 1HRI2 4AGVA 1PZ8A 3TOJA 4W6WA 5AFEA 1BBT1 1XQNA 4N53B 4BLIA 2RR12 3ZFEC 3ME2A 5DZFA 1UKRA 5K9YA 3BCWA 1PZ7A 1U5YA 4CDUC 1IS3A 2ZGTA 4YW4A 3WG1A 2E7QA 4OI4A 3ZSKA 3V56A 2TBVA 4Q27A 1MEC1 4XJ8A 1Q8QA 2OZ6A 2R16A 1SCRA 3GZTB 5JPMB 5I0SA 2RS12 4AGGA 1LGCA 3TNPB 5BYNA 1AR82 4XJWA 2Q4SA 3LGRA 2E9QA 3RPQA 2A6WA 3ZYPA 2CGPA 5JSRA 1FOD2 1S0IA 3UJOA 5L7OB 1ZRDA 3RWNA 4CDXB 4HANA 3AK0A 3A0NA 3AZWA 2GNBA 3MFAA 1LECA 2AENA 2VMHA 4YGEA 1Q8OA 4K1YA 3CNAA 3VBFA 1SLIA 1GBGA 2BNNA 4R4XA 4YLZA 2A3XA 2QUOA 5GZCA 1IKQA 3U07A 4B7KA 2IC1A 5A3LA 3N3HA 2RM22 1MQTC 3ZFGC 4RQPA 1AL23 4AI3A 4IESA 4LBKA 2Y38A 2VXRA 1PNFA 5CIRA 1BVVA 4BLJA 1HRI3 2X5IB 2OIIA 1G9CA 1VR3A 5CG9A 3VHNA 2VQ0A 4MVTA 5LEJA 3MW2A 3S7IA 2RR13 1IS6A 1UPSA 3ZN4A 1DQ0A 3E5XA 2DVFA 1PGL2 1D4M2 5JR7B 4W6YA 2PHFA 3BODA 4Z82A 1WLDA 4XBQA 1GLHA 4CEWA 1TME1 3ZYRA 1G9BA 4YZ3A 4E27A 3ZN6A 2RS13 1RIRA 1YO8A 5CVRA 2JKBA 3VBSB 3WINE 4LO5B 1AR83 2BTVC 3RJRA 2RMU1 3J26N 4QD2A 4COYA 5FOBB 3ZX7A 3O0XA 4KGGA 4MH0E 1FOD3 4NO4A 1WCKA 3WDUA 4DB5A 3TYJA 2R072 3DL3A 3MW3A 2JG9B 4U36A 4AK3A 4RR3A 3ETQA 3JB8A 4QQPA 1HRV2 4TYSA 1ASJ1 4UW4A 5KHHA 4D7SA 1APNA 3ZSMA 2ILMA 1KFXL 3VBFB 2R063 3USSA 4FPEA 4FOVA 1TEIA 2O0OA 1GSLA 2W08A 4XFAA 1U12A 3M7AA 2FZ2A 1RUJ3 4K3UA 3H9AA 4RS5B 4WV8A 1BJQA 2HKXA 2R1DA 4RQPB 3RYKA 2PYTA 1LTEA 3RMXA 1HDKA 5EYYA 2HWE1 2YDEA 4AFDA 1G7YA 4OVEA 4I0AA 4XJAA 1OQEA 3JD72 2WFF1 4AI1A 2ZHKA 3VBHB 1NLRA 3V0BA 1AVBA 3N36A 2XG3A 3DGTA 2VW1A 1SQ4A 1LENA 2VULA 1D4M3 4KH9A 3VKNA 2R0FA 1C1LA 4GMP0 1AYM3 3M3EA 1W6QB 4HETA 4YG6A 5FCCA 3ROUA 4YVSA 2UWCA 3R4DB 5KXBA 3MFCA 4JV4A 1AR62 1OFSA 4URTA 1NXD1 5J36A 1POV1 5GZFA 1AUYA 4I3GA 3FBYA 1FPN1 3OJBA 3ZN6B 3U10A 1RUD1 3HQXA 4WM7A 4FO9A 3ZN5A 3VHRA 2PHLA 3IM0A 4UBHA 3THTA 1CQ9A 4GMP3 2BFUS 2HWB2 1UF2C 1XYNA 3KSCA 4QPIC 3WDWA 4BMBA 2ZGNA 2GMMA 1AHSA 2R073 1YFXA 3HBZA 1KQRA 3NV3A 1KRIA 4AEMA 2RHPA 1V6LA 4RR3B 2P3KA 1HRV3 1TMF1 2VECA 2ERFA 5BNPA 2BQPA 3RDIA 4QGMA 3IN9A 4YZ4A 3WVJA 4IV1A 1R082 3CLPA 1UIJA 1Z7S1 1J3PA 1SLAA 2EALA 3M3QA 2O8OA 2I74A 5C33A 3HN1A 4BQ1A 1FYUA 1DZTA 4LE3A 3BIWE 3ILRA 3ZDSA 2OYZA 3JD73 3LCPA 2D5FA 1QOTA 1YJKA 1AXYA 3BPZA 5FMOL 2WNUA 2HWC2 1PIV3 1WD4A 5KC6A 1W6OA 4XETA 1RUH2 4IEQA 2VOXA 3M2MA 3VBUB 3WHTA 4CP0A 5C4WB 2YC0A 1NYWA 2CWMA 2A5ZA 3WW1A 4D3WA 4Z8BA 2AZ5A 1S0FA 2QFEA 4ITCA 1AR63 4AFBA 1RUI2 3O5SA 5LK5A 1CN1A 3MF6A 3KCYA 1FNZA 1RL3A 2ZMNA 4WM7B 3OPZA 3CJIC 4UW5A 5C9AA 5I93A 4GWNA 2XJVA 2B9UA 2BFUL 1CAVA 1XNDA 1Q8PA 2WNVC 3KGZA 4OI1A 4UBGA 1VBC2 4NVPA 2P17A 5I8SA 2RS32 4AQTA 4LO8A 1BCXA 2IFWA 1VALA 1DYKA 1R083 4LBOA 4FAGA 1OA2A 4IEOA 4ASMB 2AGSA 5DUVA 5T54A 2WZR1 3K51A 3AX4A 1R1A2 3WLUA 3N7JA 3J9SA 1XNKA 3MIHA 3RYRA 2ZPXA 5JI7A 2MEV2 4K21A 5GLWA 2A73B 4YW3A 1LODA 4P9WA 3RZZA 2EXIA 5I0UA 5I8TA 5C8CB 5FQ0A 2ENRA 3O14A 4D69A 2WNUB 1GYKA 2UY9A 4Q4Y1 5A33A 1YJLA 1RUH3 5E8AA 1H1IA 5K7PA 4N53C 1WCSA 5KHKA 4FQZA 1PZ9A 2HWD2 2NZ9A 5EFUA 5HXVA 5FREA 4DRRA 1G9AA 1N1VA 3UL2A 1H30A 1I6XA 2Z5WA 2H0BA 3AP7A 2WQ4A 4AQSA 4DXZA 1H2LA 1ZRCA 1RUI3 2Z69A 3KCXA 1CIWA 4KU8A 4PIXA 4GB31 4E4SA 3LB9A 4XOGA 2JDZA 4YVWA 4Q4V1 1LOGA 4BE3A 5FLIA 5DG1A 1LU1A 3LAGA 4HL0A 4EWAA 5C6CA 1ULFA 5EXOA 1VBD3 4I02A 2VVFA 4HK9A 5KC5A 4IEPA 2WQZC 3AJYA 2JJ6A 3ZXJA 2Q1ZB 1NG0A 4CDXC 4XJ9A 1RMU3 1C1FA 1LCLA 2TEPA 1ULDA 1KDMA 2B7YA 1H2KA 2SLIA 3ECQA 1LOFC 1WLCA 1R1A3 4CEYB 2QJVA 3EJKA 5HCFA 1CJPA 4FP2A 1I9RA 4Q2FA 1YRZA 3VBRA 2MEV3 1SLTA 1NA1C 2ZHNA 4Q0PA 5BNOA 5FQ0B 2E7AA 4RGAA 2TUNA 5EJ3A 2X5IC 5AC91 3CEWA 5A33B 2H6BA 3OGJA 4QU2A 5IK7A 4DS0A 3X29B 2HWD3 1N1TA 2JG8C 2ZMLA 1Q8VA 3FUOA 5JSOA 1HX6A 1XU2A 3SHRA 4S2HA 1GR3A 1QGLA 4QQHA 5EZWA 4JGZA 1NCQA 4HN1A 4YRDA 5JZGB 4N43C 3RJ2X 1SCSA 1MEC2 1REDA 3ENRA 1O5UA 2PHDA 2P3JA 2R042 2XBO1 4YSFA 2GN7A 4LULA 4ZU4A 1ENXA 2CV6A 1DFQA 1ZRFA 4FQ4A 3VBSC 1PK6A 4XDQA 1W6NA 5FTTC 3VN4A 3ZXLA 2P37A 3WNXA 4DQAA 1OPOA 3WCSA 1H8TC 4YM2A 5DXDA 1ENQA 5FO9B 4Z2WA 1OOPB 3TN92 2JG9C 5GLTA 1FI2A 1ZZ8A 1URXA 1UKGA 2Q1MA 1QOSA 1RUF1 4DY5A 1S1AA 4OHVA 1M06G 3GHMA 1LHOA 4H55A 4RHV1 3U4XA 2BWAA 1O3QA 1JTZX 4EN9B 4ZU5A 3QH6A 4RS5C 1WLWA 1V6IA 4MGIE 2WS93 1QKQA 4C90A 1DQ4A 3GALA 1UD1A 3M4FA 3UKNA 4WVVA 1ZA4A 4AYUA 3CU7A 1BBT3 2X8KA 1W2UA 5GZDA 3VBHC 2X53S 4OUSA 1ALYA 1Y3TA 3VBOC 3ZVXA 3NW4A 1OKQA 2EAAA 3B69A 3E5QA 3ZMNA 3OF1A 4L97A 4IEXA 1RUE1 2E51A 1VRH2 5CFDA 2XWJB 4AHWA 4Q8LA 2GZWA 4JGZB 1NCQB 1UU5A 4NPRA 4E2SA 1QJX1 2P3IA 5KXDA 2D3PA 3WD5A 2OUHA 1MEC3 3URFA 1IHMA 1OQ1A 1ZZ7A 3POSA 1G86A 2EAKA 3NSTA 3IKWA 1PVC1 4Q4X2 3O7OA 5BNNB 1W6NB 4YM3A 4LT5A 4JRAA