4QPIC

Crystal structure of hepatitis a virus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
246
structure length
246
Chain Sequence
MMRNETRVSTTENVVNLSNYEDARAKMSFALDQEDWKSDPSQGGGIKITHFTTWTSIPTLAAQFPFNASDSVGQQIKVIPVDPYFFQMTNTNPDQKCITALASICQMFCFWRGDLVFDFQVFPTKYHSGRLLFCFVPGNELIDVTGITLKQATTAPCAVMDIAGVQSTLRFRVPWISDTPYRVNRYTKEAHQKGEYTAIGKLIVYCYNRLTSPSNVAHHVRVNVYLSAINLECFAPLYHAMDVTTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hepatitis A virus and the origins of picornaviruses.
pubmed doi rcsb
molecule tags Virus
molecule keywords Capsid protein VP1
total genus 48
structure length 246
sequence length 246
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qpiC00
1RUG1 1BBT1 1BBT2 1PVC3 2XPJA 1ZBE1 1ZBA3 1PGW2 1A6CA 2FZ1A 3J8F3 2X5IC 4CDXC 1W39A 1RHI3 1X36A 1RUI2 1RUI1 3ZFEA 4Q4W1 1HRV1 1COV1 4GB33 1MEC3 4CDWA 4YVSB 3VBOC 4Q4X2 4Q4X1 1AR71 1EV13 1MQTB 1K5MA 2X5IB 4N43C 1D4M3 5LK7B 3JD72 4JGZA 5ACA1 5ACA2 1K5MC 1OPOA 4CDUC 4N43A 2TBVA 3TN93 1RMU3 1X33A 4GH4B 1NCRA 4RFT0 5GKAC 1R1A3 1HXS1 2HWC2 2HWF2 5A32B 1NCQC 1NCRC 3NAPA 5CFDC 4QPGB 2RR12 4FTEA 2RM22 2RM21 1PGW1 1HRI3 1VBD1 5ABJC 4N53B 5BNOB 2PLV3 1AYM1 1TME3 1NCQB 4WM7B 1R083 1VBA1 1R082 3VBUB 4FTBA 2RS31 4Q4V1 3ZFEC 3NAPB 3ZFFA 5C8CC 4CEWB 5C9AB 1AR61 1AR62 4IV1A 1OOPA 1FMD1 1RUG2 3ZFFC 5C8CA 1H8TB 1RVF2 4IV1C 1HRV3 1FPN2 4NWWA 3VBRB 4JGZB 1RUH2 4N43B 4Q4W2 4WM8C 1DDLA 1Z7S2 2HWF1 5A33A 3ZFFB 1NA1C 4RQPA 1OOPB 1RMU2 1AL22 1AL21 1VB4A 4Q4Y3 4NWVA 4RR3C 3NAPC 2RR13 1OHFA 1VBD2 5D8AA 3VBRA 1VRH1 3JD71 1VRH2 5BNNC 1WCDJ 1QJX2 5C4WB 3TN92 1CD3G 1POV1 4CDXB 1C8M3 1QJY2 1VBE2 1BBT3 1QJY3 5C9AA 2HWB1 5J96B 5JZGC 5BNPA 5C9AC 2R043 2XBO2 2Y26A 2ZAHA 2HWD3 3DPRB 2BFUL 1Z7S1 1AUYA 1RUI3 1EAH3 1COV2 4YVWB 4QPIA 1EAH2 1PO22 2VQ0A 1PO21 1NA1A 2WS91 4QPGA 1RUD3 4WM8B 1QQP3 3JB8A 1RVF1 4CEYA 4QPGC 3JBG3 5BNNA 3TN91 1RUH1 1C8M2 4QPIB 1GFF2 2HWE3 3JB4C 4SBVA 1B35B 1MQTA 1RUJ2 4IV3A 5K0UC 1RUJ1 4JGYA 1FOD1 1AL0G 3VDDA 2WFF3 1VBE3 1VBD3 1VBA2 2RS32 4Q4V2 4FSJA 1VBA3 1AR63 4CEWC 1ND2C 2WS92 1HX6A 1FMD2 1AR92 4AEDA 2HWB2 1QQP2 1VAKA 1AR73 3DPRA 1R092 2XBO1 5J98B 3VBUA 4YVWA 3VBOA 4YVSA 1RUD1 3VBUC 2HWF3 1ND3C 1RUF1 4YVSC 5A32A 1B35A 3JBG1 3M8LA 1VBC1 1ASJ3 4JGYC 2RMU3 1BEV1 5BNNB 1BEV2 3JD73 1QJX1 1HRI1 2WFF2 1FOD3 1POV3 3ZFGC 1C8M1 2PLV1 5DDJ3 5CFCC 2FZ2A 1PO11 3LOBA 1K5MB 2R071 2X5IA 4N53A 4EJRA 5CFCA 4CDQB 4GMP1 5L7OA 3J8F2 4RR3B 1R091 1AYN2 2R041 3IDEA 4CDWC 4CEYB 5L7OC 1BMV1 1TMF2 1BMV2 1RUD2 1TMF3 1Z7S3 4LLFA 4CDXA 1OOPC 1EAH1 3CJIC 1E57A 1PO23 4CDUA 1VBC2 1NY72 1SMVA 3CJIA 2MEV1 2WLPA 2RMU2 1AL23 1QQP1 4GB32 1RUF3 3VBOB 1HQNA 4Z92B 1NCQA 1F8VA 1VRH3 1RUH3 3VBSB 2RS13 2GH8A 3ZFGA 1BEV3 1FOD2 1IHMA 1RUE3 5D8AC 3VBFB 1ASJ2 1RB8G 2HWE2 4N53C 1AR81 1AYN1 1AR82 2HWB3 5DDJ1 4GH4A 2WZR2 1V9U1 2R061 5AC92 4Y5Z0 2BFUS 5AC93 1PVC1 4GH4C 1ZBE3 2PLV2 2HWD1 5BNOC 1NY71 1AR91 2DF7A 1NA1B 2R072 1NG0A 1NOVA 4GB31 2WS93 4JGZC 1FPN3 1R1A2 2WWSA 4RQPC 4Q4X3 2R042 2XBO3 1RUC2 1RVF3 1RUC1 4FTSA 1PIV3 3HAGA 1QJU3 1VB2A 1D4M1 1RUF2 5ACA3 4CDUB 5CFDB 3VBHC 4WM8A 1M06G 5C8CB 1ASJ1 1H8TA 1RUE2 3JBG2 2HWE1 1ND2B 3VBFA 1VBC3 3VBHA 4PDWB 1RUJ3 1H8TC 2RMU1 1QJX3 4WM7C 5FMOL 5ABJA 1V9U2 2R062 3VBSA 1HRI2 2WFF1 4RS5C 2IZWA 4BCUA 3ZFGB 1RHI2 5K0UA 4IV3B 4RHV3 4RS5A 1PO12 5JZGA 1POV0 3VDDC 2HWC3 1TME1 5BNOA 1C8NA 3J8F1 3S6PA 4AEDB 4GMP3 5ABJB 4QPIC 4GMP0 5DDJ2 5C4WA 2WZR1 1TMF1 1COV3 1D4M2 1NCRB 1HRV2 4CEWA 1ZBA2 1ND3B 1EV11 1EV12 1PVC2 2RS52 2HWD2 5CFCB 2MEV3 4JGYB 4CDQA 1PGL2 2GSYA 2MEV2 5BNPB 4RR3A 1RUC3 4YVWC 2RS53 5D8AB 3VBFC 3ZFEB 3VBRC 1MQTC 4Q4Y1 1R1A1 3FBMA 4Q4Y2 4WM7A 2RS11 1ND3A 2ZTNA 3VBSC 1B35C 4Y4YA 2BUKA 1HXS3 1VBB3 1ZBE2 1RUE1 1AYN3 4IV3C 1F2NA 1PO13 1RUG3 4RHV1 4RHV2 2R073 1AR83 2RS33 1AYM3 5BNPC 5AC91 1R081 5K0UB 1ZBA1 1R093 5C4WC 1V9U3 2R063 4Q4V3 4RS5B 5FMOS 5JZGB 1AR72 1RHI1 4RQPB 4Q4W3 4CDWB 1CJDA 1PGL1 3DPRC 1AR93 1TME2 1FMD3 1MEC2 1MEC1 2WZR3 1ND2A 4CDQC 3CJIB 1FPN1 3VBHB 4PDWA 4AEDC 1PIV1 1QJU2 5FOJB 1PIV2 1QJU1 4CEYC 2BBVA 4PDWC 4IV1B 1RMU1 2RR11 2QQPA 2RS51 1AYM2 5L7OB 3VDDB 2ZZQA 2BPA2 3ZXAC 2RM23 1QJZA 5A33B 1VBB1 1VBB2 2RS12 5CFDA 1HXS2 1QJY1 2HWC1 1VBE1
chains in the Genus database with same CATH superfamily
2ZGKA 2O14A 2P6CA 2A7AA 1BBT1 3DYOA 4KU7A 2Q8OA 2EF6A 4GD4A 3DCQA 2XPJA 1KFXL 4UYBA 4H7MA 2QQNA 3GCXA 4Q0UA 4CZSA 3U14A 2UY9A 4TWTA 3H3ZA 2DFCA 3GGLA 1H9WA 2FZ1A 3AZYA 2VMHA 2WT1A 3HIFA 1H30A 2LRPA 2X5IC 3NJZA 3ZSJA 1W39A 1RHI3 1K3IA 3KHBA 3BOWA 4NHYA 4D6RA 1XNDA 3DECA 1W2UA 3THDA 1HRV1 1GZ9A 2XUMA 1QNWA 5HXMA 3PTYA 1UMHA 1UY0A 4CDWA 2GALA 4AR2A 3OUIA 4META 1AR71 4U36A 1ULOA 1XBFA 1MQTB 5J09A 5KHKA 3IDAA 3ZYHA 4YW3A 1D4M3 5LK7B 1G9BA 3B9CA 1IQAA 2XL9A 2EICA 4WBBA 5EJZB 2WL1A 3LFMA 3MO4A 4AFAA 4N43A 3U37A 1NE6A 3GBWA 5HCFA 4YNIA 1O5UA 1X33A 4W50A 1JHNA 1S2EA 5C70A 2CSGA 2EAAA 3UL2A 3KS7A 3I2JA 3NKGA 4KWLA 3U75A 4AGRA 5CEHA 4XTPA 5HCBA 1JZ8A 1EUUA 3D5OA 5ANNA 5J36A 1T2XA 1ODMA 3PTRB 2HWF2 2VR4A 4YW2A 5A32B 1MZ6A 3MZHA 3WEZA 4AHWA 5LEJA 2OZ6A 3NNJA 1WW5A 1OQDA 2RR12 5JPMB 3ECQA 2DCJA 2RM21 1O5LA 1P8JA 2VZ3A 2IXCA 4W4ZA 1JTZX 1VBD1 4N53B 2XVGA 3NL1A 2PLV3 3WP5A 2VJXA 4MOAA 1R082 1W03A 2JE7A 2RS31 5DG1A 1OVSA 1QOOA 1W8UA 4Q4V1 4A7KA 5CISA 4LKSA 1JOPA 2W47A 2WSVA 3ZFFA 1QOTA 1FT9A 4LO5B 4ITCA 1DQ4A 2WABA 2Z2SB 4UT5A 3WCSA 2G19A 1H8TB 1RVF2 1GZCA 3OD4A 2R1BA 4JDNA 1R1ZA 2D6OX 3ZIWA 1H2KA 3T30A 3ZO0B 1FPN2 4INDA 4IDZA 1Q3EA 2TNFA 2Y0IA 2YU1A 3P5BA 1RUH2 1XPWA 4N43B 3O1OA 1VAMA 3BALA 1XXNA 1DDLA 3ZFFB 2PA7A 1NA1C 4TLFA 1ZNPA 3WG2A 4RQPA 1OOPB 3K2OA 4NHLA 2VNOA 4ISQA 5CVRA 5FP3A 4CUCA 1PHMA 1YJKA 1V70A 1MS5A 5FY8A 1A78A 1N1YA 2RR13 2XH6A 4QHOA 1VBD2 1W6OA 1QEXA 3ZDSA 2MNGA 2UY8A 3T0AA 1VRH1 3ACGA 2VCAA 2K2SA 1OH3A 4NAOA 4NRQA 2JICA 2PHWA 4HK9A 1WCDJ 2GNTA 5FXWA 1QIQA 4D8MA 3VDBA 4PQ9A 4NROA 3GNEA 3I2KA 4AQSA 5EIYB 3IWZA 2V09A 3HPNA 1C8M3 1GWLA 1VBE2 3OCPA 3HQUA 3F2ZA 1SCRA 4LOSA 5C9AA 2HWB1 2VMEA 2C5DA 2W2IA 3ZMOA 2XR4A 2UU8A 3G7DA 1SFPA 4Q0SA 4QDQA 4F8AA 2BVVA 2QKDA 2J1TA 3WF4A 5JZGC 1K45A 1OA2A 2R043 3FUQA 4URAA 2O8OA 3GCWA 3GHMA 2YBPA 1ZRDA 5KXCA 2BFUL 4P14A 4LBNA 2W46A 1EAH3 1UXXX 4YVWB 3BU0A 1DZRA 3V0AB 3MI8A 4UFKA 3Q8EA 4Q2FA 2JG9B 4ASKA 2VZPA 3GHNA 4HOOA 1RC6A 3UKVA 2J1RA 4IUGA 1QQP3 3ZN6A 1QXJA 2WT0A 3WG3A 4LXLA 5IVEA 5J37A 2BGOA 2R7EB 4CEYA 4DIQA 4DXSA 2P34A 4R9AA 2QTWB 5A7OA 4WZFA 3ASIA 4MVTA 4IGQA 4K21A 4MV2A 4RD7A 2XLGA 1NXMA 2RG4A 2HWE3 3SCHA 1HQWA 5E1RA 3UNPA 2PAKA 4NJ4A 4SBVA 3I3BA 1MQTA 2OKXA 5K9YA 1O3SA 4COYA 4FPHA 4LO6B 3I3MA 2PHTA 2WUHA 1D2SA 2C9AA 2XWJB 2RDQA 3WOGA 4C0BA 3POSA 3VDDA 5E16A 2OZJA 2P1BA 3WINE 2BZDA 3B7MA 5FZKA 1CQ9A 3CMGA 2XKPA 4NR1A 4YARA 5JXJA 1U5ZA 3KV5A 2ZEZA 4A6SA 4LE3A 5FMCA 3ZYBA 5DG2A 3BB6A 3LSDA 4KBBA 4HL0A 4Q4V2 4AGVA 3J7HA 2W1QA 1ULCA 2DU1A 2ZX3A 3H3UA 3NJVA 3HEIA 4MGKE 1UYXA 4FFGA 4IEOA 1JBCA 4FPLA 5FLIA 2ZMKA 2ZGTA 4CEWC 1SLCA 4ES8A 3LGRA 2WO3A 2BWAA 2HWB2 2DCZA 2ENRA 2JDAA 4XFCA 2WA3A 2Y64A 1QGLA 1QQP2 3T3YA 4OZOA 5A3UA 1VAKA 4FXGB 5DAXA 1JYCA 2JDPA 5C3PA 4CPBA 3HMYA 3LDBA 1LENA 2NQYA 4YVWA 5F37A 2G4IA 3HNBM 2J1SA 2V5YA 4AI3A 3MDPA 3CQOA 4L9BA 1RUF1 3MBWA 1B35A 2C6SA 1BK0A 3EO6A 3OPTA 5FLJA 5FPZA 5A3PA 2WNVC 2QDRA 1N47A 1PK6A 3FFZA 4JHTA 3TEYA 4JGYC 3VDCA 4H55A 2G9GA 2RMU3 5FZ7A 2XKOA 4IL7A 4E2SA 2A1XA 1YQ2A 3ORJA 5FMBA 1HRI1 2WFF2 1UZVA 1F31A 2AH2A 3ZFGC 2WJSA 2A6WA 1SBDA 4ARXA 1ENRA 5CFCC 3KQ4B 4CCJA 2W91A 2VTXJ 4E2GA 2ORZA 3LOBA 1UPSA 1G9CA 4W65A 4MXWB 1JYNA 4EN9B 4N53A 3ZXFA 3IDBB 5IK7A 3U10A 2QQMA 4X6RB 4CTEA 4B4PA 2OUJA 1ZM1A 1F35A 3D4KA 3MPBA 4RR3B 3B5LB 4K8RB 1SFYA 2CDOA 4OULA 4NIHA 1YC61 5FBZA 4CDWC 1FV3A 5ANQA 3RYRA 5KWRA 1BMV1 1RUD2 2WIIB 3BODA 1Z7S3 4HN1A 4R8HA 4P5YA 1EAH1 5FYCA 1U5IA 3P3PA 1E57A 4HG6B 3JU9A 4B3NA 3VL9A 4FFIA 4CP9A 2P37A 1XQNA 4IEZA 4BM8A 1VMJA 4CRQA 3CJIA 2GC2A 3BGAA 1LEMA 2MEV1 2AZ5A 5FYHA 2W0XA 4R4ZA 1YFXA 2RMU2 3KZ4C 1AL23 1XNBA 4Y22A 4XJUA 1O4TA 3AP9A 5FPUA 4ES9A 3DKQA 3I3QA 4GB32 4LQRA 3WF3A 4AFCA 5JDBA 4Z92B 2ZA9A 2P3YA 1H0BA 2VCBA 3C8XA 4BOWA 3N9OA 5FZ4A 3SEPA 1YQ8A 1LOEA 4S2GA 2VBBA 4Y20B 2Y38A 1S0BA 4CP0A 1TE1B 3FJSA 2W87A 3HBZA 2UWBA 4M01A 4DINB 5IATA 3BIEA 2KR2A 2X05A 1N3PA 1QWRA 1X7NA 4Y1YA 3H1WA 2HWE2 3CZUA 4F83A 4GAZA 2BYVE 5FPAA 2VVFA 5BYNA 1J58A 1OA3A 1VJ2A 1HJGA 1YFWA 3LQCA 1US2A 5DDJ1 5DZFA 3SC7X 4AAXA 4DY3A 5KXDA 4UW5A 4XF3A 2QQJA 3E5QA 4NPLA 3VD7A 1AX2A 2BNMA 2YFUA 5AC93 1V6NA 4WZCA 1QH6A 2PTMA 5E6HA 3W20A 2CNAA 3AP6A 5FZ8A 2WO7A 3D0SA 1NY71 3ZYJB 2DF7A 2JG8A 1NA1B 3WNPA 1AJKA 3J7NA 5T3NA 1VRBA 2R072 2A73B 1G6NA 3LEMA 5C5TA 1AXZA 4UF0A 2H6CA 5FR3A 4GB31 4AOCA 3QCWA 4GXLA 1RXFA 2AC1A 4JGZC 1W8HA 4XDPA 4XDQA 3VHOA 2E51A 2VW2A 4QWNA 3ACLA 3IZOA 3O0VA 1RUC2 1RUC1 3HAGA 3B02A 3MW3A 4XE9A 3N9MA 1JHJA 4JKKA 3VKLA 3EQEA 3I2IA 4AXOA 3JBG2 2BWCA 2HWE1 1NQJA 3ITQA 3NQHA 2WA4A 1RUNA 1VBC3 2JIGA 4PDWB 3VBHA 4AQTA 5JPNB 2ILMA 1WA6X 1RUJ3 5EV7A 4GIQA 4YW5A 5CG9A 2VZRA 2ZX4A 2JX9A 3Q8CA 4Q1PA 3KGZA 3WDXA 2BQPA 1W3XA 3AJYA 3JZVA 4Y20A 1TZOA 5IWFA 1RHI2 4OI1A 2JENA 4BQXA 4OUMA 3V65A 1W6QA 3W59A 1AXKA 2JKBA 3BIWE 2HWC3 4HXCA 3OGSA 3AX4A 3POJA 4PIZA 3QBQA 5BNOA 1NZIA 1DYPA 2B39A 2W68A 4L2NA 4B7KA 2VOWA 4IETA 4M3CF 3J8F1 4GMP3 3DYPA 4Q29A 2EXJA 1O4YA 3QLQA 3HBKA 2WWJA 4OHZA 5DDJ2 3B00A 1NLSA 4DS0A 4HSLA 1PM7A 3N9LA 4CEWA 4YM0A 4FPFA 1ND3B 4YW6A 1D7PM 1T6BX 3QH7A 1EV11 3VZLA 3WT3A 5JSOA 4LBKA 3C7HA 5SV5A 2RS52 4YG3A 4B4RA 2HWD2 2WNUB 3JCIA 5CFCB 5EYYA 4CDQA 4DUVA 1ONAA 5FO8B 2GSYA 1IOAA 4MGQA 3AMQA 4RR3A 5CU1A 1LKNA 3KLSA 3PURA 4U2AA 1QMJA 1RXGA 5FYMA 5J7MA 5K8SA 3RDIA 5B4XA 2YROA 1ENQA 1C4RA 4NIDA 5FRAA 4AEKA 4LPLA 5JI9A 2J1VA 4KQ7A 4A7ZA 2YC4A 4Y33A 4WM7A 2WAAA 2W39A 1DQ2A 4LO4B 2RS11 3TEZA 1QJFA 3K75B 4URTA 5FO7B 5LB6A 1W28A 2ETEA 1V6OA 2XWBB 5GLUA 5CAZA 1XYOA 4IE6A 4KL1A 2VTXA 2BUKA 1HXS3 4L99A 4RSUA 5A7QA 1K5JA 2XG3A 2SLIA 5CBLA 3O1PA 1HB4A 1DGWA 1UYZA 2FDFA 5GZEA 3GZTB 4FOQA 2JDZA 1O8PA 2ET1A 2QVSB 4FPJA 2JDYA 4FXKB 4IV3C 5F8PA 4COWA 3ZOIA 5JWPA 5BNQA 2CV6A 1DZTA 4WV8A 1AR83 2RS33 1AYM3 3WY6A 2WN3A 1VLNA 2Z5WA 1LESA 1R093 1F4AA 4CU9A 1QOSA 4RS5B 2BTVC 2ORXA 3ZSEA 3ZXKA 4CE8A 3TEXA 1RHI1 1EP0A 3ZXLA 1W05A 3ELNA 3T2OA 1CX4A 3N7KA 4I02A 1UF2C 4ZZ5A 4CU7A 4AFDA 3WQ1A 1TME2 3PJYA 1EYBA 1MEC1 2WZR3 1AJOA 2V5DA 1W9YA 1TEIA 4X8PA 4CDQC 3CJIB 2HEYF 5FWEA 2QDNA 1UU6A 4BQ3A 2ARBA 3MV01 1PIV1 4MHRA 2VZVA 1PIV2 3ACIA 3DYMA 5FZIA 4CEYC 4DEVA 5FOJB 2QE3A 4UXAA 3ZR5A 3E1F1 4PDWC 3POIA 5H9QA 3SH3A 4NUBA 1W6MB 3JQWA 3MIDA 5EJ3A 2RR11 4OQ9A 3O1SA 2EXIA 4IEYA 5FZ1A 2XJSA 2X53S 4DO0A 1IS4A 3RVHA 3Q8FA 5GLZA 5IT6A 3C2UA 4FAGA 5L19A 3VDDB 3UYJA 2DVGA 4PBPA 4PHZA 3SLIA 2Q4SA 2XDVA 2WNOA 3FX3A 4Q0PA 1CIWA 5FJKA 2BPA2 2C9KA 2ZGUA 5F3IA 5FJHA 4DPNA 5A33B 1F5JA 5CADA 4IE0A 2E7QA 3N9PA 4XMAA 3VB9A 5IHRA 1JYIA 4HVQA 2WQ8A 5KC5A 2CWSA 1UZ0A 4YRDA 1QJY1 4FBFA 1VBE1 4HPKB 5LA9A 4BQ5A 1RUG1 2VECA 1OI6A 3ZYFA 2ZHNA 1UCXA 4P9XA 5FZEA 1ZBE1 3RI9A 4N9IA 4ARYA 4N8MA 4QKNA 1W2AX 1RJ8A 3K3OA 5GLWA 4CDXC 1JUIA 4A2UA 1SLAA 4PF5A 2VULA 1OUXA 3OGGA 4Q4W1 4QQOA 4YWAA 4AE2A 3WG4A 1W8OA 4EYUA 1COV1 2XLFA 1YIFA 5T5OA 2JB8A 1MEC3 2V72A 2VL4A 2ZHKA 4YVSB 3VKFC 2D6LX 1E5SA 1NLRA 4A42A 4YZ5A 4Q4X1 1EV13 1NKGA 1GMMA 4ASMB 1A34A 1ODNA 1YWKA 1U5YA 3DL3A 1OQEA 3N7LA 4EN8B 2ZKNA 1ZZBA 1CWPA 3JD72 1GR3A 3BPZA 4QPYA 2YGMA 2WNVA 4F7ZA 2OPWA 5ACA2 1JYWA 1QJEA 3AKSA 4O61A 4AI8A 1W0NA 4KBZA 2Y8KA 3TN93 5LZ6A 1RMU3 5BPXA 1NCRA 3N4MA 4IEXA 5GKAC 3URFA 4OHWA 4XFBA 4AW7A 4P9JA 2QFEA 5LA2A 2HWC2 4IEWA 2AYHA 1TG7A 1GNZA 1S55A 3CLPA 2JDKA 3CJXA 4MXVA 3TB0A 3T2PA 4A6OA 5LY1A 1BJQA 2KD7A 1BK1A 1H1IA 1WGPA 2Y6HA 4H2AA 4KWJA 5F5IA 3MGUA 1HRI3 1WBFA 3IIAA 1OD3A 1AYM1 4XACA 4D0QA 2RVAA 5FAXA 3AB0A 1LOAA 3GF6A 1VALA 4JCKA 1DGWX 4FTBA 1OF3A 1F9KA 1SPPA 2H6BA 2QQOA 4YM2A 3J26N 5GZDA 2B46X 3FFQA 3NV4A 3PL0A 3WNXA 2V4VA 4AVBA 4LHKA 1L3JA 4Q8KA 4QM8A 3WW1A 4XBQA 1OT5A 2BVBA 1CAVB 1W6NB 2D7FA 4BA6A 1LECA 4QXHA 3KMHA 1RUG2 1SLLA 1H6XA 4OHXA 3ZFFC 3MF6A 5A3LA 4HKOA 5GM0A 3SNMA 1C57A 4NWWA 3WNMA 2CTVA 2MHFA 1UQXA 1XE7A 2F17A 4Q5OA 2VOKA 1OQ1A 1FYUA 1HB2A 4Q0QA 3WG1A 1CGPA 4XAAA 2XVKA 1W3VA 5T54A 1Z7S2 2YMZA 5A33A 1H4HA 4LT5A 1OKOA 3POBA 4QHZA 5AFEA 3KF5A 5BXXA 2LW8A 4BPZA 1PMHX 1MZ5A 1YI9A 2DWRA 2VMIA 2BEOA 3P6BA 2TUNA 5D21A 1KXGA 2XJUA 4S2HA 4RR3C 1GYKA 1V6KA 2PN5A 1G9AA 1V6LA 2EALA 2IUWA 3DKWA 3UKTA 1PZ8A 2GNBA 3N7MA 2OPKA 4B4QA 3JD71 4P9GA 1TNRA 1UMZA 2XJTA 2YC0A 5BNNC 5IK4A 5JR7B 2O0OA 1XU2A 2XVLA 3CO2A 1BLZA 2WINB 4AVVA 4E8CA 5C4WB 2D5HA 3GM8A 3LA7A 3H8UA 4ZU5A 3GBGA 1CD3G 2Q1MA 3CKHA 4KG8A 1UZWA 2O1QA 1GWMA 3DXTA 2XQRA 3IPVA 3NNGA 4IW3A 4XUNA 3AMHA 4CDXB 1A3KA 3B94A 1YQ6A 5JVVA 4CCKA 4CXXA 2B9UA 4ORFA 2FDKA 1BBT3 1LHVA 5T5JA 4AL9A 2HYKA 4GZ9A 5J96B 1GQPA 3ZSLA 3M3EA 3WX5A 5A1AA 5BNPA 4D69A 1VMFA 1X8EA 4E9KA 2RDRA 5C9AC 4QKFA 5LA1A 5F5CA 5K4LA 4P08A 2ZAHA 4TN7A 3FN9A 4UBGA 1SQ4A 2HWD3 3U78A 1X9TA 1AUYA 5E89A 1QDCA 2P3JA 3TEWA 4FCAA 1H4GA 2JIJA 3A21A 4LORA 1EAH2 3IMMA 1UL9A 1ULFA 5DZGA 1RINA 5DN2A 4ATEA 4DMIA 2WN2A 1UKRA 2D40A 5CG8A 2Y6GA 4CCCA 3A0KA 1O8SA 4WM8B 4AI9A 3IT8A 5IVVA 3FHAA 2YBSA 3HVDA 2NP0A 2AACA 3POFA 3UKNA 1NX9A 1C8M2 2DBNA 5LY2A 1J3RA 2RHPA 1V00A 4ZS3A 4DUXA 2CDPA 3JB4C 5A6QA 5CNAA 1J59A 1B35B 1ZRCA 1OA4A 1YLLA 3CU7A 1RUJ1 1AL0G 2TEPA 2GP3A 2I07B 2K9ZA 5LRRA 1CESA 2WFF3 4AHYA 4YZ4A 3WQ0A 1DQ0A 1X9PA 3LDKA 1VR3A 1UZZA 4A3XA 3IAPA 5FY4A 5C5UA 5A3NA 1ZZ9A 1VBA2 1WLCA 1O3RA 3AK0A 2RS32 1GZWA 1PZ7A 2P3IA 2J1UA 3R4UA 4AYUA 1PZ9A 1UY3A 4QX8A 3SEEA 2Q0AA 1AR63 2YGLA 1DFQA 4QM9A 5F2SA 3VKNA 4ZKTB 5JOZA 2JE9A 3H9AA 1GBGA 1ND2C 2WS92 3SCGA 5F3CA 1FMD2 4K3UA 4NHXA 3M3IA 1K12A 3ACHA 2JG9A 3RJ2X 3EMRA 2QZ2A 1XNTA 2WNEA 5FBJA 1W6OB 1X50A 3OTFA 3RNSA 4BH9A 1SBEA 5IVCA 3KQRA 4JQRA 5J98B 3K4ZA 3OYWB 2C26A 2JDMA 4OVEA 3RJRA 4W6XA 1LULA 4BU2A 1S0DA 1ZVFA 2QJVA 1YO8A 1QH7A 1DHKB 5JXGA 4A7YA 2IFRA 1ZX5A 5FZFA 4LK7A 3JBG1 3VZKA 3WNKA 4D94A 3RYKA 4SLIA 4AG4A 1RIRA 3HT1A 2VVDA 1BEV1 3NMBA 2UURA 4LIUA 4N7UA 2Q1FA 3HQXA 3R05A 4BQ2A 4EN6B 1H1AA 1KDKA 2GMEA 1W2TA 1S0GA 1FOD3 1V6IA 3SMHA 5CKQA 2GC1A 5D1IA 1C8M1 5DDJ3 2VNRA 1Q56A 3GZAA 2E26A 3B93A 3RI8A 2R6QA 2FZ2A 5FPVA 1PO11 3MF9A 5DAPA 3Q9OA 1UIJA 3AYCA 3WW3A 2PHUA 2BNOA 4LBLA 4M4RA 1FAYA 2Y33A 4DRVA 1C3HA 4G3YC 4EJRA 4CDQB 2E33A 3PIGA 3J9SA 3I3DA 3J8F2 2DFBA 2CHHA 1REDA 1OLMA 2BV4A 4CUAA 4DXTA 1O7FA 2R041 2VMFA 3ES1A 4QB6A 4XFGA 4CEYB 4PIXA 5L7OC 3LSEA 4TYSA 5B2GB 1LOBA 1TMF2 2LUWA 1XSRA 2ZEYA 4Y26A 1Q8VA 4L92A 3BTAA 3PU3A 1A8DA 4LLFA 1OOPC 2XUEA 5C33A 5KC6A 3EXUA 1NUKA 3S7EA 2UYBA 2VG9A 2VMDA 3MYXA 3OBZA 2VMCA 3VZNA 1GUIA 1SMVA 2YFZA 4CDUA 4MLOA 5A6XA 2WLPA 1PK6B 1UOFA 1QQP1 3ETQA 2VW0A 3T0DA 1MS0A 2I2SA 4PLNA 3VBOB 4XJZA 1GP6A 1KJRA 1LEDA 1IPSA 3SHRA 4EZHA 4E4ZA 1F5FA 5GZGA 5LW9A 4MADA 3MIHA 4XEZA 2B42B 4C1XA 4TXWA 1RUH3 2G9FA 5EPAA 2GH8A 2WBKA 1HN1A 1MS8A 3V64A 4LK6A 1BEV3 1UPIA 1XNCA 1I5PA 3WDVA 5D8AC 2WZ8A 5FYBA 2RJLA 3VZJA 1DBNA 4CUBA 1ASJ2 2Z69A 4QT6A 1RB8G 1LHUA 5CYYA 2ZGSA 4N53C 1JZ2A 1U0AA 1AYN1 4Y1ZA 5C8WA 4PLOA 4UAPA 1XNKA 3MPPG 2WZR2 1JZ5A 1KQRA 3RMYA 3R0RA 2E32A 1YJLA 3POGA 1WW7A 4AHXA 1V9U1 4AVSA 2YPDA 3ZMNA 3VD9A 3TNQA 2X8KA 1TNFA 2WQ4A 4GH4C 2VPVA 1ST8A 3BCWA 5LCWL 1L7LA 3PVBB 2EIEA 4UOJA 2IXIA 5C7GA 4E27A 5BNOC 4BHPA 2BDRA 2C24A 2E9QA 4XF4A 3V56A 2YBKA 2CU5A 4NE9A 1F4HA 4ZONA 1NG0A 2DUQA 1W6PB 2J22A 1S0FA 2WS93 3AL6A 2ZXQA 5JR2A 2VM9A 3BOPA 1R1A2 2JEMA 4RQPC 4WVWA 1S4CA 4CYDA 4ZS2A 3WUCA 3ZXEA 2R042 3OPZA 5JAXA 4XDOA 2XONA 4FTSA 1FX5A 3FLPA 4XIKA 2Q8DA 2PHXA 1JYVA 1C5IA 2D6KA 1G86A 3E5XA 1LHNA 3Q8AA 4CDUB 5LRSA 1M06G 3AYDA 3AXDA 4PF1A 5C8CB 2D3SA 1CAUB 1S2BA 2YPJA 1DQ5A 5C3RA 1ND2B 4R9DA 3POEA 5KHGA 1HIXA 1OLQA 1V0AA 3OGJA 2E7AA 1OVPA 1O6UA 1BVVA 5ABJA 4XXAA 1APNA 1GQGA 1GOGA 3IN9A 1V9U2 3TYJA 4BCUA 4RS5C 2IZWA 4UFJA 2JXAA 1O4ZA 4BISA 1UU4A 3OGVA 1JMUB 3S5QA 3ZX7A 2QBXA 4RHV3 3HNYM 2NZ9A 5A3WA 4X8NA 4OUEA 2DBIA 4RGGA 2XLAA 1KS5A 3GBFA 5JLVA 3MW4A 1CZTA 1GICA 2WAOA 3QACA 4BXFA 3S6PA 2B5HA 4FI9A 5ABJB 4UW3A 2PFWA 4LKFA 1XE0A 4AF9A 4GMP0 1UD1A 2DTWA 4OCTA 4MGYE 3OBAA 1ACCA 3S57A 1COV3 3I8TA 5IVYA 5FUNA 1ZYBA 1WLTA 1Y4WA 1ZBA2 4KG0A 2EAKA 2VUDA 1N3QA 3OY8A 3C7OA 4JGYB 2PQSA 4GKYA 2JD4A 3LA2A 1KDMA 1RTVA 2MEV2 5BNPB 1GZTA 3NKTA 3OEBA 2JE8A 4D3WA 1CR7A 2OW4A 4NRMA 2JD9A 3VBRC 4OZXA 1GU3A 4XTMA 4QDSA 3GZEA 3OSDA 4Q4Y1 1R1A1 1NXD1 3U07A 5FWJA 1RL3A 4UFMA 2VZUA 3VBSC 5E8AA 5FP4A 4M3CE 5LWBA 1S0EA 3OGRA 4LTAA 2VO5A 4V2WA 4J6GA 1MS9A 3ZDVA 1WCQA 1HLCA 4S2FA 5C3OA 1OBNA 2AUYA 1VBB3 1ZBE2 2W52A 4K20A 4XAEA 4AGGA 2XHNA 2BGPA 3I2DA 5EJ1B 1F2NA 2Z79A 3RWKX 4E8DA 5FK8A 2N7GA 1JODA 4B7EA 3WR0A 1RUG3 3MLLA 3ZN4A 5BNPC 5IAXA 1MS4A 1XOYA 1LOFA 5AC91 4CXYA 5K0UB 1ZBA1 1US3A 1QU0A 2RJ2A 2R063 5FMOS 1W6QB 2VD7A 4KWUA 4QB1A 4XIOA 5I0DA 3S5AA 2ZGOA 3AXEA 4RQPB 2VW1A 5AVPA 4CDWB 1GWKA 5DMYA 1CJDA 4B29A 2K46A 3QD6A 3R4SA 4FVVA 2H0VA 3DPRC 3LOIA 4ZPIA 1KRIA 4XQWA 2DYCA 5GZFA 2OQ6A 3CZJA 4V1PA 5FPBA 4LE4A 4QX2A 1REEA 4N7IA 4PDWA 5FYUA 4AEDC 3R4DB 1UX6A 4BLIA 1NT0A 4R9BA 5I93A 1QJU2 4UI9L 1WA4A 5FMDA 4CA9A 4JV4A 3NO8A 5CKNA 4PBOA 3PUIA 5EXOA 5JSRA 2WWUA 4W6YA 5FOBB 1RMU1 3HN1A 1ENSA 3FLTA 5I0SA 4LITA 3D82A 2FCUA 2RS51 2QQPA 1STMA 2DUOA 2YZ4A 2IVJA 2VXRA 2WNVB 2ZACA 5JIUA 1MS1A 2D6MA 3L9JT 1XE8A 1Y3TA 4DFSA 4RGAA 1LGCA 1AYM2 3P1IA 5L7OB 4LJHA 1UOGA 3BKZA 1J1LA 2ZZQA 1SLBA 5JUVA 2E6VA 1PNFA 1RJ7A 4KGGA 3AVSA 2Y6FA 2PXJA 1YEWA 1QJZA 2E63A 2EXHA 4P5HA 4XCAA 4AFMA 4C90A 4NIGA 5FKCA 3ALQA 2RS12 1W8WA 1WKYA 3KB5A 4ZY9A 4K1YA 2PHFA 2HWC1 3LB9A 4LKEA 3MIGA 2D93A 4COVA 4BZ4A 1EY2A 2G1MA 1PVC3 4FAHA 5JMCA 2GC3A 1LODA 3D8CA 1WD3A 1PGW2 1FV2A 2OXBA 1SDWA 2B7YA 1A6CA 2Q30A 4HT1T 3J8F3 1DYOA 3THTA 4IESA 1X36A 1RUI2 1YI7A 3ILFA 5D2AA 3ZFEA 3I2HA 3AKPA 1NE4A 1Q43A 4GJZA 4RA0A 3HR9A 1YUDA 4HKWA 3ZPOA 1PMIA 1UZYA 2ZGPA 4GB33 4LLOA 4YFWA 3A7QA 1W8NA 3FWEA 3VBOC 3CDZB 2ARXA 4MXWA 5T55A 3LA3A 4FPGA 4NMIA 4QXBA 2BOIA 4YW1A 3ST7A 4N43C 4CCLA 1W8ZA 1WCSA 1H2LA 4UF0B 2SBAA 2B4KA 4JGZA 4R9CA 5ACA1 5L73A 1K5MC 3THPA 1JZ6A 4AVTA 1HJFA 1H2NA 3I59B 2TBVA 2DVDA 4Y1VA 1RGSA 1VAVA 5A1LA 1DZQA 4GH4B 3ZSMA 4NIAA 3X29B 5FZAA 3AYAA 1OPMA 4XHBA 4E4SA 2BBAA 3SQOA 1NAEA 3PVEA 3LWCA 4I01A 5H9PA 2RJKA 1Y9QA 3IPVB 1EUTA 3FMGA 4FOWA 4MSVA 5FPXA 4C1WA 5A3OA 1D2QA 4AWDA 1WCUA 2ZBJA 3A4UA 5BNOB 5LBCA 2Q1ZB 3H3LA 1LGNA 5FUIA 3O14A 1NCQB 3MIBA 1MR5A 1R083 2FDJA 3AFKA 4FOVA 4IEPA 1VBA1 4OUSA 1EPWA 4BQYA 4Z2AA 3T2QA 4TTGA 1MVEA 2B8MA 4YFZA 5FYIA 5KHIA 3W58A 4JZRA 4YYOA 3ZSKA 3FC0A 3NAPB 3NWKA 3KCXA 5C8CC 4CEWB 2R49A 1AR61 2CAUA 1O3TA 3TBDA 4IV1A 2D43A 5FZOB 1UYPA 1FMD1 4MG2A 2NMOA 3WF1A 1AZDA 3OY8B 4ZXKA 2WT2A 4XYXA 1XRUA 2VCCA 4HKLA 4QQPA 1HRV3 1LU2A 4PI0A 3RG0A 4R4XA 1W99A 4P9WA 3AKQA 1KFUL 1W04A 1SPPB 1YXWA 2ADEA 1WMEA 4Q4W2 1SACA 2HWF1 2XGXA 1REFA 1Q8PA 3ZYIB 2AENA 4LBQA 1RMU2 3VD5A 1LOCA 2A3WA 1AL22 4B1LA 1VB4A 5J48A 4Q4Y3 3O0XA 5F6KA 5F3GA 3A23A 1W0PA 3NAPC 3ZPYA 4DXRA 4XUOA 1JS9A 4JTOA 4XBLA 4LKDA 3GXUA 5D8AA 1J3QA 3VBRA 2A6XA 4FPOB 1Q8OA 1LNSA 1UWWA 2WLQA 1QJX2 1UX7A 2DVAA 5EQUA 2WZPP 3ZXGA 1CJPA 4YGEA 3WNOA 2CL2A 1VMHA 4HANA 2PAEA 5BV6A 1POV1 3LEKA 4YSFA 1CAWA 4NAMA 4N9HA 1QJY2 2YC2A 3DUIA 5HPOA 2GNMA 5C6CA 4DEQA 2HYXA 1JI6A 4PI2A 3ILRA 5FZLA 5IUQA 1UMIA 1UU5A 2FBEA 1Y7BA 4HN0A 3TNPB 2B9VA 4JVAA 4Y1XA 5AFBA 1WLDA 2D98A 2XBO2 4O9GA 2VZOA 1ZA7A 1UOJA 2KXLA 1AX0A 2W92A 4LUKA 4YM3A 1JXNA 2CGNA 4PT6A 1RUI3 2VOVA 2OS2A 2WZEA 1MVQA 3AMMA 3E6BA 1COV2 5FP7A 3T2TA 3K48A 3ZKYA 2A75A 1CPNA 2JDUA 4XJ8A 1PO22 1PO21 1CPMA 4EE2A 2EIDA 2WDBA 2W95A 5G05L 2VBPA 4H14A 2EVXA 5FV3A 2WS91 3WNNA 4QPGA 1J83A 3TAYA 1OUSA 3JB8A 3U4SA 1RVF1 1HV1A 3WD5A 3S0MA 5A7PA 3M3CA 1G7YA 4UW6A 3V0BA 4QMAA 2WO1A 3JBG3 2GAUA 5BNNA 3U1XA 5LASA 2RE9A 1LB2A 4XF0A 4QPIB 5BY5A 1OFNA 1GZWB 3H42B 1GFF2 2XMLA 3USUB 1WMDA 5IAVA 4Z2WA 1Z0HA 4DXZA 2AEYA 1OH4A 1N1TA 1C28A 1RUJ2 2GZWA 2QQVA 2V73A 1MZEA 3DN7A 4FPEA 4JGYA 5K0UC 4L97A 2VQAA 2OT7A 5FREA 3KWVA 4LBJA 1VBD3 2Q5TA 1ZRIA 3MIEA 3O12A 2D6PA 4LR4A 3N7JA 4GALA 1VPHA 1WD4A 4Q26A 2D3PA 3MW2A 4HMZA 1PGSA 3PIJA 1D4VB 1VBA3 2YHJA 4LOTA 2A3XA 5FCCA 1DLLA 2BGCA 3KV4A 3PUHA 2IWGB 5F7UA 1IS5A 1XJAA 3W21A 1LHWA 2J7MA 3PMSA 3LAGA 1AR92 4Z82A 3AVRA 2JWPA 3R6SA 2NM1A 3K51A 3BTYA 2QNKA 4IGPA 4C91A 4JDMA 4W6WA 5FY9A 4DNYA 5BUVA 5JOWA 1ZZ7A 2E7TA 2ZHLA 1LAJA 1AR73 4UFLA 1PX4A 2JG9C 1RUOA 2VBDA 2YV8A 2GP5A 2HBUA 1AVBA 5LBEA 2YDEA 2VOXA 1T6GC 3AMNA 3VBUA 2IVIB 5LA0A 3FL7A 4LIVA 3VBOA 3WP4A 4IQPA 4XF9A 1Q5OA 3NSTA 2ZGQA 5I0RA 1WLWA 1I6XA 5KBFA 2HJIA 5ERLA 2P5BA 3M8LA 3LD8A 5EFUA 1ASJ3 2XB6C 2XOMA 4IXLA 3U11A 1HW5A 3AKTA 2XJRA 1IS6A 1BEV2 3BTZA 5HCHA 4IERA 3RZGA 3JD73 4ONUA 3LKJA 2W1SA 5L36A 4I30A 1QJX1 4QQHA 2WQZC 1UO9A 3E5UA 4N90A 5FY5A 2OA2A 3I2OA 1DIWA 4XQ4A 2IFWA 1Y43B 4L0PA 3HJRA 3O7OA 4NO4A 4QXKA 1UXZA 2FMDA 3MEPA 4OQ8A 3IDCB 3FHIB 4ZU4A 3KT1A 3TWIA 3TOJA 1K5MB 2X5IA 2WC2A 5CKMA 5DUUA 2ZKLA 3DF0A 5CFCA 4GMP1 2VUAA 5L7OA 5ISLA 4QKDA 4G4FA 4I0BA 1OC1A 2GNDA 4WVVA 2EA7A 4XFFA 4J1XA 4GQ7A 1MACA 2XHKA 3WCRA 4JQTA 2DTYA 2ERFA 1TVGA 2WYSA 4KH9A 2UYAA 4XFIA 1JH5A 1GANA 1UN1A 2VE1A 2ZAAA 4I09A 4CDXA 2ARCA 1PM4A 4HPKA 4CCDA 5JXIA 3RPQA 3BYWA 1PO23 1VBC2 1NY72 1W9SA 5DQ0A 1HB3A 2W1UA 2DURA 2ARAA 4I2OA 2YUEA 1ZZ8A 1HDKA 1CIYA 3NNLA 4MGIE 5FO9B 3T4VA 3H0OA 1RUF3 4HVOA 4MHUA 3LFIA 2VZTA 1VRH3 3V0AA 2R1DA 3OBTA 5DABA 4QAWA 3ZFGA 1HKDA 1CAUA 1FOD2 1KITA 1YNAA 1RUE3 3VBFB 3QH6A 3OOXA 1BCXA 4OLLA 3O5SA 4CCMA 5KXBA 1SBFA 3WQ7A 3AZZA 2Y6JA 4TZDA 1WW4A 3J7LA 4RGKA 2PELA 5FQ0A 4LA3A 1CZVA 2HWB3 1I3HA 2QQLA 5JIAA 4DRRA 1H6YA 4XQDA 4QX0A 5H9RA 4CSWA 1DYKA 3H8OA 4XCBA 5AC92 4XABA 2BFUS 5APAA 3MLJA 3UJOA 1UY2A 1PX3A 3APBA 1GP4A 5SV8A 2J1EA 1VIWB 2HWD1 5A70A 1AR91 2OYZA 4AZZA 2PHLA 3KVBA 1YYNA 2GMMA 2VY0A 3AYEA 4GWMA 4PJYA 1R64A 3WDUA 3VKOA 2YXSA 3SKVA 5I8TA 2VUJA 1NOVA 4XUQA 2AR6A 4XBNA 3T09A 1FPN3 2O8QA 3T4HB 2WWSA 5HCAA 1MZFA 5IVFA 1QDOA 2VAUA 5T5LA 1HB1A 5GJ6A 4FO9A 4JX0A 4BK5A 4O65A 1AF9A 1D4M1 4FFHA 5FK7A 5ACA3 4ISRA 3THCA 3USUA 4XJAA 4JC1A 1SCSA 1OLME 3VBHC 1CVNA 4IE7A 2A3YA 1DF0A 1ASJ1 1JU3A 1RUE2 4OFGA 2ADDA 4CPBD 5EYXA 4UW4A 3RRDA 2VZQA 3I54A 3V0BB 3S30A 2BW8A 5FMOL 4P9YA 5T5PA 3WHUA 4QPWA 2ZX1A 3K77A 3RZLA 1SG3A 3VBSA 4BIOA 1W8FA 3OPWA 2E53A 5JOYA 1SFNA 2QCSB 2K0GA 3ZFGB 1QHDA 3VDAA 5K0UA 3DXUA 4IV3B 4A3ZA 3I49A 4K8FA 1LHOA 3M7AA 2Q8CA 3WVJA 4RS5A 1GNHA 2VNGA 2NMNA 3PMEA 3AP4A 4LMFA 4YGDA 1POV0 3OJBA 1VE0A 1N1SA 3MLKA 5FYZA 3T1MA 5KHJA 3O1VA 2CGOA 1D0GA 2PAMA 3BPSA 4JKLA 2JG8C 1C8NA 3IM0A 3WW4A 4AEDB 3ZN6B 1LOGA 1UAIA 1YQ5A 4EN0A 4MGTA 3ENRA 3M2MA 1YRZA 4QPIC 2VMGA 2HEWF 1VP6A 2V4AA 5C4WA 2WZR1 3OEAA 1TMF1 5FZ6A 2ID4A 3UGFA 1H9PA 3HOBA 4BLJA 1NCRB 3AMPA 1DGRA 3FHQA 4MH0E 4A4AA 2DVFA 5FZCA 3ZYGA 1ULDA 1POQA 5A3MA 3MFCA 1GV9A 3RZMA 1E5RA 2VU9A 3CBNA 2YB7A 1ZZCA 4XILA 2I45A 5GALA 1PGL2 4ATFA 4D7YA 5FDBA 2BJSA 4XETA 2R30A 4FP3A 1RUC3 4EWDA 1BVP1 1SDDB 2RS53 3FLRA 4IEUA 1W90A 5D8AB 4H7LA 4XZUG 2ZMLA 3QOPA 3LPFA 3C3VA 3BUCA 3FBMA 4Q4Y2 1IPJA 5GLVA 5DXDA 5JI7A 1CX1A 2ZTNA 3CNAA 3KSCA 4YW7A 1DQ1A 1E5HA 3IBMA 3O1RA 2BOJA 3LIGA 1DLCA 1Q8SA 4D7TA 1XNAA 1DQ6A 2P4EA 4OMDA 1ZZ6A 1U5XA 2P3KA 3KV9A 4RL7A 2F4PA 5FKBA 4ASLA 4E2QA 1JUHA 3O1UA 2HKXA 2W3JA 2Z42A 1AX1A 4YW4A 1PO13 4ET7A 1BYHA 2WSUA 4RHV1 2R073 1WWYA 4OHYA 3E6DA 4LHSA 4AFBA 5LBBA 1R081 2GH2A 5F5QA 3POYA 1V6MA 4G9SB 4Q4V3 5JZGB 5B4NA 1AR72 4P00B 5I8SA 1LRHA 1HN0A 4Q4W3 4KNCA 4LBOA 3P3NA 3H8RA 1V6JA 2DCYA 2R0FA 4IEVA 2IXLA 1AR93 2Y0OA 3ETPA 1PGL1 1J3PA 1MEC2 2LM3A 4HK8A 4NOTA 4B8EA 1S0CA 2EXKA 4QHBA 5T52A 2Y34A 3C7FA 1FPN1 4M3CA 3VBHB 2OX0A 1UY4A 4Y22B 5IW0A 3RYPA 2DV9A 3N9NA 2B45X 3KT4A 5CB7A 1JYXA 3HN3A 2PHRA 1QNYA 2IXJA 3I7DA 4IV1B 5A80A 3RZHA 2BNNA 5I91A 4R52A 5FZ0A 1CAVA 1IG0A 1W6NA 2JDHA 2W08A 1YQCA 1NYWA 5K7PA 4AQ2A 3KT7A 1SLIA 2Y60A 2ZMNA 3DV8A 1CN1A 4M00A 1O59A 4YGCA 5FXXA 5JCTA 1BZWA 3ZXAC 4MX3A 3AJZA 2ZJCA 1H8VA 3JXSA 4FQ4A 4QX3A 4JDOA 3J7MA 3VLBB 1W6MA 4J1WA 1WMFA 2A71A 1DU3D 3W9AA 3WUDA 3D0JA 3O1TA 4MGZE 3SCFA 1YCIA 1G9DA 1G9FA 1IPKA 1BBT2 3JUUA 1KEXA 4Z07A 3FUOA 1ZBA3 3EB7A 4FPKA 5FY0A 5KR7A 4JRLA 4QGLA 4K6BA 4JKMA 1RUI1 3IMNA 4HETA 3WDWA 2VGDA 5A7WA 4A44A 4CP1A 4QGNA 1CAXB 3AC0A 4L8QA 2JKXA 3F95A 4Q4X2 3AM2A 1A8MA 1FNYA 1PNGA 4IE4A 1K5MA 2X5IB 3B69A 3RQ0A 2CYFA 1Y9MA 1OF4A 2PMWB 2GMPA 3AL5A 2W9XA 3AP5A 1C1FA 2QQWA 3KHCA 1OPOA 3VZOA 4CDUC 4AI2A 1S1AA 3H1YA 2C4XA 1WMXA 5A1FA 5TSWA 1JZ3A 3RS6A 1BKZA 5H9SA 4RFT0 3ZKUA 3PUQA 1R1A3 3KGLA 2ZABA 4Q0VA 4H3WA 1JZ7A 1HXS1 2VZ1A 1NCQC 1NCRC 3IIIA 3NAPA 3OB8A 3W5NA 2FHRA 1NLQA 4LO8A 3ZM8A 3BN6A 5CFDC 4QPGB 4DOUA 4HFSA 4FTEA 2RM22 2LALA 2ZS6B 2GC0A 3GDBA 4XXPA 4OI0A 1PGW1 4FPYA 4DY5A 5ABJC 5KXEA 4MYEA 1FI2A 4AAPA 5C3SA 3BU7A 4M0HA 1Y9GA 4Y24A 2VUCA 4CU6A 1TME3 3UGHA 4WM7B 3RZJA 4BJ0A 1JN2P 3NV1A 3A0NA 3VBUB 5A7NA 4AI1A 3ZFEC 3ZYRA 2ZEXA 1SZBA 2XXZA 4MO3M 2GN3A 4MZUA 4ZXEA 5HXVA 4BYYA 4D6QA 5C9AB 2PYTA 5A6YA 2ZX0A 1DCSA 3JQXA 1GKBA 4BDVB 1IKQA 1OOPA 3GALA 1AR62 1SLTA 3DEMA 1KS4A 1GOFA 4MGSA 3BTXA 3J4UH 4I0WB 5LATA 3UGGA 5C8CA 2P2KA 3VD3A 5HI0A 4IV1C 4TLGA 1AXYA 4JTNA 4OHVA 3SH5A 4CCOA 2WR9A 4K40A 3VBRB 1QF3A 1UOBA 3PVOA 1XSQA 1W9WA 4JGZB 4XFAA 2FDHA 4HZFA 3WSOA 3C7EA 3H8XA 1PMJX 2AREA 5HV4A 5IYYA 3K46A 3GJBA 4DQAA 4WM8C 1J84A 2FCVA 1OXCA 1KD7A 5I0UA 4PQQA 1N3OA 4P9IA 3ZYPA 2CAVA 1RITA 2ES3A 3H50A 5FZHA 1AL21 1ULEA 3AZVA 1IG3A 4NWVA 4NPRA 3LZZA 1OHFA 1M4WA 2LS6A 4C0HA 5J3UA 4IGOA 2DUPA 3HNMA 2R32A 2FDIA 1VRH2 3NV2A 2X10A 3CIHA 4QDRA 1QY4A 2R0HA 4B1MA 3ES4A 3TN92 5CA6A 4V2VA 3I4IA 2AEZA 5IFPA 3ZVXA 2L9LA 4OI2A 3AZXA 5GZCA 5EHDA 2QQIA 4P02B 1B09A 4UBHA 1QJY3 1IKPA 5L9BA 4EWEA 3OBRA 4QGMA 3T0BA 1JOBA 4UFIA 4QU1A 1OURA 4AEMA 4IEQA 1LJ7A 3LF7A 5DUVA 3M70A 2Y26A 4NIIA 4GJYA 2QQUA 2BERA 4NHMA 3AP7A 1GOHA 3A22A 3D3AA 3DPRB 3L2HA 1Z7S1 5M0TA 4CP2A 2VVEA 4XJWA 1YHFA 4QQLA 4EROA 3PU8A 3BI3A 1H2MA 3OYWA 1WUVA 4QPIA 3ACFA 3PDQA 5L9RA 1O3QA 3GYDA 1SEFA 4A41A 2VQ0A 3KCYA 4QU2A 4YZ2A 5I8YA 3HQRA 1GSLA 4O9EA 5F3EA 5L9VA 1NA1A 2LROA 4HONA 2WNUC 4K9SA 3S7IA 1EPZA 3PUAA 4GULA 4CUGA 1RUD3 1WZXA 1W9TA 4FP2A 5A6ZA 4QB2A 5LEKA 1ZA4A 3SH4A 2XL7A 5FUPA 1UY1A 4LHNA 4IV3A 2FCTA 4GA9A 2WKKA 4QPGC 5FQ0B 1LR5A 3FZ3A 4XHXA 3K3NA 4COUA 3TN91 1RUH1 5FZDA 1IS3A 1JZ4A 3INAA 5IVJA 2ET7A 5JMOA 1CZSA 2JB4A 3PJQA 3NRUA 4CCEA 2ZGMA 4AQ6A 2Y6KA 2D97A 1FOD1 1C1LA 3M1HA 3RMXA 2JG8B 1NQDA 4LUMA 4ZHNA 1ZRRA 3VL8A 4XC9A 1VBE3 2BRTA 3UETA 1W6PA 2W5FA 2WRAA 4XMIA 4Z1VA 5JOXA 4BMBA 3VHPA 4BK4A 3N35A 4KU8A 3KVAA 4QKBA 2OIIA 3I3EA 4AVAA 4FSJA 4GWNA 4Q27A 4LEJA 4GWJA 4KWKA 2EIBA 3D6EA 2A6ZA 5FZGA 1XYNA 1W2NA 2OQ7A 2XJVA 5EZWA 3H1MA 1HX6A 2YG0A 1DP0A 2D5FA 5HBAA 3ABZA 3VZMA 3DGTA 4AEDA 2IC1A 2WFPA 4Y4RA 3NJXA 3VHNA 4DUWA 2QUOA 4UWDA 2A6YA 4FT8A 3LPGA 1IGOA 3DPRA 1R092 1OKQA 1NZCA 1W8TA 2XBO1 5DAVA 2IXHA 4GWIA 1C5HA 2DCTA 4M4PA 2PQQA 5F6LB 1ZRFA 2VXJA 4YVSA 4YZ1A 3WNLA 2KA3A 3FE5A 1RUD1 1OD5A 3VBUC 1UKGA 5DAWA 2HWF3 1ND3C 1LGBA 3IAQA 5F9TA 3B3QE 4AK3A 1GQHA 1D0HA 4YVSC 1FXZA 1XB9A 1XC6A 5A32A 3VUOA 3HT2A 4IE5A 2Z4FA 3LIHA 4QX7A 2IXKA 3MICA 1JW6A 1VBC1 4YGBA 2UWCA 1FNZA 4XUPA 4X6QB 5BNNB 2GDFA 4DZGA 4D6SA 3G6JB 1I1EA 3SISA 5EWSA 2YY1A 1G8WA 2VZSA 2RV9A 4BMEA 1POV3 3SXWA 2OUHA 2F6BA 3MUZ1 2PLV1 4C8DA 2VQUA 4XFHA 2DCKA 4W8JA 3O0WA 2DVBA 4BWOA 2JDNA 5F39A 3KCCA 2VCMA 3T1LA 1O91A 4E4DX 2R071 2EIGA 3K4DA 2W1WA 4BIFA 4XZPA 3CF6E 5A3TA 4ZZ8A 1N1VA 1ULGA 1R091 5JSPA 5FZBA 1BQPA 3UV9A 1WBLA 1Q8QA 4OMCA 5C71A 1AYN2 4HVRA 3IDEA 3LE0A 3PNAA 4FOYA 2ZX2A 3I2GA 4RYDA 3WP6A 1LTEA 2ZGRA 3OD0A 3SITA 1BMV2 3CL1A 2I74A 1TMF3 1U12A 4XW3A 3SKJE 5DPNA 2C0ZA 4NN0A 3CJIC 4FPCA 3B9IA 4HBNA 3NNMA 4RFRB 3IKWA 1S0JA 2X29A 1WW6A 1FATA 1J1TA 3WXPA 4K7JA 4A45A 1L7QA 4M0NA 5IFTA 4PCRA 5C3QA 1KGYA 1UIKA 3EBRA 3GZUC 3NJYA 3Q8BA 3WW2A 1K42A 4Q1RA 1UYYA 4YPJA 2HLEA 2NYYA 4JRAA 4XVHA 1HQNA 1NCQA 1ALYA 2A5ZA 3VKMA 3NNFA 4D7SA 4COZA 3VGIA 1F8VA 4JAAA 2GN7A 2Q8EA 3VBSB 5DZEA 4XURA 2RS13 2ZPXA 1W0OA 4EQVA 1QXRA 1DGRN 1IZ3A 3ILNA 5CIRA 1AHSA 1GLHA 1IHMA 3NW4A 3RZZA 2VOTA 4EWAA 5JXHA 3E6CC 3BVCA 2C1FA 2CWMA 2VH9A 3RZKA 1DG6A 1OSGA 5I0TA 2ZEWA 4S2DA 2P17A 5IK5A 4OI4A 3LDRA 5KHHA 1AR81 1AR82 4QQ2A 4GH4A 2FD8A 5IVBA 2R061 4EV0A 4Y5Z0 1MS3A 4QXCA 5FXVA 1PVC1 3K4AA 2QQKA 1ZBE3 4NHKA 4AI0A 1KJLA 2PLV2 1YFYA 2ZGNA 4I0AA 2YU2A 3MHZA 5DAQA 3T08A 3L2YA 5J1XA 3OF1A 4NVPA 3HD8B 3B01A 1RYYA 5G04L 1S0IA 1JU4A 3ON7A 3OUJA 1URXA 4EN7B 3PVNA 4XPVA 2F4LA 4L11A 3N36A 3IB3A 2RDNA 4Q4X3 2XJQA 2A70A 3NV3A 1W06A 2XBO3 5CZKA 3WF2A 3VD4A 1JYTA 1RVF3 1PIV3 2VNVA 4NRPA 1QJU3 4J25A 4LO7A 4OYUA 1VB2A 2ZHMA 3GJAA 4XF1A 3WLUA 3PUSA 4I3GA 1Z78A 3I2FA 3I97A 1RUF2 3W5MA 4XJ9A 4LA2A 4P9LA 5CFDB 3CHXA 3UT0A 4WM8A 4TSVA 1W9FA 1H8TA 3USSA 3LEGA 1I5ZA 2VC9A 3VBFA 1L7RA 4YG0A 2ZCWA 2KM2A 3EJKA 3O1MA 1GP5A 1QKQA 1H8TC 2AGSA 1QJX3 2RMU1 3OG2A 4Q8LA 4QD2A 4WM7C 4YLZA 3VV1A 3ZN5A 1DGLA 2DU0A 2ZOEB 2R062 1OFSA 3PHMA 5T50A 4EZ4A 1HRI2 2WFF1 4BQ1A 1YFUA 2ATFA 4I3PA 5EP9A 4JHZA 4LBMA 5IK8A 2JJ6A 1PO12 3MIFA 4UFHA 3WV6A 5JZGA 5FYVA 1YIPA 3VDDC 1TME1 2HH9A 1X8MA 4FQZA 4QX1A 4HLTA 3RFRA 4YG6A 4LHLA 3UK9A 2R16A 2J42A 4QX5A 1GNYA 4CXWA 1MPXA 3RGBA 3RWNA 3MFAA 2E31A 2ZZJA 4LULA 1LU1A 2D3RA 4XOGA 3WQBA 1BHGA 1D4M2 1ULPA 1HRV2 1E5IA 2UWAA 5FZMA 1HV0A 1I9RA 4FFFA 5FZOA 1EV12 1PVC2 3LCPA 4KGQA 1PVXA 3ROUA 3TRSB 3UJQA 3LEIA 4F3JA 3FBYA 2MEV3 2BU9A 4RN5A 4M3CB 5FXZA 3WDYA 3KM5A 4CCNA 1OLRA 2FQPA 3ATGA 2ZGLA 4YVWC 3VBFC 5FLHA 4GKXA 3ZFEB 3ZXJA 3N3HA 1F15A 2D44A 2DDUA 4Y5TA 4NPMA 1MQTC 3OUHA 1ENXA 2YYOA 2WO2A 2XQXA 1ND3A 1CAXA 3ZR6A 1OMIA 3N9QA 4KMQA 5FIXA 5IJRA 2FMYA 2XJPA 1B35C 4Y5SA 1LCLA 4Y4YA 4CP9B 4PLMA 5F32A 4BXSV 4Y3OA 1CAWB 5A7SA 4YM1A 2Y6LA 4K1ZA 2D6NA 1WCKA 5F1RA 2X09A 3EYPA 1RUE1 1IQDC 2P6HA 4BQWA 1AYN3 3C7GA 3NVCA 4YZ3A 2NN8A 5FFOC 3I59A 4AEJA 3H7YA 2VQTA 4KI5M 4PIYA 5DUXA 5FP9A 4Z8BA 2LTNA 4RHV2 3KD4A 3AFGA 4WVMA 3H7JA 3MUY1 4CVUA 5DUWA 2J1AA 1V9U3 4DB5A 1W2OA 5F2WA 5C4WC 5A7WB 4Y1UA 1LOFC 2HEVF 2PHDA 3POWA 4LBQB 2OVUA 5FY7A 3U0ZA 3RSJA 3AZWA 2MPFA 5LK5A 2VTFA 1FMD3 2FDGA 2WNUA 2BP6A 3AKRA 1ND2A 4LNVA 5GLTA 2HBTA 3WDTA 4MUVA 4ZU7A 1UW8A 3UESA 3ZLIA 5FPLA 3PLQA 2H0BA 3M3OA 3WF0A 1QJU1 5FZ3A 3VHRA 2BBVA 2CGPA 4WVZA 2CY6A 3MV11 3ME2A 3M3QA 3ZIXA 3VN4A 1TQ5A 1XYPA 2WYFA 2NPIA 4HSJA 5FTTC 5FP8A 3ZXDA 1QXPA 2NLRA 2QZ3A 4CU8A 3U4XA 1ZREA 2JECA 5FYSA 4BE3A 2G9ZA 1H1MA 5AVAA 3WP3A 4AVCA 2RDSA 4BB3A 5FY1A 4E4HA 3KV6A 5E88A 2GU9A 5FYTA 1JOJA 1X82A 1SHWB 1PK6C 4LBQD 5F5AA 2RM23 3EHKA 1CONA 1BXHA 2W94A 3WHTA 3HWJA 3M4FA 4XUTA 3KF3A 1VBB1 1HQLA 4WVMB 1VBB2 3E97A 4BQ4A 5LBFA 5FZ9A 5FYYA 1XU1A 1S2KA 2A6VA 5CFDA 4AHZA 4O7XA 3CEWA 1HXS2 1UNBA 3WZ1A 5HV0A
chains in the Genus database with same CATH topology
2ZGKA 2A7AA 1BBT1 4KU7A 2Q8OA 2EF6A 2XPJA 1KFXL 4CZSA 4H7MA 4Q0UA 2UY9A 4TWTA 3H3ZA 2DFCA 1H9WA 2FZ1A 3AZYA 2VMHA 2WT1A 3HIFA 1H30A 2X5IC 3NJZA 3OGJA 3ZSJA 1W39A 1RHI3 3BOWA 1XNDA 1W2UA 1HRV1 1GZ9A 2XUMA 1QNWA 3PTYA 4CDWA 2GALA 4META 1AR71 4U36A 5KHKA 1MQTB 5J09A 4YW3A 1D4M3 5LK7B 1G9BA 3B9CA 1IQAA 2XL9A 4WBBA 2WL1A 4AFAA 4N43A 1NE6A 3GBWA 5HCFA 4YNIA 1O5UA 1X33A 1JHNA 2EAAA 3UL2A 3KS7A 3NKGA 4KWLA 4AGRA 4XTPA 5HCBA 3D5OA 5J36A 2HWF2 4YW2A 5A32B 3MZHA 1MZ6A 4AHWA 5LEJA 2OZ6A 1WW5A 1OQDA 2RR12 5JPMB 3ECQA 2DCJA 2RM21 1O5LA 2IXCA 1JTZX 1VBD1 4N53B 2XVGA 3NL1A 2PLV3 3WP5A 1R082 2JE7A 4A7KA 2RS31 5DG1A 1QOOA 4Q4V1 2WSVA 3ZFFA 1QOTA 1FT9A 4LO5B 4ITCA 1DQ4A 2Z2SB 3WCSA 1H8TB 1RVF2 1GZCA 3OD4A 2R1BA 4JDNA 1R1ZA 2D6OX 3ZIWA 1H2KA 3ZO0B 1FPN2 4INDA 1Q3EA 2TNFA 2Y0IA 1RUH2 4N43B 1VAMA 3BALA 1XXNA 1DDLA 3ZFFB 2PA7A 1NA1C 4TLFA 1ZNPA 3WG2A 4RQPA 1OOPB 4NHLA 5CVRA 2VNOA 4ISQA 1PHMA 1YJKA 1V70A 1MS5A 1A78A 1N1YA 2RR13 2XH6A 1VBD2 1W6OA 3ZDSA 2MNGA 2UY8A 1VRH1 2K2SA 2JICA 2PHWA 4HK9A 1WCDJ 2GNTA 4PQ9A 3GNEA 4AQSA 3IWZA 2V09A 1C8M3 1VBE2 3OCPA 1SCRA 5C9AA 2HWB1 2C5DA 3ZMOA 2UU8A 3G7DA 4Q0SA 4F8AA 2BVVA 2QKDA 5JZGC 1OA2A 2R043 3FUQA 2O8OA 3GHMA 1ZRDA 5KXCA 2BFUL 4P14A 4LBNA 1EAH3 4YVWB 1DZRA 3V0AB 3MI8A 4Q2FA 2JG9B 3GHNA 1RC6A 3UKVA 1QQP3 3ZN6A 1QXJA 2WT0A 3WG3A 5J37A 4CEYA 2P34A 4R9AA 4WZFA 3ASIA 4MVTA 4K21A 4MV2A 4RD7A 2XLGA 1NXMA 2HWE3 3SCHA 1HQWA 5E1RA 2PAKA 4SBVA 1MQTA 5K9YA 1O3SA 4COYA 4FPHA 4LO6B 2PHTA 1D2SA 2C9AA 2XWJB 3WOGA 4C0BA 3POSA 3VDDA 5E16A 2OZJA 3WINE 3B7MA 1CQ9A 4NR1A 2XKPA 4YARA 1U5ZA 4LE3A 5DG2A 3BB6A 3LSDA 4KBBA 4HL0A 4Q4V2 4AGVA 4MGKE 1ULCA 2DU1A 2ZX3A 3H3UA 4IEOA 1JBCA 4FPLA 5FLIA 2ZMKA 2ZGTA 4CEWC 1SLCA 4ES8A 3LGRA 2BWAA 2HWB2 2DCZA 2ENRA 4XFCA 2WA3A 1QGLA 1QQP2 1VAKA 4FXGB 1JYCA 3HMYA 1LENA 2NQYA 4YVWA 2G4IA 2V5YA 4AI3A 3MDPA 4L9BA 1RUF1 1B35A 5FLJA 3EO6A 5FPZA 2WNVC 2QDRA 1N47A 1PK6A 3FFZA 4JGYC 4H55A 2G9GA 2RMU3 2XKOA 4IL7A 4E2SA 1HRI1 2WFF2 1F31A 2AH2A 3ZFGC 2WJSA 2A6WA 1SBDA 1ENRA 5CFCC 4E2GA 3LOBA 1UPSA 1G9CA 4W65A 4MXWB 4EN9B 4N53A 3ZXFA 3IDBB 5IK7A 3U10A 4X6RB 4CTEA 4B4PA 2OUJA 1ZM1A 3D4KA 3MPBA 4RR3B 3B5LB 1SFYA 4OULA 5FBZA 4CDWC 1FV3A 3RYRA 5KWRA 1BMV1 1RUD2 2WIIB 3BODA 1Z7S3 4HN1A 4R8HA 1EAH1 1U5IA 3P3PA 1E57A 3JU9A 4B3NA 3VL9A 2P37A 1XQNA 4IEZA 4BM8A 4CRQA 3CJIA 2GC2A 1LEMA 2MEV1 2AZ5A 2W0XA 4R4ZA 1YFXA 2RMU2 3KZ4C 1AL23 1XNBA 4Y22A 4XJUA 1O4TA 3AP9A 4ES9A 4GB32 5JDBA 4AFCA 4Z92B 2ZA9A 1H0BA 4BOWA 1LOEA 4S2GA 4Y20B 4CP0A 2Y38A 1S0BA 1TE1B 3FJSA 3HBZA 4M01A 2UWBA 4DINB 1N3PA 1QWRA 1X7NA 4Y1YA 3H1WA 2HWE2 4F83A 2BYVE 2VVFA 5BYNA 1J58A 1OA3A 1VJ2A 1YFWA 5DDJ1 5DZFA 5KXDA 4DY3A 4UW5A 4XF3A 3E5QA 1AX2A 2BNMA 5AC93 1V6NA 4WZCA 1QH6A 2PTMA 2CNAA 3AP6A 3D0SA 1NY71 3ZYJB 2DF7A 2JG8A 1NA1B 1AJKA 5T3NA 2R072 2A73B 1G6NA 1AXZA 2H6CA 4GB31 3QCWA 4GXLA 4JGZC 4XDQA 3VHOA 2E51A 2VW2A 3ACLA 3O0VA 1RUC2 1RUC1 3HAGA 3B02A 3MW3A 4XE9A 3VKLA 3EQEA 4AXOA 3JBG2 2BWCA 2HWE1 1NQJA 2WA4A 1RUNA 1VBC3 3VBHA 4PDWB 4AQTA 5JPNB 2ILMA 5EV7A 1RUJ3 4GIQA 4YW5A 5CG9A 2ZX4A 2JX9A 4Q1PA 3KGZA 3WDXA 2BQPA 3AJYA 3JZVA 4Y20A 1RHI2 4OI1A 2JENA 4OUMA 3V65A 1W6QA 3W59A 1AXKA 2JKBA 3BIWE 2HWC3 3AX4A 4PIZA 3QBQA 5BNOA 2B39A 1DYPA 4L2NA 2W68A 4B7KA 2VOWA 4IETA 4M3CF 3J8F1 4GMP3 4Q29A 2EXJA 1O4YA 3QLQA 4OHZA 5DDJ2 3B00A 1NLSA 4DS0A 4HSLA 1PM7A 4CEWA 4YM0A 4FPFA 1ND3B 3QH7A 5JSOA 1EV11 3VZLA 3WT3A 4LBKA 5SV5A 2RS52 4YG3A 4B4RA 2HWD2 2WNUB 3JCIA 5CFCB 5EYYA 4CDQA 1ONAA 5FO8B 2GSYA 1IOAA 3AMQA 4RR3A 5CU1A 1LKNA 3KLSA 4U2AA 5J7MA 1QMJA 5K8SA 3RDIA 2YROA 1ENQA 1C4RA 5FRAA 4AEKA 5JI9A 4KQ7A 4A7ZA 4WM7A 2W39A 1DQ2A 4LO4B 2RS11 4URTA 5FO7B 2ETEA 1V6OA 2XWBB 5GLUA 5CAZA 1XYOA 4KL1A 2BUKA 1HXS3 4L99A 4RSUA 2XG3A 2SLIA 1DGWA 5GZEA 3GZTB 4FOQA 2JDZA 2QVSB 2ET1A 4FXKB 4FPJA 4IV3C 5JWPA 4COWA 5BNQA 2CV6A 1DZTA 4WV8A 1AR83 2RS33 1AYM3 3WY6A 1VLNA 2Z5WA 1LESA 1R093 1QOSA 4RS5B 2BTVC 3ZSEA 3ZXKA 1RHI1 1EP0A 3ZXLA 3ELNA 1CX4A 3N7KA 4I02A 1UF2C 4AFDA 3WQ1A 1TME2 3PJYA 1EYBA 1MEC1 2WZR3 1AJOA 4X8PA 1TEIA 4CDQC 3CJIB 2HEYF 2QDNA 1UU6A 2ARBA 1PIV1 5FOJB 1PIV2 4CEYC 2QE3A 4UXAA 4PDWC 5H9QA 3SH3A 1W6MB 3JQWA 3MIDA 5EJ3A 2RR11 2EXIA 4IEYA 2XJSA 2X53S 1IS4A 5GLZA 5IT6A 3C2UA 4FAGA 5L19A 3VDDB 2DVGA 4PBPA 3SLIA 2Q4SA 3FX3A 4Q0PA 1CIWA 2BPA2 2ZGUA 4DPNA 5A33B 1F5JA 5CADA 2E7QA 4XMAA 1JYIA 4HVQA 5KC5A 2CWSA 4YRDA 4FBFA 1QJY1 1VBE1 4HPKB 1RUG1 2VECA 1OI6A 2ZHNA 1UCXA 4P9XA 1ZBE1 3RI9A 4N9IA 1RJ8A 5GLWA 4CDXC 1JUIA 4A2UA 1SLAA 4PF5A 2VULA 3OGGA 4Q4W1 4QQOA 4AE2A 3WG4A 1COV1 2XLFA 1YIFA 5T5OA 1MEC3 3VKFC 2ZHKA 4YVSB 2D6LX 1NLRA 4YZ5A 4Q4X1 1EV13 4ASMB 1YWKA 1U5YA 3DL3A 1OQEA 3N7LA 4EN8B 2ZKNA 1ZZBA 3JD72 1GR3A 3BPZA 4QPYA 2YGMA 2WNVA 4F7ZA 5ACA2 3AKSA 4AI8A 3TN93 1RMU3 5BPXA 1NCRA 3N4MA 4IEXA 5GKAC 3URFA 4OHWA 4XFBA 4AW7A 4P9JA 2QFEA 2HWC2 4IEWA 2AYHA 1GNZA 1S55A 3CLPA 3CJXA 3TB0A 4MXVA 1BJQA 1BK1A 1H1IA 1WGPA 4KWJA 3MGUA 1HRI3 1WBFA 3IIAA 1AYM1 5FAXA 3AB0A 1LOAA 3GF6A 1VALA 4JCKA 1DGWX 4FTBA 1F9KA 5GZDA 2H6BA 4YM2A 3J26N 2B46X 3FFQA 3NV4A 3WNXA 4AVBA 4LHKA 1L3JA 4Q8KA 4QM8A 3WW1A 4XBQA 2BVBA 1CAVB 1W6NB 2D7FA 4BA6A 1LECA 3KMHA 1RUG2 1SLLA 3ZFFC 4OHXA 5A3LA 3MF6A 4HKOA 5GM0A 3SNMA 1C57A 4NWWA 2CTVA 2MHFA 1XE7A 2VOKA 1OQ1A 1FYUA 4Q0QA 3WG1A 1CGPA 2XVKA 5T54A 1Z7S2 2YMZA 5A33A 1H4HA 4LT5A 5AFEA 5BXXA 4BPZA 1MZ5A 1YI9A 2DWRA 2VMIA 2BEOA 2TUNA 1KXGA 2XJUA 4S2HA 4RR3C 1GYKA 1V6KA 2PN5A 1G9AA 1V6LA 2EALA 3DKWA 3UKTA 1PZ8A 2GNBA 3N7MA 2OPKA 4B4QA 3JD71 4P9GA 1TNRA 1UMZA 2XJTA 2YC0A 5BNNC 5IK4A 5JR7B 2O0OA 1XU2A 2XVLA 3CO2A 2WINB 4AVVA 5C4WB 2D5HA 3LA7A 3H8UA 4ZU5A 3GBGA 1CD3G 2Q1MA 4KG8A 5CBLA 2O1QA 3IPVA 4CDXB 1O3RA 3AMHA 1A3KA 3B94A 5JVVA 2B9UA 4ORFA 1BBT3 1LHVA 5T5JA 2HYKA 5J96B 3ZSLA 3M3EA 3WX5A 5BNPA 4D69A 1X8EA 4E9KA 5C9AC 2ZAHA 4UBGA 1SQ4A 2HWD3 1AUYA 5E89A 1QDCA 2P3JA 4FCAA 1H4GA 1EAH2 1UL9A 1ULFA 5DZGA 1RINA 4ATEA 4DMIA 1UKRA 2D40A 5CG8A 3A0KA 4WM8B 3IT8A 2NP0A 3UKNA 1C8M2 1J3RA 2RHPA 1V00A 3JB4C 5CNAA 1J59A 1B35B 1ZRCA 1OA4A 1YLLA 3CU7A 1RUJ1 1AL0G 2TEPA 2I07B 2K9ZA 5LRRA 1CESA 2WFF3 4AHYA 4YZ4A 3WQ0A 1DQ0A 1VR3A 1UZZA 4A3XA 1ZZ9A 1VBA2 1WLCA 3AK0A 2RS32 1GZWA 1PZ7A 2P3IA 3R4UA 4AYUA 1PZ9A 2Q0AA 1AR63 2YGLA 1DFQA 4QM9A 4ZKTB 3VKNA 5JOZA 2JE9A 3H9AA 1GBGA 1ND2C 2WS92 3SCGA 1FMD2 4K3UA 3M3IA 3RJ2X 2JG9A 2QZ2A 2WNEA 1W6OB 1X50A 3OTFA 3RNSA 4BH9A 1SBEA 3KQRA 4JQRA 5J98B 3OYWB 4OVEA 3RJRA 4W6XA 1LULA 1S0DA 1ZVFA 2QJVA 1YO8A 1QH7A 1DHKB 4A7YA 2IFRA 1ZX5A 3JBG1 3VZKA 4D94A 3RYKA 4SLIA 4AG4A 1RIRA 3HT1A 2VVDA 1BEV1 2UURA 4N7UA 3HQXA 3R05A 4EN6B 1H1AA 1KDKA 2GMEA 1S0GA 1FOD3 1V6IA 3SMHA 2GC1A 5D1IA 1C8M1 5DDJ3 2VNRA 1Q56A 3GZAA 3B93A 3RI8A 2R6QA 2FZ2A 1PO11 3MF9A 3Q9OA 1UIJA 3AYCA 3WW3A 2PHUA 2BNOA 4LBLA 1FAYA 4DRVA 1C3HA 4G3YC 4EJRA 4CDQB 3J9SA 3J8F2 2DFBA 1REDA 1O7FA 2R041 5L7OC 3ES1A 4XFGA 4CEYB 4PIXA 3LSEA 4TYSA 5B2GB 1LOBA 1TMF2 2LUWA 4Y26A 1Q8VA 4L92A 3BTAA 1A8DA 4LLFA 1OOPC 5C33A 5KC6A 3EXUA 3S7EA 2UYBA 2VG9A 3MYXA 3VZNA 4CDUA 1SMVA 4MLOA 2WLPA 1PK6B 3ETQA 1QQP1 2VW0A 1MS0A 2I2SA 4PLNA 3VBOB 4XJZA 1KJRA 1LEDA 3SHRA 5GZGA 4E4ZA 1F5FA 4C1XA 3MIHA 4XEZA 2B42B 1RUH3 2G9FA 2GH8A 1MS8A 3V64A 1BEV3 1UPIA 1XNCA 3WDVA 5D8AC 3VZJA 2RJLA 1DBNA 1ASJ2 2Z69A 4QT6A 1RB8G 1LHUA 2ZGSA 4N53C 1U0AA 1AYN1 4Y1ZA 5C8WA 4PLOA 1XNKA 3MPPG 2WZR2 1KQRA 3RMYA 3R0RA 1YJLA 1WW7A 4AHXA 1V9U1 4AVSA 3ZMNA 3TNQA 2X8KA 1TNFA 2WQ4A 4GH4C 2VPVA 3BCWA 3PVBB 2IXIA 4E27A 5BNOC 4BHPA 2E9QA 4XF4A 3V56A 1NG0A 2DUQA 1W6PB 1S0FA 2WS93 3BOPA 1R1A2 2JEMA 4RQPC 4WVWA 5JAXA 4CYDA 3WUCA 3ZXEA 2R042 3OPZA 4FTSA 1FX5A 3FLPA 4XIKA 2PHXA 1C5IA 2D6KA 1G86A 3E5XA 1LHNA 4CDUB 5LRSA 1M06G 3AYDA 3AXDA 5C8CB 1CAUB 1S2BA 2D3SA 2YPJA 1DQ5A 1ND2B 4R9DA 5KHGA 1HIXA 1OLQA 2E7AA 1BVVA 5ABJA 4XXAA 1APNA 1GQGA 3IN9A 1V9U2 3TYJA 4BCUA 4RS5C 2IZWA 2JXAA 1O4ZA 1UU4A 3ZX7A 4RHV3 2NZ9A 4X8NA 4RGGA 2XLAA 1KS5A 3GBFA 5JLVA 3MW4A 1GICA 3QACA 3S6PA 2B5HA 5ABJB 4UW3A 2PFWA 4AF9A 4GMP0 1UD1A 2DTWA 4MGYE 1COV3 3I8TA 1ZYBA 1WLTA 1ZBA2 4KG0A 2EAKA 1N3QA 3OY8A 4JGYB 4GKYA 2JD4A 3LA2A 1KDMA 1RTVA 2MEV2 5BNPB 3NKTA 4D3WA 1CR7A 2OW4A 3VBRC 4OZXA 4XTMA 4Q4Y1 1R1A1 1NXD1 3U07A 1RL3A 3VBSC 5E8AA 4M3CE 1S0EA 4LTAA 4J6GA 1MS9A 1HLCA 4S2FA 2AUYA 1VBB3 1ZBE2 2W52A 4K20A 4AGGA 3I2DA 1F2NA 2Z79A 2N7GA 4B7EA 3WR0A 1RUG3 3MLLA 3ZN4A 5BNPC 1MS4A 1LOFA 5AC91 5K0UB 1ZBA1 1QU0A 2R063 5FMOS 1W6QB 4XIOA 2ZGOA 3AXEA 4RQPB 2VW1A 5AVPA 4CDWB 1CJDA 4B29A 3R4SA 3QD6A 4FVVA 2H0VA 3DPRC 3LOIA 1KRIA 4XQWA 2DYCA 5GZFA 4V1PA 4LE4A 1REEA 4N7IA 4PDWA 4AEDC 3R4DB 1UX6A 4BLIA 4R9BA 5I93A 1QJU2 1WA4A 4JV4A 3NO8A 4PBOA 5EXOA 5JSRA 4W6YA 5FOBB 1RMU1 3HN1A 1ENSA 3FLTA 5I0SA 3D82A 2QQPA 2RS51 2DUOA 2YZ4A 2VXRA 2WNVB 2ZACA 5JIUA 1MS1A 2D6MA 3L9JT 1XE8A 1Y3TA 4DFSA 4RGAA 1LGCA 1AYM2 5L7OB 1J1LA 2ZZQA 1SLBA 2E6VA 1PNFA 1RJ7A 4KGGA 1QJZA 2E63A 2EXHA 4P5HA 4AFMA 4C90A 3ALQA 2RS12 3KB5A 4K1YA 2PHFA 2HWC1 3LB9A 3MIGA 2D93A 4COVA 4BZ4A 1EY2A 1PVC3 4FAHA 5JMCA 2GC3A 1LODA 3D8CA 1WD3A 1PGW2 1FV2A 4Y1XA 1SDWA 2B7YA 1A6CA 2Q30A 4HT1T 3J8F3 3THTA 4IESA 1X36A 1RUI2 1YI7A 3ILFA 3ZFEA 3AKPA 1NE4A 1Q43A 4RA0A 3HR9A 1YUDA 4HKWA 1PMIA 1UZYA 2ZGPA 4GB33 4LLOA 4YFWA 3FWEA 3VBOC 2ARXA 4MXWA 5T55A 3LA3A 4FPGA 4YW1A 3ST7A 4N43C 1WCSA 1H2LA 2SBAA 4JGZA 4R9CA 5ACA1 5L73A 1K5MC 4AVTA 1H2NA 3I59B 2TBVA 2DVDA 4Y1VA 1RGSA 1VAVA 1DZQA 4GH4B 3ZSMA 3X29B 3AYAA 1OPMA 4XHBA 4E4SA 3PVEA 3LWCA 4I01A 5H9PA 2RJKA 1Y9QA 3IPVB 3FMGA 4FOWA 4MSVA 5FPXA 4C1WA 4AWDA 1D2QA 2ZBJA 3A4UA 5BNOB 2Q1ZB 1LGNA 3O14A 1NCQB 3MIBA 1MR5A 1R083 3AFKA 4FOVA 4OUSA 4IEPA 1VBA1 1EPWA 1MVEA 2B8MA 4YFZA 5KHIA 3W58A 3ZSKA 4YYOA 3FC0A 3NAPB 3NWKA 3KCXA 5C8CC 4CEWB 2R49A 1AR61 2CAUA 1O3TA 3TBDA 4IV1A 2D43A 1FMD1 2NMOA 1AZDA 3OY8B 4ZXKA 2WT2A 4XYXA 1XRUA 4HKLA 4QQPA 1HRV3 1LU2A 3RG0A 4R4XA 4P9WA 3AKQA 1KFUL 1YXWA 1WMEA 4Q4W2 1SACA 2HWF1 2XGXA 1REFA 1Q8PA 3ZYIB 2AENA 4LBQA 1RMU2 1LOCA 2A3WA 1AL22 1VB4A 5J48A 4Q4Y3 3O0XA 5F6KA 1W0PA 3NAPC 3ZPYA 4JTOA 4XBLA 5D8AA 3VBRA 1J3QA 2A6XA 4FPOB 1Q8OA 2WLQA 1QJX2 2WZPP 2DVAA 3ZXGA 1CJPA 4YGEA 2CL2A 4HANA 5BV6A 2PAEA 1POV1 4YSFA 1CAWA 4N9HA 1QJY2 3DUIA 2GNMA 5C6CA 3ILRA 5IUQA 1UU5A 2FBEA 4HN0A 1Y7BA 3TNPB 4JVAA 5AFBA 1WLDA 2D98A 2XBO2 4O9GA 2KXLA 1AX0A 4LUKA 4YM3A 1JXNA 2CGNA 1RUI3 2VOVA 1MVQA 3AMMA 3E6BA 1COV2 3T2TA 3K48A 2A75A 1CPNA 4XJ8A 1PO22 1PO21 1CPMA 4H14A 2EVXA 2WS91 4QPGA 3TAYA 3JB8A 3WD5A 1RVF1 1HV1A 3S0MA 3M3CA 1G7YA 4UW6A 3V0BA 4QMAA 3JBG3 2GAUA 5BNNA 2RE9A 1LB2A 4XF0A <