4QPJC

2.7 angstrom structure of a phosphotransferase in complex with a receiver domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
120
structure length
120
Chain Sequence
b'GSMRVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGIDLGKLYDYDIILLDLNLPDMSGYEVLRTLRLSKVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIHAIVRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphotransferase
publication title Structural asymmetry in a conserved signaling system that regulates division, replication, and virulence of an intracellular pathogen.
pubmed doi rcsb
source organism Brucella abortus
molecule tags Signaling protein/dna binding protein
total genus 41
structure length 120
sequence length 120
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qpjC00
4RDCA 2HJ9A 4MRMB 3C3MA 1KGSA 2JB9A 4MR9B 1M2EA 4B09A 1H9CA 4NQRA 1ZH4A 5IC5A 5JS2A 1EHCA 1TVMA 3EDCA 3JY6A 4L4UA 5CNMA 4Z9AA 4CBVA 1LJLA 3L49A 4WWHA 5TPZD 3NNNA 1E6KA 1D1QA 3LUKA 4PEVA 4RV5A 2OQRA 1R8JA 2FN8A 3CNBA 1CHNA 1U0SY 3N6VA 3ROTA 2F8SA 3JPWA 4W5QA 1AB5A 4G0MA 4XFKA 4KRFA 1VPWA 2WRZA 4WUTA 3N8IA 3RQIA 2PAFA 5HKOA 1DBPA 4G0XA 4GNRA 3SM9A 4MAAA 2E4ZA 3UUGA 1QPZA 1BAPA 3HEBA 3F73A 2LPMA 3GWGA 2AYZA 1ZESA 3DGFC 3CLKA 5IX8A 3RVJA 2NZVG 3N0WA 2WJAA 3QLUA 4D74A 1M2FA 4RWEA 1J56A 1ZGGA 3I42A 1Z26A 2A9RA 3IP6A 1D4ZA 3I45A 5KWSA 1QNLA 2M98A 1Z13A 2JVKA 5IUKC 1A04A 4MS3B 2MYUA 5KQMA 2RJNA 3H1GA 3MIZA 1ABEA 3H5TA 3QLUC 5FBHA 4W5OA 4FB4A 3OM0A 2A9QA 3QX9A 5HQJA 1Z15A 2JK1A 2J48A 5CNIA 3QELA 2W42A 3TX6A 4PZ0A 1MIHA 2F8TA 4XASA 2QU7A 4W5TA 4RXMA 4M88A 2MYPA 1FQWA 5EWLA 1JHZA 3O2SB 1PEYA 3QEKA 1YK0A 3QK7A 3KCNA 5JNVA 3NNSA 3OQOA 2YHBA 3LUFA 1E6MA 2GX6A 3IPCA 3HM9A 4TMYA 2FEWB 5C5CA 3CRNA 2MYNA 3G85A 2QZJA 3GYBA 2O20A 2MYTA 1EWVA 3N0RA 3OLYA 3OMXA 4OLAA 1DJMA 3CU5A 3LFTA 4H3KB 5BR1A 3GT7A 4RK4A 1F51E 5EWJA 1TLFA 1URPA 2QVCA 3F7NA 3FDFA 3GA5A 4G86A 4Q7EA 4QYWA 2QV0A 3O1HB 2WB4A 2B4AA 1ABFA 4OTZA 4RY9A 4YV7A 4W5RA 1W9HA 2ZAYA 2JVJA 4Q6WA 4XARA 4EGSA 2NZUG 3Q7TA 1KRWA 4MR9A 2FXIA 2H0AA 3NHMA 3BILA 3HJFA 1JYEA 3E3MA 3EGCA 3MQ4A 2RDMA 2LIVA 4G0PA 4RY0A 1GCGA 2WWVD 4RS3A 3N0XA 3K9CA 3I5AA 1PUXA 1NTRA 3M9WA 3BRQA 3IP9A 2R47A 3H6GA 3SQNA 3KYJB 2P4UA 3DLHA 1NXVA 6ABPA 3QLVA 1ZAYA 1YS6A 4O1IA 5TPZA 2FEPA 2QW1A 2MSKA 2B1JA 3IP7A 1L5ZA 1P2FA 4IILA 1M5TA 3TO5A 3LUCA 4JA2A 5BRJA 4JB0A 3A10A 3FFWA 3FGZA 3H5OA 2IPMA 5EWLB 4MPTA 2XDYA 4EYKA 2PUFA 1JFVA 3O75A 4JP1A 2JVIA 2R25B 1Y1LA 2CWDA 1LK0A 2FKAA 3F6PA 1C0EA 2ZWMA 5JS1A 4G0ZA 4Z99A 1LBIA 1E2BA 4MLCA 5DLEA 3CTPA 2GI4A 3O2QB 3JS5A 2HPHA 4RSMA 4Y9TA 2I6FA 4D6XA 2L19A 1PNRA 3RVOA 2HQRA 1I3CA 3T6KA 5EWJB 4F12A 4KK3A 1JFSA 3OLVA 4MS4B 5D2CA 2KYRA 4Z0NA 3HUTA 1SRRA 1U8TA 3VNBA 4IGAA 1YMVA 1ISRA 4LDAA 5DCLA 1XHFA 4PYRA 3URMA 4ZJPA 3QEMB 4N41A 2QR3A 4LE1A 4IMIB 4KFCA 3GBVA 4EYGA 3JVIA 4H3HB 3OM1A 3SAJA 1NXTA 3MM4A 2R48A 3R0JA 5TQ2B 3HVRA 5JNUA 1FSPA 1Z2DA 1D5WA 2FQXA 2P9HA 2VK2A 4KNYA 1P6UA 4NICA 2FEKA 2OENG 1BA2A 3RVMA 1NXPA 4P98A 3HO1A 5F64A 3LOPA 1CYEA 2L18A 2QSJA 2PJUA 4MR7B 2JBAA 5KQGA 1SD5A 3A0RB 3BRSA 4MQFB 1EAYA 1TM2A 3B2NA 3LUJA 3OO0A 4YO7A 4OLBA 3DBIA 4PE5B 1VLZA 3RVQA 3LUGA 1XWWA 1ISSA 2FLKA 2E4UA 1U2PA 4EUKA 2WMYA 1MB0A 3NHZA 1ZITA 3ROFA 1SXIA 2MSLA 2YHAA 4NV3A 1JX6A 2TMYA 5HM6A 1A0OA 3KTOA 4EYQA 1WETA 1CEYA 1QQAA 5DKFA 2FSPA 3ILHA 1EWTA 2PL9A 1LBHA 1NXSA 5CNJA 2LUOA 4Z9BA 2IPNA 1OXBB 3L6UA 5EWMA 1K66A 3EQ2A 4KMRA 4W5NA 3HZHA 4WXMA 2HSGA 3N53A 2CD7A 3BBLA 4F8JA 3RVKA 1JDPA 1ZN2A 1C4WA 3CHYA 3T95A 2FMKA 3CZCA 3QX8A 4DQDA 4RXTA 4WZZA 5IEBA 1YMUA 5KQPA 2A9PA 2LP4Y 1QQBA 4YRZA 1MVOA 3HK2A 1SXHA 1JL3A 2IKSA 2AYXA 4MS4A 1YIOA 1D2AA 4Z4CA 2NT4A 4RU1A 1FFSA 3LKBA 2HQOA 3S99A 2JBAB 4QICA 2L17A 2ID9A 3HCWA 1IIBA 2FMIA 3QEMA 3QLTA 4IRXA 1NXWA 4ZMRA 3KG2A 2V0NA 1JF8A 2IPLA 2FLWA 4MQEA 3Q9SA 1BVHA 5DGCA 4OATA 3DGEC 4G97A 5TQ2A 4OBBA 2IDMA 3UK0A 2E4WA 1Z16A 3EULA 1Z2EA 3UKJA 1A2OA 1LJUA 3HSYA 1PHRA 4JB2A 1W25A 2M1ZA 4E7OA 3O1JC 4JAVC 3NNDA 3T8YA 1EWKA 1DC8A 3IPAA 4MR7A 2PUEA 4MYRA 3G1WA 1ZHHA 3HDVA 4MQFA 1MAVA 1U2QA 4NCBA 1NY5A 2IPAB 3KLOA 5EWMB 3SG0A 1Z12A 5TE9A 4KVFA 4MS1B 2PKXA 2MSWA 3QLVC 1DRKA 3CG0A 3O1IC 1UDRA 5C5EA 1FFGA 3TD9A 1DBWA 1GCAA 3P9YA 5GOTA 3GRCA 3Q41A 1EFAA 1YTUA 4ETIA 2PUAA 1QO0D 4RK7A 3KS9A 3H1FA 4Z4FA 3LKVA 4MR8B 4Z4HA 1JH9A 3I09A 1YK1A 4HYEA 1RNLA 3OLXA 4ZPJA 1Z18A 1SXGA 1HEYA 2R4QA 4UHJA 1NXXA 4EVRA 2RGYA 1GUDA 5KQLA 4RK1A 5T7BA 3D8UA 2NT3A 2A9OA 2FMHA 3RVRA 5FWXB 3T38A 1RZRA 4KK4A 1DCMA 4MLDA 1DG9A 4Z4EA 3KLNA 1QP0A 1BDJA 5TQ0A 4MQEB 4G0OA 3IDOA 2LBPA 3EQZA 4EVQA 9ABPA 3C97A 4E7PA 3H1EA 4HNQA 3H5WA 2PUDA 3O74A 3H75A 3SY8A 3OQNA 2BGGA 1VKRA 4LRQA 4QPJC 4RKQA 4RKRA 4XLTA 4F3TA 2E4VA 5BRAA 5ED4A 3BREA 3LUDA 4YP9A 2PE5A 4ETNA 2FW0A 3OLZA 4RZSA 3RVSA 2E4XA 1QKKA 5JNRA 1S8NA 2PUCA 1ZDMA 3NBMA 4KREA 3KHTA 3JVDA 3HS3A 4XXHA 4G0QA 2L2QA 4TLMB 4DN6A 5CNKA 1DP4A 3KSMA 4XAQA 1NXOA 1E6LA 1ZGZA 4EVSA 5FWYB 4YR7A 4FE7A 1PEAA 1U04A 5PNTA 3F6CA 4ZYLA 1DBQA 1DRJA 4KQ9A 5BQ3A 2CHEA 3CFYA 1ZH2A 4P1ZA 1KMIY 4QYMA 1RZRD 2ID7A 3GL9A 5TPWB 1F4VA 4O5AA 2FTKE 5IEJA 1B00A 4MS1A 5DTEA 1Z25A 3IP5A 4N0PA 5GQSA 1BDIA 4EYOA 4JASB 4EY3A 3RH0A 5TQ0B 4RXUA 3C6QA 4LX8A 1DCKA 3OMWA 1TJYA 1Z17A 3Q15C 1USIA 2DRIA 4HNSA 4HNRA 3JPYA 4MGEA 4MR8A 4DADA 2HQBA 5CHYA 3SNKA 3A3KA 1JYFA 1ZY2A 4RK6A 4ZMSA 4FE4A 3KJXA 5ABPA 1QO0A 1L5YA 4OG2A 4YLEA 1JDNA 5IULC 4NCAA 4JOQA 1TMYA 5FWXA 4GPAA 3O2JA 6CHYA 4Z4GA 2PUGA 2JRLA 1VRVA 4Q6BA 2WY2D 3JTEA 2FQYA 1RPJA 4RK0A 5T3YA 3ILYA 1QP4A 3RVLA 1DC7A 2H3HA 3HDGA 3MA0A 1MB3A 3C3KA 2FVYA 4N0QA 2GBPA 2PMCA 5KI6A 3RVNA 5KC9A 3HXMA 2PUBA 4KZKA 3LTEA 1JWLA 1JLKA 1YS7A 1YVUA 3Q7SA 7ABPA 8ABPA 2QXYA 5JNSA 4LE0A 5TQJA 3CZ5A 1QP7A 1D1PA 2PLNA 3E61A 3H6HA 3Q7RA 4YS6A 5FBKA 3MF4A 3W9SA 5JNWA 1DCFA 4IF4A 4RY8A 4MRMA 4YGXB 5E3JA 2Q5CA 4WT7A 1ZVVA 1T34A 3H5VA 3D02A 3LUHA 5IBQA 3HV2A 4L85A 1USGA 4YCSA 5JNTA 1M5UA 3MYYA 1USKA 4LDZA 3M9XA 1AB6A 4RK5A 1P6QA 3LMKA 4G0YA 1JBEA 4D6YA 1K68A 2JCGA 3H5LA 1OXKB 2X7XA 1P8AA 3CG4A 3FFTA 3GV0A 5FWYA 1DZ3A 3FFXA 4N76A 3DZDA 4S05A 2FN9A 3CS3A 2GWRA 2FMFA 4Z4IA 1GUBA 3EODA 2QVGA 2CHFA 3O21A 3CKMA 5I4CA 1KRXA 3LUAA 3QELB 3TMYA 1XHEA 3K4HA 3TB6A 4N03A 3DLBA 2PL1A 5IUJC 3FMVA 3EJWA 1QMPA 5TPWA 5HSGA 3H5IA 4TLLB 4H60A 3C3WA 3GBPA 4KV7A 1GLGA 3OO1A 4ML3A 4KPYA 1FFWA 4F11A 3M6MD 1NATA 2NUBA 4O1HA 4UHKA 2GKGA 1JFTA 4N47A 1RXIA 3EAFA 5IUNC 4PICA 3KKEA 4MS3A 4TN5A 4YWHA 4LE2A 5B3JA 2WJWA 2VUHB 2E4YA 4KQCA 3KYIB 3RVPA 3MMNA 4F06A 3OLWA 2VYCA 3OQMA 2VUIB 5KC8A 3HUUA 1RXEA 2FQWA 4IMJB 4WXEA 2IOYA 1PNTA 1APBA 4S04A 4LZLA 1BDHA 3N75A 2RJOA 2IYNA 3A0UA 2N9UA 5B3JC 4ETMA 3VNAA
chains in the Genus database with same CATH superfamily
1B6SA 4D82A 4P7GA 3DE4X 2GPYA 3C3MA 2RHHA 2PWZA 1LC3A 3PQFA 4A0GA 3BWEA 4B3XA 3WTBA 1J7JA 1SXQA 1HT0A 1X92A 4KE7A 2Q3JA 2PX5A 1KXJA 1JWBB 1PK7A 4E14A 7ADHA 4ILKA 2OEPA 5FI5A 2FZ4A 5DZSA 3SYNA 3OOHA 3ZGLA 4YLGA 5A5VA 1A8QA 3CH7A 3DOEA 4NJEB 4RVFA 1ZKDA 5T6MA 3SGLA 4BBJA 2RCYA 4KTTE 2WVGA 1R4NB 2QMQA 3EEYA 1IOZA 1PL7A 4R3NA 1OFHA 4B4VA 1ZI9A 3OX4A 1T0HB 5EHZA 5JISA 1XX6A 4G3XA 1FRVA 5CVTA 4NSNA 4CDMA 3RSLA 3OP1A 1XYVA 1K6EA 1SUFA 1R64A 1ZGCA 1P7PA 1NX9A 2OSVA 2WC1A 1AUPA 2GCNA 3L40A 3ZK7A 4EATA 1A3CA 3ASUA 2AYZA 4MO9A 1ECJA 1MB2A 3UXHA 5EINA 3QLUA 3AEQA 2V45A 2O8CA 3BCRA 1DT5A 2AOVA 2QU8A 2H2WA 4GXRA 1M2VB 1ZWLA 1IXRC 2JD2A 4IXWA 4GP9A 4JIGA 1OLXB 2GPAA 5EMMA 1AY0A 2DQKA 2Q6VA 4KBYA 1TPZA 4MS3B 2CMDA 1DV2A 2J30A 4EHNA 2VYQA 4OXQA 1U2GC 1J8MF 1DG1G 3JZMA 2BEUA 3KKNA 3ULKA 3VAAA 5JAPA 1NI3A 2J3MA 3JQAB 1AE1A 3QELA 1KDOA 5AK0A 3OESA 4A0HA 5JASA 2IH4A 1N4AA 3R7BA 2OWEA 4G5SA 4ZHQF 2W2KB 1CJCA 2J67A 1NOIA 3OPQA 3DDWA 1JHZA 2YS7A 3WWYA 1F4PA 3SC3A 3CLTD 4DLNA 3K9FC 4JC0A 2J46A 4M1EA 4DIFA 1B0PA 1B74A 2JFFA 1DADA 4JLBA 3SR4A 4BLSA 3LP8A 4BNIA 3WGQA 5IWAB 3FX2A 3W5AA 2NQTA 3BG5A 1QX3A 2HXGA 3IR7A 4JYZA 1EWVA 4XX0A 4PNEA 4UBOA 1H9AA 2X5KO 3B13B 3VPAA 2F3UA 2JI8A 4KUHA 4BFWA 1KOGA 5T8KC 1TUEA 1NPTO 2CWWA 3OZVA 5K4AA 2ZUDA 2GSDA 3FDFA 2HIHA 2HBZA 3UMYA 4LF4B 2YY7A 3BDVA 3ICQB 3HQ4O 4UUOA 2QVXX 3LCMA 2R68A 1KDPA 3Q7TA 5FKJA 4LOIA 4IFTA 3WIOA 1TVKA 2W8ZA 1ZN7A 3EHDA 3PGVA 1E2HA 4M1QA 4LV8B 1JYEA 1XE3A 2QTVB 4N5IX 5GADl 4PZLA 1GN8A 3TAXA 2B1QA 3D3EA 3L8GA 4DR3B 3RRZA 4A91A 4FI3C 1T36A 1ISHA 3QOWA 3V4OA 2PRIA 3HLKA 4CLHA 2Q4RA 2ZAOA 2ZQYA 2F64A 3AJ9A 2UKDA 3H6GA 2EJCA 3INYA 2RIRA 3IJEB 3M6UA 1PVVA 4G5OA 1ZGAA 1JQEA 1MV5A 4ARUA 3W6UA 2QE6A 4W9RA 2I4RA 1RIIA 2WVAA 4X8HA 1BKDR 1ESEA 1WXQA 1W34A 3R3YA 3REOA 1U9ZA 1G8YA 2ZT5A 2Q1UA 3EVAA 2Q7XA 3OIYA 1ADFA 2QQGA 1EWQA 5KYUB 3FYHA 3OTIA 3FFWA 4ENRA 3EVZA 5FI3A 2XRMA 3LXRA 4ME6A 5K6RA 2Z58A 3LSYA 4PTLA 4NYJQ 4Z7OB 1N2IA 5EJ8A 3HVRA 1Z4KA 5JE8A 5C81A 1E2BA 1WCWA 3NXKA 1B6RA 1C81A 3LX6A 2Q4EA 2XTNA 1EP2B 4NYJR 4UVDA 2A9KA 3SD7A 1WDMA 3P7MA 4DSTA 3PFWO 5BURA 1B43A 4CL2A 2YKGA 4I1IA 5IG2A 3L0PA 1NBEA 3TSOA 2L19A 1DIHA 2AUMA 1H2HA 4D6XA 2Q9BA 4DT1A 4INZA 5DFAA 4BNNA 1XKXA 4Q18A 3T6KA 3H83A 1EK2A 1P72A 4M37A 4KK3A 4BGDA 3AF4A 3PEWA 3MEQA 4PYJA 1WQ4A 4V3BA 2WFLA 5LJIA 1TQ8A 2A7XA 3B6JA 4QHTA 1E2JA 1QIEA 3SC4A 1PFWA 4F2HA 5C7IO 1EXVA 1JA9A 3L07A 2BGIA 2Q5QA 1VL0A 1T0BA 1XHFA 1KK1A 1WCIB 4R6WA 1DS6A 4Q02A 1H94A 4CKBB 2QR3A 1V5GA 1YZTA 4TV8F 1PIWA 2DOKA 2FX3A 3VNRA 3WHLA 2NW6A 1QIMA 4AJ2A 4QO7A 5FXMA 4JNKA 4QPPA 4CPDA 2CVFA 1NXTA 2R48A 4IKEA 5DWQA 3TUIC 1S9HA 4NE2A 1J07A 1Z2DA 1XP8A 1Z3IX 4OFBA 3DOOA 5EKSA 2JIZD 1CJUC 1QLJA 3L0CA 4L9WA 2JKVA 2XYQA 4MW5A 2A94A 1T91A 2FEKA 2OGTA 2P5YA 1YQQA 2YIMA 1L4LA 1LRKA 2BEKA 2IBMA 2X5NA 3OC6A 4TSFD 2R751 4TZ0A 3RJ9A 4NZOA 2IYEA 5T4HA 4C2AA 1E92A 3QVKA 3RIEA 1W88B 4M0KA 5JFOA 5DYIA 4EKDA 5KUTA 3CLTC 2ODNA 5KOHB 4NZYA 5EHNA 5I45A 5JQGF 1KR2A 2QRKA 5KKNB 3UB4A 1U9JA 1YB5A 2G40A 5KNBA 1V5FA 5B30A 3KWLA 1C14A 4N82A 3HB7A 3LUGA 1XMSA 3FDZA 2YQ5A 4CQMB 5KU7A 3BMXA 1IMOA 4UPVA 2JJMA 4G5XA 5B36A 1FJXA 1EXWA 1A2BA 1ZXBA 2J7KA 4QUBA 2XSZD 3KKKA 4ES6A 1GD1O 4BP3A 1CEYA 3PRYA 3ZXSA 3KSDO 2FR8A 5CBKA 1QQAA 3O91A 3GA7A 1F38A 4CM5A 2B20A 2PL9A 3WAKA 3RRBA 1SHZA 2QTGA 1M6VB 3DZFA 4OOEA 3RBVA 3R9XB 1X7XB 1IFXA 4FPXA 3OG9A 4L75A 5DTQA 4XWOA 4C2UA 1XEWY 3FJ1A 3A1DA 3L6UA 2QDXA 4QFMA 2ERYA 3AF3A 4JX9A 1M54A 2DZDA 3KE8A 1V25A 5DHPA 4ZI3A 3TW8A 2XKBA 3WBBA 4FIZA 3TQFA 2C58A 3A4TA 3MLAA 2B7CA 5EPUA 5FWDA 1N7IA 3GQBB 1VLLA 1ZN2A 5BMVF 2VPXA 3ANXA 4Y6QA 1G20A 1XRRA 4BRZA 3ND9A 1W0JD 1N2ZA 4KN5A 3RQSA 4ND5A 4PR3A 1DWQA 1SG6A 5EESA 1Z45A 2BFMA 2PSEA 5BSUA 4UBIA 5AM4A 2JFUA 5CVDA 5T64A 3ZU2A 3H8JA 3OOYA 2JA1A 4ENWA 1Y4AE 4NATA 4ZARA 3RD5A 3I5XA 2C0PA 1FP7A 1JL3A 1B15A 2G88A 3FLAA 5HQTA 1EVJA 1U2DC 3DBRB 5F77A 1ZU5A 1FFSA 2GNPA 3B70A 1B41A 1KKMA 1P19A 2JGNA 2AT1A 3JVEA 3EC2A 5J9FA 5A0VA 2P2DA 4GYYA 1G2PA 1CETA 2AS0A 3GA0A 4PQRA 4BB5A 2PZGA 2ZE5A 4II7A 4H17A 4FWBA 4RTPA 4W1SA 2P91A 2QUIA 2IPLA 4MI9A 1TM3E 3W3AA 3ZG6A 4EPWA 2GERA 5AW4A 3H9UA 2K7ZA 1KAOA 2WZCA 3D8HA 1ZK2A 4FGSA 5AOCA 5C35A 4IFBA 1OB5A 4I8DA 2VRCA 3AMVA 3JZIA 3L1UA 2R3SA 1XSEA 3O8OA 2OLKA 4MRVA 4NNOA 3WK5A 1QDLB 4QSHA 3QQPA 3NIGB 1NNLA 2NU9B 1SC3A 1Y8CA 4DGSA 2M1ZA 4RHCA 4BB9A 4NE9A 1A8UA 4X6LA 3BL8A 4QT0A 4UPEA 1C4KA 5AI5A 3GLKA 3NORA 3ED1A 2HXYA 1FF9A 3U17A 1M83A 3W7AA 1JPVA 4RZIA 3ZE9A 4YQFA 3O8QB 5ITSA 3UGJA 1NRWA 3AFGA 3CV3A 3GAFA 1EWRA 4RVCA 2AR9A 3UQZA 4R9RA 1HQKA 2IWRA 1KL7A 1U81A 2F9LA 2XJ4A 4CV1A 3HKEB 2CBXA 1OT5A 3KTFA 2BLNA 3QEJA 4JJIA 3WOHA 3JALA 3LHDA 1LPPA 3UUWA 3VQTA 2NYVA 2V1UA 4HB0A 1JT9A 2AKAB 4KH1A 1DB3A 5KNDH 1F7UA 4R0VA 5AVRA 3B9BA 4YBZA 5HWSA 1YZFA 3FPAA 3H05A 4FYYA 3U49A 4CL3A 1RNLA 1Q7BA 5C8YA 5L3SA 2IXBA 3U7FB 1J8DA 1HRKA 2AJTA 2GHTA 3FI9A 5TEWA 3STHA 3F5FA 5JVDA 2V5UA 1N78A 2F1OA 1PLKA 4E6EA 1U98A 3DPSA 4LVUA 4QD3A 2BFBB 2PFKA 4L8GA 2VPTA 1NUAA 2VXBA 1HR0B 2A9OA 2JH9A 3BIWA 3BMCA 1UJ5A 2Y1DA 2XEXA 4I4IA 1BEEA 3KYBA 3UCXA 1IOVA 1NR7A 1CUEA 2EZ4A 2Q5LA 2QP9X 4D2IA 2HT1A 3P4YA 1OQAA 3T12A 5CTJA 1PEDA 3QNWA 4XZ3A 3DAYA 4KKXB 4K6GA 2F43B 3CMCO 3T06B 4C6TB 1S2NA 1I3KA 4DR2B 2Q27A 5KQSA 2JLSA 2UUBB 3EGIA 4W7SA 3WOVA 3F6BX 1L2TA 2C04A 1BD4A 1PW7A 2E4VA 4FMCB 4R2MA 3VGJA 3BREA 4OV6B 4RGYA 4Y67A 1X1BA 3UBTA 4TKVB 4D4GA 2WMOB 5FFNA 4F5WA 3SQDA 3RSFA 4C88A 3T9AA 2XD4A 1ZMRA 4RLFA 3RYCB 4QOFA 3TW0A 3DUWA 3DW3X 5BXQC 1FY2A 2FU5C 1K6MA 4CM7A 3ZOKA 1CEQA 3KJFA 3DDCA 4BQSA 4C5AA 4F3RA 1K98A 3F2IA 4O8ZA 3WJ2A 1U3FA 2VHEA 4IV5A 2FSVC 5AW8A 2FWMX 1WR8A 4Q9NA 3RTAA 1UPBA 3N07A 5F1KA 3GL9A 4N3NA 3CUWA 3EUAA 3CVVA 3QG1A 2RI0A 5F7OA 5E8JA 1J09A 1JZQA 1DKRA 1QGAA 2VKQA 4P7KA 1EX9A 1PR3A 2C5FA 2P6OA 3E9RA 2D8MA 3WLJA 1E66A 4IDEA 5D86A 1BDIA 3QF4A 4NEQA 1L5MA 5FLKA 4JQZA 4QXRA 3ZYZA 1IL0A 1TCAA 4HRXA 4AUNA 3P45A 3ZVLA 2PS9A 4M21A 5FF9A 1NJSA 3DWEX 1Q1ZA 4OU5A 5LXTF 1F2VA 3TNFA 3X1JA 2YHIA 3BHIA 4PC6A 4DREA 2HX1A 2QX6A 3FBGA 4NJMB 4HLNA 3S1SA 1FTWA 2WFAA 2Y66A 5CNMA 1XRLA 1TM7E 5LUAA 1T2NA 1L5YA 4MVJH 4AX8A 1X39A 2FMUA 2AVDA 2RHLA 2VJQA 3C87A 3H42B 3KNZA 5ENVA 2ZDHA 2ZU0C 1JKIA 1RHRA 4QZVA 4HO1X 5FNVB 5JZ9A 4C08A 3IT1A 6YASA 5HHTA 3PE4A 3Q9UA 6CHYA 2IHVA 5DVZA 4O2AF 4DMLA 10MHA 3ZV4A 3FAKA 4ZV7A 3QU4A 3SLRA 5DYNA 4ZCIA 3HB9A 2IJGX 1PF7E 4RF5A 2BKUA 3UT5B 4JI0B 1XZDA 1HT3A 4EJSC 3AKZA 4TTVA 1PGQA 2PMCA 1WNTA 4YEDA 4BWFB 3HEMA 1X0XA 1UMKA 2AI3A 2YZ2A 4JI6B 2G76A 4CMIB 1S96A 2F3QA 2Z04A 8ABPA 4HLCA 4YAKA 3WGIA 3W34A 1T25A 1ZUWA 1A5AB 3HDTA 1OZFA 4N3AA 4MJ3A 3MCUA 3AOEC 2VH1A 3MJTA 4LY0A 5JNWA 1ZVVA 3PDHA 5KSOA 3QKRB 1A9YA 1NPYA 3GFPA 4ZEOA 1E2DA 1MBZA 4LJ8A 4UHCA 2R7AA 1NTOA 5K0GA 3DM9B 2UZIR 1LY1A 3U7IA 1M5UA 3IPRA 1FDVA 1N9GA 1V37A 3AETA 4BXOA 5EJ6A 3IAEA 4LKRA 3HFGA 3SNHA 3SYMA 3TVYA 1PL0A 5G4KB 4L3VA 2Z0MA 4PHTA 5BYJA 5EFZA 3PKZA 4NYIQ 3MOIA 4TVSA 5CAEA 1J7KA 5KYYA 4NYIR 2PGOA 1VQ1A 2I3DA 3G49A 3DE5X 4YHBA 4D9HA 1K3TA 1ISJA 1Z3CA 1FEZA 1Q11A 3QU2A 4D9FA 4GUDA 1UMDA 4TRNA 2VHCA 1B0UA 1YBMA 5L3RA 4QJ3A 4XLLA 1GAWA 2PJZA 2HPAA 4P7FA 4IJWA 1Z4MA 3WDKA 4HATA 3ZCPA 3FOCA 1ZJWA 5EJIA 3F90A 2C83A 5HKKD 1CPYA 3UUFA 1FU7A 5B3JA 5SY9A 2ZUFA 2GHIA 2MSDB 1SIBE 3K8QA 4KQCA 4RO0A 3S8MA 2D59A 4OMDA 1KEEB 5FYQA 2I2WA 2VYCA 2DCMA 4ENPA 4W8GA 3OQMA 4Z53A 4B7XA 3HBLA 1PWZA 2ADFA 4URWR 3WDSA 5C80A 1RAFA 1YZYA 2IF2A 3SEAA 3S7ZA 4FGUA 4QUAA 4KO2S 5H80A 3VDQA 3QVVA 4HLQB 4RHFA 2IYSA 1BU8A 3RYFA 4MA5A 3FTPA 1QE5A 2PIAA 3KQSA 4HXGA 3W7BA 5I7HA 3A25A 4DVJA 2E2WA 3OKAA 3KFXA 4DPLA 4N40A 1R7RA 2R1VA 1ZL2A 3BGIA 3QTTA 4CI9A 2JFYA 4EOGA 5IHXA 3BTSA 2D5LA 1G5PA 5EZYF 4RV5A 3VJRA 2JFOA 1YAHA 1CR6A 1EUCB 3K0CC 5IFLA 5JSZB 3JPWA 5LQCA 1SEPA 2GILA 2IHYA 3L5OA 3TR5A 3ZDQA 2FFHA 3HMKA 4J7AA 3WWEA 3NRCA 3HA7A 4X6XA 1ACJA 1VHQA 3GELA 4WUTA 4BQPA 1VTKA 5J4YA 3A37A 1Z4QA 4WEOA 1JE1A 1XD2B 4PZUA 4TUYA 3EIOA 2WUDA 4YCNA 1T6BY 3AONB 3R7LA 3QBDA 2WHXA 2WJAA 3DUFB 1FL9A 4IHKA 4EG6A 4CMGA 3WO0A 3C0KA 1A9PA 1Z26A 2BLLA 3MUFA 4N6GA 3VMFA 5U1PA 3RS3A 3W1WA 3AIOA 1XAGA 2GZMA 4U9IS 3GJ7A 3I6QA 2X86A 1W0KA 2XRZA 3F3YA 4PQEA 3LBHA 1CQIB 4WQMA 2BMDA 3BB4A 5CB8A 1RVV1 3CNOA 2R4TA 4R3UC 4REMA 3FKJA 3RNOA 1NAIA 2HIAA 4L7QA 1T29A 4MUKA 4W1QA 3TX6A 4AN1A 3L8YA 1MIHA 1GYRA 3NH6A 5EWLA 3W90A 3K9WA 1AXGA 1F48A 5D6OA 3NU1A 2CHQA 2BHLA 4DQ0A 5TARA 4QLBA 1NM5C 4R4JA 3TVTA 3OWXA 3L7AA 4PG8A 3DNMA 1FX0A 2HGSA 1E6MA 3JARA 4JWTA 3DHWC 4IZIA 5J40A 2IF0A 4OYLA 2Y3IA 13PKA 1JPNA 3LFHA 4C0QC 4MUIA 3OMXA 1P0PA 3QHAA 1Q1AA 1XDBA 2FF7A 1M0EA 5AJWA 4KFRA 3BD6A 3L18A 3MD0A 4LI3X 5F12A 4YMHA 1TTTA 1EHIA 3MWJA 3B7GA 4HQLA 1PZXA 1TYEB 1F2UA 2ZAYA 4O8CA 4Y1FA 1OWMA 3IUJA 3NV9A 4GZMA 2ZI7A 2H63A 4B2PA 1Z0UA 5LYJA 1XTTA 2OV3A 3OIDA 2H0AA 3P0JA 4N3GA 2H1VA 3EXHB 4RX1A 3RDPA 1K7XB 1L5FA 5ECGC 5G0WA 1FS5A 1JAZA 2OSBA 3QXCA 2RGWA 4YRJA 4FFNA 2IU4A 1PZFA 3WMRA 2PYIA 1H65A 1ZJ6A 1ULZA 2AA3A 4O33A 4MUEA 4XPIB 1JU9A 3W0LB 1BHO1 2RKWA 3ZDYB 1KSGA 2R47A 3PHGA 4CLDA 3D4IA 2HA2A 3DLHA 4V39A 5EJ2A 2EP7A 1YA8A 1QRDA 2OV1A 2QW1A 4IILA 1T6NA 2JIQA 2YV1A 4MYTA 5TQVA 1XF1A 4JENA 4OP1A 3ZDDA 1CXZA 1FRQA 1ZUNA 1SHUX 1T0PA 3F49S 4JA2A 4S0XA 2OHIA 1OIWA 3VDMA 3U0BA 5AVOA 4BWVA 4DSOA 3A4NA 3ZHTA 1A97A 3A9TA 1ZI8A 4E5NA 5BWLA 4GICA 5D3MB 3BJIC 4BO7A 1NLMA 3AUTA 3JQRA 3TTWA 4CTJA 1H4SA 1CERA 2XMRA 1Z0AA 4OHOA 3NHYA 2FXVA 4LXXA 3LRPA 5JG7A 3QV1A 1Y8RA 3WC4A 1U5BA 2ZTUA 3CPEA 4MVCA 4QQKA 1DINA 3IMFA 3LG2A 3G9QA 3GZTB 3WP1B 2VQ3A 4HDKB 1PNRA 1XZCA 3B52X 1O6ZA 3SBXA 2ZRJA 1TA4A 4X7RA 2Q5OA 3DKPA 3QF7A 4IVPA 5AM0A 4BFYA 3FPJA 3GLHA 3IELA 3IKVA 1HV8A 3L8CA 4OPMA 3VZSA 5JH7B 5FI1B 4NP6A 2WAOA 1KSFX 4HV4A 2B34A 4YRGA 1EE2A 2ZIFA 1X1AA 3ZDCA 3A1WA 4OL9A 1O97D 3HRHA 4EQ6A 4R1PA 4EI8A 1ISRA 1A8PA 4P33A 1BD3A 2EC5A 4TLDA 4DZZA 1AKWA 2UUOA 2ZAGA 3BVPA 3D64A 4KBFA 1VJ0A 2V9CA 1LDMA 2PLWA 1D4OA 3B78A 3IP3A 1BEUB 1LSUA 2WWGA 3IUQA 5CVUA 4QELA 3WNDA 2HRZA 2HMWA 1VRWA 3NB0A 1EX1A 1VJDA 2Q3EA 1I32A 5C1IA 4B2LA 4U7DA 5MFZA 4KNYA 3F74A 1ZUD1 1SZDA 1Z2OX 4EG0A 4JBIA 1FVHA 1YUNA 5G02A 2H2IA 3A1CA 2HLDA 1CYEA 2PJUA 3DT8A 3OEHA 2I2AA 2DTXA 4NDZA 1TM2A 4MMZB 4ZQIA 3FVTA 3G9XA 5DLDA 3B2NA 3R41A 3P5SA 4MKRA 4MVXA 1V43A 4YYZA 3AK4A 1FU8A 4MP3A 4A23A 1PV4A 1RMYA 2SCUA 2XIQA 1P0IA 4N5NA 1KAMA 1QE0A 3R9IA 5MN4A 1CQXA 4G6ZA 3JQ7B 4HFMA 3AH8A 4OGLA 4UM9D 4L8VA 4YRFA 1Z4IA 5A5DA 4ARZA 2V4MA 3ROFA 3OCXA 2Y0EA 5KTKA 2ZIZA 2BVNA 1JIXA 1GYPA 1U0TA 4DV0B 4HWKA 2HK8A 2X4GA 5C3MA 2X7HA 1ZNXA 1SJ9A 2K87A 3ET4A 1TLLA 2DPHA 4YALA 3C74A 1BWSA 2NO5A 1UKVY 1VLMA 1E6WA 3IEKA 1UM9A 3M5DA 5EJFA 4BZXA 4QYXA 4DBVO 1IVSA 1OXBB 3AUYA 2ZJZA 1P0FA 3NASA 4UAVA 4JBHA 3R9WA 2P6UA 5JYEA 4K05A 1DX9A 3A1EA 2QROA 1V8BA 1JMVA 2XGGA 4I55B 1TUBA 5EN4A 4E51A 4R2XA 3CUEF 1R5BA 4IHJB 3E6AA 5FUQA 1UKEA 3PICA 2OWDA 4Q37A 5TR9A 5JY6A 2WSIA 2BT4A 1XTZA 4FR0A 4OI4A 3M1LA 5BN5B 2E0IA 3PDUA 1L1FA 4XDYA 4B8WA 3CM0A 1BX3A 4ZYZA 2REQB 1V4NA 2J33A 4X3CA 1QTRA 3AR2A 2CUTA 4YJGB 3PFGA 3NHJA 4O2BA 1P39A 2Q1SA 2BGNA 3KAKA 3P8ZA 1MHTA 1FZTA 5FBLB 4OOFA 2OG1A 2O0JA 3R7WB 3KEFA 4C4XA 2D1FA 4HEHA 1IWOA 2A7QA 3OPYB 1XZHA 1P7CA 1VYTA 2DG2A 3D2BA 5DI9A 5C1BA 3ORYA 1SNYA 3P9NA 4J0FA 1VYHA 2NM0A 1UBFA 4GOLD 5JIBA 3E4CA 1NXWA 4FWIB 4B7AA 1CUBA 2X2EA 2YNMA 4OQFA 5F1PA 1XNJA 1N2BA 2FLWA 5H16A 4C03A 3Q8MA 4WFQA 1WRBA 3DHVA 5KX5A 2DFKB 3JW8A 2HL6A 4V1CB 2JBWA 1SN7A 3K3PA 5K3DA 2Y92A 4YQEA 4CMCA 2FR1A 1GYQA 1H1LB 1NJ1A 3M4ZA 4O3FA 4RQUA 4LDJA 3TGPA 1P1BA 3RSZA 4ETWA 3AI1A 3FGOA 3OU2A 4FS8A 3O1JC 3QV2A 1AX9A 1G21A 4M38A 4KB5A 3T8YA 1NBOA 4HMQA 1O97C 1OGIA 3CO5A 1X8KA 1L7DA 3O6VA 4MR7A 4M9ZA 1R10A 5DTIA 1QYCA 1GXSB 4XB1A 1U2QA 3BPSA 1RM5A 3QPVA 2YOFA 3JQ8A 4PTYA 4C7OB 1T2EA 1GG8A 3TFOA 3RV4A 4MS1B 4NTZA 4RA9A 1DAIA 4IH1A 3LDUA 4QJBA 3OE1A 5CIYA 4D9BA 4R31A 2BFNA 4QIHA 2V7PA 2Z1DA 4DLVA 1OYYA 2Z2IA 3ZIAD 1QRUA 3UY4A 1N8SA 5ECWA 2O2XA 4R2IA 1YC2A 1MXFA 3NOQA 4IKOA 5EE5B 3D8BA 4H08A 5TS3A 4D3DA 4YMIA 4H15A 4LK2A 5AOAA 2IIPA 5B6IA 2I65A 3ZCQA 5AKYA 4CM9A 1N2HA 1DRVA 4OLJA 1ZC3A 1OWLA 1OPXA 3AHGA 4MTCA 4EW3A 5I6DA 1WQ1R 2J31A 2B4QA 2RGYA 2BL4A 2BR4A 4ZYUA 1NN3A 3D8UA 2DQZA 3QU7A 4GWLA 5BSKA 2HWXA 2MINA 1DIAA 4EO4A 3O47A 1Y8QA 1F20A 3Q2OA 4GX1A 5IJXA 5SICE 1XTJA 3KTAA 4RD2A 2XB4A 5IYZA 4M0DA 1WULS 1XEWX 2Z6UA 4MQMA 3ZGOA 4MQEB 4G0OA 1TMKA 4H4EA 3B3JA 3PLRA 3SIXA 3WLTA 1P74A 1LS6A 1V5WA 5AM5A 1UT5A 4OGFA 2XE6A 3IJPA 4HEA1 1XTPA 5CA1B 3UH1A 2FEXA 2X9NA 3V34A 2PZJA 3FTFA 4LHYA 4F3TA 4YMUA 1HUQA 1G8MA 1D0VA 2ZAIA 4ETNA 4FHFA 3V2HA 1RWKA 3D0OA 2RGEA 3DPIA 4W5JA 4Q00A 1QVRA 1PZNA 1NF8A 3EMVA 4ZU6X 3BJEA 3U7JA 4HKTA 4EF5A 1Z7WA 5FOVA 3AJAA 1OIXA 2PS0A 4ZAFA 1EFRA 2HA0A 3L4BA 1VJRA 2WWXA 1JAXA 2PWPA 2W6ZA 3CRZA 4G5FA 1XPUA 1NXOA 2W2LD 1CZNA 2BKVA 2CMKA 3EIXA 3GN2A 5IMBA 3WQRA 4A7PA 3M81A 4HQOA 2FCRA 3OIUA 3EDQA 1JT2A 1IZYA 3QPUA 1DAMA 5BXYA 4M7RA 1QAQA 4QGBA 4TVKA 3RBZA 4DE5A 3LQ1A 4CF7A 4X1IA 4Z2AA 3ORFA 1PSWA 4LBVA 2XE7A 3AR9A 3MVEA 4WJKB 2BMAA 2I3ZA 1L5HA 1W6UA 2R8EA 3DP9A 3E3AA 3IEXA 1NI5A 3MWDA 1Y7LA 3Q4GA 4G37A 2VTBA 1Z4OA 4RDIA 2EIHA 3P2OA 4R0NA 1TCCA 4EYEA 3B5EA 3E84A 4NS1A 1A82A 1P9WA 4EYOA 3D0QA 3ENKA 2JGDB 3R6WA 5HILA 1ZMTA 3C6QA 1OKKD 1KERA 4U2EA 5AI9A 4GPEA 3I53A 4YLYA 3U37A 1YRQA 2ETXA 1ODTC 2GEDA 3ESAA 2VCHA 3GLIA 4Z4QA 2OVBA 4QBFA 3ELBA 2R1ZA 3GZJA 3VSAA 1XF9A 3CT6A 4JUCA 1N1EA 5FOQA 1U3UA 4HN4B 3REQB 4EMUA 1FYFA 4YACA 1X9IA 3N1UA 4C0KA 2Z83A 2OCIA 4GLBA 4CEHA 1GA4A 4WHMA 1TK2A 5LIRA 2QLLA 5HEKA 3PD0A 2VJCA 2WJJA 2OCKA 1EQUA 5FWXA 1OUMA 2C4MA 2G1KA 2P69A 3AF0A 3HVUA 4GPAA 1B42A 5F1YA 5HBGA 1LX7A 1MNQA 3AFIA 2G77B 2HMSA 1G20E 5FUMA 2QSYA 4MJLA 2J08A 1QGDA 1QTNA 2ZB8A 3FSJX 4ZDWA 2WY2D 1V41E 3NWPA 4JSTA 5LU8A 1K86A 1SOMA 2WABA 4LV5B 2WHPA 3I2YX 1QRTA 4LJ5A 3NDPA 2VT7A 5IDYA 2ZTLA 3LP5A 4OREX 3OP4A 4TTPA 1QQ5A 1RQRA 2W7TA 3QY0A 3RVNA 2AOTA 1K06A 5BVHB 1X1QA 2ZWPA 2VAMA 4FMDB 4J3JA 5ALOA 2FWPA 2OBYA 4TLCA 5JCJA 4BNKA 4C6RA 2DJ5A 5CDUA 1GZHB 1HM5A 3F8WA 3R75A 1QP7A 1U6JA 3E61A 3H6HA 3GEMA 1OWNA 1E58A 1FB5A 2JFHA 4IF4A 2VQ6A 5EKDA 3UHOA 1ISMA 3BFVA 1HYGA 4F72A 2NOAA 1LD3A 1XJCA 4PPNA 2BGKA 4M4SA 2P2NA 5BR8B 3L7BA 3SQXA 2PSFA 3AEQB 2FP4A 4M0MA 2O8CB 1JR4A 3JAKB 4LRYA 4PLCA 4DG8A 1PUJA 3HCEA 4RK5A 3M9XA 1A96A 1JHXA 1N6KA 4CYMA 3KR1A 1TA9A 4I8IA 4GU5A 1SBCA 3RBAA 3WGZA 1J39A 5C5DA 5D3QA 3DZDA 4JI1B 3N9IA 4JOSA 1B6TA 4MB0A 3O21A 1YFZA 1PU2A 4KFSA 4CR6A 3QELB 1TFUA 1IN1A 1YONA 4KNWA 1C4OA 4BMOB 2GKOA 4A2PA 2XUOA 3AP3A 1NOKA 3PVSA 1FJHA 1P73A 3WK4A 4AKEA 2H6EA 3CNEA 4N39A 3EVBA 1ZIOA 4EITA 3AB8A 3BEDA 3FKSD 4UBKA 4KTVE 4CCSA 2F7SA 2B37A 3FYUB 1TYDE 4KQ2A 4P3XA 3UG7A 1WBJB 3ER6A 3NHAA 4F11A 2VLIA 2P1DA 4BNFA 1A77A 3DAOA 1TM4E 3KKEA 1HE4A 4UEKA 3CH5A 4XX0B 2VUHB 3RARA 3VNQA 1IXYA 4B87A 4GX2A 4FFOA 1VIYA 2VK1A 3ILSA 3HSSA 1ZXLA 2GVNA 4KDRA 4ZOCA 3TCNA 4YROA 3CVYA 3Q3EA 5JLJA 4AJ4A 1EJ6A 2J4FA 4P32A 4IICA 1ESDA 3O73A 1C3LA 2HLPA 2N9UA 3HO8A 2Q2OA 4MUBA 3R6DA 2AN1A 5BOSA 3PI6A 4KXWA 8MHTA 1NQWA 1TVKB 2H7XA 1Y9JA 1CTQA 2JFWA 4LV6A 1VLJA 5CEFA 3K72B 3QUBA 3CH4B 1GUYA 3ZNNA 3PIRA 5B4UA 5DGHA 3ZJ4A 3Q3GE 3A6LA 3OEEA 4RTSA 3D0RA 1Q7RA 2VXYA 2WAAA 5ICFA 1QTIA 2Z3VA 1T5DX 1V8ZA 3T7JA 5ECDA 1X42A 1PX0A 1T1IA 5EXDA 2H3EA 2V0GA 2FFBA 3VI4B 1RYZA 1KYIA 4WPGA 1SA0A 2YV3A 1UMCA 2BJWA 3IXQA 1MZVA 4DIBA 5K0JA 3FNBA 4L9SA 3ASZA 4HG2A 1YR3A 1IUKA 4X41A 3EG5A 4J0GA 4EI7A 3IVMA 1Z33A 3AF2A 2LPMA 1AQLA 3F5SA 3CPHA 4EABA 3CLKA 3RVJA 4WXYB 4QQRA 1EVKA 2HSWA 3N0WA 3V8VA 2YVQA 1AJEA 4D74A 1T9DA 3DL4A 1U9IC 5LQAA 3M6LA 5BVGA 2ONYA 3BRWD 3GCGA 4BWYA 1VSQA 5KWSA 1G5QA 3WL6A 2KQUA 2JVKA 5CT5A 2DMRA 3ZBQA 3DOFA 2Q5EA 4KV9A 5AVJA 1QVVA 3NDIA 5IKOA 4DT1B 4X8MA 1PTJC 2Q0QA 1AH2A 4BBPA 1J90A 2H51A 4R2KA 4HWOA 2FAXA 3QZUA 1OTHA 2JK1A 3LAWA 5KBYA 1L7PA 2JHGA 1SVKA 2UYOA 3AZQA 4N7MA 1YFJA 1NLZA 2RGCA 1EZ1A 2CL5A 1YD7A 1MX3A 3ZBPA 1U8AA 1YIDA 2EERA 2NUTB 1R6UA 3PC2A 1ZPDA 1GNLA 4LIPD 3O3CA 4Q9AA 5D1NA 5I3CA 3ZDBA 1LNSA 3L8EA 3RC7A 2RHGB 4L6AA 4YIHA 1YRLA 3H4IA 1MOSA 2ES4A 2FNAA 2GJ4A 3KCNA 3NNSA 5D7NA 3LUFA 3V3KA 4A27A 3TG8A 5L6LB 1XV5A 1WHTA 2QX8A 4C0LA 1A88A 1R0KA 1N3YA 1WDLA 3BULA 3G85A 3MNFA 3CLVA 4FX5A 4OMUA 3T3HA 4ZCMA 1GL9B 2GFIA 2COUA 3KQQA 3WGGA 2WYVA 3Q6MA 5DGXA 5F2KA 2O1SA 2O7QA 3BWCA 1NVUQ 3BF8A 3AEKB 4F6RB 5TMPA 1K8YB 2QVCA 1QV6A 1FP4A 1QZZA 2UV8A 1NW4A 4Q7EA 5CTAA 3SWWA 2XZTA 4OVKA 1MCZA 3SFVA 3ZS8A 5AM2A 2B4AA 2XMCA 2XYPA 6AT1A 3AFHA 3I92A 4D79A 2DF8A 2FPPA 4A1FA 2NU8A 2ZE8A 1AQNA 2Q3LA 4HUQA 3OD5A 3DAHA 4U02A 1J2UA 2D2XA 3LS2A 4AJEA 3K7EA 3KT3A 1U63A 1Z08A 4R1QA 2RHOA 3E3MA 4G5HA 3MQ4A 2DULA 3MGCA 2IS4A 4JA0A 3FDZB 4CV2A 3MN1A 3EBLA 3CEHA 2CZQA 3HP7A 3ROGA 4QTTB 3GZNA 3UJNA 3EVTA 3TGLA 1DOAA 3M9WA 4F2PA 4E30A 4NL4H 4LXIA 1NWCA 4PG4A 4ABYA 4Z0HO 1EEXB 2PH1A 5KU1A 4ON9A 4X44A 4XM2A 1FC0A 1TEHA 2ZT7A 3RS0A 3VM6A 1YNSA 3WLMA 4BZWA 4E94A 3KQHA 4RTKA 5TPZA 3LY8A 4PCAA 4R2LA 4AJIA 4XWKA 3FHOA 1X7GA 1H4TA 3GBSA 3SSMA 3A6JA 3O9VA 1PI3A 5E6UB 4D45A 3N8GA 2ZCUA 3FWZA 2IZ6A 3FGZA 4YUWA 2ZUEA 2EKBA 4EQZA 1JFVA 4OJMX 1BWRA 3O4JA 5KWIA 4I50F 1CR0A 1PJBA 2GK4A 4XQEA 1XMXA 5ESRA 2ZWMA 1OVGA 4DYVA 4PYNA 4AF7A 3NYRA 1OOEA 2EX0A 1T8UA 5KHOC 1AKRA 2GI4A 4GQAA 2IQ5A 2Y1WA 3D1JA 3IPXA 4EKGA 3ME5A 4Y8VA 1OI3A 4BZZA 3H9GA 3T99A 3IB6A 5EMLA 2GSWA 2RAFA 3BXZA 3O0DA 3QOFA 5JFGA 4RMJA 4M1ZA 1ZD8A 1Z28A 2BBOA 3H16A 1KYYA 1NJ8A 3LOQA 3NP7A 1ORWA 5EWJB 2IYZA 2QTBA 3ZLBA 4E22A 4F56A 4B6EA 1DHTA 5ALUA 3WGKA 3WHPA 3ICEA 1U2SA 4ZT6A 1Q84A 1OA0A 3P0RA 4F86A 1U8TA 2WWRA 1U0JA 4Q7KA 4RYDA 5CH5A 1ZZEA 3I05A 5ADVA 3RI3A 1PV1A 3EZLA 4TS9A 3WV5A 1I3MA 2ZP1A 1JZTA 4NHEA 1R50A 4H6VA 2O5EA 4NNPA 1MJGA 5DN6A 4NJOA 3P5BA 2NVUA 1PJQA 1C0LA 1R3UA 2FV8A 1NYTA 3MM4A 3DZBA 3FR8A 3JU3A 4KJXA 4NRDA 3T9BA 2GZHA 4F2DA 3MJ4A 1RQXA 5AW0A 2B0JA 2OFFA 3O8OB 1HYQA 1SCBA 3QTBA 3JD3A 4GAEA 5EJ4A 4YRPA 1GU1A 5B53A 4IEFB 3JAWB 4RNDB 2UYGA 2RFLA 2HCJB 5CX4A 3Q3JB 2EF0A 2W2XA 1SD5A 1ZK1A 3BN3A 1W48A 3EG9B 4NU6A 1S4MA 5FO1A 3LBYA 3T35A 1Z0DA 2ZU6A 1M8PA 1HXHA 1C9EA 5KSPA 3UPDA 3TLEA 1U2PA 3GMIA 4MUHA 2B9VA 3G2PA 1OU0A 1MB0A 3JALB 3NV7A 4K9NA 4YGYA 4JVOA 4QOGA 3VMMA 3WTCA 1XZIA 4YJKA 3T5PA 4XJTA 2WA1A 4E2WA 4NPAA 5K09A 1FSGA 3UJHA 1XIVA 2PIDA 4S1VA 3SJUA 2C7VA 4W8OA 3HP1A 1RYBA 5AVZA 5FNZA 2X4IA 5C8YB 5L3SB 1WMSA 2ECPA 2I8LA 2L0XA 3OBBA 5ERXA 1GFWA 5JVDB 2G1PA 1I14A 2EG9A 2H1WA 4G2TA 4TYPA 4U9UA 4E4TA 1QF6A 3BMCB 4G1CA 2HSGA 4YAUA 1IBLB 2MDTA 4NXMB 1KEKA 2A0FA 3EGDA 4ZEWA 2H07A 3ZQ6A 2Z8YA 4KOEC 1N9ZA 2ECKA 2EX4A 1Q0QA 1VGRA 2ANBA 1Y81A 4RXTA 3ZK8A 1N0IA 1R9JA 3IQGX 5ULLA 1XRMA 3IHLA 5A03A 1EG7A 1WZEA 5A3QA 4Q3NA 4AWXA 4UAJA 4YXWA 3EAQA 5IABA 4JZKA 3HFJA 1OFUA 3ZIDA 5HZKA 1QLWA 4FHZA 3ZBTA 5BQFA 1YIOA 1J6UA 4E2ZA 5KNBD 3ETEA 3U7EB 2I6TA 2JIMA 2IEIA 5G41A 4OHRA 3L82B 3PTLA 1WQ3A 3E22A 2JBAB 4WZBB 4QECA 2ISCA 3HYNA 4YPVA 3ISJA 4HH0A 2ZJOA 3DLTA 4YK7A 4PGGA 1DKMA 1XMIA 3VDXA 4D98A 2JFBA 3UVEA 4DL9A 1Y1TA 1NZDA 2I5PO 1I3OA 2DHCA 5TIIA 2WFMA 1WTAA 3K70D 2OOSA 1VP3A 2CN1A 3NS7A 3ZCTA 3ZWVA 2IDMA 1YRYE 3QWAA 1IZ9A 4MSUA 2JW5A 1X80A 2JFPA 5JXJA 2JA2A 3UKJA 2V65A 1A2OA 4MP6A 5EMJA 5NLLA 1PHRA 4IJQA 1RMQA 2C2BA 3PHJA 2KLHA 4M49A 2JL1A 1JG6A 3AZOA 3OFVA 4ZOAA 1SQ0A 4DQUA 4C2TA 5BW4A 2QENA 3LL4A 1JQJC 3TTYA 3GFTA 2DB3A 1OFGA 2NZJA 4MQFA 2WYWA 1YQWA 1MABB 2YYSA 1DBIA 1KNQA 1CLEA 5T57A 4KXLA 5EWMB 4OXNA 4TQUS 5BT8A 1OILA 2XUFA 4EKYA 2D4AA 3V42A 3D6MA 3HA3A 3HHPA 4BAUA 4BHTA 5BNIA 3QF4B 4BO8A 4NPCA 1X9HA 1O0BA 4KHPB 2WZQA 3DNPA 4PFKA 3GEDA 5F2NA 2A9VA 1TF2A 1MDBA 2PMFA 4UARA 4QBKA 3G2LA 4AJJA 3OIGA 1JZSA 3UQYS 4B3RB 3U7GA 2Q41A 4OGKA 2NO4A 4C7JA 4AULA 5BQXA 2ECQA 5KTOA 4Q9DA 2ZIXA 4OGWA 2ZSBA 2Y71A 3RHSA 3ROXA 2KS6A 2R00A 2G6TA 1PLLA 3ONDA 3ZC3A 4Y6PA 3E7PA 5MGNA 4RK1A 4TV9A 3W3AD 3BB1A 2B82A 3KETA 2J3KA 2WHEA 2JNWA 2XXJA 1PBNA 2IUTA 2X41A 3H2BA 2Q0SA 1DG9A 4K9LA 1N2GA 3DKRA 4IDNA 1LSOA 5JSQA 2BKLA 1LEHA 1UODA 3JQ6A 1UBOS 1WXIA 2ZITA 2MT9A 2VR1A 1H1TA 1P9OA 3B2EA 3EXG2 2A3NA 4RDXA 1ABBA 2QX4A 1HURA 2XNSA 4B79A 1RI1A 2JAQA 4PONA 5I8WA 3R0VA 1ZH0A 3PVZA 3GLHE 3NTUA 2TSYB 3AESA 1OXSC 5B2ZA 4FNOA 2ZDQA 2ABWA 1MPXA 5JJIA 1P7VA 1PR5A 2SKCA 1M2OB 1Z6ZA 1S8FA 3BX1A 2DKFA 3A2NA 3IEPA 1E1MA 4P2BA 2ZYWX 1P2DA 2I6XA 3KKLA 5C34B 4EMSA 1T9AA 4F97A 3TF5A 1OB2A 1U94A 5FQNA 4BWGA 4F84A 2CCJA 4ZI7F 2C31A 2XCQA 1U9YA 3PNPA 4YJ2B 2V6GA 5DW3A 3MRSA 1B76A 3M5WA 1FSZA 2B25A 4FJ1A 1N9GB 4HWGA 4TLMB 2L2QA 3AX6A 3RRJA 4BXOB 2BFWA 1M5RA 3IDQA 3LPCA 2TS1A 4TMVA 1IK6A 3OZFA 4DHWA 3NAGA 3AY3A 2HKIA 4E09A 4IS3A 4FZJA 1F06A 4Y2HA 4Q9KA 1QGUA 4GQBA 3K53A 3KT8A 4WKCA 2B8TA 4MUMA 5MDHA 3OC0A 4IXMA 5CAEB 1DRJA 3JWJA 2GWHA 2DHRA 3HV0A 2C8JA 4TN1A 2VDLB 3UYKA 4A8JA 2HAEA 5KYYB 3GGSA 2LCQA 4EDHA 5FOUA 2DT5A 3UJCA 3QJGA 1ADBA 3BMOA 4E11A 2DUWA 1FFYA 4IWXA 3WIVA 1JDUA 1E9DA 5JWHA 3T5BA 1NJ6A 1B00A 4MB2A 5CFLA 1TUGA 4BTEA 3K70C 4U5QA 5ELLA 3EIHA 3VGPA 5ARDA 5FJJA 3HZOA 2XODA 4JASB 3CUUA 3GUYA 4BKOA 3PT9A 3VH2A 5FUYA 5KNLA 2OUIA 1LBQA 4B7UA 1EI9A 1G5IA 2JLYA 1T9GR 5IK2A 1SUSA 1SULA 4W63A 1JKJA 2JIRA 1Y33E 1SU7A 4OBWA 3P2EA 5CLFA 4GPBA 1JYFA 3IP8A 4DV5B 3SQWA 1UBMS 2NAPA 2HCTA 3T1QA 1BCRA 1JIJA 3HZZA 3ISTA 3SS9X 4I8XA 2P9JA 3EGOA 4RV4A 3KJXA 4AY3A 1QCYA 2IELA 1JDNA 3E3LA 3PYMA 4GW3A 2FKNA 1TZ2A 3BC1A 3EXEA 4UW9A 2E37A 5K8LA 5LD2B 2BF4A 1XQ1A 1P45A 5D3ZA 1I4OA 4JELA 3M6VA 1TIKA 4L76A 1D7OA 1WB6A 3G8DA 4MA4A 2FQYA 4LFCB 2R1VB 2H48A 2H5LA 2CL0X 2NPIA 2OZPA 3L6OO 4G5RA 1VKJA 2X9VA 4RK0A 4BFZA 4F91B 3B1XA 4WCDA 4UTZA 1GZDA 2XKJE 1KH2A 3EY9A 3MA0A 3PUJA 4J1TA 3RHTA 1S3IA 4YAIA 5CK5A 2NV2B 2VWGA 3C85A 2J9GA 4ALKA 4I4CA 4IOJA 5KSYA 4KZKA 2MHCA 3C1TA 4PV7A 1R5NA 1XK6A 4JYCA 4X20A 3PT5A 3CT4A 5DTJA 5TQJA 5ADWA 4OB6A 2Q3DA 1RR6A 5LQDA 2IEBA 4GE3A 1I7DA 3A27A 1KDRA 1Q1GA 3IPLA 2XYHA 3NBFA 4TUYB 4GS5A 4NCIA 4PPGA 5DE3A 2R11A 3RJTA 1NW5A 1MV8A 1TKCA 2AJCA 3KKOA 3NT2A 5CLIA 1C5KA 5BN3A 3LXXA 3LGSA 1WMFA 4JBYA 1WY5A 1ILEA 3Q6NA 1GO2A 3PI7A 2IV3A 5HK9A 3W5BA 2PPLA 1W5SA 1JBEA 2GTHA 2XADA 3FWHA 4Y2RA 2FJ0A 3JAMA 1SVMA 2W5UA 4IIJA 1PDVA 1JDBC 1D5CA 3GLQA 1PRYA 1G55A 2VDWA 1ZCFA 3F3SA 2MJLA 5K0BA 1G21E 1RWXA 3DLPX 3DMRA 3PNBA 4RELA 4ZK6A 4CIWA 4LNUA 1RJWA 5JZSA 2A58A 3U44A 4V03A 4BQNA 1ITZA 3TAHA 7REQA 4EPVA 5TB5A 2PKWA 1FRFS 2A84A 5DH9A 4EW1A 5TPWA 1O6CA 3MZ0A 1CUCA 5HGXA 1RJFA 3DTYA 2JD0A 3N7UA 4KQXA 3SJ7A 5AIBA 3A04A 3WICA 2NN3C 5LUBA 3W5SA 1Z4JA 4XVCA 1FX0B 1I1QB 3JARB 1KMHA 3FWNA 3HVIA 1RE0A 3RFTA 2FHPA 1W4RA 4LTDA 3PX3A 4PICA 1NP3A 4HDQB 3DL7A 2HGZA 2GDZA 3EWIA 3A11A 1JUDA 1LNQA 1ORIA 1KP3A 3HNOA 4MVWA 5DYWA 1Z5WA 1SBQA 1P77A 2CBGA 3L6BA 1UUFA 3LHSA 4KDEA 4TSKA 5CRIA 3TOZA 1U28A 4CEJB 1O96A 1MH9A 5DM0A 1DCTA 3C5HA 1QIJA 1TECE 2QR2A 1EVLA 5EQDA 3TQTA 1UPFA 3MPOA 1TVEA 3LFUA 4PIPA 2WQ6A 1C7QA 2PX6A 4ZGBA 2IYNA 1F2UB 3PJFA 4Q9JA 1NDHA 1F14A 2X13A 2X19A 3RIHA 5K03A 2HJ9A 4TYWA 3VR4A 1ZHFA 5EIAA 2RE8A 4C0HA 3GRAA 2IWHA 3F6YA 3K0AA 3AY0A 1SQGA 2ZSHA 3A1VA 1HORA 4ZT7A 4CKZA 1UC5B 2OYSA 4L4XA 2CSXA 2FMXA 1MVNA 3WL8A 4D7AA 1KI6B 1CSEE 2QM3A 3WYEA 2FN8A 4HGQA 2X0DA 5CFRA 2WUFA 2FX5A 2EVWX 2XT9A 1D03A 2PD4A 2VAXA 3I8XA 1AB5A 1Z4PX 4KMSA 3DOUA 4LCJA 3Q5EA 4WCFC 1FSFA 1DC6A 2SKDA 4ZQEA 2OT3B 3W2TA 2AGVA 3AEXA 1VPTA 1KO5A 5C0OE 2ZZMA 1CUYA 1ZUNB 3QRWA 1UOOA 5EP3A 3L01A 1RWMA 3F73A 1P31A 1YOBA 3IE0A 3NC1C 1XU4A 3R3HA 3VX3A 3HXPA 1H69A 2DFLA 4CUJA 1XDZA 1XN4A 2H4FA 1O54A 4FSXA 1QCZA 2A0WA 1IN5A 2EYQA 3BHNA 3PCXA 4AY2A 3EPRA 3RUHA 1Z13A 1Q92A 3MBIA 1KE1A 3CY6A 4I5GA 5KQMA 2PZKA 3AY7A 3R7DA 3BMQB 1QFYA 2WI8A 4MPRA 2FSFA 3WGJA 1DMRA 2G04A 4FB4A 1NA5A 2R6DA 1MB9A 1ADYA 2JDIA 1RP1A 1Q50A 3B1WA 1NMSA 3DZJA 4DAOA 1TAGA 1RYFA 1XMJA 3CZ9A 3AKCA 1Y42X 1ZYUA 2CVHA 4MYCA 3D4BA 4EQ6B 4CMJA 2Q2NA 3G0HA 2P2CA 3NEYA 4XTCS 4BQOA 3ETJA 1JDJA 3OZBA 1DC3A 2ZJ1A 2H0QA 4UREA 3VR0A 2AK3A 2JI7A 4DDMA 2NUPB 5JAQA 1YT5A 2XCOA 4FQ7A 3FRJA 2XEDA 4UZSA 1KRHA 4ENUA 4KUEA 5C8DA 3GLIE 4RCVA 4GI7A 3E9NA 3L7OA 2J3IA 3LHKA 4GRIA 3TPCA 2OHGA 4IY1A 3NTLA 5I7OA 1Q3HA 2XXBA 1S2MA 1EINA 1SCJA 2ZI9A 1KK0A 1MKYA 1W9HA 2YXLA 4FONA 4MW6A 1EZ4A 4LECA 3TZBA 2AHRA 1IAQA 3EUEA 4ASUD 1NI4A 3KP1A 2ATCA 1NP6A 3IBGA 1CUVA 1V48A 2RDMA 1G291 4IEEA 3HYSA 3VKVA 4FN4A 2A6PA 2MMGA 4LISA 1VCNA 1HYEA 4PS1A 2G9RA 3KXLA 4KMOA 4S24A 4UEWA 3TLYA 2BZ1A 4ARZB 3K2BA 4C0WA 1FU4A 2E5FA 4JDUA 1K27A 2DPGA 3U26A 1L8OA 5I9MA 4V0MA 3B1JA 4JQCA 4AIRA 4CG1A 3EW9A 5EI5A 4AG5A 1UM9B 2GARA 1YZHA 1J9ZA 4MITA 1C8LA 3GUCA 4X1YA 3UN1A 1SIUA 5BSGA 1VECA 2GD1O 4CNBA 4A26A 5K8CA 2AJ8A 3OTQA 4HTFA 3QMPA 4QUIA 4YO8A 3O75A 3VUEA 1FVFA 4J16A 4KX3A 4XYBA 4UUNA 3B1ZA 1D8AA 4HF7A 2I33A 2AEEA 2J4CA 4XR4A 1KJNA 1AN9A 3WLKX 2ZPTX 1N2CA 3P2KA 3HP4A 4QUDA 1XDDA 4MW0A 4EY7A 3WNBA 5JCXA 4OXIA 3W5CA 2WA2A 1M9NA 3T61A 4KQJA 4RJKA 1JRLA 2DWUA 3PFKA 2AH5A 4HS4A 4JUFA 5E38A 4HNTA 1R6DA 4O2BB 5I8ZA 2ACEA 4DR4B 1GR1A 5IVIA 1SQFA 5DRTA 3D43A 5CVVA 4Y1EA 2BF7A 1I4WA 3TSAA 3SZLA 1JHVA 1DE0A 3HUTA 3S29A 3ZHCA 2WPDA 3GLFB 3OOJA 3RS9A 3RJMA 3TRDA 2LDBA 1VB3A 1XZGA 3HVKA 4IR7A 3JQ9C 1EFKA 2ZRLA 2HJVA 1WSDA 2R2GA 4P35A 2AE2A 3IPYA 2PR7A 1SCIA 3N59A 3BXHA 3URKA 2JCVA 1O89A 4FHDA 3CX3A 5DHTA 3S2UA 1KAGA 4OSEA 2HB6A 2JFZA 4MW4A 3RS2A 4L0MA 1YQUA 5AKLA 2YDYA 3SC2B 1QUEA 1IM8A 2IZ7A 4RTJA 3IXLA 4DYHA 1G21B 1DJPA 4ZCLA 4QUJA 4GUAA 4RA6A 1RKQA 1NW6A 2AG8A 4MR7B 3JYPA 3VYWA 3HC7A 3RJZA 4DCPA 4N8DA 1OJ7A 1MC4A 3LUJA 4R5MA 4RKEA 2IXGA 1UL1X 3A14A 3CN7A 4JXKA 5H81A 4HAZA 5I01A 4R83A 4RA9B 2PSDA 3L0SA 4AAYA 2P3QA 3I2KA 3CUTA 4PSCA 2XT6A 6ADHA 4GHWA 2AFIA 3GJZA 4WY8A 2GOYA 5AO9A 3QUSA 2Z6QA 5CUQA 1T4CA 1YZUA 3T54A 4U6QA 5LP6C 4BB0A 5EA2A 2XWJI 2VJBA 5HKLA 4AJNA 1CX9B 1EWTA 1H05A 3ILHA 1QH1B 1HLFA 3MTIA 3N7TA 4P4GA 4UFNA 5CK4A 5EXTA 3EIUA 1NVEA 1XRPA 1BHSA 3V8EA 1CJTC 2OO5A 4Z51A 1J2TA 4FMDF 4Z9BA 2IXFA 2R6JA 3AM5A 2P6RA 1DGQA 1RRGA 3OX3A 3A3OA 1KR5A 1Z6AA 2B4YA 1HT2E 2Q4TA 3G6KA 3M4JA 3N5KA 4JGIA 2ZG6A 3ZUGA 1VSUA 4BJ1A 1M6NA 1VKZA 2F1RA 2MINB 1C3XA 1GA1A 2X3FA 1Y8QB 5FP0A 3ETLA 4C4SA 4C43A 2VJKA 2AW5A 2LVBA 3A36A 3KTAB 4LVNA 5JRZA 1SOWA 4G07A 4K8RB 1A69A 1POWA 4MXDA 1U3DA 5IYZB 5K8UA 3CZCA 1AV7A 5ALVA 1HDXA 4Q3DA 2HF7A 2Y4OA 1L5VA 1YMUA 2Z2ZA 2JD1A 2LP4Y 3BE4A 3V32A 2BMVA 2HLDD 1P7ZA 1UC8A 2R6R1 4N65A 3FW1A 4H7HA 4NU5A 4EGAA 3OEHD 2NUAA 1DPGA 2II6A 2P2GA 2AZ4A 2Y0PA 1HA3A 4HXFB 4RGQA 4DDHA 1E5VA 2IKSA 4HVLA 3KSBC 1BGXT 1ZN8A 2YYZA 3G0BA 1SG0A 2VSXA 3EA4A 2E87A 4G0NA 4PC3A 2VUSA 3NONA 1YCDA 5AVVA 5K0CA 2YY6A 2ZIWB 3FUTA 4UBNA 3WP0A 1F0PA 1REQA 2ET6A 4BATA 1LS1A 2NXNA 1XZAA 3Q85A 4IVNA 2OM2A 5I47A 2H59A 2IYRA 3DZIA 2FFAA 4LZWA 1LU9A 3BJMA 1W1IA 1E1NA 1YE8A 5CVEA 4R1LA 5JAUA 3DB2A 4GT1A 1N1DA 1A5SB 2PZBA 4N49A 4G8BA 3ZN2A 1B93A 2XTZA 5DPMA 4BDTA 2EU8A 1IJFA 1Z16A 1X38A 2FPMA 1ZOIA 1ZI6A 3N0VA 2EHJA 4PF1A 4RPLA 4RWZA 2DY0A 1EXDA 3I32A 3V4RA 1W36D 4P54A 1TTHA 4M1TA 4LHSA 3N86A 1CR4A 1EFCA 1FTQA 1GVHA 3B1KA 3ZOZA 1I7SB 1D3AA 1R00A 3QWIA 2PUEA 1E79D 4MW1A 5HNKA 3HDVA 3VFDA 4M1KA 2X14A 1L5HB 2D0OB 1N5KA 2OBMA 4BNZA 1D09A 3BWDD 1IEVA 5TGDA 2VTBB 1YL6A 3G8YA 2VDOB 3VU0A 2OPHA 4FDTA 4HGNA 1VIVA 3QPBA 5K3EA 3KLPX 3ZXIA 1YRWA 4C7BA 2K2QB 1RQNA 3A3PA 3MHPA 1OLSB 4B71A 2HRBA 2ZYVX 4XSHA 2AXQA 2H9AA 3KU1A 3PUZA 1E7WA 2D5CA 1P4SA 2IGBA 4FFBB 4CM8A 4P3PA 3GLIB 5D51S 3L7DA 2GPWA 1P0QA 4NH0A 1RWOA 1UZMA 3N6RA 4XRRA 5JADA 2C3MA 4MWZA 5GJWC 2QV7A 1G3RA 2AX3A 2HF9A 2ZE6A 3NETA 2V7WA 2EX1A 4MRAA 2YNMD 4P0TA 3UAGA 5KQLA 3LZ6A 2DUJA 5B37A 1OSNA 5ARBA 2C42A 2NT3A 2PBLA 3DO5A 1AO3A 4HOYA 5G2OA 2MR6A 5FWXB 1DCMA 1UBGA 2Z9BA 5GZ6A 4DLSA 1QMGA 3A28A 3L04A 5IAAA 2QP4A 4C14A 3KHUA 4Z4EA 1KI9A 4E5MA 3UJ6A 1GGHA 5KKCA 1Y1QA 3H04A 1KY5A 2VPIA 2WHPB 1DIOB 4HFRA 3P9ZA 4N6NA 4BJHB 5L4NA 4DLTA 4HGOA 5CA0A 2BMWA 4UD6A 5KAMA 1B8UA 4ENTA 5E2AA 2AOTB 4ND8A 2BGGA 3JD4A 1I6LA 2O05A 5SYAA 3E4DA 4RKQA 2PS1A 1XA4A 2RH9B 2EJBA 2WK1A 2OAGA 1WXXA 3OQ1A 3PIIA 4LNAA 1M6YA 3FN4A 1E7QA 4BKMA 4BLPA 4HNVA 5JD5A 2YDXA 3TI9A 1W96A 1GLNA 2RJ3A 2PUCA 1M2JA 4KWEA 4L3OA 1GGEA 2FP4B 2ADMA 3NM5A 4LRXA 3KR2A 1L5NA 1ZJ4A 3G2HA 2WWFA 3ZUPA 1KTIA 1NQXA 1PQ4A 5IMSA 4G0QA 5JJLA 3ZY5A 5IM4A 2X3YA 4CM9D 5T67A 5KWEA 3VSDA 3EQ9A 3PXUA 3RHFA 4BFVA 4TYNA 5GONA 1H2WA 1K75A 4JVLA 1JBKA 4YMTA 4CF3A 2BHNA 2F3PA 2GQ0A 1VZ2A 3NM4A 5HRAA 4DNPA 5JAMA 1HMYA 1T5SA 4QYMA 3OZAA 4REQB 2GEFA 3T3NA 1DAGA 3SSNA 5I7RA 1DEAA 1Q19A 1TUIA 4K1XA 4MI6A 4XFDA 1JAIA 3VOTA 1E3WB 3K9BA 4JI8B 3L4JA 5IEJA 5ALDA 2HJWA 3OZGA 3THYB 2KJQA 1C30B 2GN4A 3QP9A 4BQRA 2FW8A 4EHJA 1A7KA 4P22A 4UEOA 3RFXA 4RYLA 5H1YA 3MJSA 4O08A 1EZZA 9GPBA 1W36C 2PKQO 3Q15C 2LDXA 3GJQA 4GBED 4UU0A 2XUKA 1XJ0A 2GBGA 3EWSA 2H31A 3WJ7A 1UH5A 4GXNA 3C6MA 4WXPA 3ACCA 5F4ZA 1EE1A 3PHHA 3OEWA 3V6LA 2SBTA 4ZMSA 2ORVA 2N75A 2GN0A 4YUXA 1D6JA 4PYIA 2NV0A 5AHWA 5L3QB 1XO1A 4JOQA 5FH9A 4RIHA 5BOSB 3OQIB 2GM9A 3RK0A 721PA 1W59A 1FMFA 1MQ8B 2JRLA 1SBTA 4IIFA 2K2WA 2VNAA 3F9CA 3QH4A 4UDOA 4JITA 1S8OA 2XF2A 3P94A 4PAWA 3GROA 3LC2O 1J49A 2J3DA 3UV7A 2O8DB 1R37A 2YY5A 4H59A 4KAXA 2XE4A 2R62A 3OTGA 4FFPA 2GBPA 4QBGB 4AO7A 4YT4A 1VMKA 3VR3A 4A0FA 2PL3A 2YS6A 4E07A 2YNMC 1DTWB 7ABPA 3ZCRA 1SA0B 5EIFA 1TT7A 3TBKA 2WG2A 2C7OA 1CY0A 3CZ5A 1DIGA 2CXSA 2UZ3A 1TKRA 5THXA 3NDBB 1H2FA 3MF4A 4MVJA 2E48A 4KLZA 5EEGA 5C4GB 1C3VA 2GKSA 3FZNA 3SP1A 4EF4A 4G1UC 2H92A 3DC2A 5BW8A 3NYIA 2A5DA 3CW8X 2QI9C 2X6TA 4ZQHA 4CETA 5EJ5A 1XHLA 4MTLA 3BQMB 5BVGB 4U2KA 4EHLA 3T3GA 5UKDA 4LYDA 4BLWA 3IMEA 1K5PA 3KD2A 1ETHA 2F62A 2XZOA 4KLCA 4TKZA 3DMYA 1JEEA 2VL7A 1GZSA 3GYGA 5CVJA 5FCDA 1CY8A 1U8CB 5KO2A 1P1KA 3AFOA 4URFA 2J3JA 4BNWA 5JTUA 1KRXA 4TMZA 3DL2A 4DC1A 1GFIA 3BWYA 1R27A 1DAOA 3BSWA 5JDCA 3FKQA 3K35A 3TQOA 3ZI4A 2SHKA 1OCEA 2XB6A 4UVHA 5F2OA 4D4IA 5AJHA 4XIGS 4HYYA 4L4YA 2FWIA 1GL7A 1E1CB 4I0WB 4GL2A 2J7PA 1QPBA 1NATA 2WUWE 1RXWA 1J1ZA 3COVA 1ZD3A 3LW8A 4O29A 4P4SA 3R9KA 4MVJM 1WHTB 3I2JA 4A0SA 3WRWA 4PIVA 5JZBA 3H1TA 4QYTA 3E3OA 4TS4A 4WTOA 4DCUA 2Y1FA 4TN5A 4NCNA 4KYIB 2VP5A 3B9PA 1XMQB 2QRNA 3ZU3A 3BXFA 3ZI7A 3QBJA 4FYWA 1P7YA 4CXMA 2X2OA 1NV9A 3FPSA 4RS4A 3ZE7A 4M1WA 2H29A 1BO6A 1SD1A 1FP4B 2B8JA 4I2VA 5LZ2A 1T4MA 2O8EB 3HUUA 1PT6A 3LZDA 2A30A 4LGVA 4G36A 3OPYI 5C8YF 5JLAA 2R6GA 5BNWA 5ADUS 4UU1A 3L8FA 5JVDF 2RIPA 4E4YA 3QEBZ 2PZAA 3E23A 5E1BA 1EK1A 1JXOA 2LIPA 4K3UA 5IKMA 2YWRA 1ZH4A 1H2EA 3RGWS 2JLBA 3PS9A 5IKEA 2WU8A 3JY6A 4JLKA 3U3RA 2YV4A 3MYRA 4JR2A 1LJLA 4K81B 1IBKB 3LQ2A 2GJAA 3T5MA 1PYGA 2VHVA 3GZNB 1G2QA 1U7UA 2X8LA 4CTOA 3OKFA 3FOEC 1F7VA 4MUXA 4AB1A 5NULA 1H2BA 3O8CA 4AL4A 4BE4A 5EUQB 3JATA 1GN9A 1JFFA 2R87A 4NMLA 5F52A 1R4AA 2XZLA 3CR8A 2OILA 4J1SA 5BQPA 2FH5B 4DWVA 4JMPA 3Q3VA 2FK7A 2KHZA 2OP0A 4F4HA 3L4BC 4PANA 4QM7A 4FC7A 4XYGA 4XGNA 2HRRA 3IUYA 2I4OA 2OD2A 1SK8A 5H02A 4HPJB 1K5HA 4PBRA 5G1OA 4XWAA 4GBMA 3H86A 1L4HA 1RJ9B 4BVKA 1CUZA 4AQDA 1OTXA 3D3NA 3KDPA 4B6OA 3QFHA 1FP1D 1UAAA 3RTBA 1YDWA 2B4TO 2B6HA 4ZYWA 2QM0A 1KZ9A 5HF6A 4JBNA 1JTEA 1ECBA 2LTAA 4BP8A 2QTAA 1ABEA 2COKA 4TTRA 5FBHA 5KJEA 3OM0A 2NSJA 4N8SA 1PJSA 1QGYA 4BDSA 2J48A 5AVQA 3TRJA 1JLRA 4NDAA 1TIPA 3PPYA 3DFMA 4V2UA 4D02A 2L42A 5GP1A 5KJ6A 2W2NA 3PC7A 1DZIA 4O0MA 1L8LA 2XNHA 4FP9A 1Z6TA 3IBSA 2H06A 1BCSB 3OEED 4J6EA 4KZPA 2OMEA 4C0JA 1HOXA 3DMTA 1MQSA 4ER7A 1RQGA 3IQFA 3MTEA 1NG1A 4WX2B 2YHBA 3N3BC 4LTMA 3OZSA 5BYAA 1DAHA 5FPTA 1U8XX 2FCAA 2NVUB 1GILA 3GYBA 3ZVRA 1Q77A 2FOXA 4P5DA 4M0UA 2Y0DA 3B5JA 2P1RA 1C0PA 1WU7A 3SHTA 3Q0TA 2P2YA 1RYNA 4GMHA 4AXBA 3H11B 4B17A 1E89A 1F3LA 3RV3A 3U13A 2FUCA 2PGJA 5LMZA 1OC2A 3O1HB 2KB0A 4B3FX 4OTZA 2FJUA 5E0OA 3S2SA 2O57A 4G01B 4RTQA 2FMTA 2O3UA 3MTAA 4BLTA 2C3YA 2EFHB 2B83A 4UMVA 5ILGA 2HLHA 2WSMA 1WY7A 4FC6A 4PVCA 2I1QA 4XPZA 4L1KA 4LGYA 2XR1A 2ZB4A 3K9NA 2P11A 4MZDA 4NYMR 2EGGA 3GH3A 2OCDA 3KC2A 4MCHA 1P1IA 2JH3A 2LIVA 4AK9A 1MIOB 4PYLA 5CXUA 4M0PA 2QG4A 1EGVB 4V2IA 3DZGA 3IAM1 1QANA 1T4DA 3IAUA 1I30A 1TMGE 3U48A 2HC9A 1A9TA 2D06A 2XB8A 1I7PA 3GEPA 3RSHA 2AC4A 2C2HA 2C2XA 4RY2A 3V4VB 5FX2A 2CXUA 4YJ3B 1BMTA 3RSGA 4C07A 4YCCA 4ZZIA 1NXVA 1AT1A 4OP2A 1II0A 1Y7HA 3I6BA 2WWHA 1P2SA 3KX2A 2IZ0A 2I03A 5K2MA 5HKBA 4G4IA 3TO5A 3ZCSA 1CLUA 1ZOOA 3LIPA 4JKOA 3BCSA 1YZGA 2DKNA 2ZBFA 4QBIA 5DV9A 1NW3A 2H11A 4HZUB 1Q17A 1RHQA 2OESA 4HWTA 4ZQCB 5J2UA 3DW1X 1OHHA 3EGDB 3ADDA 4CLRB 5CYGA 5CLLA 2XVXA 4PX9A 1Z68A 1YV9A 1XROA 2YTZA 1FDRA 2ZBVA 2GVZC 4JI3B 2X4DA 3PEUA 1E96A 1UOQA 3ONFA 4EKNB 5FPKA 2JLZA 5LA6A 5JS2A 5H3CA 1X19A 4YP7A 3U60B 2HQRA 1D8TA 3KQOA 5JO9A 2J41A 4XJSA 2BR5A 4WVLA 2ZK7A 4CF5A 1DWUA 1DOZA 1F9EA 3K92A 4P93A 1ISGA 1XZJA 1YUMA 2YFKA 4U7HA 1YE5A 1SRRA 1KETA 2H4YA 2X0KA 3MCVA 2WU4A 4IDCA 3E22B 4CFZA 2K6GA 4WZ6A 5BWNA 3ZVNA 1YACA 4URUR 5DNDA 5EJ9A 2IDJA 1NUUA 3QFTA 4KO8A 2GEKA 4IKPA 1R0SA 1Y37A 4PFQA 4ZJPA 4E21A 4QPNA 4WFKA 1I6KA 1I3LA 2JH8A 1YQXA 2WQ7A 5J59A 3I1FA 1U0OC 3O8BA 2DHDA 5GGXA 3EFHA 1WSBA 5M7EA 4Y0AA 2WIJA 2GAJA 3I8OA 3PZRA 1S1MA 2EKDA 2FQXA 2P9HA 3B38A 1X80B 2YWJA 2YXPX 2PCJA 2AMFA 3RG8A 1K92A 4KLRA 5DGIA 1T3SA 1W5FA 2H57A 4YJDA 3NVAA 3M82A 4WNCA 1DEXA 1YAJA 2CE2X 4IGEA 4BRUA 1V8DA 2BYTA 4FM9A 4BNDA 3ZHBA 2W4QA 2YZKA 4NOJA 5IBRA 1N8KA 1R0WA 3WBFA 3HBAA 5J4VA 4MQFB 4A36A 1RCTE 3CZPA 1QVWA 3WHIA 4HGRA 1N33B 1C1DA 2ZVPX 4F9FA 5IT0A 1EK5A 2GB4A 3KWMA 3SOPA 1N36B 1R6AA 2HA4A 2XHEA 3HXQA 3ENNA 1BFUA 1MRSA 3ODGA 2WMYA 1TKBA 4RLHA 3B6MA 2FJPA 3IIJA 3V46A 3NBUA 1J20A 2VP3A 1A0OA 1CRZA 2EQAA 2G5PA 4RFSB 1QIIA 4QXOA 2AN3A 4ZDIA 3I23A 2JGAA 4JJFA 2ZIXB 4GX5A 3L0YA 1SKMA 4NNJA 3SVLA 4IZHA 3ZZ1A 5BQ5A 1Y7IA 4X71A 4FNAA 1XL0A 4FYPA 3FJYA 4DV7B 3THXB 2QNIA 1E6CA 4KMRA 4KRYA 4TV9B 1R6TA 1QAMA 3HZHA 4WXMA 5HOEA 2GJ9A 4P3YA 4Y2XA 4OHWA 2CD7A 4TUYF 3QGMA 3TL2A 1IBSA 1VMAA 2GBLA 4QATA 4TMXA 3V5NA 4FNGA 1V1RA 2ZQ5A 3JYNA 3GRFA 3GUUA 3U0VA 1G17A 5J3JA 1T1RA 2JFXA 4FVTA 5KB3A 2IU3A 3C43A 1WPXA 2BIFA 2XWBF 1EG2A 4WZZA 1YGPA 4YRAA 4WN9A 1J97A 2IEDA 1ORVA 1U8YA 2IZ5A 3G8CA 2FPSA 3O4IA 1ODCA 1FTNA 2PM8A 4FCCA 5AI8A 1PVOA 4L5CA 3IMKA 4Y6RA 3WVNA 5CPBA 3AESB 4QDTA 3BWVA 3GW8A 3QJ5A 4QXAA 5CGZA 3H65A 3TFWA 2I8CA 2IGTA 1QO9A 2GYYA 3SYTA 1MHPA 2CHGA 4LZPA 3W2IA 4GGMX 1JVSA 4FDVA 3EXAA 5FR2A 1P9LA 4DARA 4Z5XA 2RBGA 2HHAA 2ZWVA 4HAWA 2EG5A 4RMNA 2GO7A 4F85A 3CVUA 1IU9A 1YVEI 2HDNB 3KZOA 1I1HA 1T8SA 1KZ7B 1XTRA 2Q1TA 3VVBA 2WIAA 4Y6GB 4GKAA 2POCA 2JJQA 4PSDA 1GRCA 4QGGA 5JYDA 3KWFA 3RAJA 3GH1A 3WNCA 3JQGA 4MQ4A 2WYOA 2BFCB 4Y18A 1ZM2A 1JXMA 2CXQA 4OQNA 3PC8A 1LJUA 5DXFA 3OCZA 2GVDC 2EWWA 4AQYB 3KSZO 1XCJA 4HADA 2FQ1A 3OF5A 4JGBA 1W44A 5FLEX 2HNAA 5YASA 4JS0A 4DC9A 3FCEA 2XQGA 2GJ8A 4HY3A 1ZA2A 3D8SA 2GJKA 4ATNA