4QPJC

2.7 angstrom structure of a phosphotransferase in complex with a receiver domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
120
structure length
120
Chain Sequence
GSMRVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGIDLGKLYDYDIILLDLNLPDMSGYEVLRTLRLSKVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIHAIVRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphotransferase
publication title Structural asymmetry in a conserved signaling system that regulates division, replication, and virulence of an intracellular pathogen.
pubmed doi rcsb
source organism Brucella abortus
molecule tags Signaling protein/dna binding protein
total genus 41
structure length 120
sequence length 120
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qpjC00
4MRMA 3N75A 1NATA 4RK6A 1EHCA 1PHRA 2JVKA 1JFVA 5GQSA 4D74A 3H6HA 1OXKB 2IPLA 4YGXB 2HPHA 4RK0A 3UUGA 2WMYA 1YS7A 2QVGA 3O2QB 3URMA 3LKVA 2VUIB 1QP0A 3K9CA 3HXMA 1MIHA 4Q6BA 4IGAA 3E3MA 1XHFA 4KREA 1DBWA 5FBHA 2FQWA 4Z0NA 4YCSA 2BGGA 4RWEA 2WWVD 1NXTA 3T6KA 1KMIY 2PUFA 2A9RA 1DBPA 2FEWB 4IF4A 1L5YA 4EYQA 1EWKA 5I4CA 2P9HA 4MAAA 5IX8A 3JPYA 4G0MA 1XHEA 2AYZA 4G0ZA 1Z25A 3KG2A 3RH0A 4EYGA 2NT3A 3HM9A 4YRZA 3FDFA 2DRIA 4RY8A 4MQEA 3QEKA 1TM2A 4GNRA 4N41A 1LBHA 3QX9A 4XFKA 1LK0A 5IEBA 4TLMB 1ZN2A 4RZSA 1Z16A 1OXBB 1U04A 2R4QA 3NBMA 5CNIA 1A0OA 4QYMA 1VKRA 1QP4A 4JB2A 4HNQA 3OLXA 2HSGA 3HV2A 3A0UA 3OLZA 1JYEA 1Z18A 3Q7RA 4PZ0A 2FEKA 2I6FA 3QLUA 4Z4EA 4PE5B 2HQOA 1Z13A 4G0PA 5FWYB 3MA0A 4RY9A 4OATA 3H5WA 3D8UA 1USGA 2CHEA 4KK3A 4ZPJA 5B3JA 2B4AA 1ZESA 3GWGA 1QMPA 4RK1A 1NTRA 4G97A 1TJYA 3FMVA 5TQ2A 2GI4A 3SNKA 4YS6A 4B09A 1KRWA 2FQXA 2OENG 4F06A 4P98A 3TX6A 2NT4A 4TMYA 1FQWA 4TN5A 4XASA 2H0AA 5IUJC 1A04A 3I45A 4G0YA 1D1QA 4EYOA 3RQIA 1PEAA 3O2JA 1MB0A 3Q7SA 1F51E 2FLWA 4N76A 3HSYA 3T95A 4RSMA 3D02A 3QX8A 5EWMA 5HSGA 3EODA 1NXSA 3R0JA 3A0RB 1U0SY 5IUKC 4OLBA 1JBEA 4RXTA 1ZDMA 1RXIA 3HUUA 3KJXA 3RVNA 1GUBA 4NCBA 1YK0A 5BQ3A 2LPMA 1BA2A 4KMRA 3O1JC 2L19A 4EVRA 3NHMA 4EGSA 1P2FA 3EJWA 1FFGA 3IPAA 5EWMB 4Q6WA 2QU7A 3LUKA 1M2EA 2R48A 3FFWA 3HO1A 1Z12A 1CYEA 4DADA 1ABFA 3RVMA 1BAPA 1TVMA 2VK2A 2JCGA 2AYXA 4KNYA 4MS4B 3SAJA 4G86A 3HJFA 1IIBA 4JAVC 4LE1A 2LIVA 9ABPA 5KQGA 1FFWA 3QEMA 3RVJA 3KYJB 2MYPA 1JDPA 2JRLA 3GV0A 3OLVA 4MLDA 4RK7A 2WJWA 4RS3A 3RVOA 2F8TA 4WWHA 3QELA 1U8TA 4IILA 3KLOA 3OQOA 3EULA 3LOPA 3CKMA 4G0QA 4RKRA 1DCMA 1D5WA 4MQFA 4MS1B 2GWRA 1J56A 2Q5CA 1QNLA 4NQRA 3W9SA 4EYKA 3KS9A 1C4WA 4H3KB 1DJMA 4YR7A 1H9CA 4GPAA 3LUDA 3EGCA 3IP7A 3EQZA 3O1IC 2R25B 2VUHB 3SY8A 2N9UA 1B00A 1JYFA 2A9QA 2R47A 4YO7A 2LUOA 3H5LA 3HCWA 3MF4A 4WT7A 2FVYA 2A9OA 2MSKA 5IULC 5KQPA 6CHYA 4NV3A 3QLVA 4YWHA 3TMYA 4ZMSA 3A10A 2PUEA 1XWWA 3F7NA 5TQ0B 5ABPA 7ABPA 4Z4IA 3GRCA 4DN6A 1ZGZA 3CG0A 4ML3A 2CD7A 2PUAA 4L85A 1Y1LA 2MYUA 4MLCA 3H5IA 2QR3A 5C5EA 3DBIA 1QKKA 3Q41A 3OQNA 1YIOA 5D2CA 2IPMA 1NXWA 2P4UA 1M2FA 3IPCA 2FEPA 2B1JA 3KKEA 4M88A 1ZH2A 4IMIB 4MS3A 1QQAA 3K4HA 1DG9A 3N53A 1K68A 3H75A 5TPZD 4EVSA 4MRMB 1NY5A 5TPWA 5FBKA 3I42A 3HVRA 1JH9A 4LX8A 3HDVA 4EVQA 2JK1A 3TO5A 1WETA 4D6YA 3BRQA 3BRSA 4HNSA 4JASB 3LUCA 3C3WA 2HQRA 2QW1A 4O1HA 2WJAA 1FFSA 4MS3B 4D6XA 4HNRA 4RKQA 1USIA 1F4VA 4LRQA 1PNRA 5TPWB 1CHNA 2WB4A 1SRRA 3BILA 1PNTA 3KLNA 3LUHA 2PE5A 3E61A 4ZJPA 2HQBA 5JNSA 1BVHA 1VLZA 2E4VA 1VRVA 5KC9A 4S05A 3Q7TA 3UK0A 4MQEB 5TPZA 5EWJA 4W5QA 3UKJA 3S99A 4JP1A 4KV7A 5BR1A 3QLVC 3HUTA 2E4ZA 1NXXA 2GBPA 2WRZA 3N6VA 3VNAA 1JF8A 1AB6A 5HQJA 4FE7A 3C97A 3OO1A 1BDIA 1EAYA 1JDNA 2FN8A 3KHTA 4KFCA 4LZLA 4MR8A 5ED4A 5IUNC 3GYBA 5JNVA 3CS3A 2L18A 3IP9A 4MPTA 4P1ZA 4RU1A 5JNUA 1GUDA 1P6QA 4XAQA 4XLTA 4KPYA 2XDYA 2QZJA 1U2PA 1DC7A 4RDCA 1DC8A 2RGYA 3OO0A 3N0XA 1R8JA 3SQNA 1E2BA 1EWTA 2WY2D 5TQ2B 3C3KA 4PEVA 2PUBA 4MR7A 3LUJA 2IYNA 2ZWMA 2M1ZA 4QICA 3L49A 3GBVA 5EWLA 2JB9A 4EY3A 4RY0A 3O74A 4Z4HA 3HK2A 1GCAA 4S04A 1RZRD 2E4XA 1QQBA 1FSPA 3FFTA 1M5UA 3CFYA 4OTZA 4KVFA 4ETNA 1UDRA 4F11A 2F8SA 1ZY2A 1PEYA 2W42A 3KCNA 3IP6A 4Z9BA 2RJNA 4WZZA 4RXMA 3CZCA 1JWLA 4UHJA 1DCFA 3NNDA 3OM1A 4QPJC 1RXEA 3ROFA 3DZDA 3FGZA 4E7OA 4NCAA 5JNTA 4IMJB 4LDZA 3QLUC 3M6MD 5JS2A 5CHYA 3M9XA 1DBQA 3JPWA 3P9YA 5CNMA 3GBPA 5IBQA 1SXGA 5DKFA 3IP5A 4JA2A 1E6MA 3TB6A 5FWXA 4Z4GA 1QO0D 3F6CA 3LKBA 4PICA 4OLAA 1HEYA 1DCKA 2YHAA 3NNSA 3RVRA 5B3JC 1W25A 3H1EA 2PLNA 4ETIA 3EAFA 4G0OA 3LUFA 1PUXA 1TLFA 3CNBA 4JOQA 2PUCA 3H5TA 3MIZA 4NICA 1ZH4A 3CU5A 3N0RA 4HYEA 2E4YA 3KYIB 4MR9A 3T38A 6ABPA 4Y9TA 1BDJA 1ISSA 3QEMB 1JHZA 5DTEA 3C3MA 4RXUA 3JVIA 4Q7EA 5FWXB 5KWSA 4W5RA 3CHYA 5TQJA 3QELB 4Z4FA 4PYRA 3MMNA 1MVOA 2HJ9A 2PAFA 1JLKA 2RJOA 3H1FA 3GT7A 4LE0A 4MQFB 4JB0A 4RV5A 2JBAA 4F8JA 1TMYA 1JL3A 1E6KA 3BBLA 3I09A 1JFSA 1USKA 1URPA 1ZGGA 1BDHA 1QO0A 3LUAA 4WXMA 3RVLA 4MGEA 1DRKA 1ZHHA 2CHFA 3CLKA 3H6GA 2MSLA 5GOTA 1APBA 3OM0A 3T8YA 2E4UA 2GKGA 1MAVA 5T7BA 1L5ZA 1YVUA 3DLHA 3CTPA 3SM9A 5JS1A 2QXYA 4DQDA 4XARA 4H60A 3OMXA 2PMCA 4W5NA 2FW0A 2NUBA 1QPZA 3HS3A 2E4WA 3HDGA 2O20A 4IRXA 4Z99A 1GCGA 3VNBA 3LTEA 3EQ2A 3O2SB 1LBIA 2IOYA 5DCLA 1D4ZA 3H5OA 1W9HA 2GX6A 1KRXA 2NZUG 3A3KA 3I5AA 1AB5A 4KQCA 4KK4A 4YLEA 1Z2EA 4YP9A 2PJUA 3CG4A 4XXHA 4F12A 2QV0A 5IEJA 5BRJA 1C0EA 5CNKA 4YV7A 4MYRA 1JX6A 3TD9A 2MSWA 4Z4CA 2L17A 3FFXA 4OBBA 1YMUA 3ILYA 3O75A 3Q15C 5CNJA 2FLKA 5KQMA 3F73A 1EFAA 1RPJA 4N0PA 2MYNA 2OQRA 1JFTA 2IDMA 4Z9AA 1I3CA 5KQLA 2J48A 5E3JA 1EWVA 1Z2DA 4F3TA 1CEYA 5FWYA 5EWJB 3EDCA 1NXOA 2MYTA 3JVDA 2FMKA 3KSMA 2IPNA 1K66A 2QSJA 5KC8A 3DLBA 1D2AA 4LDAA 3HEBA 2V0NA 2PKXA 3JY6A 4N03A 5IC5A 2KYRA 3CRNA 3M9WA 1U2QA 1RNLA 4MR8B 4RK4A 5DGCA 2CWDA 3G1WA 3NHZA 4QYWA 2YHBA 5TE9A 1E6LA 5T3YA 3RVPA 2PUDA 2H3HA 4WXEA 2ID7A 3N0WA 3RVQA 1A2OA 3BREA 4O5AA 1QP7A 3G85A 2VYCA 3CZ5A 3MYYA 3OMWA 3C6QA 4MR7B 4FB4A 1DZ3A 1Z17A 3DGFC 2A9PA 1DP4A 2FKAA 3N8IA 1SXHA 5EWLB 1YS6A 4W5TA 3F6PA 2X7XA 5JNWA 2PUGA 1D1PA 1ZITA 2FXIA 2FMIA 3Q9SA 2QVCA 5HM6A 2PL9A 4UHKA 1DRJA 1SXIA 4WUTA 1Z15A 4ZYLA 4EUKA 4MS4A 4RK5A 5JNRA 1NXPA 2FSPA 2FTKE 2L2QA 1S8NA 2FMHA 2IPAB 3H5VA 3KTOA 3L6UA 1RZRA 3O21A 3H1GA 2FQYA 3GA5A 5F64A 3RVSA 1T34A 1P6UA 4N47A 1ABEA 3MM4A 3JTEA 1M5TA 4LE2A 4TLLB 3ILHA 4MS1A 2FN9A 3JS5A 3QK7A 2FMFA 1SD5A 1NXVA 3RVKA 4ETMA 4FE4A 4CBVA 5C5CA 1LJUA 4KQ9A 2LP4Y 3OLWA 3GL9A 3LMKA 4KZKA 2JVJA 3SG0A 3B2NA 4H3HB 4MR9B 3O1HB 3MQ4A 4E7PA 2ID9A 2JVIA 2M98A 5TQ0A 8ABPA 4W5OA 5KI6A 3DGEC 3OLYA 2TMYA 3QLTA 4L4UA 1VPWA 2LBPA 4G0XA 1MB3A 1Z26A 3ROTA 5BRAA 3OQMA 1ZAYA 1P8AA 3NNNA 1YK1A 4O1IA 2JBAB 1KGSA 5DLEA 2NZVG 5PNTA 3LFTA 1ZVVA 2ZAYA 4KRFA 2IKSA 3IDOA 2RDMA 1GLGA 2PL1A 1ISRA 3LUGA 5HKOA 4OG2A 1YMVA 4N0QA 1LJLA 4ZMRA 1YTUA 3HZHA
chains in the Genus database with same CATH superfamily
3W79A 1VFNA 3NT2A 2C7RA 1C7EA 5AKEA 3ZY4A 2HPHA 1YB5A 2Y27A 3ORSA 3T4EA 4H9GA 2QVGA 3N8NA 1R15A 3VV3A 1U98A 2VUIB 4S3MA 3TI7A 5A3QA 1NQXA 1U3FA 5FTJA 4DNFA 2CBXA 1WHTA 3GU3A 4HDKB 4KNVA 4FFRA 1NXTA 4GKBA 4CLEA 1SVKA 3E3OA 3L93A 4GVLA 5MN5A 4N65A 2ZJAA 1CIVA 1C9YA 4O1MA 4RNCA 2AFIA 1HEIA 3EE6A 1VXRA 2BGIA 4IF4A 4M60A 3HDHA 5DGTA 5AW9A 3TFWA 4DPKA 4EYQA 4YT4A 2CDNA 3H4TA 1XHEA 3IJ5A 1QO7A 1W36D 5DXFA 4BEJA 1Y6GA 2Z6UA 2VSFA 1C30A 1R4ZA 3FNBA 1Y89A 1PT9A 2AFIE 2I22A 4MICA 5HDBB 4ZZ1A 1XROA 1UBGA 3TVYA 2CFOA 2CXXA 3Q2OA 2G8LA 2C7OA 1XTIA 1O5TA 1MQSA 1K3UB 1NF2A 2FPMA 4FC6A 5IRCD 1NWCA 1R6XA 2P3SA 4RZSA 1Z16A 4GDFA 1L4FA 4JP2A 4IFTA 1POWA 4OQPA 3S28A 1HDRA 2G9ZA 2QLMA 1QP4A 4PV7A 2VBFA 3PC4A 1O6CA 2IS2A 3TBKA 1FU4A 3GGDA 5JVDB 1EX1A 4MPPA 1O8CA 1YFZA 3QBJA 4KJZA 4BPRA 1T36B 3KKOA 5LP6B 3DEZA 1TA9A 1CQXA 3DE1X 1C9EA 5HK8A 3HB0A 3JV7A 2AOWA 4FOOA 5JZSA 2EXXA 1TC1A 3QQPA 4I50A 1VKNA 3HU2A 5CYPA 3PE6A 4WNIA 5AICA 3M1AA 3QPWA 4YH1A 5ESWA 3F74A 4AY6A 4RVHA 1Z83A 3H1PA 3O6VA 5IK2A 3D6FA 3G6WA 1RJFA 2WUEA 4G23A 4YT5A 4QYXA 2WWIA 4CG2A 1X7YB 1XAGA 5BUSA 5AVVA 5JQWA 3QPDA 3K32A 2Q3FA 3IHWA 3EGWA 2Z56A 4NE7A 5HZGA 4BNZA 1KVRA 3IB3A 3M83A 5AVUA 4FSHA 2WJ4A 3FTFA 3JRNA 4PFJA 1JVSA 5DM2A 5EKDA 3KE9A 3EXIA 4AJHA 3K0FB 1J8FA 1EVIA 2OBMA 3UATA 1GAQA 3ZEIA 2Y92A 1CY1A 1U1IA 3AUFA 3P4XA 1EXVA 2I2FA 2HU7A 3O38A 2B6NA 2I29A 2HHJA 3QQ5A 1RWQA 1LVHA 3DE5X 3C4VA 3RVNA 1O94D 5CCDA 3KKKA 4ZRNA 1OFUX 4NVRA 2QZSA 2Q9UA 4GPIB 4R4JA 5EJ5A 1RAAA 4ZI2A 1HNWB 3GNSA 3TECE 4BKQA 3TNLA 3K2QA 2A84A 2QM7A 1Z22A 3ND5A 3PE3A 3AHDA 2X14A 1ONPA 2A30A 4C0LA 3C6BA 2QYOA 5HXAA 1G41A 2XD9A 3HYCA 4TPKA 4ILEA 2ONZA 3WQQA 5JSUA 2ILVA 1XZCA 3A9CA 1AHPA 2ZJ6A 9ABPA 3KVNA 2OO7A 3K6SA 2IUUA 3VYUB 4IQGA 3DEIA 3FCSB 1V0JA 4GC5A 4MLDA 1HOXA 4GAEA 4CDMA 1M1NA 1XELA 3NVKI 1JR6A 2J7PA 3ZWKA 3OQIB 1C7FA 3UQZA 1XQVA 4AMVA 1ESCA 3VRHA 3WGTA 3Q85A 3BHIA 4J2TA 1B6SA 1GUYA 2IV3A 2QBYB 4IH4A 4TMZA 1D03A 3IUNA 4BQSA 2ZXFA 1EE2A 2TYSB 3K73O 3GOQA 1YC2A 2IODA 3S1AA 4QXAA 5CXSA 2BLLA 1SQFA 5A6SB 4CLOB 1Y4UA 3EEOA 2O8NA 3HCWA 1KS9A 1G8HA 3DBLB 3DQZA 3B7PA 3WWPA 1M34E 5IULC 3R6DA 3TZ6A 4DARA 4M9CA 2ZB2A 1M1YB 4YHHB 4J07A 3W5BA 3G13A 1MORA 1UDCA 2PUAA 1Q15A 4LBYA 4J0IA 4BATA 5K20A 4P3XA 3TD2A 4LK2A 3G9XA 2O05A 3FLEA 3UGTA 2YWBA 2HJVA 3TSCA 2ZIXA 3OF3A 1V8PA 2PT6A 1T2UA 2NPFA 4C3OB 5LLDA 1M2FA 2FUKA 1PR9A 3FETA 3FNEA 3I9MA 4KI7A 4OFZA 1AHIA 3F6BX 1S0UA 1LNSA 1P1JA 1BXRA 1SA0A 4FDVA 1XJWA 2CNDA 1JLHA 3L7OA 1J2UA 3OESA 3R0IA 4B7ZA 4AJIA 4NBRA 4ZYXA 4HQOA 4TSFA 1CY7A 1FSGA 2H1SA 2PCLA 3AUTA 3HDVA 3OCXA 3PVSA 5AKJA 3SEFA 3SDZA 3TZHA 4EY4A 1KZGB 4LJLA 3BRSA 2ZYTX 4HWPA 4QPCA 1EKXA 4UM5A 2HQRA 1YR1A 5HMLA 4CMBA 1H2ZA 2VHQA 5IM5A 2D7DA 1D6MA 3OCCA 4U2FA 5IKOA 5TMDA 4PC1A 4RPIA 1F4VA 4YVFA 1UXKA 4HEQA 3I6MA 2VPTA 4K05A 4EG0A 1RKVA 4BFCA 3L1UA 2GAOA 3TKAA 3VV2A 2ZANA 2PE5A 4DPMA 4XJTA 3PTLA 5KTRA 1O94C 1V3VA 3NIBA 4MUMA 1FYFA 1SK8A 1MAUA 3R5SA 4ZJPA 1T9DA 4R40A 1WY5A 2GDJA 3CVXA 1KAEA 1W76A 1E0KA 2C07A 1VG0B 4QJBA 1T2AA 2H2AA 2IL1A 1AOXA 1RHKA 3S2GA 3G5AA 2UVQA 3QJGA 5KTSA 1R16A 2V3WA 4NAUA 1TZBA 2EJTA 4IOKA 4ARZA 4D45A 1A9ZA 1CJSA 1VRCA 1YKGA 2G4LA 4PRKA 3W6OA 1IN1A 3HYLA 3LZ6A 3PFKA 4A82A 1UC5B 5HQJA 5BMOA 1C3OA 2FRVA 3DUFB 1M2VA 5H8WA 1YHYA 4OLJA 1QVWA 4M0LA 1N75A 3K96A 5E9JA 1E64A 3S2YA 1XZAA 2Y1CA 1UBKS 1XQWA 2AE1A 3CS3A 1DINA 2WSSA 4FCTA 5KSPA 3WNQA 3T9BA 1PVOA 1IQUA 1NBHA 1LPBB 3FPLA 3HADA 3HBJA 1DC6A 4ED9A 1XLUA 2PZ8A 1B4DA 1DC8A 4ROSA 5HPYB 3FDXA 5TQ2B 3IOYA 3COPA 5B7GA 2ZI4A 2AR0A 1DADA 1SVLA 5JDCA 2P75A 3P9PA 5L3SB 2M1ZA 1SHTX 2Q4EA 4KTTE 1ZSNA 4NCAA 5DRTA 4ER3A 3FGPA 4LOIA 3OU7A 1G6KA 3VUEA 5EGNA 3STYA 4BP1A 4DV4B 2CLIB 1J49A 1KBQA 1T4BA 1PYGA 2F43B 3UFXB 4Z7OB 1SM4A 1ZY2A 3BEDA 3LT2A 3O73A 1XBTA 4QDOA 3G2PA 2QAGB 5G1PA 4XIJA 1SJ9A 3ZG6A 4ESOA 2Z9BA 1HE3A 1DWPA 3BE8A 1MABA 3CH4B 2ZS9A 4LZOA 4N0DA 3A6EA 4UOEA 2LDXA 3QU2A 2QB5A 3DZDA 3FLAA 2BN4A 5CVCA 1A9PA 1TT5B 2E55A 4HAIA 4E5SA 3TUZC 1I8TA 2YW9A 1WCYA 3WSVA 3FYUC 3U1BA 1EGHA 4L50A 4A10A 2XUFA 4AZ3B 1NN0A 1W5EA 1PJ4A 2H5JA 3L0ZA 3LQKA 3KKZA 4ZZIA 1KP2A 1EJ0A 2XTJA 4L76A 4GQAA 5GIOE 2OB2A 3HC7A 3EAFA 4RHTA 2YYZA 1U1EA 3JARA 1D2HA 5JBQA 2DPYA 4MR9A 2XD4A 3NUQA 2Z04A 4WPGA 3S70A 5IWCA 3VR5H 3B7GA 4DVGA 3BSWA 3NT5A 2OD7A 2HJGA 4DR7B 2QI9C 1TUBA 2LDBA 1IYZA 4X94A 1JW9B 1QAQA 2IVFA 2WJHA 5AKIA 1MJ5A 2B82A 5IMBA 4EARA 1P91A 1MVOA 1E2PA 2DECA 2GN2A 1XTPA 3GPDG 3LRPA 3H1TA 5HG0A 4MWGA 1UFVA 2RGEA 1GZHB 3AVOA 3DXZA 2ECKA 4S2EA 5LA6A 3ETGA 3GDGA 3TQSA 4RZ3A 3S2ZA 3IT1A 2GASA 1EFUA 2A9VA 3BWYA 5EFOA 1SOMA 1ZOSA 1EE1A 2ID8A 4QT4A 1IBSA 1N6IA 3UHPA 4GZ3A 4YC7A 4G0NA 3DW1X 2O8CA 3JX9A 3PJGA 1XDSA 3GLRA 1KH1A 1X8LA 5B4TA 1P9NA 2XXAA 2G0AA 1M5RA 2PGLA 4XARA 2IT1A 2I8LA 2ZJ5A 4CKWB 3B8HA 1ZNQO 3O7MA 1A8UA 2WICA 3AU8A 3PPYA 1CK4A 4GO1A 3QVMA 4NULA 1H8ED 4TKMA 5DHTA 1PJ3A 4RJJA 4BFVA 5H68A 1DIOB 1AZTA 3LGAA 5AUQA 4CTKA 1Z06A 4H6VA 5TR9A 2PH5A 3BD6A 3KU1A 1GCGA 4NJOA 5B1IA 3VNBA 3HA7A 3W2EA 2ADFA 4JNCA 5IYZA 3E7DA 4EA8A 4LW8A 3RYTC 4FFOA 5JC8A 4UMFA 3ZCSA 3GRAA 3O3NB 3OZTA 5COAA 1GZ7A 4HKTA 3CUEF 1FIUA 5BNIA 1XDGA 1C3VA 1KXZA 2PJUA 1WDWB 2WIKA 4OQXA 4TS3A 4JP8A 3UBMA 1XCOA 3ZXSA 3OKCA 4KQKA 5FV4A 2RKBA 5CITA 5F2KA 1QMGA 2YN2A 2XEXA 1Z5UA 1C9JA 3FCAA 4K40A 5K4AA 2R4UA 5J4HA 4YUVA 1M76A 4EJFA 4PRZA 3UV7A 4NNJA 2R84A 2WOOA 4WLFA 2G09A 2HNAA 3QKSB 3BB3A 3ZCXA 5BY2A 2MYNA 1CVRA 1KPGA 2V5UA 4LC9A 4OFXA 2F7SA 4Y2SA 1D4FA 2ZEJA 2VZEA 2ZUDA 3IJEB 2Q3BA 4NAVA 3G2IA 3DTVD 4CN9A 1E32A 5L4LA 3UAXA 4M38A 5EXEA 4BEBA 1YBMA 1E59A 2GK7A 2CSXA 3V34A 4RD4A 3MUNA 5DNCA 3UA3A 1NM5A 3OJ0A 3I2FA 2VNIA 2GHQA 1KJWA 3QVOA 3ITEA 3HN7A 4JELA 4YMLA 4WN9B 5GAJA 2A4MA 4PNEA 3HDQA 2WSLA 2CXTA 2DHQA 1S7GA 1M3SA 2NO1A 4M54A 3ETCA 4J3FA 8LDHA 2FZ5A 1G4AE 3ZTYA 3ZDAA 4BZPA 3DDOA 4X54A 2D6FA 3RTDA 2Q2QA 3HN6A 2O2SA 5GJBA 1FXUA 1Q7RA 2WT8A 1R88A 3C3EA 2P2NA 2QW0X 2VHXA 3CUUA 4I50F 4KQXA 3WYEA 4BNHA 4EDFA 4NCKA 1LDYA 3TBFA 1A5BB 3MYYA 2J87A 3B1FA 1XJCA 3C6QA 5CX1A 4JLKA 3VU9B 3CLTD 4BC1A 4QQRA 2CLFB 2BGMA 4MQ6A 2VTKA 2C2BA 5IC6A 5A5FA 1Q0PA 4OQYA 4PW0A 3Q12A 5EWLB 2DE0X 1I6KA 5EESA 3USES 5BV0A 1YQTA 3EBLA 3N3AC 4QUBA 4CFYA 1F1JA 1A1SA 2C7VA 4X20B 4E08A 2EIXA 4G9BA 2VCHA 2OCAA 3V8RA 3UB3A 4TL7A 4BXOB 4TL6A 2DB3A 1SD2A 2VOEA 1DIAA 2JLRA 5IF3A 5ALOA 4JXXA 1OXMA 3A2LA 2AOXA 4L5JA 4KRYA 4E4RA 1CY4A 1UBLS 3AUJB 1VCOA 5DLEA 2X8LA 3SHOA 3ZH2A 4KB5A 4IV5A 4QOJA 1K8XB 2AXEA 4LIPD 5EJ4A 1YR8A 2YH2A 1E2EA 3H97A 2HA3A 1XTSA 3N5KA 1O95C 5DLYA 2PO7A 3H2KA 1SN7A 3ILHA 4MS1A 1C8KA 4W9NC 4ZK2A 2Y9PB 4DWOA 4BCBA 2ZJZA 3WK7A 2W2XA 4QOHA 1T2NA 4IW3B 4CI9A 3EVDA 2CNNA 5C8XA 5KX5B 5BSEA 3HWX1 4UU7A 5JASA 2BMVA 4CBVA 4GH5A 3U62A 1V8DA 2HZBA 3C5WP 3OTIA 5A5EA 1O03A 2W11A 1KC1A 3F4LA 3C85A 4ND7A 1TM7E 2B36A 4QJIA 3NVAA 5DVZA 4AURA 1G66A 3NO4A 1SIUA 2J5XA 5F51A 2K5UA 3BS4A 2HREA 2Z5VA 5JQGF 1VPWA 4KGVA 3ZQ6A 1CY2A 2ZU0C 4EZIA 1ARZA 3G0HA 1WPQA 4YLGA 4ABTA 3C7CB 3CZAA 2J4DA 1SBIA 1TZ2A 4UATA 3S81A 2ZSJA 5FWNA 3T52A 1Q19A 1QOPB 1SCQA 3COYA 5JROA 1H9AA 1OROA 2H9YA 3R3XA 3PA6A 1GGMA 5DF1A 3UT0A 3E4DA 1ECGA 3IDAA 4U2DA 3WLAA 4MH0R 4ZMRA 1JMYA 3QUCA 1FCJA 4HSEA 1N8SA 3HJAA 2A1UA 2P2CA 5DK4A 2HRDA 3IP1A 2E1PA 3CKYA 3T1NA 3URMA 4H4DA 4P4UA 7MHTA 1XU7A 3TR0A 3VO9A 3HXMA 1JHMA 1U0HC 4JI3B 3RSHA 3HU1A 4MQ4A 4O4LF 5BXQC 1LV8A 2ZYGA 1VLLA 3CLUD 3PGA1 5EZYB 3SXJA 5IFKA 3PNLA 4E94A 2K87A 5EIAA 1OCEA 3KWLA 2HWUA 2JFOA 5I4CA 5AJHA 4B8ZA 3GLGB 2LRHA 4MAAA 2OYCA 1EFPB 3RC7A 5BN3B 5I7RA 1ETHA 2AYZA 2GLTA 3CRQA 2I9PA 1GFIA 3HM9A 1Y3AA 3E9YA 2OZPA 3GLTA 1Y37A 3GQVA 2DRIA 3DV9A 3K0HA 4AS3A 5IK2D 3RIEA 2KLBA 4KXMA 1JHDA 3NAQA 5J5VA 4MROA 3U3JA 4FS3A 5AM5A 1IN5A 4IDCA 4RH3A 1PWHA 5G0UA 4KHPB 2WWWA 3W1EA 2IYXA 2BMEA 1RPNA 1U04A 1XEWX 3ZCPA 5DHSA 1G6Q1 3MT0A 4FZ3A 1NBAA 2P0AA 4CG3A 4CIVA 3KQKA 2WMOB 4UOQA 2WF5A 1TVKB 4Z8XA 3F6RA 3KOZA 4MQ5A 4PO3X 2X8JB 3L7YA 1U3CA 2VDPB 1BOOA 1LXCA 2IHZA 3IQGX 3NBUA 1NR7A 3Q7RA 3LGSA 2PV7A 2AFVA 1BYIA 3F96A 2C83A 2YTZA 3RO7A 4UREA 1K3FA 2X7JA 1U0FA 5TGDA 3H9GA 5IT4A 2OCYC 1ZMXA 1DL5A 2HY7A 2UYOA 1D7AA 1V41E 3A1CA 3CLRD 4JUCA 4WY5A 3EXEA 3RYHB 3RRBA 1KO8A 1NQUA 1M75A 4OQNA 4RVOA 3G6KA 4K9SA 1D1TA 2IFTA 2OUKA 1SZJG 4ZPJA 1YO6A 4QU9A 1O0BA 3F1KA 1PW7A 1E9RA 3M82A 3IFSA 3AIIA 4D3DA 3GJRA 1XLTC 2OENG 3WK9A 1MF7A 3HUEA 3EW9A 5EPUA 1PSZA 3F3KA 1U8XX 1QQ5A 2XLCA 2AZDA 4BE4A 4DLYA 4KPUA 1EFVA 4P98A 4TMYA 1C7QA 4BVAA 5ICMA 1JDBB 2CBZA 2I65A 3UJAA 2FLVA 1X7ZB 2P9GA 3FCYA 4BNXA 4BFLA 2I8CA 2BEJA 3O84A 4GMDA 3WVNA 1GUAA 1LSJA 3A4YA 5J3JA 1XMVA 4TT3A 3U0BA 4N0EA 2PMKA 4UFOA 4UCXA 2GD6A 2VHVA 2WQZA 4FSDA 3GD5A 3OLCX 2J7PD 3UICA 2QU8A 1CP2A 1NXSA 1L3CA 3BJEA 4NMWA 4OQMA 1NT2A 1JBEA 4YRLA 2NOAA 3I76A 1WB9A 3NHBA 5ILQA 5AVXA 1NBMA 3HUUA 3G9UA 4KGXA 1MVLA 1WMAA 4BO3A 5BWLA 1FU7A 4JU8A 4FHFA 1FVXA 1EGAA 1NFQA 4M1SA 2D1YA 4YQZA 2NVWA 3WYBA 3Q6NA 4KPEC 2QP3A 1EYZA 1OBFO 1JJBA 1NBME 1D6SA 2FI1A 1MKYA 1P1IA 2HMUA 3NHMA 3OWOA 3JASA 2P9EA 2VRWA 2GXSA 3NHRA 4QFDA 4US0R 2ZRPA 1R0XA 4IAOA 1GQ2A 4CCYA 3HABA 5K0ZA 2ZYUX 3BFVA 1DEXA 1EZZA 3DP9A 4JOBA 5LKRA 2D1TA 3U81A 1DTWA 1E3QA 4B6GA 3MQ2A 5EKXA 2VT7A 3NRBA 4ZD6A 3WL6A 1PR2A 3GV0A 5DASA 2X2OA 2D1SA 3DJYA 5EINA 1M2NA 5H83A 1G4HA 3RC1A 5FYQA 2GZ2A 3MCZA 5IVIA 4IILA 2PT5A 2QPTA 2C03A 3OQOA 4RZIA 4G0QA 2NVOA 5EZQA 5KYXA 1NQAO 3T7IA 4NQRA 3QY9A 3V00A 1SPBS 2XHZA 1KMCA 3EGCA 5CDUA 5LQDA 2CYAA 2FU5C 2NW6A 1G98A 3R2JA 2WFLB 2QSUA 1DUVG 1N5MA 4NBWA 3HRHA 4QEKA 1QXSA 4WT7A 3OZEA 5KQPA 4LWPA 3O8QA 4C7KA 5D87A 3ZKWB 5HKLA 3X1YA 2PUEA 3LH5A 2HZ7A 3IODA 2RCNA 3E0QA 2WKQA 3D9QX 4DN6A 4CCAA 3O91A 4ML3A 3TSWA 3VC3A 4B47A 1FP6A 1AZSC 4YJ2F 5IXJA 3CNOA 3WQHA 2B4TO 1F4LA 2OBYA 4FW8A 3WWEA 4AJLA 1YH3A 5AFSA 5JBIA 3Q41A 3PFGA 4G37A 1CZUA 3K9NA 4LZZA 4OMDA 3WICA 2IPMA 5B30A 2IOQA 2M1XA 3HFJA 4PAOA 4X3PA 5LA6F 3FHTA 1AUXA 1XI2A 1SUBA 4GZMA 1Y4AE 2B5VA 4LMBA 4RFVA 2FSVC 4UAGA 3V8QA 2QP9X 4RPCA 5E1BA 4R7TA 1N4AA 3SKYA 1BU5A 4NOLA 1BCRA 4X1KA 1A77A 2H9IA 3DC7A 2R62A 2WLTA 3DW3X 4XWYA 3U9TA 2I2AA 1D09A 1UFOA 1QKJA 2QAIA 3QF4B 1J7JA 1N5KA 2JJ1A 4MWCA 5HBRA 1OHHD 3WKAA 5GIPE 4IHJB 4H1UA 4MUHA 5CHEA 2Q2VA 2ZRMA 2VP9A 3OEWA 4CR7A 3ZE2B 4DZZA 5GJVC 1USIA 4CL2A 1C29B 1AQYA 3DKPA 2JAUA 2X0NA 3JYNA 2PRSA 2VNAA 3P9XA 4RGYA 4CF6A 3PXEA 3I62A 3K5IA 2VTEA 1ZP6A 3KJNA 5CD9A 3HUFA 5IYZF 1U8CB 2WSYB 4HX9A 2IIPA 2H06A 4BV8A 2E4VA 3P94A 1KEVA 4DJJA 5K9ZA 2V0CA 1VL2A 2VQFB 3SQLA 1EFRA 1XA4A 2FMUA 1JU3A 2J07A 5CYFA 3U9SA 1R0WA 4NJMA 1QRAA 1KZ4A 2B92A 4WECA 3H1BA 3OHPA 2FW1A 2VYNA 3S99A 3V1UA 1N78A 1GDDA 2I4RA 5BR1A 1CJKC 2H48A 3HUTA 2IYTA 1WBJB 2E4ZA 4I8IA 3AXTA 2J3HA 3N6VA 2RB5A 3FYDA 5HS6A 2RGDA 2Z2JA 1L1QA 3WY9A 1VJ5A 1VIAA 1IZZA 2GSWA 1ACMA 1PBTA 3IVCA 3FZEA 2QQEA 4FQ8A 1GFZA 5IUNC 1JUDA 1YR2A 3A6KA 3H4IA 3I2GA 2YQ4A 1X7XA 3EXFA 1OAOC 3MGBA 4L08A 4UXJA 1H23A 4ARCA 5ADVA 4IDNA 3PKJA 3GJZA 1AKMA 4L22A 1S2DA 3AT1A 1W29A 2PRYA 1X1BA 2XDYA 4K9KA 3JALB 2X22A 4LHSA 2JIQA 3EGXA 4C43A 2GPBA 2XX3A 3CYFA 3AVUA 4GYWA 3PGKA 1HA3A 1HZZA 3KOOA 3QOXA 1W5SA 2R65A 3AHFA 5KYNA 3U16A 2FPIB 3LUJA 1GNSA 5HIKA 4V2IA 3ZCVA 2JCXA 4L2IB 2W0MA 4EY3A 4U2EA 3B2EA 2VRBA 4MK4A 4ZCIA 5I48A 4BE7B 3GP8A 3HWWA 2QTAA 1R8SA 2BV3A 2XF8A 5KYGA 2CNBA 1H05A 2XUKA 3UBTA 4BO0A 4BNFA 4YREA 3B1ZA 5GOZA 1U6KA 4DNQA 1RM4A 2ZBUA 4KIGA 2W93A 1DRUA 4G89A 3UTDA 2QX8A 3WGYA 1BYUA 3VSDA 2YXNA 3BXXA 1QHNA 3X1ZA 4A4DA 4AKSA 2NTNA 4TXHA 2ACKA 3M6MD 3VZQA 1GAEO 1Z7BA 3SK0A 4RAQA 1T1SA 1YS9A 4PSDA 5J1SB 3ZD7A 5BNZA 3AC0A 3RYIB 4O4IA 5JH7A 3HG7A 1NBIA 1Z68A 2DKFA 2KBFA 2XCOA 2XCIA 3NYRA 4ID3A 4YO8A 3TLMA 2V6IA 4E2FA 5B7PA 4L0MA 2PFKA 4F2GA 5AQ1A 4M7RA 5EXSA 1MB9A 3P9RA 5H9WA 3R3ZA 1ESEA 4BNUA 3CNBA 2C4KA 1I3KA 3WLOA 3AP3A 3F8SA 4E2YA 3LQ4A 1ZK1A 3AJEA 5AO9A 1VZ2A 5KEIA 2OAQ1 3ZJ5A 5K5EA 5L53A 1ISMA 4YJFB 2YV2A 3AHGA 3QEMB 3QYJA 4DNOA 2GPWA 5T8KA 3KSDO 2HMWA 3C16C 4HXFB 1PZEA 4ZMBA 2C3MA 4P7KA 2GLUA 4EKGA 1AQUA 1DI0A 4KE9A 1HYEA 2IXAA 3SX2A 4KAFA 3QBDA 2HJ9A 2OQVA 4X41A 4WZAB 4MQFB 3JQBA 5J63A 3EPHA 2P9JA 1C7JA 3OI7A 4K2AA 4YP7A 4KQGA 1DFGA 3BBLA 4LY6A 3WFJA 4M0MA 1URPA 3O83A 3PK0A 1W1WA 3AB7A 2YC2C 3GFVA 3ORRA 4I1SA 3V97A 3BX1A 1P0PA 3FM9A 3N74A 3PYLA 1JAXA 4PQFA 4QSMA 2TS1A 4F9EA 3R9WA 4RVSA 1M1XB 3FPSA 1NW9B 3NFYA 1YE5A 5IAAA 1GYQA 4GOXA 3RV3A 1ZGCA 3T1QA 1V39A 4UASA 2I7DA 4DCSA 1TZJA 3KXPA 1QNFA 4YJGB 4OU5A 3V1NA 2HCJB 4MVXA 4OL0A 4FI3C 5KTKA 4HAYA 1P61B 2RHCA 4XRGA 1H66A 2CNKA 3KE8A 2G1UA 3GFBA 4L28A 5GONB 3EXHA 2HFJA 2C2WA 4C9BA 1Q44A 1QPZA 1S5PA 2EW2A 1JAZA 2LTAA 3HJCA 4OGKA 2EYQA 3HDGA 1H2FA 1I10A 1N6RA 2AFRA 1CQIA 2C96A 3IXLA 4FINA 4QXMA 3R7BA 3HJNA 2AC7A 3OPYA 2ZUSA 1YJQA 2DPGA 5KYWA 2F90A 3F5DA 1LBIA 3FWNA 4YMUA 2ODNA 3G2QA 5E2BA 1GQOA 2ZP1A 2BEVA 5ALZA 4U2KA 4MTCA 4UTXA 5U1PA 2Q5OA 3H8SA 3HGQA 2X8AA 2YVAA 1YT5A 4GEKA 4YP9A 1WMDA 4A2WA 5KREA 5I5EA 1GDTA 1FTQA 1G8FA 1NKTA 3FMGA 1G8SA 4L4YA 3OFKA 5M3BA 3HXPA 3QLJA 2JGIA 4GOMD 3HDTA 3UPDA 1W44A 1RXVA 4BMCA 3LCUA 5C52B 2FSSA 2BMDA 1I2AA 4FFLA 3G88A 4UMEA 3SQOA 1ZJ6A 1G2IA 3R8XA 1P77A 1SHZA 1Z5GA 4N49A 2OQRA 5KMGB 3EFEA 4MKGA 2AR7A 4Y0AA 1DBRA 1GGEA 3WOHA 1LUAA 2C5EA 1MO2A 2UZ1B 1GG5A 3T9AA 1BJTA 2J48A 5BUCA 821PA 2X6QA 1ODTC 3NJ8A 1Y9ZA 5HFNA 4RA6B 3SJAA 2GJ8A 4W82A 5EYPB 3GROA 1QLJA 3S2IA 1AQIA 1U11A 2BDTA 2DBVO 3U49A 3R20A 4A26A 5IAOA 3WFIA 3GUYA 4YP1A 5BV8A 2P30A 3GJ8A 1VJDA 2ZXEA 4WNAA 3H8VA 3HVJA 2NUAB 5KC8A 4X24A 1JZTA 3DLBA 3IVXA 4K5QA 4UPDA 1P72A 2NXEA 3HVKA 3QWFA 3LM8A 5TMPA 2F1IA 3D2BA 3HEBA 5AM0A 4KN9S 5ENDA 3Q88A 4AJNA 4ZARA 2DUUA 3CRNA 2G9VA 1Z6QA 2OV1A 4I14A 5K0GA 1U1DA 4NIMA 2OM2A 4J76A 5A4MS 4OA8A 1G42A 4YAUA 4UFNA 4I2VA 3E4CA 2H3HA 2CJXA 3C3JA 3DTTA 4OJTA 3GFGA 4JBXA 3RNOA 1RM3A 1BD4A 1TCUA 5KCZA 3UMYA 4DC9A 2QRVA 4XB1A 1LJ8A 4BN0A 4QBKA 3NHWA 1N2JA 4MEJA 1PLKA 4QEDA 2B7CA 3T5AA 1ZVKA 3QI7A 2JLSA 2XDWA 4V24A 1JEEA 3NORA 4C7OA 1ZUWA 5B58C 3KQWA 3NHKA 3RKUA 2XGOA 3ADOA 2C88A 2PGDA 1IEXA 4NY1A 2SCUB 3NQ41 5JNWA 2Q7OE 2JGDB 1A88A 2W2OA 3ZZNA 4R01A 1GTRA 2G5PA 1TTQB 4EHFA 2CLMB 4PNZA 2GQ0A 4MCJA 3VOAA 4ZYLA 4JSYA 4M8NE 3MTIA 3FLMA 5CVVA 5ALJA 2MINA 4RK5A 2BM8A 1K97A 3FUUA 2FTKE 4AIIA 2YJTD 1DLJA 2C59A 2FFHA 3L6UA 2AF4C 4BO7A 2RH4A 3H1GA 1E1NA 1XDBA 1FRQA 3F7OA 3GA5A 4YASA 1L5KA 5C80A 4Q0MA 4BV2A 4OFWA 3ITKA 1ODLA 1ABEA 5J9FA 3DPSA 5AW5A 3KZKA 4LE2A 2X0FA 1XCMA 4MUIA 3FJ1A 1CUSA 4PBTA 1EB8A 2P79A 3ED1A 3OOYA 1EFTA 1KMNA 2BJVA 3R5FA 5IT5A 3A3PA 1K8QA 2BGWA 2GM3A 4KR7A 2VR1A 3ESCA 4PG6A 4D0RA 3ZPXA 1X1QA 2YOHA 3H2HA 4KLAA 1Z39A 3E18A 4ZODA 1SG6A 3T1OA 4ZDIA 2IGBA 4ZVVA 4EVIA 5LMUB 4NPCA 2JVJA 2J45A 1SRQA 5SYMA 1L5MA 3DO6A 2X9VA 1N6OA 2EG5A 4D92A 3BJZA 1ILWA 1UFKA 1RJ9A 3QXXA 1C9DB 1UADA 4QFMA 1GTL1 1M2HA 5KYKA 4TMFA 5LOVA 2I6TA 4L8YA 4DJFC 3LC2O 3K05A 3B1XA 3LBNA 2H4WA 3LYLA 3SZLA 4YRAA 2QVLA 3HCPA 4XA8A 4OH1A 3IQZA 1QGUB 1KGSA 2AFHB 5FBWB 1N8KA 4UVIA 3VZSA 3C3DA 2BGTA 4B74A 2GVZC 3HR4A 5JEEA 2MOKA 2Q6LA 4UNQA 4BIIA 4C89A 3FOBA 3OA2A 3NWBA 2F8LA 2R68A 1KJ8A 2NQ2C 1UMDB 4ZOLB 1FDRA 3U5TA 2B2NA 5GQSA 1OIXA 3EOZA 1W5BA 2XUGA 2J67A 1CVLA 4UZSA 4DR4B 4QE3A 4C29A 1PX2A 3JZFA 4OLHA 3G59A 1ZN7A 4KDFA 1B6RA 1Y8CA 2FZVA 3DD1A 4MVYA 1PR4A 2XZTA 5REQB 1CC1S 4BZQA 1OAAA 3EWIA 4EL5A 3QFRA 5L7WA 5EIBD 1DXYA 3SC4A 3HVUA 4HNAB 1W0KA 2JGKA 4K86A 4KYVA 5D5PA 4YCSA 2ZI7A 4TQGA 1ZH8A 3E58A 3GLQA 3L6OO 4UHCA 2I7TA 4TQAA 1N2GA 1J99A 3HKBA 3N05A 3F2VA 4CLDA 1MR3F 2Z6AA 1ISPA 2AQIA 1QYDA 4UUNA 2IWHA 3M0EA 1MOSA 2RH8A 3BQ9A 1Z25A 5LN1A 4A5OA 2A35A 5IVHA 1ZKMA 1FLDA 3IRVA 3P2IA 3QXJA 4IXTA 2C95A 2ZTLA 1BHSA 4H7KA 3T4XA 4CMKA 3E1SA 4MQLA 1T5SA 2O1EA 4GNRA 1CUZA 1RP7A 3QG1A 2IY8A 1FXWF 4KWEA 4OQDA 4XFKA 5T57A 2QJOA 4U9UA 2ZTMA 2YV1A 5AVWA 4GF5A 5JAOA 3K92A 1P44A 4CF4A 2OVFA 1X7GA 2HBYA 3EUEA 1RC8A 2ARKA 1NLMA 3BSFA 2J9XB 3AEUB 1Q6YA 1V1MA 5FQOA 1H5QA 1RHMA 1GPYA 2G5GX 5AP9A 1Z2NX 3TGWA 4DLAA 5M5BA 3WLLA 2I6FA 3H7AA 5KNBH 3KHSA 4PE5B 3DMPA 3SE7A 2BDUA 3WLJA 1CKEA 4YRFA 1YB2A 2M9MA 3RB8A 3HDJA 3ER9A 4TXMA 2X3YA 3HL0A 4G4IA 3EGVA 3L6EA 1ZD2P 1S2GA 1X42A 2HQ1A 2HYDA 3A3NA 1QH1A 4PY2A 1IH8A 4X7RA 5ARCA 2CL5A 4MW4A 4Q18A 1K2VN 3KUUA 3KO8A 3EASA 2RGAA 2X58A 4WFQA 1UOOA 2DUJA 2FZWA 4LXXA 5K0LA 3BMNB 4B3TB 4O2AA 2X1MA 5IUJC 5BV7A 3VM6A 3NBYC 3LE8A 4DJTA 3W7BA 1VBMA 4LRTB 4EFLA 3RQIA 5D51S 1PEAA 2CLSA 4F56A 3Q1KA 2AEMA 4CQLB 1AY0A 2R6JA 4K26A 4UFPA 2G88A 2DFDA 4R1LA 3D4PA 4WX2B 1MHPA 1LQ2A 3V5NA 5JO0A 2I71A 2Q5HA 3QX8A 3UJHA 5K45A 1VLMA 1KZ7B 1PJBA 1PFVA 2ZYSA 2YJ4A 4KHZA 3RRXA 1QH9A 2QRPA 4MUGA 3SHWA 5I7VA 4HJXA 5IBCA 1E5QA 3RYCB 3RWMB 4N8EA 5CP8A 3KJXA 2O54A 1UBNA 1UEJA 2ALJA 3IA2A 3K0BA 3A3OA 3NVMB 3H5AA 3MTQA 3QVLA 1LPPA 4WA8A 4A0QA 4F5WA 4HQLA 4R8MA 4XZ3A 5AXAA 5KYYA 6ADHA 1GZ4A 1E7QA 4OP2A 4C07A 3FNQA 3DULA 3GMTA 1P2FA 3EJWA 1OZAA 1WUYA 2AEJA 3P1JA 1IHPA 1LI4A 4DOMA 3ONEA 5G40A 2GYVA 3LUKA 1TYCA 4NYJQ 2A5FA 1SUDA 3GEEA 5BYKA 3OTWA 1A9XB 4NCXA 1E6CA 3TB4A 3PR3A 1HYQA 1SU7A 2DLCX 4M1ZA 4QDJA 4E0BA 4B5LA 3WDLA 4X3CA 4YCLA 3ADPA 1YJCA 3K7EA 5EP2A 4NHOA 4DCTA 2ZCJA 3VR4H 2JRLA 3FWZA 4G8DA 4YJKA 3CEHA 2H11A 5B3KA 3KLPX 1CIJA 1NRXA 2CUZA 1WB4A 2CMKA 3CKMA 2F1HA 3ND8A 4BO6A 5JH7F 1R6TA 1DJMA 4MJLA 5DNEA 1XZNA 1YRBA 3ODPA 4J16C 5AKGA 3GI1A 4EYKA 4YR7A 3NB0A 1TGVA 1ILEA 1H9CA 1Z7EA 1XXLA 1WSBA 4HB3A 3SF8B 1W5TA 1UMBB 2QTLA 2G5CA 4KRGA 1OGYA 4IO1A 3TDMA 2YFKA 3AUXA 2NXNA 1S4MA 3R75A 1NVWQ 2A9OA 2Z5FA 1NASA 4M6WB 4DY4A 4DHEA 2JJ1D 4J75A 5IW8A 4ZOCA 1V71A 2PMDA 2WF9A 4HFRA 4R05A 3GJTA 4C2BA 5BVHA 1D5CA 2IHVA 3QVSA 3CW8X 5DHFA 4TKVB 4UVEA 4JR1A 2O8BA 1M33A 2OCPA 2QR3A 1YDEA 3G8DA 2IX3A 4BU1A 3BFPA 1L8AA 5K3AA 1O5OA 2IOFK 1QKKA 3B9QA 3GEDA 3T7RA 3TD6A 5J2UA 3KQUA 2Q1XA 3GP5A 2P4UA 4FFNA 1NN1A 3W2IA 1NVAA 5I4IA 4DHWA 1EFRD 4KPGA 4U7TB 2Z83A 2H92A 4HAZA 4B80A 5JIBA 1FVHA 1F3OA 1I9CA 2ZR8A 2ZT8A 3AW8A 3HY6A 1VHDA 4REQB 1BMTA 1BHO1 2VYND 3ZJYA 2PWPA 5CB4F 5BSTA 1VPDA 1GR1A 3BFKA 4RE5A 1JH9A 3ENWA 1AU9A 1NIJA 2O23A 3KETA 1NNLA 1U9ZA 4IL5A 3RHZA 5KINB 1WETA 4HNSA 2G4CA 5LUAA 3MMSA 3B6MA 3P4YA 3DD5A 4F8EA 4DMRA 1QBGA 4FJ2A 4XX0A 4WI1A 2QTCA 4Y6SA 3DWFA 3SMVA 2JAQA 4RTMA 2EX1A 5CU7A 1DOAA 3VO1A 2I3ZA 3PRKE 2HDHA 1IXYA 1NOJA 3SYKA 3NTVA 3E61A 1YNOA 3JZDA 5ADWA 1N34B 1U6JA 2Q1SA 2OUIA 3F5SA 2VP4A 4E2XA 1O1YA 4XIFA 1DARA 1W1IA 2JASA 2VAPA 3EG9B 1PJLA 1GZ5A 3VH2A 2GHRA 3DUWA 4PWZA 2YZ7A 1H2AS 5EWJA 3HKDB 1GV1A 4YTEA 5SZKB 1X74A 4JDPA 2ANCA 2SECE 1UBSB 3CVYA 1FZTA 1F8GA 2E7ZA 2A2ZA 3SQMA 4DEXA 3IEXA 1RZUA 2HIGA 3X1KA 2VO1A 1MC5A 2G04A 2P9QA 3E2PA 3ET5A 2PZGA 5DTJA 1PI3A 3DBRA 3C97A 1K89A 3OO1A 1GPBA 4JZYA 4MV7A 2GF9A 4RL6A 4CF5A 2JDIA 1J5EB 3M4XA 1FQOA 5IARA 3UA4A 5BNTA 2CDCA 3NWEA 3LI2A 2H3EA 2OGWA 2EWVA 1XAIA 4ZVMA 3ZQKA 4FYXA 5KYTA 3FJYA 3IR5A 4A8HA 2IK8A 3PXAA 4Q3NA 2CJYA 2V9CA 3FYUB 5TF4A 4P0QB 5KTTA 1CR1A 4CQMA 2JIBA 3KWJA 3P4UA 2NU6A 3ESYA 4E1AA 2WPDA 4L9AA 1CX9B 1GA1A 2L42A 4MUBA 5E6RB 3S2EA 2IYNA 3GLIE 2J0VA 4B43A 3GBVA 3CVJA 4IYJA 4ZU1X 1NVXQ 5K8CA 1OD6A 5A4FS 1MG5A 1QQBA 5H70A 1PSDA 5DLDA 3C5VA 3R3SA 4BMNA 1WW3A 3ECAA 4QL3A 2Q6VA 4AVYA 3CTMA 3B1JA 3LRXA 4JUFA 5GGXA 5J1TB 3TLBA 4FU0A 5K2OA 3OP4A 2RJNA 1JHRA 1T4CB 1YZQA 1ODCA 4V1CB 2QZPA 2G9RA 1U9IC 5LBUA 5FLXA 1BH6A 4HLDA 3SIRA 3F4BA 2MDTA 3WBJA 1FP7A 4LDZA 4KR0A 1SKYE 2WUFA 1NQOA 2WTEA 3P9YA 1OBHA 5KAPA 1X1SA 5IBQA 3MGCA 4OUDB 4PCAA 1CDDA 5DKFA 3DG9A 4PPQA 3V8PA 2H4FA 4RWZA 1RYFA 2XV1A 3DFKA 4Y7CA 1O6GA 3TB6A 4PICA 2ZOSA 3A1NA 3NYIA 4Q19A 1M6HA 1AKEA 4TLCA 1E0DA 4D02A 2QUKA 1Z8HA 2XOEA 4QXRA 5B4UA 1CE8B 5H4HA 4N3NA 1EJ6A 3WNBA 1THGA 1PP4A 3P27A 4G0OA 1Z9BA 2GZDA 2W90A 1YQWA 2P3OA 2X9LA 1LX7A 3JQ9C 4XTCS 4MKHA 2HMYB 3JYHA 3QOFA 1PWXA 3BB1A 1H2BA 4BKRA 4EMBA 1I4TD 5K8JB 1KAOA 2CK3A 1I36A 3CSDA 1KDVA 3H2BA 3R4VA 5FUBA 2PNJA 4BTLA 5LQAA 2GCEA 1XHLA 1KZ6A 3LDFA 2ZJOA 1AT1A 2AE2A 4FZJA 3WDSA 3QE2A 3K8YA 1SFRA 1FXSA 4BTEA 1P3JA 3WO1A 2PZJA 3OIYA 3S2UA 4CEIB 3IDFA 4LXQA 4ZAZA 4MA5A 1RQ2A 4FCVA 2EDCA 2VF5X 1SC3A 3KBBA 1E6KA 1HH4A 2E87A 5C46F 3M7IA 3GUZA 3PJDA 2IBMA 3BMQA 3FY4A 2FOXA 4R9RA 4XQCA 1DQRA 1P9RA 4XSHA 5I8PA 2J08A 2AI1A 4MQMA 2DZDA 3BERA 4OK3A 5BMVB 1G5IA 4AWBA 4QC2A 1E18A 1XRSB 5H1YA 3SBOA 1EVJA 2IE0A 3VZBA 4L6IA 2QJFA 4WBNB 2QXYA 5G0SA 3SX0A 1K6EA 3V6MA 4DQDA 1JGTA 4H60A 4M2LA 1AV6A 1H6DA 2ZR7A 1M0SA 3O8DA 1V5IA 2GPAA 4PLTA 4GPTA 1RJGA 3M4NA 1L5HA 3ZHRA 4C0HA 2FUG6 2DGDA 2V7BA 3GFRA 1IBMB 2QPOA 1HSZA 1WW8A 3O2SB 4JC5A 3ROXA 3W2GA 2Z43A 1SR8A 1UXHA 2W71A 1A96A 1T26A 1MTOA 3IOMA 3O9ZA 2CY0A 5ALPA 4PS1A 4P34A 2BE7A 5DU2A 3RS7A 2Y1EA 4ITVA 4C2TA 1ST3A 3HBLA 4JN6B 1QF9A 1T9GR 1T5IA 3HLYA 4N8SA 3E2IA 2GUWA 2JGEA 2AW5A 4CCWA 4FOTA 5SZHB 5T8KC 4CR8A 2QV0A 3JVVA 4PZAA 4TROA 4OHFA 1FNSA 1CP3A 4F84A 1WQ3A 3NGXA 5LD2C 1D04A 1ISFA 4DSAA 3O75A 2YVLA 1B26A 4HLUC 2C94A 5J2TB 2IBSA 3ZJUA 4MVJP 2XQGA 3A1VA 1BKYA 1X14A 3ZDDA 4L9RA 2JD1A 4YPFA 3KB8A 5JZOA 3T4UA 4ON9A 1K6MA 1G5PA 3FAZA 4KMSA 1E3WA 3QENA 4DV0B 3BL8A 3OBIA 3EB9A 1FYEA 4GWLA 4X85A 5EERA 5LMZA 4KMOA 3CWZA 1R9JA 2ZIWB 5DNUA 4ACAA 4GZ5A 1ULSA 2A3NA 1T6YA 2CKMA 1KDPA 1PT5A 1SIWA 1PG0A 1HE2A 1IRIA 2YZNA 3IA7A 3GAAA 5E4YA 5ITWA 3ORYA 4P3OA 1QC5A 3KJEA 5KHOC 2IH4A 1DX6A 1PJ8A 1XB2A 4P4LA 3V1YA 3I58A 2XBMA 2HT6A 1RMQA 4F5YA 1S3FA 2QRUA 5T3YA 3WS7A 2H63A 4B3IA 2PUDA 2CYBA 1Z3CA 2Z1NA 3ZXUB 2AG6A 1OI7A 4DR6B 4KC0A 1ZVJA 3ZGOA 5HZMA 2Q4RA 3G2NA 2OK8A 1XAHA 4O0LA 5FO0A 3BKXA 4MMZB 4WCDA 2RG1A 2WJIA 3K0AB 1TU3A 1CF4A 1DBVO 2C5HA 4WXHA 2EF1A 4W7HA 4C78A 5K0CA 2C2XA 4DCUA 5KQMA 2Q4DA 4L9WA 2GRUA 4HZUA 1DJOA 1NQVA 5SY9A 3VC1A 3UGJA 3J81A 3FOZA 3FWPA 3P97A 5K6AC 3VKHA 5LWQA 3TW8B 2ZZKA 4JQSA 2FFJA 2LWIA 1XZ8A 4QLOA 2QVCA 4KH0A 2RAUA 3D0KA 2IS6A 4JGIA 2YS7A 4WUTA 1XCLA 2OO5C 4DCPA 4LXUA 3Q0TA 3PHJA 2YN0A 2L2QA 3KTOA 4BAGA 4H7PA 2OV6A 3R9KA 8GPBA 2QV7A 3AW9A 2II6A 4ENPA 3E1KA 1YS2X 3PX2A 5IM4F 5FADA 4PAGA 1JIKA 3HYNA 3F98A 2FDRA 4K9LA 5CFZA 1QTQA 2X86A 4N12A 1Z07A 3ZV4A 1YBAA 1QIMA 1P73A 1TF2A 4RZQA 3OG9A 2NM0A 5EJ2A 4BY9E 1L5OA 5JRJA 2JARA 1XRMA 4EENA 1Y48E 3BDAA 1Q95A 3ZJVA 3ZLBA 3OU2A 4JIMA 1R4MB 2R7LA 2PVPA 5HBGA 1ZJJA 3SG0A 4H3HB 3JQAA 1WUJS 3T06B 4R84A 2H8KA 2ZYDA 3TTUA 4QTYA 2ZRJA 2C1XA 3SOZA 4LK3A 2WZCA 4I5GA 1MLDA 5TQ0A 4O4HB 5DRYA 3PITA 2VWGA 5LBTA 4L4UA 4OI1A 1GNQA 1OIVA 1W0KD 2QJTA 3DZ8A 2ATCA 5F2EA 2QRQA 2XT9A 2I91A 1PJQA 4PFKA 4Q4AB 5ALLA 4JGBA 3PNMA 3AB3A 3F3SA 3OIDA 2FN3A 1TA4A 3HP4A 1XZQA 2EGUA 2OMEA 4F2HA 5IVPA 4YRQA 3G0BA 2YYAA 2RC5A 5EQTA 5CM9C 3IUEA 4JDUA 4R8KA 2B4KA 3SJ7A 1JLLB 4TRNA 2IW3A 1FP1D 1LJLA 2ISCA 3DDUA 4TUYB 5LXTA 5JPCA 1N2CE 1SCNE 2F55A 4ENVA 2VDWA 4AP6A 1GFWA 4Z7NB 4MVJI 5FUMA 1M7BA 3K0KA 4RULA 3FDIA 4FMDB 3QP9A 1NG9A 3E9EA 4TZKA 1EZ4A 3IHTA 4PHFA 3TMKA 3TDNA 3N2YA 3CVVA 2IJGX 3CGWA 1MIHA 4FYIA 1RQNA 3RW9A 3JAKB 1P7CA 3GA7A 1GPNA 1Q0HA 3H99A 5J2UF 1P7YA 2H7YA 3JRXA 3W6NA 1BROA 3WBKA 4RWEA 3BTOA 5HP4A 3I2YX 1A72A 3KFXA 3OZXA 3AUUA 5LYJB 4BLPA 1P2VA 4DCMA 4YDHB 4JL8A 4OVKA 1E9BA 3FVRA 5DYIA 4OK6A 1E9EA 3N1UA 5IHPA 1FA9A 2FN7A 1JDTA 5ALHA 5C1BA 4G0ZA 3GUUA 1KY4A 2BFMA 3WGKA 1J97A 4YRZA 4G5XA 4QECA 4WCFA 1EB9A 3Q3CA 3QEKA 4EF5A 1BNCA 3ZOZA 3HJBA 2SHKA 1CU1A 3UJ8A 4A1FA 3L7BA 1CYDA 4FT2A 1E4YA 4IXNA 3ZCUA 2AFIB 4KN8A 4C0AC 2JL1A 4RNDB 4ZVPA 4BGIA 1GT91 1HT1E 1U5CA 5COBA 3TRDA 5IXSA 2CGEA 4Q7MB 3WJ7A 1XU4A 2VDRB 3ACCA 4DQ0A 4DJDC 3A0UA 2A9KA 3LL7A 2C9YA 1PGNA 1I4WA 3G7SA 3L8HA 3QLUA 3PJFA 5BUZA 2BF4A 1HG1A 1QHXA 3AONB 2ZDHA 3LVBA 4X7PA 4A7PA 1TEZA 1YFKA 4C2UA 4M9QA 2J3JA 4RTLA 3IUMA 2YRWA 4G0PA 2GWHA 2OE2A 1LLUA 2CUTA 1QVVA 2G82A 3HZRA 4N7MA 3DXYA 4HNHA 1BKSB 4R2MA 3GLVA 4I4TA 4Z6KA 1WPGA 1H2WA 2GI4A 2HA0A 2HXSA 4FFDA 4PAMA 4GP6A 4Q9HA 2QG6A 2GPSA 4EHKA 3PFBA 2REXB 5KTYA 3IJPA 4HBZA 5B1SA 4KO3S 5FA8A 4F06A 1DRVA 4TZ6A 2QLNA 3MMXA 3NAGA 5E7QA 2Y05A 1NZDA 2XE6A 3I45A 5KWJA 1D4OA 1E7SA 2HJSA 3CH7A 3QBVA 2R85A 3IR7A 4J0EA 4LKRA 4RM2A 1TEXA 3BSSA 3KEQA 1TKCA 3V2UA 1XMSA 4I55A 4KXXA 1ZISA 1SBHA 2H7CA 2W7TA 4Y3UA 1PQYA 1KK1A 4HVLA 3K2IA 5FPKA 4R2WA 2LXNA 3BMOB 3KKNA 1HDZA 5IP5A 1SG9A 3NW9A 5J59A 2RI6A 4D3XA 3R0JA 4A0HA 3HXQA 3A0RB 4RGQA 3CF4G 2D59A 2Y68A 2MSNA 2OV3A 4JL6A 2ORED 4B3JA 5FORA 3G2JA 5I7EA 1RMTA 1H3EA 1IE3A 5IN4A 2Q6IA 1GUBA 1IBCA 1ZG3A 1WXFA 1KKUA 1VPLA 3DMRA 4J94A 4ZT2A 3UY4A 3O1JC 1NKVA 1J07A 2L19A 5ALSA 2C0CA 3MRXA 5CT5A 3PDWA 3TVTA 4I5DA 1STOA 2FWJA 7MDHA 2IELA 1M2JA 4IPTA 3RUHA 1NF9A 2R8OA 1JMVA 2MHCA 4KQEA 4MLZA 1C41A 3F2IA 2O2HA 2YINC 3DEFA 2DPMA 4J43A 2Q2OA 4BUZA 2IYEA 4LCEA 4FGSA 2XDQA 4G5YA 1IIBA 3IEPA 4KE7A 4M8SA 5FTKA 1FTWA 2WJZB 1SD1A 3K8OE 3LK7A 1RHQA 4MAFA 4OAQA 4BLWA 2FPKA 2HR1A 5AW6A 1E0SA 5A5DA 2Q3EA 4XM0A 4IUBS 5DN6A 1D5WA 1V47A 4BO5A 2Q1YA 3TSZA 1QVRA 3T9FA 3KS9A 4H3KB 1NE7A 3L9WA 1RWWA 3INNA 2E6KA 3PHBE 2FR1A 1WWKA 3FR7A 5JISA 3K6SB 1MO4A 1J7KA 1JYFA 4YO7A 3K2EA 1M1NB 3B20A 3VR6H 4IFEA 1L5VA 3C3AA 1IG0A 3K9WA 2QG9A 5I9SA 2VCEA 2OZLB 5B6IA 2IEAA 3TMYA 2O2YA 2X9GA 2ZIZA 1E92A 2OLJA 5ABPA 1QIFA 1DIGA 5TJ9A 3UAYA 1NJSA 3C5HA 3GRCA 3I3SR 1TF7A 3M33A 1HDOA 1N4DA 1M34B 2CWWA 1L7RA 1T9CA 4R51A 4ZYWA 4URZR 1RRCA 3H5IA 2P6RA 5JAPA 1PK7A 4JT4A 1QCZA 2AWNA 4DCJA 2F9FA 1IC6A 3EA4A 1B0PA 2QDXA 2X2EA 5D5HA 1Z28A 3IEIA 1DXQA 1JRLA 1W96A 1LSOA 3BE4A 3OZSA 1ZC4A 2HO5A 2QRLA 3ANSA 3LNCA 1E1LA 5CLQA 5CPFA 3F0TA 2PRKA 1NOKA 2GEJA 3H5NA 1CNMA 4KLCA 1ADFA 4E21A 3QXGA 1NMXA 1OWNA 1WMFA 2XE4A 1TD9A 4BVBA 1EVYA 2ZAGA 1NUUA 2ACVA 1RRFA 5TPWA 4CMIA 3K71B 3ZZTA 1XFAA 4XX1A 4IIJA 1E2NA 1GKKA 4JBGA 1DJPA 4MGYR 3TO5A 1QE5A 3CC8A 4HEA1 1GL3A 4CTJA 1JG4A 2WJPA 3WSWA 3ZR4B 1ADCA 3EYAA 4ZU6X 2HHCA 2IZOA 2Q6TA 4QPNA 1L3BA 1H1LB 2CW5A 2XWBF 2IEIA 2V7PA 1LBTA 4FFVA 1QLWA 3V7WA 1LDNA 4HDMA 4GX0A 8OHMA 2DBYA 2P67A 1NY6A 3FCOA 1BS2A 1GGKA 5B37A 4C1BA 3LPAA 3KD2A 2J3KA 2BFDA 3DBHB 4LEIA 1VSVA 4Z1OA 2H2HA 4ZT6A 4ZI7F 4CQMD 2PMBA 2BT4A 3OTGA 2X15A 3PU6A 2VDMB 1XTVA 2PH7A 3KKQA 2I99A 1UBFA 2NO0A 2UUAB 2WPDD 1GTSA 1DEKA 2JIDA 3IV7A 1ZX1A 4KV7A 4EAAA 1JXAA 2C9ZA 3ND9A 2Q0SA 1M72A 1U7WA 1GPKA 2WHYA 2W2MA 4QASA 3C3PA 2IS1A 1J25A 5CFRA 2NZ8A 2D5AA 4FE7A 2WILA 4Y2VA 3LECA 4GX2A 5LQUA 3IO3A 4R5MA 1A9OA 4A0RA 1JJFA 5DI9A 1JHQA 4E51A 2E4AA 3R74A 3SQWA 2ZE5A 2CXOA 2ES4A 3DDWA 4GUDA 2ZSFA 4MRVA 1PF7E 4EGJA 2R1VB 1ZGHA 3ZE7A 1P19A 3GRRA 3GFFA 4RZHA 1P74A 1ZLYA 4HJRA 4PYMA 3ORFA 3AVPA 3UHJA 5FA5A 1M2VB 4IEIA 1ZXBA 3UJDA 4LF9B 1R8JA 4B73A 1COZA 4IEFB 3KELA 3QX7A 4MR7A 2A14A 3P9KA 4B87A 4KKVA 4D0LB 3TTTA 4UAJA 2CSUA 1CJBA 1Y7TA 3U7QA 4YUZA 5K99A 1I4EB 1PL8A 2RHWA 2IUFA 1DIBA 2BKEA 1Y5IA 4HLQB 3TL2A 3EMVA 3ZHOA 4C4RA 1ZU5A 3A1WA 4E5MA 3QEJA 1OWOA 3GJ7A 3WISA 3BA6A 4Y2TA 2CK3D 3H2SA 1FFXA 4B2PA 1WF3A 1T1IA 4C04A 2JFYA 4K88A 1UQUA 2VA8A 3KT0A 3N7TA 4POAA 1W19A 1PZFA 4PRLA 5DHRA 4QA9A 2NAFA 1BDBA 3RU3A 3HGMA 3ENQA 3CLSD 1HMYA 5A03A 5ILGA 4TM8A 1MT0A 1CS0B 1TQ4A 2ZSHA 4M0UA 3T3EA 2TMKA 4CL3A 4D8WA 3AKZA 3FPEA 2OV8A 3V4SA 4EELA 1KOFA 4Z4GA 2CVFA 1QFSA 1ZN9A 3MILA 4AYXA 3CVUA 1WTCA 2MJLA 1QZZA 1TCAA 4IJ6A 3OX3A 1MABB 4G84A 1PGPA 2A88A 3AGQA 3CWCA 2P9FA 4H18A 1EAMA 5K0TA 1JYSA 4RKYA 5EHZA 4GKKB 2CEKA 3JVUA 3CZ4A 1BEUB 3GJ3A 3QE4A 1FUEA 4MDEA 1UAYA 2FR8A 2YZMA 1EP9A 3KL2A 1UZLA 2O2IA 3JVIA 4Q7EA 3AEYA 1F6WA 3THXA 5C2JB 1HV8A 4O0MA 4PPGA 1UMKA 2AMFA 4TMVA 4Z4FA 1C1XA 3RUFA 4F71A 5LPNA 4N01A 1ML3A 1P1RA 5M2QA 1V6SA 3GT7A 4JJZA 2HMAA 4LE0A 5D3ZA 1P31A 1KRXA 2KE5A 1J9ZA 5C1DA 3T99A 2WNHA 1YONA 3AVTA 1GR0A 2NXJA 3VU8A 1LB1B 4KFSA 5AH0A 4XJXA 4D3ZA 1DRKA 1TUBB 1LKZA 2ORYA 3C14C 4Z0HO 1APBA 1N77A 4B84A 3UT6A 1MAVA 3SIWA 2UXCB 5DBEX 1BG6A 3PX3A 3FDJA 5AM1A 2VKQA 2IIBA 1K75A 1RYDA 2JF0A 2QUZA 2Q2WA 4PR0A 3FWYA 4BCCA 3F46A 2VHEA 3I04M 3L5KA 2EZ8A 2BDEA 4WUVA 4FVTA 2Z8XA 4TRJA 3L4SO 5BR7A 2F62A 4GL2A 5L7TA 5F76A 1MIOB 1TYAE 4Q12A 5EY5B 3QJYA 3BTSA 3ITDA 3OWXA 4WOKA 1F6DA 3ADCA 5LXTF 2H52A 2BTQB 4FZVA 4OQLA 4LN1A 1QBKC 1YU6A 3PQ4A 1L7DA 4ZTBA 5C7IO 4DBZA 1QONA 2FSFA 1UXIA 3I2HA 3I04A 3G3EA 3LA6A 3O8RA 3M1LA 3DKRA 3FVQA 1Z63A 3C3XA 1IY8A 1SHJA 4HD8A 1ZICA 3LOQA 2XA1A 4N6OA 2BF7A 2JCBA 3ONFA 5CNKA 3RIGA 2XKJE 5BW4A 1FMJA 1X8XA 3IEUA 3L01A 5K0NA 2D4HA 3KCQA 3UWKA 3OEEA 3LUBA 3MT9A 4GOKA 2B8JA 4MVJF 5H3HA 4DEVA 1RPJA 5JVDA 1FDVA 2WOJA 2C57A 1T36A 1PUIA 1YZ3A 5LP6A 4X7BA 4RVCA 3IAUA 5AOVA 3LU1A 1OLXB 3Q0IA 4NDZA 2JFPA 2ZM6B 4DABA 4FYVA 2ABWA 4PLWA 4KG7A 3DDZX 4AB1A 3ZWXA 1O89A 1U0GA 2P1ZA 5H5JA 5A7HA 1K92A 4FNGA 1F60A 4C0BA 1SG0A 1XQ9A 4X44A 3JVDA 5KKCA 1ZRMA 2FMKA 2QMZA 2GZHA 3U3MA 1CDOA 2RGXA 3U19A 4FMPA 1X7YA 4NECA 3ZXIA 4CKXA 5LWHA 1D6NA 3VZRA 1ZSVA 2C9CA 1Y8AA 4OSOA 1ZSYA 2HYIC 2PX4A 1UC4B 3M9WA 4O08A 2B2XA 3GFSA 4GRAA 2OCDA 4OU4A 3IR6A 3NHZA 3O4HA 4P82A 2WMNB 4LNUB 5HIIA 3SLRA 2APJA 3ZQJA 1UT8A 1OZHA 2PWAA 2YMLA 3IT2A 3U4CA 1AV7A 1DXHA 3RVQA 1SKUA 1KYIA 3CW9A 1DRWA 1AS0A 3FZYA 3OZFA 5SYAA 3VI4B 2VYCA 4AY3A 4BCDA 2BYTA 2DHDA 3EIOA 4MYSA 3OMWA 1Q0SA 2EL9A 2O8FA 3AOEA 1QGOA 1CXZA 1XZPA 5JJKA 5B3AA 1BS9A 3AOGA 3KR0A 1IXZA 1P0IA 3A6ZA 1ZD8A 3GCZA 4RW0A 4A0GA 3DC2A 1FX1A 2WB2A 1GWNA 1ZITA 4KITB 4I55F 2GCNA 1YGYA 5ALNA 3JQAD 4B75A 1DRJA 4DQUA 1M0WA 5CX1B 5CEEA 1Z15A 1KVTA 3K0EA 3CX4A 1KZ1A 3LX8A 1KSJA 1RVV1 1Z6XA 4M8LA 1XE3A 1EVZA 4MLPA 4C76A 2QY6A 2PG3A 3PG5A 5C9ZA 3OQIA 3K31A 5J58A 1P6UA 2Q7DA 4N47A 1SBQA 3Q7PA 4U7JA 1EHIA 2KHZA 3K70D 1IY0A 2RI0A 4YWJA 4LMPA 1JP7A 1UKCA 1NPTO 3JU3A 3ZBTA 2CNLA 1Z7WA 3ADDA 2QBYA 2BR4A 2ORWA 3VGJA 1NLYA 2GS9A 1CZLA 2REBA 1U28A 4PCLA 1EPUA 1OI4A 5JHGB 4TV8A 2H7XA 3DOIA 5F5XA 1FJHA 1YVDA 5PGMA 3U4QA 4ZAXA 4MUJA 4CLOA 2FEMA 1I4DD 3ZWPA 2C5GA 3C1UA 3O1HB 5DXJA 1M1YA 2ATIA 1OXTA 5IT9A 2BEKA 1X0VA 2P3LA 2WKSA 4AG6A 3GW8A 2PA0A 2LBPA 3L46A 1I5RA 4I66A 3UQYS 4DC1A 3IE1A 2BR5A 1W7AA 2TSYB 2XI4A 3OQMA 2DUWA 3VPFA 1VP9A 1JR3E 1DSSG 3EEQA 1JG1A 1TU0A 4N3CA 2ISQA 3MXTA 4O1IA 5HFAA 1UH5A 5H59A 2C78A 1O6ZA 3DS8A 4D79A 2G5TA 3B78A 5BN5A 4UHEA 2E49A 2ZAYA 3AFGA 3QTBA 4GWGA 1D9ZA 3ZLTA 1HZJA 4LZNA 5BV2P 5F7OA 4D26A 4I3GA 1GLVA 1YMVA 4NOMA 1JN0A 1JJ7A 3OM9A 2PFSA 5CT6A 3BH7A 3CRMA 1YXMA 1SWWA 3EMKA 3ZJ4A 4GRIA 4LQ4A 5BWBA 1SOUA 3DHVA 2BHNA 3MCUA 3SR4A 1O97D 4Z51A 1TW3A 3IAM1 4ZVLA 3R41A 3B3JA 3HPRA 3V1TC 4DNPA 3N2KB 5CAEB 4Q01A 2HCFA 4HN9A 3DYVA 2ZITA 4EKEA 5KDOA 3WB2A 3DHEA 4YI5A 4P86A 4EUSA 3ZDQA 4KWHA 1SOWA 4BX3A 4IVPA 4C5AA 5DT9A 2C4TA 4MO2A 2YNMC 3CXUA 1LLQA 4JBLA 5JG7A 4LOLA 1YI8A 5B57C 1C2YA 2CFIA 1D6JA 1DBPA 1R6BX 2BFWA 2QN9A 3QYFA 4FOSA 2PS9A 5EUBA 3K72B 5IX8A 2ZUWA 5ALIA 5JHHB 1SB9A 2WAXA 1SC6A 1EQUA 1YULA 4P38A 4QUHA 3T15A 1FFAA 2FV8A 1FMTA 2Q99A 3LP6A 4N4AA 5AVKA 2LW7A 3NCHA 3U3XA 4CM5A 4YPVA 3KZVA 4LYGA 3QWBA 1OXVA 1M6YA 2VRNA 1B8VA 2BGLA 1SC9A 4EKIA 5AI9A 5CNIA 3L0OA 4G5OA 3EA5A 2J46A 1A0OA 4CJXA 1BC5A 4HN4B 1YL5A 3DUFA 5A4JA 1G1MA 5CX4A 3GHYA 4ZAYA 1WVMA 2GBLC 2ONKA 4CUZA 1C7ZA 2HSGA 3MGAA 2HBRA 3SMQA 2ECPA 3IAAA 3L7IA 5C32A 1O6FA 3OLZA 4Q7LA 4WLNA 2ZPTX 3ICQB 3RUIA 3VX4A 3L1KA 2ADOA 4NXMB 3VZPA 3AIOA 4HDSA 3ETDA 1GRNA 1UXGA 3I9JA 1CDEA 3U4IA 5E1OA 3AU9A 5FWYB 3BH0A 3B6EA 5CT4A 5IZ4A 1NW8A 4MTLA 1PS9A 2XTAA 5TNXA 5B3JA 5E9WA 2B4AA 3TQOA 1RWNA 3HCDA 1NTRA 1RVDA 1CDZA 5TQ2A 4DG9A 2AOUB 1WQ4A 1CJTC 3PL5A 4HMOA 5I9BA 3RD5A 2O7QA 1DUIA 3TG2A 1XYVA 5L3SA 3E23A 3L82B 1QIKA 2UZ0A 5JAMA 2EG9A 1ZK2A 2SBTA 3KQOA 5G4KB 1XZFA 4RA9A 4QDKA 4D9KA 1YZKA 1E2DA 2Z9DA 4GI7A 3UFXA 3OSZA 4EYOA 3OQ1A 2E89A 4BUCA 4Q1FA 1FNCA 5LIPA 1R5BA 1GIAA 2QAGA 3C7AA 4MP8A 2FLWA 3W78A 2C4UA 2EBFX 3ANNA 3T95A 2YIVX 3PGJA 1S01A 1VCIA 4M1OA 4EF4A 3BSYA 4E70A 5LBIA 4AN1A 4OBXA 1IUPA 1ESZA 4KPUB 1C3EA 4QJ3A 4R8LA 5IUKC 4G01B 2VUSA 3WLNA 3DNFA 1HRKA 3PFNA 4F3CA 4PYJA 5JJBA 2QE7A 3RK0A 1WABA 2JANA 2VPYA 1YUBA 1NMSA 2JEOA 2L82A 3BZWA 3QKTA 5ECDA 1U0OC 4V39A 3ABQB 3UMCA 4LFCB 2I3GA 2QU7A 2HA6A 2A9JA 3GIDA 4KFTA 3FFWA 3NIGB 2WG0A 1FS6A 2EKBA 1K98A 1RCUA 1XNJA 4FR0A 1R3UA 2QTBA 3V7NA 4PSUA 2WWRA 1NRIA 1QANA 2ZIFA 4NYIQ 2OBLA 3P9IA 5TXGA 3RVJA 4JH0A 3SI7A 3TKLA 1XRPA 3OY7A 2JH8A 3PWZA 1RLUA 3FSEA 3QKWA 3R40A 5D6OA 5L3QA 5EZ6B 1VZ3A 1GVHA 3AEXA 4MXDA 4LOKA 4AWAA 1AMUA 1G3IA 3DDCA 3JASB 5LQMA 1Z0UA 2AS0A 1WKCA 4QDUA 2BHRA 3LOPA 2C8LA 2GA9A 2Q5CA 3ELYA 4CCYB 3PE4A 3QPCA 3ROQA 4MP3A 4IF6A 3O1IC 4YV2A 1DTWB 1KHHA 3MWEB 3TRJA 2I0FA 3M4JA 4CTNA 4XUGB 3KT3A 3FOEC 4UCWA 1A7KA 2JFFA 2WR8A 4OSPA 5CUQA 4DJAA 1GTMA 4ND5A 2ODTX 4IM7A 4US2R 5KYXB 1XWWA 3NHUA 4P3YA 3GZTB 2FSHA 3G68A 2QIPA 1CD5A 3FOFC 4H1WA 4KQHA 1EXMA 1JA0A 1YWGO 2P6OA 3NXSA 5E6SA 3V33A 4LISA 4F4DA 4AYWA 4R6WA 3RF6A 1TEVA 1W0JA 3A1TA 2ZKIA 3ONWA 1ACLA 1WAMA 2XB2A 2FW6A 2OCKA 3X2SA 3S1LA 1PFUA 2H1CA 3RS5A 5JAQA 5BT8A 1E5VA 4BX0A 2K4MA 4DS3A 1G5QA 4M87A 4ID9A 1CB0A 3EF0A 2VBIA 5AM2A 2GK4A 3EVEA 2QPLA 3IQWA 3ZE6A 4GR4A 3FRIA 2LGJA 5GMOA 5ILOA 4HTFB 3D6MA 3KD3A 5TT1A 3USCS 4R0NA 3C3WA 5AK5A 5JJ5A 3B2QA 3D0QA 3A4LA 2XTZA 4UDYX 5G0TA 4AWXA 4RKQA 2XIJA 1BCRB 1HNNA 2W83A 4DLLA 1T9ZA 3K1YA 3D3WA 4MW2A 4GNKA 4V0NA 5FOWA 3GJYA 3KLNA 4JL5A 4KOAA 3W5DA 4R1SA 4OAPA 4TVKA 2DQZA 4IJMA 4GPD1 2FZEA 3VBEA 5I7HA 5JNSA 2PWBA 3CZQA 3IULA 1C3XA 3A58B 4HFMA 4RYDA 1GL9B 3EIHA 3Q40A 4BQPA 3IKTA 2FSGA 2R7KA 2ZU6A 5IJAA 2EZ4A 4WV3A 5IZCA 2PNFA 4YJDA 3Q8KA 3O47A 4G1CA 4JC4A 3SBDA 3ODGA 2BGNA 3PHCA 2CL6X 2BISA 3C8UA 1GPWB 3N0TA 4M0EA 3PPWA 1ZD9A 2P6NA 3SDSA 1I6MA 3T34A 5IVKA 2W4QA 2XCRB 3MJTA 5J4VA 3M6LA 3NVDA 2VHTA 4WN9A 4OHVA 1LNQA 2X76A 1V5GA 4EHHA 2QSYA 5A0FA 3D7MA 4MZDA 4NJMB 5C8YA 5FUVA 1AXEA 3R7DA 4D6PA 5LP6F 5ED4A 4NCJA 2BTOA 1MXHA 1WCIB 1ZRNA 4MPTA 1NNEA 5HYVA 3TG8A 2VP2A 1PJTA 1TAGA 1N5DA 3AEQB 3EVBA 5I7WA 4NU5A 2RC6A 2ATXA 3A06A 3GUHA 4KWIA 1JWAB 1KKLA 2XJ9A 2D2VA 3GMSA 2PRZA 3MWDA 4ZVRA 5THQA 3VUFA 4F2PA 2EERA 4HP8A 4P80A 2G70A 5A3VA 4B4DA 4C22A 3MLEA 2VDQB 3VU9A 2GRAA 1AGPA 2CJWB 4ARUA 4MWDA 3GK3A 4C1NA 1UP6A 2ZWMA 3G0DA 2P6UA 1X7XB 3EXFB 4XWWA 3D6HA 5ERXA 5EWLA 1IAVA 3D5EA 1ACJA 1CY0A 2WAAA 3I0NA 2XRFA 3Q7EA 4Y98A 2I9KA 4D98A 1V5EA 2OESA 3EGXB 1ZLXA 4LV5B 1GU7A 3ANLA 4IZ6A 4XPIA 5DGXA 1A3CA 4O59O 2W42A 4ZREA 4COOA 4CYMA 4BXOA 2PN1A 4NH0A 4TMXA 2OGSA 1A7UA 3ZDRA 3E70C 4C5CA 3WWDA 4Q4HB 3ROEA 4S1NA 5FUWA 2EJBA 5EXXA 3H2JA 3WC4A 4CUJA 1G60A 2GPYA 3PLRA 1OX4B 4LTMA 4L4XA 5CHYA 1DFHA 2R1UA 2PSSA 1F0YA 3GBPA 4KE8A 1PR6A 5LDHA 3DPIA 1WW2A 4W9MC 2CFTA 1LI5A 5DM0A 1ENPA 1ULTA 3MLAA 5AUPB 2XODA 2ZBRA 3FGOA 4OLAA 3DE2X 1SZCA 1G59A 3C15C 4KOEC 2FX3A 2QROA 3H8WA 2PLNA 4V2UA 3TAHA 4QOSA 3TJZA 3LUFA 1KNQA 4IRMA 2R8BA 3WYCA 5IDXA 2BGJA 4D0GA 3U7HB 3BDVA 5HILA 1ESMA 1U2GC 4RVUA 4EFKA 3KJZA 5FP0A 5I9LA 2C42A 4MDYA 3T35A 2JAPA 2V8OA 4NV0A 4DANA 1BD3A 4NYJR 1OIWA 5ISMA 5A04A 1ODFA 4Z5XA 2X8BA 5IDYA 2XGJA 1K0FA 1G291 1JLKA