4QPJC

2.7 angstrom structure of a phosphotransferase in complex with a receiver domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
120
structure length
120
Chain Sequence
GSMRVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGIDLGKLYDYDIILLDLNLPDMSGYEVLRTLRLSKVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIHAIVRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural asymmetry in a conserved signaling system that regulates division, replication, and virulence of an intracellular pathogen.
pubmed doi rcsb
source organism Brucella abortus
molecule tags Signaling protein/dna binding protein
molecule keywords Phosphotransferase
total genus 41
structure length 120
sequence length 120
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qpjC00
3N53A 2FQYA 4KQ9A 2PAFA 4MS1A 3TD9A 7ABPA 1PEYA 4M88A 1C0EA 1J56A 4MRMA 3BILA 3H5WA 2FEWB 2AYXA 1Z15A 2IPNA 3W9SA 1QP0A 3K9CA 3RVMA 3IP9A 4IILA 4B09A 1BDHA 2A9OA 1D1QA 4OATA 2LPMA 5JS2A 4ML3A 3TMYA 2GWRA 2MSWA 4LE2A 4MR9B 4F12A 1EWTA 4RK4A 3CRNA 4G0YA 1Z2DA 4WWHA 4EYKA 4JB2A 3RVKA 4N76A 1BA2A 4EVQA 3EQZA 5C5EA 3CG0A 3HDGA 4W5RA 1NXPA 4D6XA 1ZVVA 3UK0A 4Q6BA 3H1FA 4HNSA 3H1EA 1MB3A 5JNRA 4EY3A 2LIVA 5JS1A 2A9QA 2WRZA 4G0ZA 5TQ0B 1NY5A 1DJMA 2ID7A 1W25A 2QXYA 3LUDA 4KV7A 3EODA 5B3JC 3FFTA 3QELB 3BRSA 1VLZA 5JNUA 5ABPA 3L49A 1SXHA 4QYMA 3HEBA 1QPZA 1YMVA 3G1WA 4JA2A 4TLMB 1JX6A 3E3MA 1EWVA 5E3JA 1URPA 3VNAA 4YV7A 3HUTA 3KJXA 1SXIA 3KS9A 3RH0A 4YR7A 5DGCA 2F8SA 3FDFA 3NHMA 2NT3A 1FFSA 3L6UA 3LUAA 3OMXA 3O74A 4MLDA 3RQIA 4GNRA 1JL3A 1BDJA 2B1JA 1OXKB 3NHZA 3O2JA 1FFGA 2WWVD 3IPAA 4S05A 2BGGA 4RSMA 3KCNA 4MQFB 1L5YA 1ABFA 4Q7EA 4RU1A 2FMIA 3CNBA 5B3JA 1A0OA 4EYGA 4W5NA 4NQRA 2B4AA 4G0OA 1DCKA 2QW1A 4JP1A 3TO5A 4G97A 4G86A 5IC5A 3A3KA 3R0JA 3HO1A 1LBIA 3SNKA 2HQBA 1DG9A 1ABEA 5KI6A 1ISRA 1VKRA 2FEKA 2NZVG 3QLVA 3OM1A 2FEPA 3N0WA 3O75A 3T8YA 4ZMSA 3CLKA 3NNDA 5TQ2B 1JFVA 2ZWMA 3D8UA 3H6GA 2QR3A 2QZJA 3KLOA 1S8NA 3CHYA 3GL9A 4F3TA 2JBAA 3OQNA 3KKEA 2FKAA 3G85A 1DCMA 3OMWA 3Q7SA 1Z17A 1NXTA 2ZAYA 3FFWA 3HJFA 3GA5A 4IF4A 2WB4A 3F6PA 1USGA 3JY6A 3Q41A 1ZITA 5FWYA 5EWMB 1FSPA 2A9RA 5KWSA 2J48A 4N47A 2AYZA 1D1PA 2FN9A 4G0MA 2FW0A 1GCAA 4FE7A 5CNIA 3OLXA 2PE5A 1M2FA 4PICA 1K66A 4S04A 2WMYA 5IUNC 1ZDMA 3LUHA 5T7BA 1B00A 5IULC 2FMHA 2QU7A 2RGYA 2R25B 3KG2A 4YLEA 3OLYA 9ABPA 4ZJPA 4F06A 1QQAA 3GWGA 5BQ3A 1MAVA 1RXEA 1JYFA 4N0PA 1YK0A 3MF4A 3N6VA 3LTEA 2JVKA 3SQNA 3QLUC 2LUOA 1ZH4A 4IMIB 2E4ZA 3Q15C 4RV5A 1PHRA 4RK5A 1YTUA 1TM2A 1LBHA 2P9HA 3I42A 2L17A 1TVMA 2IKSA 1CYEA 3A0UA 1XHEA 3C3MA 3DLBA 1IIBA 3UKJA 3T95A 1DC8A 2PL9A 1EFAA 3N0RA 3GBVA 3O21A 3IDOA 2MSKA 2PUDA 2FLKA 3QEKA 5IEJA 4NICA 4IRXA 3EGCA 1ZY2A 4W5TA 3LMKA 3EULA 5IUKC 5KQPA 1YS7A 4MS3A 2IPAB 2R47A 5IUJC 3FGZA 1U0SY 4H3HB 4Z4GA 3HDVA 5FWXA 1LJLA 3A0RB 3OM0A 3OO1A 4XAQA 3MM4A 3ROTA 5ED4A 3KYJB 3GRCA 2RJNA 5JNVA 3QX8A 4ZMRA 2GI4A 2GKGA 3M9WA 1AB5A 2CHFA 1JWLA 1ZAYA 4KREA 5CHYA 2TMYA 1JFTA 1YK1A 1ZH2A 3OQMA 3KYIB 1DP4A 3JS5A 3RVRA 1NATA 2CHEA 1PNTA 2E4YA 1I3CA 3ILYA 4WXEA 3LUKA 4G0PA 1NXXA 4KQCA 5FBKA 1CEYA 2JB9A 5BRAA 2PUBA 2PMCA 1JF8A 4RY8A 3H75A 2OQRA 1LK0A 2VYCA 2XDYA 4N41A 5BR1A 1VPWA 1QQBA 4TLLB 3P9YA 1EHCA 3IP5A 3HCWA 2I6FA 1XHFA 1FQWA 3DBIA 3CTPA 4QYWA 3QX9A 2L2QA 1XWWA 3RVLA 2L18A 1MVOA 4IGAA 1P6UA 5BRJA 3HXMA 4XASA 4MR7B 1P2FA 2Q5CA 4OTZA 4E7PA 2LP4Y 3RVQA 4JOQA 3QK7A 1RZRD 2WJAA 5CNKA 3O1HB 1E6LA 3HS3A 1QMPA 2QVGA 2NZUG 4KRFA 5HSGA 3CFYA 3JPWA 3BREA 5KQGA 2FQWA 4RKQA 3EQ2A 4Q6WA 2QVCA 1Y1LA 5PNTA 4EGSA 1USIA 4WXMA 1QO0D 3BRQA 1L5ZA 4LX8A 4RK6A 8ABPA 1RNLA 2JCGA 3NNNA 4YWHA 1H9CA 1Z2EA 3N8IA 4RK0A 4G0XA 3NBMA 1Z25A 3DGEC 4MPTA 5IX8A 1F4VA 3CS3A 4P98A 3VNBA 4ETIA 3N0XA 4HNRA 4MQFA 3O2SB 1RZRA 1DRJA 4L4UA 3EAFA 3KLNA 1ISSA 4KK4A 4P1ZA 3KHTA 1DZ3A 4EVSA 1U2QA 1QP4A 4MGEA 1JDNA 3CU5A 1U8TA 4RXUA 2V0NA 4MS4B 2GBPA 4IMJB 4RZSA 4RXTA 2IPLA 3H5IA 3NNSA 1NXVA 3Q9SA 4O1IA 3DLHA 1D5WA 4DQDA 1DC7A 1YS6A 1ZESA 4RWEA 2W42A 4W5OA 3C97A 4ZPJA 2MYTA 5TQ2A 1WETA 4YP9A 3MMNA 3LFTA 4ZYLA 2E4VA 1KRXA 3K4HA 4MS1B 1JDPA 5D2CA 4E7OA 4Z4EA 4D6YA 3H1GA 3CZ5A 1JFSA 4MR7A 3MYYA 4LE1A 2LBPA 2FQXA 4Z4HA 3QEMA 2L19A 1ZN2A 2MYPA 2JK1A 2MSLA 3F6CA 4JB0A 1E6MA 5JNSA 1Z13A 3Q7TA 2GX6A 1KRWA 1E6KA 3CG4A 4DADA 2N9UA 1KMIY 3H5TA 4FB4A 1TJYA 3JVIA 1FFWA 2ID9A 2R48A 4O5AA 4WUTA 5T3YA 2OENG 2HPHA 3H6HA 1JHZA 1PUXA 5DKFA 3JTEA 4YCSA 4JASB 4RK1A 3RVOA 4NV3A 1K68A 1DCFA 4MR8B 4Z9AA 3RVJA 4HYEA 3SM9A 3SAJA 2FLWA 3MIZA 2PUFA 3HSYA 2IYNA 3HZHA 5EWJA 2FMFA 4QPJC 1Z16A 1SXGA 1P8AA 4G0QA 1C4WA 1EAYA 1JH9A 4MRMB 1F51E 3O1JC 3KSMA 1VRVA 2YHBA 4KNYA 4MAAA 4PYRA 4EVRA 4YGXB 5TPZA 2PUCA 6CHYA 2CWDA 3Q7RA 4MS3B 4D74A 4Z4IA 3EJWA 3F7NA 3GYBA 4RY9A 5KQMA 4KFCA 4LZLA 3RVPA 5JNTA 4RK7A 3I45A 3DGFC 5TQJA 4OLBA 4Z99A 4XFKA 2VUHB 4YRZA 2HJ9A 4LDZA 2QV0A 1PEAA 2KYRA 3JVDA 2JVJA 4CBVA 5DCLA 5KC9A 2PLNA 4HNQA 5I4CA 1A2OA 3CKMA 1NXSA 3HV2A 1PNRA 2PKXA 5GOTA 3MA0A 3QELA 4Z9BA 5FBHA 4NCAA 2H3HA 3O2QB 4PZ0A 1DBPA 3HM9A 1DRKA 4Z4CA 1D2AA 2PJUA 3OQOA 4LDAA 4GPAA 2WY2D 2JRLA 2PUAA 2DRIA 2H0AA 3I5AA 4KPYA 3RVSA 2IPMA 4KMRA 2RDMA 2YHAA 1JYEA 1NXOA 2FMKA 2MYNA 1RXIA 1CHNA 3UUGA 2A9PA 3QLTA 4KK3A 4RXMA 1YVUA 1YMUA 3LKVA 5EWJB 1ZGGA 4UHJA 3B2NA 4F8JA 3CZCA 1JBEA 2P4UA 4ETNA 3M9XA 5EWLA 2E4WA 2NT4A 2X7XA 3IP6A 1MB0A 4OLAA 4H3KB 1KGSA 1ZGZA 1E2BA 4XLTA 5CNMA 5HM6A 5EWMA 3FFXA 4WT7A 3SG0A 3KTOA 4Z4FA 3LOPA 1LJUA 4XARA 2FVYA 2JVIA 3BBLA 2FTKE 1AB6A 2MYUA 3H5LA 4MLCA 2FXIA 2R4QA 4RKRA 4DN6A 4F11A 4WZZA 3C6QA 1P6QA 3GBPA 3OLWA 4EYOA 1T34A 1A04A 5C5CA 1U04A 2F8TA 4JAVC 3TX6A 3HUUA 4LRQA 2JBAB 1OXBB 1M2EA 2FSPA 5CNJA 5TPWB 5KC8A 5HQJA 3RVNA 3SY8A 2IOYA 3OLZA 3QLVC 3I09A 1SRRA 4QICA 3M6MD 5FWYB 4H60A 3IP7A 3GT7A 4TN5A 4UHKA 3HVRA 1EWKA 1BAPA 5KQLA 4RY0A 3A10A 3GV0A 5TE9A 4EUKA 4W5QA 3T6KA 3F73A 2E4UA 1Z26A 3MQ4A 4MQEA 2PL1A 2VK2A 2M98A 4OG2A 4NCBA 1HEYA 6ABPA 2CD7A 4YO7A 1GCGA 1Z12A 4PEVA 3FMVA 2QSJA 1GUBA 4O1HA 3N75A 1YIOA 1BVHA 5IEBA 1JLKA 3O1IC 1M5TA 3LKBA 5DLEA 3JPYA 1GUDA 3OLVA 5GQSA 5EWLB 1MIHA 2PUEA 3C3KA 4KVFA 3TB6A 1QKKA 4YS6A 1R8JA 4Y9TA 4RDCA 1Z18A 5HKOA 1GLGA 3ROFA 1NTRA 4MR9A 4FE4A 1W9HA 5IBQA 1QNLA 5FWXB 1DBQA 4LE0A 4ETMA 4N0QA 3HK2A 1TLFA 5DTEA 3OO0A 4MR8A 3URMA 1SD5A 4XXHA 2RJOA 5TPZD 3S99A 5TQ0A 1UDRA 3DZDA 3QLUA 1TMYA 2E4XA 3LUGA 2O20A 2VUIB 4L85A 1QO0A 2PUGA 2IDMA 3ILHA 5TPWA 1DBWA 3D02A 4MYRA 1APBA 4RS3A 2NUBA 5F64A 3QEMB 1ZHHA 1U2PA 4PE5B 1BDIA 4N03A 3E61A 1D4ZA 4MS4A 1M5UA 1RPJA 2HQOA 4TMYA 2FN8A 3LUFA 1NXWA 2HQRA 5JNWA 3C3WA 3LUJA 1USKA 3EDCA 4KZKA 3H5OA 4MQEB 3T38A 1QP7A 3IPCA 3LUCA 2WJWA 4OBBA 2HSGA 3H5VA 4Z0NA 4EYQA 2M1ZA
chains in the Genus database with same CATH superfamily
1W49A 1R5NA 3PFBA 1GQOA 1NR5A 1ZN8A 4G9BA 4WHMA 5T4FA 2B21A 1BX3A 4YCNA 1V5WA 3OF3A 2VVTA 4NU5A 3QMMA 1MXFA 1XZ8A 2WNHA 1Y3DE 1LBEA 2BF4A 4JA0A 2YN0A 4HEJA 4M37A 3ZY2A 2FNAA 5C7YA 2LPMA 1RQ7A 2IEIA 1ZL2A 2PBFA 3M49A 4K6MA 4XZ3A 2PCJA 1TVEA 1ISGA 1G2OA 2BR5A 3NTRA 3FZQA 4IG9A 4KOAA 4AS2A 3PVSA 5EZ6B 1P1RA 2FWMX 2ACVA 2FG6C 4INPA 4E33A 3DMYA 3H2YA 1C9DB 3UW3A 5SYMA 3OIWA 2DC1A 4G0ZA 3CRMA 4EPRA 3PF9A 4O4JF 5LIPA 2C61A 1GHTA 1W25A 3G0BA 3EODA 3QELB 3K0FA 3HXLA 1ODSA 5C51B 3IBFA 4S1OA 5EUMA 1I7QB 1E2EA 1GTL1 5ABPA 4WY2A 1QYIA 4CLRA 1SXJA 4EKDA 2GCEA 4GP6A 1NBMA 1U3UA 3G1WA 3IHTA 3A4LA 2J59A 1A5AB 3H2GA 2JLXA 2UVPA 3NIBA 5F5LA 1ISMA 3JVVA 5BVGB 1URPA 1QGUB 4EB6B 4C0HA 3EF1A 3ED5A 1PJ2A 1R66A 1P4HA 5EPUA 1N8NA 2B34A 2RHGB 5ERYA 1IATA 2F67A 4GNRA 3E8MA 3WFZA 2QEQA 1ZYUA 2VFAA 3GLFA 5AKZA 1ZCZA 2PQ0A 2IZZA 2QYHA 4NCXA 2OCAA 2W4QA 1ZXBA 3EMVA 2QUZA 3QPWA 4IUBS 4EHLA 4EK9A 3B3AA 1FSFA 1K4KA 1L5NA 2E9SA 2VZ9A 4JXJA 1JIXA 1D8AA 1JQDA 4TMKA 3TSCA 5CVUA 1DIBA 4J0HA 3WKDA 3JALB 2DOKA 5IM5A 4JJFA 4F91B 5JTUA 3BS4A 5LZ7A 1H3FA 1O95C 1M6VB 2FZ5A 1I14A 4G86A 4BNYA 5JQGB 5TLSA 3FSRA 1JTVA 3KTFA 2PZFA 1ZM3A 4NABA 4U7PB 1M0WA 2K87A 2XXJA 2YVUA 3ZIUA 1ABEA 3AUUA 1A7KA 1GTSA 1KFEB 2PQ6A 3EEIA 3OWOA 1J20A 4DM3A 3K0CC 2VDRB 4ND8B 4GQIA 1XWFA 4HDKB 5TQVA 3THSA 3ORRA 2NLOA 1RLIA 1D7AA 5EMJA 2ADMA 3D2BA 1SQ5A 4TKVA 2H1CA 3HNRA 1THTA 3COPA 2FKNA 4D9FA 3PPIA 4KQ6A 4QUKA 3ZI4A 2BGIA 4P8RA 1OWNA 1SC9A 4PZDA 4B1FA 3ROPA 4XVHA 3SE7A 1T5TA 4DIBA 4QJ3A 3L0BA 1AQLA 4GI3A 3THXB 1UWCA 1NSTA 3L1KA 4NBWA 3OPXA 1PFQA 1RM3A 2FX3A 3C3YA 4NMXB 5AYVA 3X43A 1H1TA 2HMSA 2GYYA 4W5WA 4BX3A 2YHUA 5ALQA 3GLHE 5FTKA 1QOZA 2WE7A 5JSHA 3AHFA 3CCCA 2ZBFA 5LB2A 1UADA 3TQSA 1K6JA 4UU1A 4DGQA 5I7VA 1HX7A 2BFCA 4YFVA 2IY7A 3P0EA 5A4IS 1XEWY 4JWTA 1PZXA 4O02B 1ZO8A 1A8PA 1K66A 3C5VA 3L02A 4JR2A 5EQTA 3TQHA 3OE7D 2GPSA 4F6LA 5IULC 3G6WA 3ZE8A 2JHCA 2RGYA 3F2IA 3KE9A 5KCMA 4ZJPA 1UEIA 1US8A 4II2A 4ND5A 2BFDB 3RABA 3VTKA 3MT9A 2CKDA 5FPYA 1C4OA 4BMZA 2CWWA 2FH5B 1YK0A 4C03A 5EZYF 2JVKA 3SYMA 2O7RA 4HL6A 2J8ZA 3NBUA 4AUKA 2J0UB 1ZH4A 2D8MA 1RRPA 4IMIB 4L6IA 2AN4A 4EKEA 2XIQA 1I6WA 3O8LA 4GOJA 1TM2A 3ULKA 4MW0A 2I6XA 4MQ5A 4TX1A 5JQGF 1ONSA 4JYPA 4J0DA 2ICAA 2NUTB 1X3SA 3KZCA 1ECGA 1DAEA 3H2HA 1F1BA 3DR5A 4PYIA 1R50A 5ALTA 4ZA2A 5K6AA 3T1OA 4Q3OA 1PG0A 4OB8A 1TW3A 4Y9RA 3BE6A 1E69A 5EXSA 4BFYA 1ZY2A 3I9V1 1ZR2A 1SBHA 1UKYA 3C48A 3ET5A 3MGKA 5TGDA 3DE2X 3NEAA 5IKXA 2C3PA 4HBZA 4O0LA 5MGBA 1YS7A 2FW8A 3E5RA 4J4TA 1MNAA 3ABOB 4MVWA 4DTCA 4F2WA 1IK4A 5G0WA 4ZC1A 4DHWA 4OM8A 3RNOA 1OASA 3OO1A 2W00A 4P7KA 3HKBA 3M34A 4NV1A 4UE6A 5EE1A 5GP1A 3VZPA 4EB0A 4ZQFA 5EUBA 1KEZA 1JWLA 3WG9A 1TADA 3AUFA 4AZVA 2IOFA 1J8MF 1NBHA 1QAOA 3NBYC 4HMOA 3L4SO 1RCUA 2VH2A 5K3AA 1CZUA 2A4KA 3QFFA 2WIFA 3FBGA 4YTEA 1X39A 1IDN1 5B3LA 3FOZA 3EGOA 1VPWA 2Q49A 5JSZB 4G0PA 2V7PA 1XU7A 5T4BA 1VBFA 2OFXA 2JZCA 4K03A 1FLAA 2CJFA 5J2TB 2C8KA 2P9FA 1V5EA 1C9YA 4CLRB 4RTNA 3H75A 3PSHA 4ME6A 4AMYA 2VDKB 1OX5A 421PA 2G7MC 1SZPA 4ZVVA 5KYXB 3U44A 5BWOA 5EZYB 1H8HD 1NL3A 2CXRA 1QRSA 3EVNA 2DWQA 4DLVA 4B34A 4EB6A 4HRXA 3TZLA 1OFTA 1EE2A 3LX4A 1UAAA 3WWDA 5D5QA 4Q34A 2OK7A 4IMPA 4E12A 3PQ2A 3T5AA 2RGUA 1BA3A 4AG5A 5FPTA 4OI2A 2ASEA 4ND3A 3GFPA 3CVXA 5CRIA 1NVKA 4TKUA 4DV6B 3HA5A 2FYTA 5AVJA 4HNVA 3HB5X 3WL3A 4EZEA 3DHEA 1O9GA 3BB1A 4B76A 2WFAA 1I01A 3CWCA 3HYLA 1RRVA 1YQEA 3HP4A 2QVCA 3QPBA 3H4IA 1MC5A 2WJ6A 2Z08A 3K9WA 4HZGA 4CMAA 1C14A 1JT9A 1RWNA 5GONB 3R7WA 4FC6A 1I6MA 4N3AA 2BR3A 1Z2EA 1G5TA 4DLYA 4L15A 4EHAA 3CZQA 3G88A 3EISA 4G0XA 4YP7A 4EPVA 2B30A 5IG2A 2PKYX 4BN0A 2DT8A 3RNLA 4ESOA 2O8NA 1SKYE 2VL7A 4RVFA 4F21A 5LWQA 1NULA 2NP6A 3AJ9A 3KXDA 4L9SA 4Z9FA 4ETIA 1EGAA 1E59A 2AW3A 3COVA 3OIVA 1IXRC 2HHAA 4L76A 3U7HB 3E27A 4FFPA 4AZ0A 1AXRA 5BUZA 2BRUA 1BX0A 1JKIA 2P11A 5P8WA 2YW9A 3GLHA 2HJVA 1NVVR 4N3GA 4RFLA 3IKLA 3BA6A 4D82A 5DM2A 5AI4A 1JPJA 3KDSE 4YLYA 1E9BA 1Z7YA 3LA8A 3TTTA 4CDMA 4YCBA 3GEIA 3O73A 2JGKA 5IMSA 3ZXYA 4YN3A 4HYQA 3R9XA 1T5IA 4W63A 1H3EA 1RWWA 1N2ZA 1O58A 4RCYA 5A3SA 1ARZA 2HBRA 3TE7A 2WG1A 4R01A 1EZ4A 2IS1A 4ZI7B 2J7PD 5D2CA 3OZEA 3W2FA 2VXBA 4U7GA 4UARA 1JAHA 2VJKA 2DPYA 2BFDA 4A5SA 2VOJA 4C2BA 1ZN2A 2O3SA 2C9ZA 3D0KA 5E1DA 1L7RA 1Z4JA 4V2IA 1VLJA 2GX6A 1G64A 4QDUA 4FB4A 4MW9A 5IBCA 3LO5A 3TAHA 5JY1A 2ZRKA 3WDMA 3F47A 1AQYA 4L0CA 1T10A 1MH1A 2OO5C 2HO4A 4KO1S 4EY5A 4I1PA 1X7XB 3OFJA 3W5HA 1GN8A 4JB3A 4YCSA 1NF9A 3F6SA 3VUFA 1H2YA 5LP6B 1WBJB 3GGPA 4GMKA 5HMLA 4NTZA 1Z83A 4MW5A 4KVAA 3LGAA 3LVQE 5BUSA 3FROA 1VJGA 5ALSA 2BCEA 1MFZA 5C31A 4B32A 4TZ6A 3C3AA 3FTCA 3L40A 1V9CA 2IPXA 4NZOA 1RR6A 1TGVA 2ZJ2A 2JHPA 3A1DA 2YHBA 4FMCF 4IF6A 1PSDA 3MJDA 5FO1A 1MX1A 3SJZA 2QMEA 1WM1A 1TMGE 4Z86A 3NMUF 2CWDA 1GPBA 1YZVA 4I1IA 5DO9A 4WXRA 2XA2A 1MAUA 3NM4A 4DSTA 4Q16A 1XPUA 5CM2Z 1EFUA 2RMKA 4LRTB 1OC4A 1EGQA 4FGLA 2CEAA 1BQEA 1WSWA 4JLMA 2G80A 2DQYA 3QBVA 1UIRA 3QM1A 3L7CA 3TZHA 2ZWPA 4JI0B 3WA7A 3HDTA 4GSYA 4MYSA 2WKWA 3AHJA 4LNHA 2AMFA 3FRIA 3RWMB 4EUHA 1UPFA 1UODA 2ZDQA 4CM8A 5K3EA 1PHPA 1N7GA 2CJXA 2O7NA 1UP7A 3FAZA 4ECAA 5A04A 2WU4A 4LF6B 3AUTA 1FRFS 2FA9A 4NJMA 2O06A 2VQ6A 4LKRA 5FBHA 4B0PA 1YAHA 2X0EA 1Z35A 3QWBA 5KNCD 2A57A 2PRZA 1JSXA 1QANA 2EVWX 2O7VA 2MCFA 1AU9A 4PZZA 3QYFA 2WJPA 4JROA 4JYMA 4RD2A 4WNAB 4C5AA 1GSAA 3LXUX 4ZICA 1DE0A 4IV0A 3JATA 4MHTA 3AMVA 2H0AA 5H9VA 3SX2A 3TBKA 1L7OA 2IPMA 1EVQA 5AKKA 3SMQA 2H2FA 2YJ3A 4HEA1 4ZQBA 2QVXX 3ZEIA 5I9NA 1XZHA 3U6BA 4HADA 1VKHA 2ZLBA 1NXOA 1KGDA 3NWEA 1GNLA 2QM7A 5AJHA 3W5JA 5CFOA 3CZRA 1RXIA 1TM1E 5HIKA 1QR2A 3PFCA 3KYCB 4EKYA 3WNQA 3S2FA 3W8EA 2QRQA 2YJ6A 1ZGGA 2QSYA 4IFEA 1KAHA 2HGZA 3ETGA 3I6YA 3GJZA 3IHLA 3K9FC 3FOFC 1EDEA 1CUVA 1VHQA 3MRVA 3KUKA 2IEBA 3TR6A 5F9MA 2LGJA 5ALLA 3QOYA 1EK0A 3FCUB 1MB0A 2OB2A 4GX5A 5J5VA 3O83A 2IOFK 3QE3A 2QRVB 4OF4A 4W7IA 2PN1A 4XLTA 4D9CA 2GCIA 4X41A 3PX7A 1R88A 3DPSA 3HHPA 4ZT3A 5KYUB 5F3WB 4ZDKA 3T9CA 1AB6A 3AWIA 5ECYA 4M98A 2UVDA 1O5OA 1KAQA 1P9RA 2I4LA 4YMTA 1E0AA 2JKVA 2PT5A 4EUSA 3M1AA 3Q7QA 1EE9A 2QLLA 4BNVA 1NUTA 5B4TA 3LBHA 4C05A 3TX6A 4YNBA 3MMSA 5F98A 4MWOA 4TQAA 1VL8A 4YJ3B 2V8OA 3X1ZA 2PQ2A 1FA9A 3CT4A 3RS4A 1T36B 1NPYA 3AF3A 3SXPA 4BDSA 5KC8A 5BSGA 4KN9S 1T24A 1RLTA 3TQIA 3FNHA 1MTOA 1GZUA 1O3YA 4L27A 3CZPA 4EF6A 3BK7A 5JY6A 3QNWA 4PTLA 2QKYA 2GBFA 4FFBA 4KFRA 1CX9B 1XD9A 5DULA 3IP7A 3GLHB 1A4UA 1R16A 1B26A 5I01A 5K05A 1I5OA 1YUMA 1J21A 2YRXA 2KJQA 3PGKA 4KDCA 4E5KA 1BEEA 5F4BA 1Z26A 1Z63A 4YLGA 2I4MA 4W5JA 2GETA 5AI9A 5A5VA 2E6KA 5I48A 4WTOA 2DPXA 4MKZA 1GCGA 5LJIA 3AXSA 4L22A 1Z4NA 4CI9A 4NJEA 3LSYA 4H35A 1ZM4A 3WBFA 3ZE0B 2A35A 5H80A 2DVMA 1YD7A 3DE6X 3L84A 3DLCA 4YRMA 2H2AA 4RMJA 2CNWD 5JCJA 1WMDA 1J8VA 4YAFA 5E6UB 5B6PA 1AQJA 4Q9HA 1WW2A 2F8LA 1F06A 1V7ZA 4HDSB 4B31A 3C15C 1GQRA 3ZI7A 5JCOC 1ECFA 5DOZA 2ZIZA 3HY3A 1ORRA 3H83A 4NARA 1KE1A 2GXQA 1SHUX 4HAYA 3FTPA 3O8NA 3ZGZA 3Q6IA 4J7UA 1HE3A 5FWXB 1EM6A 1RXUA 2CMKA 4J76A 2QX8A 3EY4A 3BORA 4BMOB 3UXEA 4JJGA 4XYLA 3E7XA 3Q3GE 2ARKA 2O2ZA 5TJ9A 1W5FA 5EJIA 2WSSD 4DJFC 3K0AB 1YZYA 1O6ZA 1SNYA 4OB7A 1IDOA 2CXXA 1E1RA 3IOEA 4Y9SA 1IONA 3CLSC 3QWIA 2IWHA 3ZXXA 4EI9A 3IOBA 3K53A 1Q7BA 1R5JA 3RKUA 2R1ZA 2ZE6A 4IHJB 1QIFA 4NVRA 3E22B 4CQMA 4CEHA 4B2PA 3D2AA 4JX8A 4IQFA 1YJXA 1KSJA 2B69A 3E61A 4N03A 6GPBA 1OXSC 1OREA 3LNCA 1A76A 2IZ5A 4XGNA 3UO8B 4PLWA 2AG8A 1AUOA 4KO2S 4QWWA 2RIRA 2FOLA 3C3WA 2QPLA 1ZOIA 2PWZA 4UOEA 3KSUA 1ODCA 3C85A 4P54A 1KARA 4B9EA 2J09A 5EUCA 1R8SA 2C5LA 2WJWA 2DULA 1VKJA 3RLFA 3PJEA 4PXAA 3LT2A 2RSLA 2VYNA 4LRSB 4I5GA 1CUAA 1UM8A 1E1QD 4ZOLA 3RQSA 3UBMA 4Q7LA 1Z4IA 1EFPA 2R97A 3MJEA 4ZV4A 2B4KA 1GCUA 1RRGA 2UUOA 4TVKA 4X7PA 5KTMA 4B87A 1RJ9B 2ZVPX 4UNNA 4Y2JA 3A6FA 1X1SA 2WA2A 1OJ7A 3W9SA 3WNCA 4YDHB 4Q3EA 1L5LA 1BW9A 4OATA 2QRHA 1XZEA 1VCOA 1WS6A 4MR9B 4BKQA 1GNPA 1PJLA 5FJJA 4ZVQA 4CM1A 4S0XA 3B38A 3LCUA 5F2OA 3VKUA 1RI5A 4ED9A 4ND6A 5AW9A 1Q1GA 2ATIA 4DBLC 4TYMA 4UKDA 3GRZA 1YXMA 5JALA 3N2EA 3ZE2B 1CR2A 2QJFA 4ZOLF 4UPDA 3PWKA 4I4IA 5I4KA 5L51A 2IA5A 3CVOA 5ULLA 1MF7A 1SB9A 4C78A 3DF9A 1UK6A 3BRSA 1IXKA 2QROA 1BJTA 2HRCA 1R8QA 3AEXA 2IXEA 4OP3A 1VKOA 4QYMA 4N5NA 3TW8A 2IUTA 1C0PA 5ECDA 2WSMA 1SU8A 2JAPA 1F6DA 2OAGA 1WXDA 3NALA 1GYRA 3P9NA 1V3UA 3P0FA 2J3EA 3PYMA 3JAMA 1RAFA 1WCXA 4IG4A 3UMVA 4DHEA 4TVSA 3QW4B 5DGCA 2OKGA 2PZMA 2P8JA 2HN9A 4F46A 3Q3HA 1C3LA 2D06A 3R7NA 3V8MA 1QKIA 4EW1A 4QM7A 1OTYA 3AYZB 3KUUA 4PWZA 3WK7A 1KYQA 1ZRSA 5EHNA 3CR8A 2JGEA 2OQVA 3NDBB 1P45A 5EE9A 1SAYA 1FDWA 4Q7EA 3W6OA 3VPBA 3JZFA 1HKUA 4U8HA 1DCKA 1QCZA 2BSQA 2HMAA 4C14A 2EG9A 4FFBB 1KC1A 2EWMA 3NATA 3GLIE 2QG4A 5GVSA 1Z0IA 2BZSA 1ZUWA 2H1SA 2ZIXB 2QM8A 4L95C 2WZCA 3TW0A 2WJYA 1MB9A 1N2GA 3FOWA 4NFSA 3WLSA 1T0JB 3DQPA 1VCIA 1W0JD 1QBGA 3N0WA 5E6RB 3MT8A 2FEOA 3Q5DA 3C3EA 2VPTA 3D8UA 5AXCA 1VI6A 3S70A 3L8GA 4UBIA 3GEEA 3RRJA 5HMMA 4J2HA 3CJTA 4ZXFA 4I3HA 1P81A 5M29A 2FF5A 4HDMA 4R1UA 1ZC4A 2H52A 4EX6A 1DSSG 4JOCA 3UTDA 3AG6A 1G7TA 3GA7A 4LF8B 2FG5A 4DWWA 2DTDA 1BFDA 3VYSB 3G2PA 1R8YA 4KBGA 4DXAA 1IU9A 3LW7A 4O59O 3EHEA 3IJRA 3OHMA 1IN6A 4HDNB 4EY8A 3NONA 1BXKA 3A25A 2XZLA 1E3DA 3VHXB 4MAFA 2CY0A 2WAOA 4X00A 4RKEA 2OV3A 1ETHA 1TCBA 3FCCA 1T6NA 5DF1A 1S0UA 5BV1A 3FB4A 2JARA 4RJKA 1F20A 4GI1A 5LC1A 4FJ1A 4OJNA 3S0JA 3RAFC 1TQ4A 2FN9A 2PVPA 3NDPA 4Q7MB 3EASA 1HDZA 1OMOA 3X3HA 1W4RA 4ZANA 1T3TA 2PE5A 2Q1SA 1S8FA 3LHFA 1Z0FA 2NU8B 3BWCA 5LLTA 5ALPA 4JMPA 4H31A 3A36A 3WQSB 4KITB 4REQA 3TLCA 3OBBA 3BERA 3G1UA 1B1CA 3Q9LA 4IHJA 1ORHA 1NYTA 3DD5A 5HTKA 1QIIA 5FULA 1F3OA 1Y42X 4N0PA 3HDHA 4FMDF 2HI0A 4LRXA 4PG6A 4UEWA 1V5GA 3HBAA 4A0HA 2Z83A 2DX7A 2W4MA 1I9CA 3EPJA 4HSGA 1ZISA 2E4ZA 2FI1A 1VYHA 4CCAA 1Z3IX 2ZZNA 1XQWA 5EYPB 3WRVA 2XMQA 1UK9A 2QDXA 5HFNA 3DMNA 1XCJA 5B37A 2F4VB 3MOGA 1TVMA 4NOMA 3A0UA 2AEEA 5FTJA 1Q0UA 3FWKA 2PKEA 3DLBA 2J4FA 4X84A 3H0EA 1TK3A 1GEEA 1AK1A 1W4CA 2QP3A 3EGDB 5ALZA 3PDIA 3AY7A 2VG8A 4J6EA 3ISTA 3IUJA 4KQMA 1UC8A 3ROXA 2PUDA 5BQ5A 4IP0A 4WAUA 2IDKA 2V6IA 1PNQA 1DO0A 1NF8A 1ZIXA 3CE6A 3AIOA 4MUNA 5K8JB 3C7DB 3LMKA 2IHBA 3X1KA 1OC2A 3H3FA 3UAWA 2YQ5A 3F67A 1BMFD 2CT8A 1AKMA 4QWMA 2DUJA 1KMMA 1O4WA 4ZYVA 3BE5A 3U37A 5EKSA 1WUYA 4LDPA 4A6PA 2VN8A 4CDNA 2YNMD 3ID6C 3U17A 3V1UA 2XYGA 3MM4A 1KRHA 4K9MA 2WLSA 2Z30A 4D1YA 4ENTA 5K4GA 1YA6A 2JBWA 2G76A 3SSAA 1FRZA 4N5IX 4XWTA 4DA8A 1YH3A 3QUQA 1HMYA 3H0CA 2CLLB 4R9RA 1F8XA 3V8VA 1WG8A 2BTOA 4H6PA 3JQ9C 3FHCB 1Y4ZA 3B3QA 2YMLA 2E4YA 4LXQA 3MB5A 1RU3A 2FPGA 1DLJA 3BJMA 3KB8A 4Z51A 4U6SA 3WGGA 1E4EB 4D99A 2W6CX 3V8EA 4DUYB 4DG8A 1QYCA 1V48A 3W2IA 2BGRA 3RYFA 1K7YA 2AJTA 3DO6A 1BRTA 1NOIA 4E1AA 3ND7A 3BKXA 4RY2A 1BDBA 3MJFA 3CURA 1C3OA 5FHRA 4QDJA 5LOVA 1HEUA 1RFLA 1RIFA 1XRQA 2O2GA 2C3YA 3A9CA 3HFGA 5FA8A 2HWUA 3IKJA 2HZ7A 3MXTA 1W44A 1NX6A 4YMHA 1UFRA 3BKWA 1OAOA 3HCWA 4YT8A 2E5LB 2G77B 2B6HA 2BJVA 1X14A 1K6MA 4G85A 4M0MA 4CNQA 1R0SA 2G36A 4L5AA 4YDSA 1FDTA 2HDHA 3TL6A 4F2PA 5BRJA 2G82A 3M81A 1OX4A 4ND2A 5KJ6A 5E7MA 5G02A 2Q5CA 5P21A 5DWDA 1TF7A 4YRIA 5DNCA 2ISSD 1KZ9A 4UEJA 5BT9A 1V41E 3EXFA 3TIFA 1GGHA 1YZFA 3GLIA 2D1SA 3P9QA 3T5PA 3AFMA 5AUNB 2QIOA 1UM9A 5FUVA 3L7OA 3B1VA 4WL0A 4KWIA 1T2EA 1L8AA 2PZJA 1HQDA 2UVPB 3AJRA 1S3GA 4FVTA 3ZDEA 4BRSA 2F1HA 1KI6B 4L50A 2ZPUA 3UK7A 4PX2A 3N59A 5EXTA 1Q14A 1UT5A 5CMLA 4KAXA 3VR3D 2WFZA 1MT0A 2PTHA 4RK0A 1N6PA 4DIKA 4PGGA 5BR8B 2ZI4A 4LBYA 5JBQA 4KPFC 5EVJA 5CCDA 3K2BA 3VC1A 2OHXA 3DQQA 5F1YA 1B0ZA 4BAGA 3P0RA 1N2CA 3LDAA 1DBSA 2VAXA 4JEUA 4PSDA 3J81k 1SXQA 4NYJQ 2WF6A 1IB0A 3RF7A 4LXIA 3K96A 4Q1EA 5KDOA 3BMQA 3K35A 3CWZA 3G0DA 4QC2A 5LZ2A 2WOOA 3A6GA 1CZLA 2QLNA 4J0CA 5E2AA 1PAUA 1Z0SA 1ZBQA 2VI5A 4R16A 5MF6A 1AGNA 5A4JA 4C7OA 2NTNA 4A6EA 4DQDA 3OBIA 2AEMA 3L8EA 2O1EA 2VAWA 3U48A 1P7CA 3EBPA 2AX4A 3C97A 3OZFA 1W94A 5C3MA 2AN1A 1OWMA 3E2IA 3UXMA 2GAIA 2W2MA 3DM5A 3GFOA 3NHSA 2ORVA 1H3NA 2NU8A 3VYRB 3WB0A 3ZX4A 2DMRA 4DSOA 2R6ZA 5LXTF 3CR7A 3QWHA 5ADWA 4AECA 1ZI8A 3EOAI 2A67A 2G9RA 2I3ZA 1LDYA 2PNJA 1Y3HA 1Z4QA 4W1QA 1ZM9A 1E5QA 1D2MA 1Z13A 2UYCA 2WSBA 1ZIPA 5EPOA 3W4JA 4J94A 4WZAA 3S2EA 1JVBA 2I87A 3OKCA 3LCCA 5A71A 4J9UE 3DZCA 3N2KA 3QVTA 4FOSA 1XA4A 3K05A 3JQAB 4RZUA 4HYEA 4U1RA 5IRCD 2OP1A 3OJLA 2IXDA 3RHTA 1EXVA 4MQUA 1OJLA 3AZOA 3PDIB 5TSDA 5K8TA 4GZMA 1P5ZB 5EWJA 2YVAA 4TYNA 4KHPB 3EARA 1EAYA 1Y9JA 2FUG6 5HF8A 1F51E 5U1PA 3MUFA 2PX8A 3MUNA 1GGVA 4LFCB 4PYRA 4GAEA 3RYIA 1SIOA 1E1RD 1Y3CE 2HMWA 3EJWA 3GMIA 2HAEA 4QA9A 4F9TA 2HK7A 2WKQA 4FKZA 1AMUA 2B82A 1LS1A 4N3BA 3OCXA 5FLEX 4KLNA 1NUUA 1G8GA 4DOMA 3NV7A 3DYBA 4FCTA 4RZ3A 2HADA 2ZS8A 4WOBA 3UW1A 2C8JA 3NPAA 1PZGA 5IT5A 3JQ8A 2QJRA 4PINA 4D2IA 2YKGA 3V6LA 3I64A 3C39A 3ND9A 1BS9A 3RFTA 1WLYA 1ESDA 3X1YA 1QHNA 4PAWA 1DWUA 1TEZA 5REQB 3ZCTA 1GGMA 2B61A 2IBMA 2O23A 3MA0A 3FZGA 3WA6A 2X8WA 3EQ7A 5I7UA 3IPXA 3HG7A 3TGPA 5AT1A 5FQOA 1A50B 2XUOA 2GUWA 1TLTA 2RK4A 3V7FA 1V7PC 4EY6A 5BQFA 1MVNA 2VXYA 5HZGA 3G1TA 1KDVA 2GPYA 3I0MA 2AOWA 4KMRA 4I6JA 4BU0A 4KKXB 3KJGA 3R75A 1WZUA 3L7JA 3ZE6A 5DYTA 5HKAA 1YQQA 4FHDA 2Q3EA 1T0UA 2IP2A 1T9BA 3QLTA 4A2QA 3E3AA 4A15A 2HH9A 3PE3A 3OJEA 3H5AA 5KHOC 1GZ4A 3FFAA 2W90A 1AMNA 3KT8A 1F5SA 3NIWA 4R0VA 3QMWA 3ONDA 3WZ2A 3P97A 5EMKA 4RTPA 1E2BA 4QOHA 4RW0A 3UAOA 4CKBA 5CNMA 2FPWA 3SEFA 1UM9B 2A30A 2P35A 1T6YA 3JZIA 2XB2A 1JWBB 1N9KA 2BF7A 5GMOA 4RKRA 5DOVA 4QYIA 3NDIA 1G20B 1E1CA 3G5UA 2VPPA 5CGQB 3LW8A 1T34A 1FZTA 4M38A 3TSZA 1NRJB 1OKKA 2XODA 4BLSA 4HNTA 2IEDA 4CG2A 1PF7E 3L0OA 1EXNA 1N2CB 2X1MA 3ZIAD 5CCEA 2O5CA 3AL3A 4XEUA 4DDTA 5LA6B 4G4IA 4MSUA 5FEMA 3NAQA 3OT1A 3MWYW 2FE4A 4I5FA 1I4DD 2DKOA 2FR0A 4TZTA 4BC1A 3C1AA 3Q7EA 5DJ5A 1VG1A 1T5OA 4JUBA 1JU3A 2ZATA 1C4XA 4ZTBA 5JBIA 3GT7A 5L3VA 4TN5A 3RFFA 4RQAA 1DMRA 1UFVA 1NURA 2BZGA 2PQMA 2GEBA 1KOFA 3DF7A 3GV0A 3HCCA 5BN1A 4S24A 4CQLA 3F73A 1CUHA 3CA8A 3JQPA 4IIUA 3BK1A 2JGLA 1U8ZA 4MYDA 1RM5A 1V7QA 3CF0A 5LNK6 4KBFA 1HK7A 5IMBA 1S02A 1CXZA 1TVKA 3EPRA 2ZB8A 3ITEA 3ICWA 3QKSA 4YGYA 1AS0A 1H9BA 5DYIA 4X1KB 1EDBA 1KI1A 3FFBA 2PVSA 2GDJA 4Q39A 4DMCA 4E6PA 4NOKA 3IULA 2KPOA 2NZWA 5FLXA 1K4YA 2ZRPA 1P1CA 3GDHA 1U8CB 3U7FB 3L1JA 4KZPA 4PNHA 1HLFA 1POWA 2BCJQ 1IVSA 3UICA 2FQQA 2GHRA 4R3NA 3TCXB 1F4LA 2AC2A 4JXZA 1YSCA 4GSKA 1Y98A 2JJ8A 4XIGS 3UB2A 4KEAA 3HKDB 3NRBA 1DO2A 1TRKA 1HMPA 2GPBA 2KBFA 3OCJA 3OD1A 1W8DA 4GUDA 4GYKA 4FMBB 5D51S 5F73A 2GJKA 3KTDA 3CUKA 3O8QB 3DEZA 4PHFA 2UDPA 5LQAA 3JW8A 1E5DA 3O9MA 3HK2A 5TS3A 1QTNA 2BPOA 2OC4A 4DCTA 1G4UR 1ODJA 3HBMA 3VSEA 4UCFA 2IV2X 4OFBA 1GITA 1JG4A 1I6LA 3R74A 3V4PB 2XMRA 3W7AA 3N2GA 1KPGA 1O94D 4JLKA 3EOBI 3VNRA 1W4ZA 1AV7A 1U8FO 4NOLA 1UMBB 4I50F 3LYHA 2QLTA 4W6QA 1PK8A 5BSEA 3GJ8A 4Z5XA 4ABTA 2WTUA 4X92A 1QGDA 2C2KA 2Z5LA 3N05A 2W48A 3RYIB 4CMIB 3IQXA 4N6OA 1XTUA 2QG6A 2OK8A 2Y0CA 1CUYA 3JTMA 1XDDA 2D5AA 2A33A 3FJOA 3GUHA 3LKZA 4RVOA 1NBWB 2RONA 2ZJFA 2XV1A 3CY6A 3STXA 1JKMA 4Z6KA 3K9NA 3FRHA 2QAJA 4EEZA 4LN1A 3JR7A 2ZGVA 2HX1A 2JLRA 2P2YA 5F52A 4L1KA 4LJRA 4LZWA 4I50A 3TLMA 3SPXA 2XQKA 4HGNA 3CGWA 1K5GA 3H42B 1SUCA 1YF3A 2PAFA 3MILA 2ATCA 4O4LA 3EIQA 4JUAA 1J39A 1GV0A 5ALOA 5D6OA 3VKWA 1SXPA 4AWAA 2UUCB 1YVPA 4HPXB 2LIPA 5GV7A 1IHXA 2XOKA 2YN2A 5J2UF 2BI8A 4MAMA 4R05A 4X8HA 1JIKA 4M7PA 2ZXFA 3WADA 3FLMA 1IM5A 2AG0A 4Q5IA 4IILA 2FGJA 3WJAA 1D1QA 4WK4B 2C3OA 2FDCA 4I9FA 3AIKA 4LI0A 2I4TA 4JQZA 3C3XA 1YB5A 2GAFA 4HAVA 5F21A 4JJ8A 2Z1MA 1IK6A 4IZHA 1CP2A 4NBSA 3UK0A 3NAGA 3F71A 3JRWA 2WA1A 4M6WB 3MWDA 5JNRA 2CMDA 3RW9A 3JQGB 4RZXA 3BMXA 1DPGA 3BHMA 1A9XA 4DA0A 2GF2A 2PS3A 4NJMB 4ER5A 1EWQA 2V9ZA 1IMOA 3LUDA 1DQPA 1U31A 4DRZA 5JCJD 4F9FA 3KZOA 4UU0A 5LZ5A 2IF0A 1H1LA 6LDHA 2PD3A 2I7CA 1K4MA 1FTYA 1PU2A 2Y76A 2N47A 1Z45A 2X0RA 2FP3A 3LP8A 1MPXA 4IKPA 2VH5R 1YMVA 2QP4A 3OICA 3QOXA 3TG2A 1NJSA 4KQKA 4TLMB 2YV3A 4DLTA 3A9UA 4O4HB 3CLSD 3AXTA 2E2WA 2BI7A 1A3CA 1LDNA 1HZZC 3IP1A 5A3RA 1NJ2A 5LUAA 4JBIA 3TLKA 1E1CB 2QYOA 3DOIA 4EIWA 5JCZA 1JL3A 1BH6A 2B1JA 1IZ0A 4QDKA 4YJFB 2A5DA 1QHYA 4EGAA 1JFFA 3KYCA 5AW5A 4GEKA 5IK2D 2QIPA 1GTG1 3PX2A 4FYIA 4YAJA 4CN9A 4ISBA 4RU1A 1V1RB 3BB4A 4Q1VA 5CUQA 3KYDB 3LLUA 1KY3A 2IQIA 5DX1A 1MIOA 3ADCA 1N77A 3WIOA 1K8YB 1RZ3A 1E9SA 3BMNA 4P5EA 1L7XA 1MU0A 1PNVA 2KW5A 3D59A 2M9MA 2OV4A 4JU8A 1DAIA 4GP9A 4BRZA 3ZD8A 1J0EA 3WLNA 1QYVA 4PRLA 4RBNA 4AKGA 4BFVA 3S28A 3P9RA 1S7GA 2XQIA 3ZZUA 2DQSA 4LJSA 5T57A 2D0DA 3SIPA 5FTWA 3T5BA 3KLOA 1JILA 3AV0B 2A92A 4Q9KA 5THKA 2H5JA 2HEGA 3WL6A 5AM2A 5HF5A 4ZCPA 1VZ2A 1T36A 5IAJA 4TYWA 1GILA 4GMGA 2CLIB 3EE6A 4NYIR 4OM7A 1JH8A 3MNFA 2IIVA 2HNKA 3ZCSA 3A6HA 4ZT7A 1AF7A 1QE3A 1BVRA 1IHYA 3ELYA 3P2OA 3PV0A 4R9NA 3PLAE 1AKVA 2Q4BA 2CNNA 3H9EO 3PICA 4E3WA 1QR6A 3GCGA 1Y7TA 4LOKA 2O8BB 5KS2A 2RGWA 2AQ8A 5AM1A 4TTQA 2VT6A 2A1TR 3AIMA 5C46F 1WV1A 3U7QB 5AMXA 5HGXA 3LUHA 2HYDA 2FSUA 5T7BA 1AH2A 5LZ8A 4RHXA 1CB0A 1N0WA 3DFUA 1AKNA 1KS2A 3LBNA 2WYWA 3CKLA 4ZWNA 4B2LA 3I04A 1L7NA 3OEHD 2XAUA 4BIIA 1GT6A 1U1FA 1XXHA 3ZCRA 1UPBA 2G67A 1PP4A 2AWNA 3BOSA 5BQ3A 2KI5A 3D0RA 3BH7A 3AVPA 3DNFA 3O31A 1GPMA 5ESRA 3S29A 3U3DA 4HV4A 1U9YA 1KZ7B 3DPUA 3T9BA 1E9FA 1P2GA 4Q4HA 4BNMA 5JADA 4TV8B 2PXCA 4PR0A 2Q5EA 2RHTA 1YTUA 1L7QA 3QVSA 4JL6A 2V3VA 1H22A 1MN6A 3SWWA 4KYVA 3K2QA 1CU1A 4KN5A 4NV0A 3RRYA 2CZGA 5DWQA 2HXYA 3SGLA 4QASA 2C7BA 2I4RA 3SJ7A 1B76A 5KO2A 3CW9A 5F76A 2G4VA 1J9EA 4D4GA 2Q46A 3ZBQA 2IYXA 3QVKA 3EIEA 4XSGA 3UC9A 3WQQA 4WBNA 3CRQA 1KQ3A 4QBGB 1P9OA 1QB8A 4Q15A 4GI2A 4EJ2A 2K6GA 2V97A 4WKCA 1WR8A 2QN3A 3N2IA 3IT3A 1R0CA 5TMDA 4IDFA 4BVEA 3FDZA 7YASA 2BIFA 2O8DB 4FNAA 2J9GA 4EJSA 3FGZA 4RFVA 2JI4A 2VKQA 3T5CA 1EFRD 1CBUA 3DOOA 4Y6OA 5EFOA 3PZRA 1LJLA 1ZUD1 2Y0DA 4OHCA 2ONJA 3KYJB 3V9AA 1II8A 2A0XA 4EKGA 2X40A 1WPXA 3GLGB 4Z8YA 4KAJA 3THYA 3HKEB 2JIPA 4CT5A 3MLAA 3IKMB 1KSHA 1S2IA 1YK1A 1YR3A 2J5XA 1YKGA 3TH5A 1CS4C 1DP4A 3F6RA 3OI7A 4HTFB 1OZHA 2GK3A 2YW2A 4Y1RA 4MP3A 2H4HA 1JR3E 4M9QA 1D2GA 4RPJA 5KNBA 1RZVA 3B1FA 1ECLA 2QRPA 4WKGA 3PC4A 1H1LB 2C88A 2QTWB 4DE5A 5CDSA 3CF4A 5EP3A 2Q0XA 2BFPA 1KAOA 2MTBA 1K08A 2PGJA 3HYNA 4HLUC 4JJIA 3TIGA 4D80A 5AIAA 5B53A 4DYDA 2BBOA 1HWYA 5BYJA 3ZQ6A 4JV5B 4KH1A 4Q3LA 3LQ1A 4BO8A 3FUVA 2QBYA 1THZA 2V6FA 3L0YA 1HG1A 4ZAGA 5BT8A 3E9DA 3BRWA 1RHRA 3FDXA 4BVHA 2O52A 2BMFA 3LBIA 1CY7A 4M22A 1XHFA 2ZAIA 3QX9A 4YJFA 1KQNA 3RVLA 3RTBA 4TM8A 4ZVMA 1P6UA 4XIJA 1RYFA 4HG2A 2VUTA 4AF7A 4CTNA 4ZEXA 1IQRA 1BEZA 3RVQA 1UT6A 3LC1O 2WJJA 3QXXA 1V1RA 4KLRA 2NUAB 5KMGB 5AXDA 3BFPA 3F3MA 1ONNA 2ERYA 5BSUA 3L0CA 2WHXA 1GL9B 1QCCA 4WK2B 1V71A 4Q3KA 5SV2A 1KQOA 4LNUA 3D3NA 5FL3A 2ZT7A 3ZJ5A 3GP5A 3AHCA 4LX8A 2AR9A 4KI0A 3ZJYA 3SQOA 1FY2A 3NNNA 3COSA 3RJ9A 4L08A 4R1NA 3RREA 4CFZA 4H7FA 4UUNA 1UMDA 4O3MA 2DLCX 2DG2A 4EDFA 1ULZA 3NHBA 5FFMA 3VAZA 2DFVA 2XCRB 1FJGB 3I8OA 1FUKA 5K2OA 3D6UA 3PKIA 1WJGA 1ISSA 1WD7A 1ZVJA 2J4CA 4QXPA 1YO6A 2A94A 3ANLA 4MUBA 4BUCA 3O8OA 4MGEA 1VPDA 1G98A 3ETDA 2O0JA 1QGED 4IMJB 4Q37A 4J1NA 5DTMA 3HU3A 4J8PA 3SC3A 1NOJA 2JIBA 3WBBA 4BNHA 1L7VC 3CUUA 4BMVA 5IHPA 2D62A 4URWR 5E4YA 3N7AA 4H16A 3VR6D 5MFZA 1MO4A 4ALKA 3KB2A 1VGQA 4PZ9A 4GXTA 3DMDA 4IKOA 4B7XA 4IIJF 4M1SA 2VNJA 3IHKA 5LL6P 3KQLA 1RBYA 1P3JA 1XZKA 1XZGA 2YQZA 3MWJA 3M4NA 2ZB7A 1VM6A 3BXXA 2B37A 3B6JA 1RM4A 2GRUA 2OO5A 1F2DA 3GRVA 5A7GA 5KOJA 3HYTA 1QK3A 1REQB 2E37A 2C9MA 1E2IA 1R6VA 1L4MA 3UC5A 4ZYWA 3F6BX 1M2HA 3NFYA 4JB0A 5GV8A 4G81A 3Q7TA 4G9GA 1N9ZA 3CG4A 5AVZA 2JGAA 3G0CA 3JAKB 5AW0A 5LKRA 1L5MA 1R10A 2A2ZA 4TMFA 2F00A 1QG2A 2V7UA 3SYKA 5IU6A 3C4JA 1E20A 1JNXX 3I8SA 4PLZA 3JTEA 2H3EA 5T3UA 2GM4A 1XD2A 4V38A 1FFBA 2PGOA 3G0OA 3RVJA 4QTYA 3EZ6A 2A8YA 4GLBA 4GX0A 4MR8B 5IKPA 1MRSA 3F78A 4P34A 4RIHA 1Y89A 3PHCA 3T1VA 1GCIA 2CNWA 3HFJA 4IO0A 1BWRA 2RGDA 4MI9A 4OAPA 4Z1MD 1QRRA 5KYVA 1NJFA 3IEIA 4MP8A 1QJ4A 1E58A 3MD0A 4PIVA 2F1OA 3NETA 5EP2A 1ESZA 2W70A 3IURA 4BB0A 4CETA 3KSMA 1NKSA 2IHKA 1IZ9A 3C7AA 3M2PA 3TRHA 1HDRA 1I4OA 1ZP6A 2BEVA 1E3SA 3FWNA 3KJHA 5JI3E 1ZWKA 3V7YA 1FOEB 4RY9A 5C35A 2VSXA 2JJ1D 3PC2A 3D8NA 5AESA 7ADHA 3AKEA 4MW4A 5ED0A 2UXCB 2CV1A 1NMSA 2VSQA 3IS3A 4Y1RB 1TQDA 4UBNA 2DBRA 1N3LA 4QT4A 2WTAA 2ACWA 2DHRA 2BFBA 2XMCA 5TQJA 2NXEA 1WTCA 3AOGA 2P4SA 3QX3A 1K5HA 2HJ9A 3JWJA 3G8DA 1DTEA 2DUMA 3CUTA 3O6VA 1ZD8A 1FVFA 1JA9A 1L9KA 1T29A 1U7PA 1LSOA 2YTZA 3PFKA 4HTFA 4AROA 5C81A 5I4CA 5M5BA 2ZG6A 1IOZA 5FXMA 3O2QB 5LQMA 1GPDG 4PLTA 1L4NA 4A16A 4AQYB 3SVTA 3SKVA 1U2ZA 4N82A 3RAPR 3OQOA 1WUIS 5AJVB 1YQGA 3EWAA 4R84A 3Q5EA 2I2FA 2R1TA 1QUFA 2SKCA 1RYNA 5JV5A 4QO8A 1SG6A 2RDMA 4JLOA 5JCXA 5AQ1A 2VP0A 1P2UA 1P4JA 4OKSA 4DLLA 2R6CA 1F7VA 2FPMA 1N0VC 1KEEB 4EOGA 3L6OO 1GVHA 1EP2B 2AN9A 1YVUA 2X13A 3EG9B 4K26A 5EXPA 1SKQA 4YUWA 1TUIA 3NTVA 2FOIA 4QECA 4ETNA 3ICQB 2V6GA 4Y8VA 3QF4A 2FPGB 2R44A 4ZQEA 1E2PA 3IQFA 2WAMA 1X38A 3BB3A 5A0VA 3R2JA 1BMQA 4OJYA 1HYBA 1L4LA 3WGOA 3LDUA 5JQGA 4X3PA 2NPFA 1HY3A 3OCCA 3K9BA 3RUHA 4U6QA 2PS0A 5HM6A 5EWMA 5LDDC 2COEA 4LYDA 1KFJB 1QFYA 1RPNA 3CZAA 1C30B 1N5IA 3AY3A 2WTBA 3I1JA 3PPXA 2COUA 2XZTA 3CEJA 3QPCA 3MWFA 1W30A 4ZU3A 3RVDA 3ZWXA 3LX5A 3PJDA 1CR4A 2E4AA 4HDKA 5KJCA 2PFSA 3PGLA 2IZOA 4Y2XA 1FBTA 1F2TA 4TKVB 4JAVC 1WUHS 2J5QA 4P58A 3TDKA 1NA5A 4E15A 2PXHA 4C88A 5AIBA 4ESVA 1UDAA 4U9HS 4RTKA 3THXA 1OIWA 4QOIA 1DJLA 3ZE7A 1SRRA 3ICEA 1G8AA 2O5EA 1KR2A 2XVAA 1A8UA 1S96A 4F5WA 3DWIA 3NLLA 4JT9A 2PHZA 1Y34E 3ASYA 3UMBA 1YS2X 2A5JA 1BHJA 4CIBA 4UPVA 1SCDA 3DAHA 5F7ZA 2GF0A 5AK4A 4OHPA 3DBLB 5A9SB 1IJBA 4B6EA 3H7AA 3L0DA 4ZI2A 2XWPA 4PLCA 2F3UA 5LUBA 4FKBA 2PO5A 3K09A 1EFCA 3KZKA 3LYLA 4H08A 1UOQA 2NXCA 4FFDA 4AJPA 3WKEA 1SBNE 1PX2A 3N5KA 4FBGA 3B53X 3OCVA 5E1MA 4B4OA 1XA0A 2HIMA 4CF5A 4GR4A 4QDOA 2AG5A 4FZJA 3TVDA 1LS6A 2W5UA 1OI2A 2NSYA 4P3PA 4OH1A 2D74A 4XUGB 3FX2A 1RKXA 1TD9A 1ISFA 4JI2B 3FCOA 5HFJA 4A6DA 1BO6A 2NVWA 2RI1A 2GBIA 3D3WA 4KBYA 4RDCA 2QGZA 3H9UA 3CNHA 1QIDA 4U7FA 4MWZA 2EQAA 4AF8A 5HKOA 1VSUA 2BISA 3M4JA 4RA9B 4C4RA 5EJ9A 2B2XA 2VP5A 1ZW6A 1UBTS 3HDYA 1W9HA 3D8RA 3LQQA 2MU1A 5H16A 4P2GA 2WKSA 2C95A 1I10A 2J32A 3BCUA 2YZNA 4LE0A 3DFKA 3SHVA 4QXMA 5LP6C 1ZR4A 1VG0B 1Z2CA 4MR8A 4FINA 4MWDA 2QUJA 5AKXA 1NMYA 1KTIA 4O29A 4TTSA 1QOQB 4YIHA 1GQYA 1K0UA 3CLUC 3RGWS 2O20A 3L7DA 2QRLA 2Q6IA 2WF8A 3D5EA 3GJQA 4L8WB 3GRUA 1QHHA 4L0MA 1J0BA 2D2IA 1JWAB 1TYZA 2ZWAA 1GPNA 4G5QA 1K6EA 4BMSA 1XQXA 3PXGA 4MRVA 1BDIA 1JZTA 3HE3A 3AFIA 1D4ZA 4CGYA 1M5UA 5JWOA 4LFAB 3KFVA 5F2KA 2VZ0A 2UV8A 1Y7PA 1YJCA 2GJ9A 4CMEA 2OMKA 3L5OA 3PYXA 2I2DA 5JZOA 3GB9A 5JNWA 2XQFA 4IIHA 1E4YA 3DFIA 4QYTA 4BVBA 1MENA 4BJHB 3NBZC 3VR2A 1OXMA 3GRPA 3KKLA 4OBBA 2EGGA 4JR0A 3F3KA 2Q5FA 4KTTE 2O2CA 2E18A 1X77A 1T8UA 4Z8XA 4EYQA 4KFUA 2XAAA 4PZCA 3OJOA 5FV4A 2IYFA 1GY8A 1YQDA 3SVZA 4O33A 1RWKA 3IMCA 1NP3A 3IQIX 4NH4A 4CM9D 1V16B 1XD8A 2XCIA 2YXDA 3RRXA 1JNYA 1QVWA 4P7BA 1PFVA 2AI3A 2EARA 2WVGA 3HGQA 4DV1B 1QP0A 2ZU0C 1ORTA 3OWHA 4M8SA 5FKJA 3P19A 3NIGB 3CNQS 1YS4A 4ML3A 3GNLA 4GOXA 2ZBDA 2XHZA 3MWGA 4BFWA 5KKNB 4KMMA 4D4LA 1YGPA 1DOZA 3CEHA 1XZJA 4BNNA 1VP3A 3H18A 1KEEA 3T61A 2H0QA 1A4RA 1J97A 1E79A 4C3OB 4FGUA 2CFOA 5ITZA 3KYBA 1F7UA 1IZ7A 3MJCA 5CPBA 3FKSD 2XE8A 2WK1A 1Y3AA 4N9WA 5A9RA 4HPWA 3GJYA 4MLPA 8ADHA 2GN2A 1M2WA 3CW2A 2UVQA 3UBTA 1UOOA 1KAEA 3MMPA 4NCKA 5FI3A 1ZEMA 5JZVA 5CT5A 1PL8A 4FW9A 4XDGA 4GU5A 2V03A 4UTOA 2BY4A 2YV2A 1YA8A 1RLUA 2FV8A 5BUCA 4M9XA 1LDEA 4FYKA 4XFDA 3ZC3A 1RHUA 1YTLA 1ZGBA 2O2HA 3GFSA 3NG1A 5LJLA 3K9GA 3O9ZA 5DMXA 2VP2A 5K01A 1T1RA 1FF9A 1SUDA 2CVHA 3B1XA 3KS9A 3MC1A 4TLCA 4YMUA 5JH7F 3OMXA 1C8VB 3CZMA 3HPQA 4X64B 1L4KA 1OXKB 2VHUA 3OFKA 4G8CA 1NFFA 1YS1X 5AVXA 2ZQZA 1L5YA 4NYJR 1ABFA 3QU7A 3Q8MA 5IWCA 4A1OA 1PR5A 3I5XA 4W8HA 2EHDA 4L73A 4HLNA 1Q20A 4XQGA 4JP1A 4MMZB 5I7HA 3ZHOA 3VZQA 3C98A 4YAOA 3BIWA 2AR7A 3W4IA 4RM2A 5KYTA 4RX1A 1UJMA 2RG7A 2WWWA 4AP5A 2Z9DA 4IXMA 4MGKR 4NC9A 5KI6A 4CEJA 4YPVA 3HBJA 1PL7A 3UXHA 1UH5A 4WJLA 2CXPA 5GADl 2YYAA 1G3RA 3O75A 3LBFA 5E7JA 2F3SA 2HSJA 5TQ2B 4CG0A 3LZDA 2PWPA 2ZWMA 5LDHA 1OGIA 3WGMA 4EB3A 3W7BA 4JI4B 3KPVA 1LQTA 1SULA 1EQAA 1Z5PA 2RH5A 5FRDA 2QD5A 3ORYA 3IFSA 3ZKWB 2DE0X 2IX9A 2YY7A 3LWDA 3O8DA 3OAAD 5JFOA 1PWEA 3MCUA 4G24A 4BMYA 4RF5A 5IKOA 3TFWA 4ZHQB 1XVVA 1XC7A 1JZSA 3GA5A 1EJ0A 2WU0A 3K0KA 2BMAA 1ZGCA 4W9RA 3O38A 5JAHA 4UUQA 4D4KA 1YOBA 4O2BB 2OXFA 3OX4A 3PNVA 2H9IA 2Y3IA 3RS2A 1FXSA 3HC7A 2XYPA 1E3JA 3THWB 2RAPA 2FUKA 3Q6MA 4HQFA 1THGA 3TX2A 1Y8CA 3IQDB 2ATEA 2IYPA 3C1TA 4UNQA 4URYR 3MQFA 5AKEA 5DN6A 5AVKA 1AS2A 2A5GA 1XNQB 2BFFA 3MBIA 4OA8A 4NAUA 4O1MA 1TVKB 4K81B 2QU7A 1QV9A 3WAJA 4MV7A 4E6EA 1XEXB 4X20A 5ENZA 3G5MA 2WIKA 1JHQA 1J25A 4M4SA 2ADFA 2VP9A 2X1LA 3NEYA 4ZAWA 4F06A 1YCGA 1QQAA 3VOBA 1BKYA 3FMGA 3H84A 3WIVA 2ZT5A 1E3IA 4OHMA 3G2IA 3ZHZA 3QHPA 1PTJC 3W7VA 1ZGJA 3KB6A 4E70A 3WLTA 1T1IA 3U80A 1NVTA 3Q15C 1Q3HA 2P5UA 4IMRA 2PYDA 4RK5A 2GXUA 1IJFA 2J08A 2W71A 1NFQA 3GXOA 3SC2A 4U2BA 2GBLC 4UM8B 4XE5A 3AR2A 1CYEA 1Z5VA 2HFJA 3OFVA 3FPCA 5EMHA 4YHBA 4CCYA 4I14A 5HXAA 1EFAA 1MO3A 3EPKA 5EIEA 3O8RA 4QTTB 4WDRA 5GJWC 4JT2A 1SVSA 2ZSBA 3MJ4A 3ORHA 3QEKA 2D13A 2Q3LA 1IMJA 2ZXEA 1CRPA 1RBZA 2R85A 4CR6A 3WC4A 3UJNA 4RCZA 2IUFA 1KE2A 1E92A 4WFJA 4U3JB 2VDNB 1O89A 3UJHA 5DHUA 1G8KA 4G5XA 4WNAA 1FMLA 4B75A 4M0PA 2Y2VA 4URUR 4X95A 2W6OA 3DDUA 5CHEA 3EYWA 5LOVF 3H19A 3HN7A 1QORA 4BP9A 3OM0A 1NW3A 4CM9A 4ZGBA 3WVNA 1SOVA 5EP1A 4ZTUB 1R6DA 3QX8A 5DI3A 2GZHA 4XUDA 4DIFA 4TXHA 1IWPB 5SZJA 1AJEA 1P2VA 4BMXA 4EYSA 3S8MA 2I6UA 4DG9A 1ZH2A 2X7HA 2VQ3A 3AEQA 5E1OA 5E9JA 2ONCA 1R0KA 2CHEA 2QZ4A 1HUQA 1Q17A 1W85A 2BGLA 2PPVA 5IJ9B 2BHTA 3NVMB 2IFTA 2D4AA 3QOWA 5AI5A 4FHGA 4Z1OA 2NV6A 1FX1A 1Z6XA 4TGLA 1W0KA 1SD1A 1TC1A 3DSRA 3FHOA 1R6XA 1G4HA 3G02A 3WWZA 3LYAA 5KKAA 4RTJA 1IRXA 1ZWLA 2P5SA 3V8QA 2H18A 1O97D 4X7RA 3BMCA 3ZE1B 1H6BA 3FETA 2LV8A 1DL5A 2NXJA 4WY8A 3O82A 1UKCA 1BCSB 4RA6A 1U11A 2VAMA 4JZYA 1QYRA 2JS7A 4K05A 4NZPA 1RWVA 4EATA 4DA4A 3PUJA 2EU8A 2CLSA 4M6WA 4DCPA 5GTDA 1SK9A 3VZBA 1Y6GA 3ZY6A 3ROMA 2G1KA 3ELWA 5FNVB 2YJGA 3INRA 2FPRA 4XJVA 2XJ9A 3CNLA 1GAWA 3GT3A 4E7PA 1PWYE 3AUXA 1FYXA 1XLUA 4JOQA 5CNKA 5K0CA 4RLSA 1RZRD 4LECA 2QVGA 1RHKA 3C43A 3HCPA 1NRIA 1EM8A 2A9KA 5IAOA 1HZJA 2QX9A 2EX1A 3G0GA 3JPWA 4BVFA 5FUBA 3TEJA 1GLNA 2HK8A 3IB6A 3JQBC 3MJSA 4ZEOA 3SMVA 3V7NA 3IV6A 4MV1A 5PNTA 4BZXA 1E6EA 2FETA 3LLCA 1D2RA 1SUFA 1L5ZA 1Z4PX 4UAUA 5DTIA 5K99A 3P45A 2GCPA 1RNLA 3GNTA 1IAQA 3IELA 2JCGA 5DCYA 4KE6A 5F5XA 2W11A 1I80A 2WFLA 2FFHA 4J1TC 5D85A 2DYKA 1R4MA 4MO2A 2GTPA 4BNGA 4IKEA 3LQRA 5AW2A 2V8BA 2BBWA 1CB7A 1V43A 2XMDA 3CUEF 4D9KA 2R6GA 1L1QA 4PY2A 5CYPA 5BYBA 4JC8A 5FO0A 2WJHA 5HM8A 3GMTA 4OK3A 3ROZA 2JH3A 4JEIA 4N6NA 4GS5A 4QGFA 1TI7A 1U8TA 2BZ1A 2C9YA 4YT5A 4DDHA 2GJSA 1TO2E 2LKDA 5DT9A 4L28A 1ZU5A 1EFRA 1CV2A 2NAPA 2PGXA 3OC6A 1LSSA 1ND6A 4NXNB 4E5MA 1G8MA 2WJ4A 3NGMA 1P74A 1KPIA 1GUFA 4URVR 5KSWB 1FW6A 1OTXA 2AI1A 4PZLA 3H8VA 3D7RA 3CLRC 4P92A 4ZPJA 3L4JA 3T4XA 3RSSA 2G9NA 3O84A 1GSOA 5HGJA 4EG1A 5DDIP 3VOTA 4MCAA 5CVTA 2YWDA 1DMSA 1ZS9A 2NPOA 1NBEA 3GFRA 1W36D 2D0IA 3K4HA 2OV1A 4IJKA 4E7OA 1KOGA 3B13B 1OGJA 2RBKA 1OPXA 1ODLA 2X4IA 3KXIA 4H1TA 1FRVA 4TWBA 1M72A 1SKBA 2X5JO 3TEFA 4EW3A 2OD9A 3G2QA 5J58A 2VQEB 4FE3A 1R4NB 4HC4A 1A27A 4JUFA 1E6MA 4ZK6A 2P91A 5C8XA 4NK4A 1TPYA 1FFWA 2R48A 5T3YA 5CG2A 1NRWA 3G2LA 5EEGA 1KJ8A 3NUZA 3TOCA 2HPHA 1RVV1 3CVYA 1L3CA 3SC2B 2C07A 2TSYB 1Q3TA 1W36C 2GFHA 4BB6A 4AW9A 2OYSA 2RG1A 2EFDB 3H4VA 1Q95A 1H2WA 3BWEA 3ZHQA 1A8HA 1TK9A 5KSPA 1FU4A 4WA8A 1B6RA 5ALVA 5M04A 1CQPA 1MQ8B 3OM8A 1R8XA 3GIWA 4NZZA 3JARB 4QPJC 5B5SA 2XGMA 5G4KA 3ZK7A 1TRHA 4OK6A 3S7ZA 3ZU3A 1R4ZA 4RLFA 5LPNA 3DMTC 3HGMA 1AF4A 3PHGA 4O08A 3LXRA 3BHIA 1VRVA 4ZYYA 4RKYA 1QH8A 3FVWA 4RPCA 4IWYA 5BWNA 4DV2B 4QE3A 1YCFA 2EP5A 1RPAA 3DXXA 3GYBA 4GW3A 4PXYA 3ZGXA 1NT4A 4MX8A 2VTBA 1Y1KE 1GZVA 1YKSA 3L8CA 2AMJA 4B7ZA 2FXVA 3C0KA 1P33A 3FH0A 1B8OA 2GYUA 2JIDA 3SZRA 1JSRA 1VG9B 3Q2IA 4FFLA 3ZXIA 1LDMA 1TM4E 4M89A 1BE1A 2SKEA 3OPNA 1AM4D 3JVDA 2C20A 3AEQB 1WEHA 2XCUA 4R54A 2CUNA 5FLKA 3BT7A 1EYZA 2ORWA 3VU8A 4MW2A 1KXJA 5DHRA 2PA3A 2VCEA 4UCWA 2WQ6A 2IU6A 3UJDA 2OV6A 4GZ5A 3K4QA 3NT5A 4Z4CA 4OIMA 2QNIA 3NOVA 3SJAA 5BURA 2OTCA 2XUJA 4FGWA 1ISIA 2JFWA 2RHWA 2VDQB 1X1CA 4PR3A 3UWSA 4R1MA 4IDNA 5JPDA 2Z8YA 3Q8LA 1WMAA 1XU9A 2C31A 2N1MA 3CRVA 3D8BA 3FF4A 4FB5A 1U5BA 2F3RA 3I01M 5FHQA 5HZMA 4MULA 3P2EA 2O2DA 4XQ9A 1CT9A 3IO5A 3ZV6A 2FW9A 5FUXA 3LKVA 5CEJA 3LDGA 2R96A 2HF8A 3AI7A 3F3YA 1PZNA 3OU7A 4UHJA 4F04A 1C1DA 5IK2A 2O54A 4RTSA 1CCWA 3H8WA 4PPQA 1BFKA 3PQFA 4Y0VA 3R0QA 5HUJA 2D5IA 5AK0A 4HDAA 1AO0A 2P9TA 1G18A 2JGFA 2ODNA 3PTLA 4FCCA 1JR6A 1QJCA 4YRBA 2R60A 4KVZA 3A1WA 1XPOA 3QA9A 1RYEA 2FJ0A 4JB8A 5LBIA 3S5JA 3OFSA 3GVHA 2EW2A 2HA4A 1Z6ZA 3SG0A 2D5BA 4BV2A 4DUZB 3KRTA 1D2CA 1QGUA 3A8TA 3I01A 2PU7A 4B4KA 8ATCA 4PS1A 5ED4A 2FXIA 2C3MA 3GD5A 3L82B 5F4ZA 2CVPA 1YBAA 4YXFA 4FUQA 4JLBA 4BKMA 3TOZA 1EUDB 4PNZA 3C6QA 1P6QA 3OLWA 3A9WA 3RJTA 3FJYA 4DCMA 2DPGA 2XXAB 2VDJA 3PC6A 4G4SP 4I6EA 1KYXA 3QYAA 4Y2PA 4UTVA 4LRQA 4NU6A 2XVYA 4V0NA 1DOAA 1USVA 4GX1A 4FDVA 1CUWA 4J03A 4KG7A 3E5HA 5KVVA 2UYYA 3KTAA 4F93B 5DXFA 2WEKA 1BOFA 2OBFA 4HDNA 2REBA 1CHDA 2NOAA 2IS6A 1J6UA 2F9LA 3E03A 3VHXA 1V4BA 1AVTA 2SICE 3LH5A 4AU1A 4DYHA 5BVHA 3GP8A 2D4HA 4DLSA 5KPDA 2J30A 2PL5A 2FPPA 1P73A 3NDRA 1UF9A 4LOAA 3WFJA 1K97A 2M98A 3PDUA 1J99A 3ZNOA 5JD4A 4FCVA 4YP1A 4YXWA 4WJZA 1HURA 3E0QA 1IOLA 5EA2A 4Q1BA 3GLGE 4V1CI 1SHKA 1DJNA 1U90A 1GAQA 2ROQA 5EIFA 4EW2A 2ZJ6A 1JB1A 3UH1A 3P2JA 1QZZA 1SPXA 2XUZA 1GUDA 1P7VA 2VEDA 4ZOAA 1SKAA 3PXBA 3LQ2A 5CP8A 5KWVA 1J5EB 3VKHA 4HAOA 1PZEA 2ZS7A 2H5LA 3AEUA 3G0IA 3Q10A 5I9LA 1F48A 3B89A 1R8JA 3OH8A 4L5CA 3LUPA 3HJAA 1F14A 3DE3X 3I37X 3O8OB 4JLDA 4NMHA 5EOVA 3ER8A 4PFJA 3UMJA 2QM3A 2F1KA 2V7QA 3QV2A 2IYEA 4PYNA 4PCVA 5AOVA 2JFBA 4GVLA 4S1NA 2BM1A 3GQVA 1EX6A 3DE1X 3L7AA 4YAKA 3BG5A 3FPAA 1M7GA 1XVIA 1NKTA 2ZPTX 2NO0A 4H7EA 5CTJA 4A8JA 4CRWB 4EO9A 1K6IA 1OILA 3JQDA 3JRXA 3DZDA 1OBVA 4DSNA 3DAGA 1T4GA 3WJ1A 1CIVA 2GN4A 1C1YA 3EZ2A 1FB5A 3GPIA 1E63A 4DR6B 3FUUA 1XKTA 4G1VA 2VEOA 4QJBA 4IDBA 4QOGA 4D4IA 4EMTA 1IM8A 1WQ1R 2W2KB 3Q2OA 2H2DA 4MS4A 1XP5A 1GGFA 3WLFA 1E0JA 2N46A 3JAKA 4U2KA 2X1VA 5BPFA 1WZ2A 3GGOA 3U44B 1PNOA 2ABWA 1W2WB 3HBFA 3PFGA 5EZYA 5L45A 3W5CA 2QZPA 3AR4A 4I1SA 4OI0A 3T9FA 1G7RA 3QV1A 2A78A 2HSGA 3U7JA 3U39A 1EH5A 1V3VA 1EG2A 4UAVA 1P1BA 3PD1A 3BE4A 4G0NA 5IXYA 1V39A 2QD4A 4DBLE 4R8VA 4M88A 5AFSA 4KXQA 4TLEA 2FRDA 3LT5A 3FCSB 4RHCA 4A27A 1HXHA 5C0OE 1N5RA 1E9DA 4ZOQI 3DFZA 4GVPA 3RYFB 4NR0A 4BV8A 2D1FA 4YMLA 1Q83A 2GJ4A 4R8RA 5M3BA 5IDWA 2C5FA 3U5TA 5F77A 3RVMA 1BDHA 3G8BA 4LE2A 3IVGA 5LOVB 1VLMA 4P0QB 3GW8A 4HI0E 4N1AA 1CQIB 4WDQA 4ZQCB 1CDZA 1ZG3A 1XP8A 3FZNA 5EGSA 4ZOCA 3DWFA 3G3EA 5AJTA 5H83A 5BORA 3HJRA 5GONA 1J5XA 1NXPA 5TGTA 3R7WB 2ES4A 3NORA 1Z37A 1T35A 4G1FA 5A0FA 4Z54A 1RMTA 4KDFA 5DB4A 4EY3A 2HJGA 2FFBA 1XAGA 5TQ0B 5A3VA 2Z57A 2ID7A 5JOQA 1LC3A 1EZZA 3OM9A 1X7GA 3ZTWA 4ND4A 1CFJA 4BX2A 4BYGA 1D4OA 5E8RA 2DWPA 3GLIB 2PSJA 1SXHA 2LCIA 2MSDB 2JW5A 4JL8A 2GN1A 1RQGA 4AZ0B 3A9TA 1X1EA 4BJ6A 2ID8A 2B99A 4PSUA 3AR9A 3IUPA 1CJUC 5E3IA 3U40A 4RVHA 2R1TB 3IIJA 4LHSA 2J9FA 4B82A 3RF6A 4KQ2A 1DFIA 2B92A 4DF3A 2AUNA 4B71A 1JPNA 2F8SA 3NHJA 1BQ3A 4UJ5A 2RGEA 1H8ED 4P35A 5DISB 4DZTA 5KU1A 5ICSA 3R9XB 1W5SA 4S05A 4NHOA 4A5OA 4H59A 4FZVA 4FWIB 1TQ6A 3WL4A 5H70A 3Q3VA 5KU7A 1RQLA 3IUEA 1J8YF 3T3MB 2OHGA 3T99A 3WJ2A 1O4VA 2VHXA 4B6QA 3QHAA 4DQXA 2FMIA 3R5HA 5CH3A 2EF1A 3BHJA 2OD7A 3TJMA 2GR9A 2ZRDA 1E79D 2Z5VA 1MJHA 1XDZA 4C6TA 2CK3D 3BMQB 3ER6A 4HX2A 5I7RA 1S8OA 5JXGA 1ESNA 3NPMA 2V5UA 4LYYA 1RPTA 3HCOA 3UZUA 1Y4UA 2W6IA 2WVHA 4ZDJA 4W82A 5IJ0A 4TWJA 4DV4B 1LBIA 1UT8A 3SNKA 3WHLA 2J67A 4CL3A 4BXOB 2R79A 1ISRA 3MELA 2FEKA 3K8ZA 3LUBA 1NDQA 5CVEA 5TV2A 2RHOA 3VAAA 3T8YA 4B74A 4M49A 3MN1A 4GC5A 4BKOA 4O2AA 3M7IA 5ECGC 1VBNA 1QTQA 3LPMA 2AX3A 4J75A 1MKYA 1L4HA 2OHHA 3ICCA 3K6JA 4F4UA 3TKAA 1P19A 1QQ7A 1MT3A 2PUTA 2R4TA 3IT0A 4FD3A 4DDMA 5CXQA 3BIFA 1EUCA 2PVCA 2Y92A 4M1ZA 4K6CA 3AYXB 1WXFA 1NXTA 2O3TA 3ETJA 4FFMA 1TQ8A 4LMBA 3UJAA 4GP7A 1EUZA 4LPSA 5A6VA 5TT1A 3PFIA 1DQSA 3SZOA 2LD4A 3V4OA 3MT0A 4AJ2A 3GLVA 4S0ZA 5DW3A 3JZDA 1LI4A 1MW8X 2CBXA 2RGBA 4QUIA 4FGSA 1KAGA 4JKYA 5AHWA 1G38A 1PX0A 1FQJA 2QN1A 4PNEA 3OUTA 2AZ4A 1H8EA 1HLDA 1ZI9A 1WBDA 1Z9BA 4PW0A 3U3RA 2IGBA 1FRNA 4PLYA 2Z04A 1RMQA 3OECA 4X6XA 5EE3A 3FPKA 2VSNA 3UWOA 3P96A 4UE2A 1R18A 3CWQA 4YLEA 4PCAA 2VRCA 4GM1A 4B2YA 4EG8A 3JQQA 1XRMA 4BNTA 1CUZA 1D0IA 2CKMA 5LP1A 3ST7A 1T0IA 1YR8A 2H08A 3P8ZA 1T9DA 4H18A 3U3JA 5EQDA 4IJMA 2C03A 4Q1DA 6PFKA 1N2BA 3RC3A 3HU5A 1UXGA 2W2LA 1HRDA 4ICIA 3KALA 2F3PA 2VNAA 3W6NA 3HDJA 2P9HA 1KI9A 3G82C 4FZ3A 5FFNA 3ZDCA 3T35A 1XRLA 4XR9A 3P32A 3DOCA 4OQMA 1J33A 1RI1A 3PWSA 1EVYA 2XA9A 4LZAA 1K27A 3N0RA 2Z8ZA 1CUGA 2NU6A 2QB5A 2QR5A 4HFJA 4GIBA 4EJ6A 1DKMA 2GN0A 4U5QA 1CIJA 4IRXA 1ISJA 1ENZA 3JQ7B 2Y0PA 5I4BA 4W5TA 4NKRA 4BL5A 3CSSA 2WSIA 5L4NA 1XCOA 1F3LA 3AF0A 5K3CA 1HQYE 2HLDA 4QRIA 1PDWA 2ISQA 1G9XA 4KWEA 4CGZA 4IGEA 3VJRA 1YIDA 4HB4A 2XOKD 4F92B 1G8HA 5C2JB 1KQPA 1LY1A 3IR6A 5JZSA 4M87A 3TQRA 1ZXXA 4QDTA 4A03A 2B9VA 4XAQA 3LGSA 5HKKD 3G2OA 3ROTA 1KEPA 1L3BA 3A3PA 1NYQA 2RJNA 4TTTS 4U2CA 3WDLA 1DIGA 4ZMRA 2AUTA 3G13A 4BFTA 5A6SA 3MSXA 2I22A 4M55A 4GLLA 4DY6A 1E1LA 4M2LA 2Q6KA 2IH4A 1MO2A 1PK7A 2NNWB 4AZSA 3NHRA 5AOBA 1CR0A 4YEDA 2XE7A 5C3UA 2H1VA 3OQMA 2CZQA 2HF2A 4IAOA 1W88A 3BXZA 1UJ5A 3L7MA 4G8JA 3EGXA 3I3OA 4HCJA 3GQBA 4WXPA 3BWYA 5ALMA 2EBWA 2PMDA 2VF2A 2K5UA 3TIVA 5JZ9A 1EVIA 1NXXA 2CNLA 1UPTA 5E6SA 1SXJE 3BFJA 3RWOA 2C59A 2MR6A 2GN6A 4A0GA 4AJEA 3D5QA 2BM0A 1Y9AA 3C74A 4R2IA 2NSHA 1C3EA 3UMCA 4D9JA 1TA9A 1T4MA 2TECE 4MTLA 3D0QA 1EBUA 4V39A 3CH5A 5LN1A 4GGMX 3ZV3A 3AINA 1QQBA 3P9YA 2WU3A 3F98A 4PWYA 4JI7B 3PNOA 3S8EA 3B1YA 4HWKA 4Q0MA 3ZH9B 4CR8A 5ICMA 2OHFA 4OQ4A 1ZOLA 4W7SA 3H2JA 2WD9A 4LY6A 5CAEB 1BHSA 4I9UA 2FZKA 3QHQA 4JJKA 4B8WA 1Q7RA 1TF2A 1EPUA 3FKSA 5I9TA 5MDHA 3Q0IA 2A4MA 1XZNA 1U3TA 2X19A 3HA2A 3SQXA 2DFKB 2LP4Y 4RMNA 5DBHX 3U9TA 1I0IA 3QKWA 5DLYA 3U16A 3HCEA 2EJBA 2WUFA 4BO9A 1RE1A 2A5LA 2NZUG 3GVPA 1UJNA 3MINB 4FK8A 4FQ5A 2FMXA 3O7WA 1NW9B 3L01A 3O8CA 2C84A 2KMLA 3NW9A 3VVBA 3PJRA 2GBGA 1YI8A 1L5SA 3PKZA 4ZEWA 4CQLB 3IEKA 2Q1XA 1RM0A 4WXMA 3FVVA 4XPZA 1ADYA 3SOZA 4D9EA 2RKWA 5TIIA 1G6HA 4BXOA 2NWQA 1ZSVA 3H9BA 3LM8A 3OF5A 1RWBA 3FLEA 4B40A 3OQVA 1H9CA 4H0CA 1OAOC 1RTKA 3F4LA 4LVUA 2V54A 4OQZA 3HWRA 4OP1A 4OXIA 2R8EA 4XTRA 3ROEA 3P4YA 4PO3X 2QF7A 4B3FX 3PCTA 3T3NA 4KQGA 4QRDA 5C32A 4A36A 3WWYA 5CCXA 2O2YA 2OCXA 1N5DA 2LZ0A 1R5BA 3KQOA 4WD3A 3B9PA 1PJTA