4QPJC

2.7 angstrom structure of a phosphotransferase in complex with a receiver domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
120
structure length
120
Chain Sequence
GSMRVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGIDLGKLYDYDIILLDLNLPDMSGYEVLRTLRLSKVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIHAIVRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural asymmetry in a conserved signaling system that regulates division, replication, and virulence of an intracellular pathogen.
pubmed doi rcsb
source organism Brucella abortus
molecule tags Signaling protein/dna binding protein
molecule keywords Phosphotransferase
total genus 41
structure length 120
sequence length 120
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qpjC00
2FLKA 3D02A 3KG2A 1S8NA 1LBIA 4NV3A 4MR7B 2LP4Y 3Q7SA 5IULC 3KTOA 1D2AA 2QW1A 1DRKA 1W9HA 1Z15A 1NXWA 2FN8A 3TX6A 3IP6A 1U2PA 2MYUA 2R47A 3E3MA 4RSMA 4JB0A 4F11A 3CG4A 5TQJA 8ABPA 2IKSA 3LFTA 2CHEA 1VLZA 4XLTA 3CTPA 4FB4A 2BGGA 1F4VA 5KQPA 4MRMA 3OO0A 2MYNA 3T95A 1Z13A 1DCMA 1GUDA 2FLWA 3FFTA 4G86A 4G97A 5C5EA 1W25A 4L85A 4D6YA 2JBAB 3FFXA 3GV0A 3QK7A 3SM9A 2HPHA 5DTEA 5TPWB 4RKRA 2FMFA 3OM0A 4RXMA 4XFKA 4RU1A 5IC5A 5HQJA 1HEYA 4HNQA 2FQWA 3LMKA 4YGXB 3P9YA 4YV7A 5JNWA 3QELB 2NUBA 3KJXA 1LK0A 1GCAA 4W5TA 4EGSA 3VNAA 3M6MD 2IPNA 4LE0A 4Q6WA 2WMYA 4LZLA 4WUTA 1Y1LA 4EYKA 1FFGA 1T34A 3EAFA 1C4WA 4ML3A 4Z4IA 4QICA 1ZAYA 1ZH2A 3N0WA 6CHYA 2QVGA 4MRMB 1NY5A 1U2QA 2ZWMA 4YRZA 3LUCA 1VKRA 4EVSA 3GBPA 4KPYA 1KRWA 3SQNA 5JNTA 5HSGA 3BRQA 2YHAA 4JOQA 5TPWA 2Q5CA 5TE9A 1NXVA 2NZVG 1GLGA 1YS7A 3I45A 4G0QA 3RH0A 1OXBB 1ZVVA 2IPMA 4F06A 4Z99A 5BQ3A 3NHMA 2LBPA 2IPAB 3RVLA 9ABPA 1DC7A 4UHKA 5KC9A 2QXYA 3IP5A 4UHJA 4S05A 3LUDA 5FWYA 4RKQA 4RDCA 1M2EA 1MIHA 2A9QA 3LOPA 2FMIA 4QYMA 3HVRA 1USGA 2VUIB 5FWXA 4O1IA 4N0QA 1KRXA 3TB6A 3RVQA 5DGCA 3BILA 5TQ0A 3MQ4A 1JDPA 4IMIB 1QP7A 1JYEA 4TN5A 1DBWA 2P4UA 3O74A 4MS3A 2GWRA 1RPJA 2L2QA 3GBVA 1BA2A 1URPA 4D6XA 3F73A 4F8JA 3DGEC 3I09A 4GPAA 4RXTA 5JNUA 4KFCA 4Q7EA 5B3JC 5KQGA 5KQMA 5IX8A 1K68A 1QMPA 3QLUA 3M9WA 3OO1A 4JB2A 4PZ0A 1Z25A 3H1FA 1J56A 2TMYA 5EWLB 5TPZA 2M98A 1EHCA 4Q6BA 3JTEA 4JAVC 1M5UA 2E4YA 4Z9AA 3RVNA 3OLXA 3OLYA 2MSWA 2V0NA 3EGCA 4MQEA 3IPCA 5CNKA 2JVKA 2F8SA 1ISSA 5TQ0B 1EWTA 1U8TA 1AB6A 3ILYA 3N0RA 4KMRA 2JCGA 2IOYA 2H0AA 2A9OA 1NXOA 3W9SA 4KZKA 3EODA 3MYYA 4IGAA 1MVOA 3OLWA 4GNRA 2CD7A 2FN9A 4L4UA 4W5NA 4Z4GA 2OQRA 1KMIY 1SD5A 4MAAA 1ZH4A 1E6MA 1EWVA 1Z26A 4TMYA 5TQ2B 5T7BA 5EWJA 4RY0A 1PHRA 3EQZA 3RVPA 1CYEA 3CHYA 4OG2A 3IDOA 1DC8A 2VK2A 4OBBA 3C3WA 3CS3A 3HSYA 1JLKA 3LUAA 4MQEB 2MYTA 4MS1B 4MR7A 3ROTA 3R0JA 3IP7A 3NNNA 4PYRA 1RXIA 2ID7A 4W5OA 1JFTA 3A0UA 2JVIA 4KV7A 2QSJA 4H3KB 3HM9A 1ABEA 3IPAA 4LE2A 2F8TA 1PUXA 2RGYA 4YR7A 1XHEA 1RXEA 2B1JA 4KNYA 2GKGA 3HEBA 3N53A 3SAJA 1YK0A 3QX9A 1ZY2A 2A9PA 1ZN2A 1VRVA 4WXEA 3JVDA 4EYGA 4MLDA 2NT4A 3RVKA 3H5TA 5TQ2A 1ISRA 5EWJB 2MSLA 2R4QA 1EFAA 1NXSA 4MGEA 3H5IA 1LJLA 5IEJA 3NNDA 3BBLA 7ABPA 1LJUA 2X7XA 3MF4A 4MYRA 4N47A 4XAQA 4KQ9A 4TLLB 3O21A 3FGZA 2L18A 1E6KA 1XHFA 2CWDA 4LRQA 1RNLA 1NXPA 4G0MA 3MIZA 1DRJA 3QELA 2FW0A 4KVFA 3UK0A 2FEWB 1FQWA 2OENG 1U04A 3HDGA 1QO0D 5DKFA 3LKVA 5IEBA 2P9HA 1DG9A 1JBEA 2JRLA 2NZUG 2KYRA 1D1PA 5F64A 4LE1A 1C0EA 4RK6A 5DCLA 1TVMA 2E4WA 2XDYA 1ZDMA 3CKMA 4MLCA 3VNBA 1DJMA 4E7OA 3F6CA 4H3HB 4D74A 2FKAA 1BAPA 3RQIA 3GA5A 1D1QA 4Z0NA 1K66A 3OQMA 4NCAA 1QQAA 4YP9A 1SRRA 1QNLA 4FE4A 2AYZA 4N0PA 3EDCA 2LUOA 3MA0A 5T3YA 2PLNA 3HJFA 3ILHA 5HKOA 5KQLA 3K9CA 4PICA 3F7NA 3T8YA 3IP9A 1P2FA 1NXXA 2FEPA 3ROFA 2PMCA 1L5YA 1Z18A 3JPWA 4LDAA 1FFWA 1VPWA 1Z2DA 1GUBA 3L6UA 5IUKC 3OQNA 1DBQA 4MS3B 5IUNC 4O5AA 3GWGA 3B2NA 2L17A 4E7PA 3O2QB 1USKA 1JL3A 3LTEA 4ZMSA 4NCBA 2HSGA 2W42A 1JFVA 3Q15C 3CLKA 4Z9BA 4N41A 3F6PA 3C3MA 3DBIA 2CHFA 5EWLA 4MPTA 3A0RB 1WETA 3G1WA 3UKJA 3TMYA 5HM6A 1B00A 3GT7A 1ZGZA 2RJOA 2PUFA 3LUKA 5EWMA 5CNJA 1DZ3A 3KYIB 4G0PA 1YTUA 1MB0A 1PNTA 3KLOA 1CHNA 4OTZA 2FSPA 3T6KA 1RZRD 1ZITA 2WRZA 3G85A 1AB5A 2QV0A 3O1IC 2E4ZA 4RK5A 3RVRA 1FFSA 1JDNA 3I5AA 4G0XA 5JS2A 2PUEA 4KRFA 3QEMA 4MQFA 2L19A 1Z12A 4HNRA 2YHBA 3T38A 4N76A 3FMVA 4KREA 2WY2D 5KWSA 3GRCA 2FMHA 2R25B 2HQOA 4EVRA 3KCNA 3BRSA 1TM2A 4RZSA 4XXHA 5FBHA 2M1ZA 3DZDA 4QYWA 5IBQA 2J48A 3DGFC 3L49A 4YO7A 4EUKA 1JH9A 4F3TA 2FQXA 4G0OA 4LDZA 4ZPJA 4MS1A 3SG0A 5CNMA 1IIBA 3EQ2A 3DLHA 1D5WA 2GX6A 3LKBA 3LUGA 1YIOA 1APBA 3MM4A 1DCKA 4QPJC 4OATA 3CRNA 4P98A 5B3JA 1D4ZA 2PKXA 4IRXA 2H3HA 4W5QA 1E6LA 4MR9B 2PE5A 4H60A 1YVUA 4ZMRA 3H6GA 3OQOA 2PL9A 3RVMA 2IYNA 5BR1A 1YMVA 1Z17A 3QLVA 4RS3A 4YLEA 5ED4A 3KHTA 4EYOA 3N0XA 2N9UA 5JNVA 1RZRA 1JWLA 3H75A 3N8IA 3QX8A 2JK1A 4RK0A 3HZHA 2HQRA 3LUHA 1UDRA 4NICA 4EY3A 1H9CA 3HDVA 2LPMA 3QLVC 4DN6A 1L5ZA 5JS1A 3OMWA 1YS6A 1M5TA 1A04A 1A2OA 3OLZA 1QQBA 5KI6A 3Q9SA 1YK1A 3FFWA 4ETMA 2E4XA 1Z2EA 2HQBA 3LUFA 3N6VA 3JPYA 4P1ZA 1P8AA 2E4VA 2VYCA 3M9XA 4EYQA 1TJYA 1JF8A 1F51E 2PJUA 1DBPA 4TLMB 4XASA 1PNRA 4G0ZA 3N75A 2MSKA 1JFSA 2VUHB 4M88A 5KC8A 2RDMA 4Z4CA 3A3KA 2JBAA 1Z16A 1TMYA 2A9RA 2RJNA 1NATA 3QLUC 1QP0A 5GOTA 1R8JA 2E4UA 2PUDA 1QO0A 3HUUA 4JA2A 2PUAA 1LBHA 4JASB 1I3CA 2GBPA 3HO1A 4XARA 4RK4A 3HV2A 4Z4EA 3GL9A 3O1JC 1XWWA 3KKEA 1EAYA 1A0OA 1YMUA 3NNSA 1EWKA 2R48A 4RV5A 3EULA 3JY6A 2FTKE 3NHZA 5CHYA 1QP4A 4YS6A 3RVJA 4Z4FA 3O75A 1SXGA 3CU5A 4WZZA 3URMA 4HYEA 2IDMA 5I4CA 4O1HA 1DP4A 3UUGA 3RVOA 4MR8A 3H5OA 3JVIA 4DADA 1CEYA 2FQYA 2I6FA 3HUTA 3TO5A 1USIA 2PL1A 1P6QA 1QKKA 3BREA 3HCWA 4ETIA 3H5LA 3OM1A 1MAVA 4KK3A 3TD9A 5JNSA 4IMJB 3HK2A 2ID9A 1JHZA 3H6HA 1ABFA 4KK4A 3HS3A 3H1EA 1SXHA 4PE5B 4WWHA 4B09A 1BDIA 3EJWA 4FE7A 5FWYB 3DLBA 1P6UA 4IF4A 2PUBA 4DQDA 2PUGA 1TLFA 4WXMA 2QU7A 4PEVA 4KQCA 3O1HB 4RWEA 1QPZA 1GCGA 4LX8A 1SXIA 2WJWA 4MR8B 3H1GA 3NBMA 2WWVD 1E2BA 3CZCA 4N03A 5FWXB 1BDHA 5EWMB 3RVSA 4HNSA 5JNRA 3C6QA 1FSPA 1ZESA 3CNBA 5BRJA 2FVYA 4NQRA 5TPZD 3O2JA 3I42A 4Y9TA 4OLBA 2O20A 1PEYA 1NTRA 2HJ9A 2ZAYA 3OLVA 2PUCA 5DLEA 3K4HA 2LIVA 3C97A 1NXTA 2FEKA 2GI4A 3QEMB 1OXKB 4MQFB 4MS4A 4RXUA 4WT7A 4RK1A 3SNKA 5BRAA 1BVHA 3H5WA 2DRIA 5GQSA 3QEKA 2FXIA 2QVCA 4W5RA 5CNIA 5D2CA 3HXMA 2WJAA 2MYPA 1DCFA 3MMNA 4ZJPA 3Q7RA 1JYFA 4RY8A 5IUJC 1U0SY 2AYXA 3KLNA 2QZJA 2WB4A 3KSMA 4YWHA 3E61A 3S99A 4IILA 4Z4HA 3JS5A 4JP1A 3GYBA 5C5CA 3C3KA 3CG0A 3SY8A 6ABPA 3QLTA 3A10A 1ZHHA 5PNTA 4RK7A 4MS4B 3Q41A 3KS9A 4MR9A 4CBVA 4YCSA 3O2SB 4G0YA 3CFYA 4S04A 2QR3A 3FDFA 4ZYLA 3H5VA 3Q7TA 1BDJA 2IPLA 2JB9A 5E3JA 3CZ5A 4RY9A 2NT3A 1PEAA 1KGSA 1MB3A 1ZGGA 3LUJA 3OMXA 3D8UA 4ETNA 1M2FA 4F12A 1JX6A 2B4AA 5ABPA 4EVQA 4OLAA 5FBKA 2FMKA 2PAFA 2JVJA 3KYJB
chains in the Genus database with same CATH superfamily
5KOHA 1FUKA 1LDBA 2HT6A 4OHMA 2X0FA 3UB4A 1F2TB 2IQIA 4DGSA 3GARA 3ZS8A 2GJAA 4B6PA 4QBFA 3VMMA 4EFKA 5JCPA 1I3NA 1I13A 2W4IA 4HGYA 4TUYB 4B6QA 1ONSA 1EAMA 3WHIA 1SUFA 2EHJA 3WBKA 3NZEA 1ML3A 3AHEA 3SZGA 1WXEA 4P31A 2ZETA 4DUGD 2CHEA 3CB2A 4CEHB 3OOSA 1UXHA 1NPYA 3HO6A 4ZOLA 3DNPA 1YVEI 1L7BA 1CXZA 3JW8A 3NEJA 1LDGA 1SBYA 3TAXA 5IT5A 1W5FA 1PR0A 1W25A 2A1IA 2PKYX 5ILOA 2JH8A 2Z08A 4BQFA 2VJMA 4DJJA 4LJ7A 1B2LA 3SM9A 3VBEA 4C01A 4EB3A 5J2UF 3B9PA 4HLUA 2X5XA 3AZOA 3MJDA 1Q6YA 2ZUTA 4FHZA 4NE7A 3B3QA 5CX4A 1ST3A 3ZJYA 5JD5A 3TG2A 4LOAA 1YKSA 1X3LA 2W0SA 3D0KA 3P9ZA 5DWQA 1PSDA 2Z5FA 1Y63A 3QELB 1KDZA 3GG9A 4I9UA 2BIFA 3H16A 4IRUB 4LZLA 2Y0BA 4G37A 1YF3A 2XZDA 3JVVA 5H4HA 1KORA 2BZ1A 2PKEA 3GLHE 3CRW1 2YJNA 1TEVA 3DKRA 4D8UA 1VG9B 3RO7A 4F2DA 1YUBA 3FSGA 1HE5A 5E9JA 2NN3C 1O89A 3J80A 1JEJA 2WSSD 5K4AA 2H2DA 3WYBA 1VIYA 4I66A 3C1UA 2HBRA 4XSVA 4PZ9A 3V1LA 4DT1B 1KFCB 1N6IA 3NQ41 4XQEA 4UATA 5E7JA 1IFXA 2PWPA 5KNDA 3JQQA 4WZ6A 3SJBA 1GNLA 4PYJA 2HIHA 1K7YA 2J3MA 3QGMA 4NDNE 3FCEA 4EBFA 2I67A 5JRZA 5AW7A 2R7AA 4QPPA 5B37A 5CJPA 2IPMA 4BBAA 3AYZB 1DC7A 3A6JA 3II6X 2ZRFA 4PZAA 3RSCA 4F2PA 4FYKA 2AX3A 2DWPA 4E12A 1G4AE 4TQGA 5IVKA 2J9RA 3JYQA 4RKQA 1W0KD 2ECQA 1JLSA 4MSUA 5L4NA 3HKDA 3BDIA 3O2NA 4WKBA 2FMIA 5DNUA 2DFLA 5LOVB 4MVWA 1QF9A 4RLQA 2Q6VA 2ZJYA 3PR1A 4GNKA 3FFAA 3H2BA 3NCTA 4KMMA 1GYPA 4DXHA 1MGOA 4OFWA 4FCTA 1CJTC 2AOVA 2GPTA 3UW1A 1PJRA 1CLUA 1CRQA 3ZV6A 1X38A 4E4TA 5C7YA 5JVDF 5JXIA 3F5DA 2C0CA 1Y4ZA 2UZIR 4OREX 1FIUA 4M1QA 4X44A 1ONPA 1XTZA 3MILA 3V1KA 4WINA 4EEZA 5J4LA 3FUCA 4E5MA 1EZZA 1EFDN 2CUZA 3ZD9A 3TRIA 2WSMA 4UULA 1Z6XA 5IM4F 2YW9A 2YY7A 2VZLA 4QASA 3BD9A 5DO9A 4I14A 5ALXA 4A5SA 4DWJA 1V7CA 4PZ0A 1QF6A 1D07A 3AL2A 4Z86A 1WPXA 2B2XA 3KAPA 4JODA 4DLXA 1MHTA 4IZ6A 2ZSBA 4KE8A 4QKQA 1ZM3A 3OLYA 1ZLXA 3G0DA 3DBVO 1VSUA 4MQEA 1FFXA 4UBIA 3BE5A 1XZBA 3JQGB 1TMKA 4QECA 3VC7A 1AB6A 3ILYA 3VDMA 4DQXA 4PO8A 4WECA 1RAAA 2EX1A 1FX1A 5CH8A 4K9PA 1AM4D 4DIOA 2QJFA 3PXUA 3DLTA 4X1KB 1U8CB 5ELXA 3Q6MA 3QUBA 4D8VA 2GNOA 4MVJI 1XAIA 4PU0A 4F4FA 2HREA 5BNZA 3GLIE 1SD5A 1ZZGA 1K3FA 4YP7A 3WNZA 3THYB 1CY8A 2ONYA 4RTJA 3NATA 2QIPA 1Q0LA 3WFJA 9GPBA 3WRXA 4X65B 2H7XA 1XR3A 4RY0A 1Q22A 4EI7A 3EQZA 2O3RA 2RKBA 2IWRA 1YU9A 5A5DA 5JBNA 1DC8A 3BRCA 1DQZA 3OZEA 2Y1EA 3TW8B 5C4IA 1Y4DE 4GRDA 1D2RA 4KQJA 4DM4A 4N6NA 5B30A 2H0QA 4D3ZA 1JQDA 4RIGA 2IP1A 4L6CA 5JRJA 2HOQA 1NIJA 2JIZA 4CUKA 5I7HA 2GZAA 2C61A 2H4ZA 3CPEA 5KX5A 4W5OA 3AFGA 2GD2A 1HE2A 3ENVA 2JGEA 2WKWA 3SFVA 5JEEA 2QAJA 1OKKA 4C6SA 2Y9MB 5CXQA 3BJIC 1Z5GA 4FYXA 3UCEA 2DQ4A 1ZMTA 1E2LA 4N82A 3QVGB 5CR9A 4NENA 2JNWA 3WFZA 3VSDA 4ZREA 4QOHA 5FLEX 2Q0HA 3ONNA 4L22A 1USVA 3AM3A 1ZH6A 3N8HA 4HV4A 3V9PA 4O25A 1YCFA 1XWFA 3F4KA 3OJCA 1L4GA 2OV4A 3MS2A 3R9XB 3FGZA 3D2AA 5FUQA 1H94A 3WJ1A 4MMZB 1NXPA 4HNAA 2C5LA 1H65A 1JU3A 4ITUA 1RRCA 1MD9A 3WTCA 2GQ0A 3CLHA 4G89A 1ZW6A 3MTAA 2NAPA 1KEEB 1NPDA 1WSAA 2YUIA 3IAEA 3MK31 4GSLA 4RIFA 1Z4PX 2CKDA 2NZJA 1I51A 3M6VA 4MVJM 3E8SA 3TOXA 3UG6A 3NKLA 3L1JA 3ZY3A 1L1RA 4H27A 3TKYA 6REQB 4FHCA 2JS7A 2NO4A 3ZZ1A 3QIVA 4DV4B 2BMAA 5BWLA 3F6CA 3SXPA 4Q9IA 1A9TA 3G5TA 1WXQA 3OZ7A 4NCAA 4M89A 3U40A 4R7GA 1TZMA 4OFXA 2V97A 4HNAB 3I0MA 3JSXA 5H1YA 2R6FA 3Q6NA 3UMYA 4KGDA 3QU4A 3UWDA 1DE0A 8MHTA 2KMLA 5T3YA 2CB0A 2YR0A 1EBFA 3ZQUA 2HV9A 3SFTA 3AUTA 3TLYA 1SVUA 1J7JA 2FN3A 3C7CB 2H5LA 4LJ5A 5C31A 4E08A 5B7GA 3UPUA 3DL2A 1G5IA 1B14A 2QZPA 4C03A 4GKJB 1DV1A 1SB8A 4Q4CA 3UOAB 4DC9A 2R6CA 1RM0A 3O3CA 2BWJA 3DPIA 3RRYA 4OVKA 3WNVA 1GAEO 5FI0B 4AJNA 4ZVSA 4GBMA 13PKA 2VS1A 2W7TA 2WWWA 3MWEB 2FZEA 4V39A 4EKEA 5CDFE 5ITWA 3LQKA 1D6JA 1NLFA 4BQRA 4RPGA 2WJ3A 2X86A 1XMOB 1O94D 1BMQA 2R3SA 1Z2DA 4M0PA 3GJ6A 1EI9A 4P7JA 4U6NA 1ZW1A 1DBQA 3IAHA 3NHLA 1BW9B 1CFJA 1KY2A 5FQNA 1PIWA 5JMPA 4OCZA 1GZ5A 2VNIA 2GAFA 4F4CA 4LDPA 4AJEA 3Q88A 1KQ3A 5AKIA 4BCCA 3U39A 4ZIRA 4QDUA 4E5SA 1E1LA 3E53A 4BWYA 1YRQA 1W46A 2JAXA 4Z9BA 3VFDA 3QVLA 4LYDA 4CG0A 2PGLA 2Q3BA 5BO5A 3TTSA 3PFNA 4MPJA 2HU5A 2IQ5A 5EIFA 5EWLA 1X7GA 2Q8NA 5CFZA 1DOAA 1R6VA 1L4NA 1ZD3A 3WLAA 3BZBA 4MO2A 3Q72A 2HYDA 3AW8A 1UDWA 4FDAA 1A9XB 1KJYA 2BR3A 2XHEA 4YN3A 3KLOA 4PQYA 4YCNA 5EY5B 1RZRD 5KVQA 3R7WB 5NULA 4LXTA 1UADA 3P9PA 5FYQA 2EBUA 621PA 3RJ5A 2GM5A 2CBXA 5DIZA 4IY1A 5CDYA 2DUUA 1XTUA 1B0PA 3GPDG 4MW6A 4KX3A 2D5BA 5KJ1A 1WMFA 1ETHA 2IWHA 2W6ZA 4LHVA 3NHKA 5EQFA 4F4IA 5B3LA 1OH8A 4UMVA 1MLDA 4GKBA 4HAOA 2V59A 3RM3A 1FDVA 4GSYA 3DZDA 3ZWQA 2BC9A 3WHLA 2C5FA 1XZ8A 2AH5A 4RGYA 5KSPA 1Z88A 2ZE7A 3FR8A 4KI0A 4NCXA 1JLHA 4JBIA 1SQGA 2FCAA 3CUKA 4HFNA 2Q3LA 3VZDA 1XP5A 2QN2A 3QIAA 4Q3OA 4NV1A 4EOGA 5ENVA 3Q98A 1I7QB 1T43A 3MM4A 4F1JA 2X3YA 5LBTA 1Q3TA 2LW7A 4ZAGA 1KI8A 4E11A 3HGQA 5K0LA 3BL6A 3OLCX 5CEJA 2XNKA 4H60A 3IVRA 1C3LA 1DKOA 3LUPA 1GR1A 3ZEAA 5BR1A 1Q15A 3HB1A 4WK2B 3ACCA 1R4NB 1QHSA 1Y9EA 5BN3B 2ZB4A 1W75A 2HMWA 3GGSA 1AG9A 2N9UA 3FSJX 2DH6A 3N0XA 4B35A 5GM1A 4A8JA 5KTOA 2J0QA 3Q6IA 1L1EA 1SVLA 1HURA 2ZVDA 4DIBA 5CA1B 2Q5QA 1DX4A 1VJGA 5FWNA 4BWFB 4B84A 1NN5A 3ORSA 4Q1FA 4LNUB 2O4CA 1XN4A 2GUWA 3E2IA 1SKYE 2V1UA 4L74A 1U90A 3UENA 4UEQA 2JAOA 1G1AA 3OZRA 4HMOA 4D3YA 1CJBA 3H86A 2Y1GA 2JI6A 4DTCA 3PFWO 4C4AA 3MN1A 4YAOA 1SOWA 4NY1A 4ARCA 1D04A 1NP3A 3A6GA 2QNBA 1ZBDA 5CB4B 4RPCA 2MSKA 4Q1CA 1QFYA 3IE0A 1Z83A 1ESEA 4GMXA 4RGQA 1GUZA 3DVAB 4YAKA 2H2AA 3PVCA 3L8DA 2A9RA 2YY5A 2WD9A 3JQPA 5F78A 3HP1A 4MUNA 4CDMA 1KDOA 1R8JA 1AN9A 4JLAA 1ESNA 2XJ9A 3G89A 2PUAA 4HNVA 1LC3A 4KWIA 2ZRAA 1RTKA 3R3JA 1N7GA 2IP4A 3WDKA 3ZU6A 3GLQA 4ZK6A 3BD8A 4AP6A 3IR7A 4IRMA 1GL3A 5FORA 1XWWA 4HH3C 5J4YA 5IJWA 2FUNB 2DUWA 2AJ8A 2QM7A 3TINA 4UXIA 2A0UA 3VPFA 3PC8A 3JY6A 1DDOA 1QIKA 2MSDB 2VDWA 4D4MA 5ADUS 5EJAA 3OC0A 3GMIA 4ZAWA 1MQ9A 2XVYA 3GAFA 4N48A 3FYUB 3I0ZA 4HN2A 2HZ7A 5CLIA 2KE5A 2QR5A 4RF3A 4XGKA 4EW2A 3AV0B 3QKSA 1XRPA 4JP5A 2P8JA 3ZGZA 3BH7A 3OFND 1HF3A 2QRMA 1HTWA 2J31A 3KEQA 2A84A 5HJ5A 3KJQA 1NNUA 1P6QA 5G1NA 4F91B 2H1WA 1L6IA 4OHWA 2P2LA 2DFTA 3PDIB 3PHBE 4I1OA 3QXHA 1ZNWA 4XIIA 4WBNB 2WVAA 4EY4A 3THXA 3IA7A 4LDNA 4AROA 2O2XA 4W82A 1E2KA 4DR6B 2FAXA 3GFRA 1BDMA 3OE1A 3NKVA 3NEPX 5GVSA 3LFHA 5CD9A 2RK3A 1PGJA 1W4ZA 4L73A 1YSCA 4LXIA 2G82A 1CZRA 2HCFA 4P4SB 4B7ZA 2W2QA 3RU9A 5FPKA 2WD8A 1BHSA 5KTPA 2GPSA 2REXB 3I12A 3R5KA 2E85A 2IOFK 4HBGA 2OO7A 1JILA 1NUHA 2IODA 2RBKA 4CJXA 4RMGA 1JDBB 1ORRA 2IY7A 5E95A 2BW0A 1N3YA 2BEWB 3IVXA 5J4VA 1DEXA 2CZCA 5FFFA 2G4CA 4CN9A 3FPAA 2WSIA 1E1NA 4KSCA 4NNJA 3F5SA 4E15A 3EVDA 5E0KB 3R7WA 2P30A 4L8YA 4C3ZA 4NAUA 4EA7A 2OGWA 5CB0A 2ACVA 5D85A 4RXUA 4BGDA 1BX0A 2G63A 2KQUA 2Z2ZA 1VLJA 1V6AA 4UHCA 1X0XA 2GK3A 4H7DA 2Q8PA 2B35A 1B6GA 2Z04A 2VRBA 3QITA 5IDYA 2IIVA 2WVGA 3RBXA 4BMYA 2QW0X 3INRA 2J9FA 3FCAA 3OQBA 2SKEA 1RT9A 2R85A 4IS3A 4P4SA 2WICA 1WZEA 2JGLA 2WU4A 2PDAA 4Q9AA 3U3KA 1WA5A 4L3VA 2HBQA 2RKWA 2AOTA 2EYUA 2V0CA 4KBGA 5ALTA 4MOWA 3ZG6A 2WJPA 1K2VN 1E2PA 1L7XA 1U0OC 3GYBA 4JP1A 2HRDA 4R05A 1RBYA 2VL7A 4RW0A 1UEXC 1KO8A 2J3EA 4GP6A 5EXDA 1FK8A 1AV6A 4TUYA 1ZO8A 5CAEB 3R76A 2HPZA 3EHEA 4R1UA 1NJ8A 2QMEA 4NZOA 3A8TA 3D2CA 3PYLA 4YJGA 2IPLA 1GA6A 1LNQA 2C20A 4G4SO 3H17A 3PCTA 3F5FA 4CU5A 1ELOA 3DXXA 4HSGA 3EUWA 2JGKA 3AXTA 1ZGGA 3N1UA 4YREA 2BM0A 1I6MA 5I3CA 3RB8A 3ME5A 3JASA 1JX6A 2OWEA 4EHLA 4OYHA 2FMKA 2XUHA 3ZQ4A 3GHYA 1WAMA 3E5MA 4Q0MA 1U2RA 4NQZA 2HHHB 5E4YA 1U1IA 5LLTA 2HQ1A 1WQ4A 1JI3A 4HQOA 3ITEA 4MCIA 2ZRPA 3TW0A 1A9SA 2X7JA 4US2R 3SEFA 1FF9A 2J30A 3OEED 1O77A 4BEWA 1KJZA 5IDVA 2P6MA 2DFPA 1RWBA 3T4XA 1QIGA 1G21A 1DG1G 1TIKA 5GJWC 5ALWA 5AH0A 2UUAB 4NABA 4UTXA 1QH0A 3HYCA 9LDTA 1ECPA 2WW8A 3KUDA 3KEFA 1MOSA 2E5FA 2YYAA 5AI0A 3KT3A 5EJ4A 5KZMB 2EQAA 2CEKA 2XTNA 5BWBA 5KOYA 4DT1A 3EASA 4TZ0A 4GP7A 3KPWA 4XCQA 1SFRA 1VE6A 1HEYA 4OU5A 2DBZA 2W83A 1U6IA 3C41J 3LMKA 4YGXB 5KJ6A 4BQQA 2PL3A 1GKYA 1Q77A 2I4RA 4EGSA 1MG0A 4XJVA 5A05A 3CVVA 4RL4A 2WAXA 3EXG1 3EAFA 3OQPA 3QA9A 4KAFA 4Y3UA 2HV8A 5HIKA 1ZAYA 4P35A 3ETNA 3FD8A 1Z4IA 3PGKA 3E27A 1A8QA 4FOPA 2H7CA 4TMFA 3GBPA 3C8UA 5TGTA 1NQ5A 2RH9B 4QQ8A 4BBPA 2PMFA 3DT8A 3KLBA 3QVUA 4IV5A 5JNTA 4JROA 1U9IA 1V11A 5HSGA 1QOQB 4XSHA 2EQ5A 4FOLA 4Z7OB 2QZSA 2ZPTX 2XE8A 5EUMA 4CLEA 1NZDA 3KHKA 4I1VA 4D4IA 4GX2A 3R6LA 4JI7B 5KSOA 4CG3A 2O3QA 2WNSA 2HDOA 3C24A 3EIOA 4UCQA 1CY0A 2OXRA 3HYNA 2VF2A 3KOWA 1E77A 3NJRA 2EV9A 5CDSA 1VSTA 1L5FA 1QO9A 3PFCA 5MDHA 3N2GB 4CMEA 1Q7BA 2GCIA 3DEHA 4L16A 1WDTA 3WL3A 4MARA 1K9VF 4F7DA 1FP7A 1MIHA 4C0HA 2BKEA 4Z54A 5K0CA 1RHJA 1GRCA 2YV3A 1N6OA 1Z6ZA 2ZPAA 2SECE 3DQPA 3FETA 4GKAA 2W2LD 2B4YA 1WCYA 3PCXA 1VI6A 4O8ZA 4ZGWA 3M33A 3I1JA 1DBWA 4N49A 3W8EA 3WZLA 2JDIA 3O4JA 5SZIA 3F97A 2GHQA 1E79D 4TYWA 3EWAA 2X58A 3SZMA 4YJ3A 3SZRA 1STOA 5B1DA 1ES9A 3CJTA 1Q7GA 2QIOA 5HKLA 3LXRA 3ND5A 3CRRA 4C43A 2NPFA 5JNUA 3GW8A 1G7TA 2JIZD 5I9LA 4JMLA 3VDRA 3MBIA 4B4DA 3TSZA 1HRDA 2XUGA 4FVTA 1U6JA 4G1VA 1T0IA 2XUJA 5A62A 1C3JA 4IVPA 2XR1A 5TPZA 3K16A 1L6RA 5BQFA 5DBOA 1KAMA 2PK3A 1ADYA 3LKZA 3UJNA 1FFCA 1RWOA 1HQYE 2R96A 3D64A 4YIKA 3QV2A 2QTFA 2ZQZA 5D3MB 3OZCA 5AW6A 2GN4A 3GN1A 5TQ0B 4ZV4A 1KEWA 5I9SA 3G7NA 3RS0A 3ZDQA 5K0FA 2WJVA 4F72A 3FVRA 2NAFA 3CZ9A 2VP6A 4OPMA 5IBRA 421PA 2VNAA 3RK0A 4F4JA 1RDFA 2OQRA 3OEEA 3ZXSA 1S2MA 3OM9A 1Z0DA 1EXVA 1RQGA 2GRAA 2ZIGA 3O7WA 5EP4A 3VM6A 3K1JA 1NUQA 1TUBA 1UT5A 1VRWA 1OI3A 5HXAA 1OTYA 2Y6VA 4R9NA 2VPTA 3CHYA 2VPWA 3O47A 1M34B 4PLFA 1KDRA 1SG0A 2VDOB 4RBNA 2RHOA 1P2BA 3C3WA 4PX9A 1PFGA 2HJRA 1HQDA 3CNEA 3D3JA 1YZQA 3S7ZA 3ET5A 1GPNA 2ZREA 1YVRA 2PBLA 5AXBA 3DBOB 2CJXA 4MR7A 3V1MA 4E31A 4M55A 5A5GA 3FNHA 1TYBE 1FVXA 1HDYA 2ZRJA 1PT9A 5AVRA 2BHSA 3REQB 3FPCA 4BQSA 2QSJA 1J23A 1R9MA 1WO8A 4OHZA 1XMQB 2Q41A 5J1TB 4CM7A 3CF4G 3I4CA 2PZEA 1Z7BA 2OHVA 3DOHA 2NSDA 4LZOA 4UTNA 3GRFA 4PPNA 4F46A 3B89A 1QFJA 2K5UA 3QX9A 1YE3A 5JDCC 3ZHSA 1DWUA 4QUBA 3P0FA 1BEZA 4V0KA 3IC5A 1D4AA 5EWJB 4A0GA 4F96A 3IALA 1EFAA 4BGUA 1KJIA 2CLFB 3TTWA 3TVYA 5TVKA 4MGEA 1BH6A 4F5EA 1ODIA 2IDZA 3FOEC 4Y9DA 3ZU4A 4N47A 4BO8A 2DR2A 1R66A 3A11A 2QUJA 1HE8B 4PR3A 4QUJA 4WE3A 5A9TA 3ZJ4A 3KR9A 1DMSA 5TC4A 1BROA 2ROQA 3ITNA 3ICQB 1MO3A 4CU2A 4P5PA 4EYEA 4RDHA 1BDBA 1LV8A 1X8KA 3MJTA 1X8LA 3T7JA 5B53A 3DTNA 1DZIA 1XJCA 4QTZA 4H4EA 1QO0D 2O7RA 3EOBI 2P9HA 1QGZA 3OF5A 5HMLA 3WWOA 5TJHA 2I3AA 2CVZA 1PGPA 4JI0B 4Q37A 1BA3A 5T67A 1MQ8B 2YYYA 3U7QB 3ZE6A 4RK6A 5B12A 1GAQA 2C99A 5KYWB 2G0TA 1JE0A 4OXNA 4LGYA 5E9AA 3P71T 1JHRA 2OQVA 4AT1A 3SMQA 3KYBA 1D1QA 3QH4A 4P2BA 3QI7A 3SQOA 3S55A 1OSNA 1EKXA 1SVWA 1NNEA 4G8DA 1OE0A 5I7WA 2ZJBA 2HF9A 1T2VA 2ZDGA 4IG4A 5DYYA 2V9ZA 4YXFA 1KI6A 2OD9A 3UAOA 3AKZA 3IKVA 1NN3A 4TL9A 2VQSA 2CNWA 4QDXA 3BMCB 1RW4A 1E79A 2XBUA 4DIKA 5I8PA 4W1RA 1E0KA 4I6EA 4CF4A 1M76A 3HLTA 3TDNA 4G25A 4HR7A 3UCXA 2BE9A 3A6ZA 4I3FA 4E46A 1DEHA 3IAS1 1SVIA 3KQMA 1Z68A 4IOKA 1CW2B 2FDXA 4LS3A 3IQHX 1K97A 1RC8A 2P9QA 1YH3A 4HAWA 5EJ5A 3H9UA 5K3BA 3HO8A 3HCDA 2CEAA 1B43A 3C3AA 4WLFA 3I9MA 1K9SA 3QVXA 2BFEB 3EOAI 4C7JA 3VKWA 2NO0A 4CI9A 5BV2P 2JFFA 1Z7WA 3KKPA 4LG1A 2W70A 4TSFA 5IUKC 1MO4A 1YXMA 2ACWA 3CCBA 1CUIA 4C21A 2X6RA 5LL6P 4NZ9A 1OAOA 3OP1A 4I9HA 5IUNC 4R81A 1L7EA 1N6NA 5F9HA 1XU7A 1MV8A 3R5FA 1SXJE 3BMCA 1EDZA 2IZ1A 3HRHA 1EVKA 3PA6A 2VDRB 3UC9A 3NGMA 5BYKA 4CETA 2ZB8A 4YUWA 1RXVA 1U3UA 2HL6A 1QBKC 4FEEA 5I7VA 2X0JA 3Q3JB 4LXGA 1XX6A 1YB7A 1KS9A 1WZUA 3PC4A 1L1QA 3EUAA 4F5YA 1I1QB 2OAEA 2Q0SA 4FFBB 2H06A 2B34A 2F17A 3EG9B 4GG1A 1MO6A 4Q16A 4UW9A 2ZI3A 5IXJA 4RZQA 5K8UA 3R3YA 4QTXA 2FRDC 3C3CA 3FPKA 4M8LA 2HB6A 4YECA 2WWIA 1T9BA 4BMZA 2C2GA 4B3CA 2FRXA 1Y9ZA 4DBVO 4UHFA 1YS2X 5JC1A 1PR2A 1FP4A 3DAHA 3FOFC 1ZITA 1Y3FE 2IYSA 1AB5A 2WRZA 3MPUA 4RTMA 4DKJA 4U2EA 4H7FA 1QHFA 1J00A 3AUAA 1FDSA 2Z4RA 3KE8A 1K0FA 5T5QA 3FI0A 4B48A 1CUYA 4KU4A 2O23A 1ZSVA 2RARA 3DMDA 1KU6A 2LZ0A 4AECA 3I52A 3NC4A 1RJ9B 3D3WB 1LW7A 4KJXA 1X14A 3BGVA 3WO1A 5GJBA 4QAQA 2W6MA 1QV6A 1R4NA 1PGQA 2V7WA 3CUSA 3HACA 4J1TC 1S3FA 4W7IA 1KTVA 3UUFA 3WYAA 5AW2A 1MNAA 3FNFA 1L3IA 1A5SB 3NV9A 4D9JA 4DWOA 1ZHOA 1YB6A 3TIGA 3PFIA 3SBOA 5TMBA 5HS6A 4YY3B 2IZ7A 5DHFA 4G0OA 2E21A 2XUPA 5HILA 4YV1A 1YC2A 2LRHA 5FLXA 1ESCA 3GOHA 1H2FA 3ND9A 3WL6A 4L9SA 3KOUA 4C29A 4OMDA 1PNQA 3ZXIA 1PSZA 3E23A 4JP3A 4ZAYA 1K6EA 1G8AA 3NHRA 3EGDA 2PKXA 2QW8A 2HRRA 1B15A 4RGVA 3VO1A 4MROA 4NZPA 3H6GA 1BZYA 4TXMA 1IBSA 4KR9A 5KVCA 5JMOA 3OQOA 1PR5A 3ZKAA 4HATA 4KPUA 3SM3A 3U5TA 1QWSA 4R9SA 4IIFA 4RS3A 3Q8KA 4NYIR 4GP9A 2A3RA 1H93A 3KHTA 4LRXA 4MRAA 4EYOA 4N1AA 1TQ6A 3AILA 1TTTA 3A2MA 1TECE 1ZOIA 4UMDA 5B2EA 4KXNA 4OSOA 1X15A 4AF8A 1XA4A 3DONA 3OOJA 2G67A 5JLJA 3FGPA 4FDMA 5M29A 4DHEA 5EQDA 2C9CA 3WIVA 3DSRA 3BA6A 4XWTA 3KJEA 5KDOA 3C16C 1XZAA 2DBRA 2GZ3A 1BWRA 2XAUA 3LZCA 3A7EA 3E1KA 2IYQA 4XIYA 5M7EA 1OJLA 3S81A 2B37A 5CTAA 3F8TA 1KYTA 3NAGA 5JWHA 1YI1A 2WAOA 3K5PA 4X3OA 3S2GA 1XO1A 2R4UA 4N9QA 4B73A 1P39A 1CP3A 4C4PA 3A36A 5T64A 5FTMA 1TZ2A 5EESA 2ZVJA 2ZYUX 3LY8A 3GNLA 4M88A 4XEHA 3RSZA 5LDHA 4BAGA 4DY6A 1KO7A 4KIFA 5FUBA 2CCKA 3LWZA 3ADDA 3EPJA 3O6VA 1Z2CA 3EIWA 3ORRA 1Y7HA 5EIEA 5K0TA 3DAGA 2FR0A 4CMGA 4XARA 3ZWMA 1DOHA 4IHJF 4DBLE 5K45A 1GZSA 4NSNA 1Z6YA 5C1OA 1QMGA 5AW1A 2AFIB 1TUIA 2JAUA 3DFMA 4YMLA 3S5JA 5FJJA 1O95A 1GTJ1 4MV8A 1FVHA 2R48A 3PD7A 4B8YA 4BNDB 4ZI7F 1T6XA 4ZRNA 4YS6A 7REQA 3NPMA 4NP6A 1Q0TA 3CU5A 4UNNA 1FLDA 4HYEA 2WAAA 3UVEA 2F00A 4V0OA 3P52A 5F35A 2R2AA 1SD1A 3UUGA 2ONKA 3RFXA 4LY6A 2V9PA 4YRLA 4AY6A 3NYRA 4UVDA 2QMZA 1JPJA 4DV6B 5ESWA 1PVOA 4BNKA 3KXDA 2AMJA 1KRHA 3CKLA 1YDHA 2IU3A 3LS2A 3QE4A 2HIGA 5ALFA 5EJMA 2D6FA 2X19A 1E3EA 1LNZA 4JIMA 4A0RA 1B42A 3TI9A 1PDWA 3K70C 4OMUA 1TEHA 3KR1A 1PJTA 2CLLB 2A94A 1S3IA 3BGDA 3EW7A 4X7RA 3MINB 3HK2A 4FSXA 4WXRA 3HN2A 1E3LA 1BDIA 2NACA 2ZCJA 2ATIA 2A59A 1G7RA 3P2IA 4NAVA 4R68A 1K89A 3WJAA 4URWR 4WXMA 4Y8VA 2TMDA 1XKQA 2R5FA 3IFSA 3F7TA 1N6RA 3HEAA 2VP4A 3O1HB 2XIQA 4NMHA 1GCGA 1UJ2A 1A69A 4QJIA 4XX0B 3WWPA 3EXHB 4EQZA 3EVZA 2R65A 1ISIA 2BVNA 1R12A 3I37X 3V1UA 4QA9A 4D9NA 1IPEA 4Q4DA 1E96A 4JBXA 4K9QA 4QPDA 2Q2OA 2QJTA 3AVXA 1GUYA 1JV2B 3B2QA 3NC0C 3H2HA 1M67A 4QLBA 3DPUA 2OCKA 2ZAYA 2YBEA 4HWTA 4Q03A 2H85A 3QEMB 4MITA 2PPVA 2F3UA 2XNJA 2CDBA 4URYR 4CL0A 1GDTA 1RJ9A 1Q0HA 2AD1A 2WYIA 3D3WA 3HWRA 3NORA 1Z5OA 4K28A 5G0WA 3SC2A 5GQSA 4PC2A 4G85A 4DA0A 9ATCA 4DR2B 2HT1A 1IONA 2PVPA 2QGNA 4OB6A 3UHJA 5BW5A 4ZQBA 3O8OB 1GZ4A 3SZOA 3E15A 4DREA 5FNVB 1JYFA 5JAZA 4WZBE 1OGJA 5L6LB 5DWDA 3LCCA 4WK0B 2XNDD 1IUKA 2B0JA 2H5EA 3KSMA 5CLHA 3S99A 4P58A 3HJTA 1G20A 2VA9A 5ECGC 2EU8A 4GECA 3AINA 1GP2A 2B2NA 2VAXA 1PJZA 2XMPA 4R1OA 1CU1A 2WHEA 5PNTA 5DYNA 3VPXA 4DJDC 3ISJA 2X0NA 3HZZA 3VZCA 1Z74A 1IEWA 3R4CA 4UCFA 5K0SA 3VU8A 4M7OA 1NV8A 4MCJA 3T61A 1UDXA 3UV3A 3AWDA 3R20A 1ZN8A 4UM8B 1BU8A 3LWNA 5DASA 4B32A 4EUFA 3V5NA 5K01A 3SQXA 2WQZA 2WBLC 2VYQA 1E5XA 2BSXA 1O97C 3D8UA 4AAYA 1NT2A 3PRJA 1J0EA 3Q7EA 4UU0A 1OI7A 5LQRA 4L9AA 1WZ2A 1BOFA 1PQUA 4WFJA 3K1AA 1IY8A 3DHYA 1X8JA 1EGMB 4OGLA 1S8NA 3AP3A 4R16A 4H77A 3EQ8A 5AJWA 3JD4A 1CD5A 5AM5A 3MUNA 4KRXA 4LHXA 5F7JA 3ZU2A 4DCTA 2HHJA 3AHDA 2VYND 1G17A 1QDUA 3WIOA 3MJFA 2CV1A 3DV0A 2ECPA 2XH8A 2BCGY 3L0IB 3LM8A 4N01A 721PA 1XZEA 1Z6QA 2EF0A 3IBFA 3E3MA 3E84A 1RYMA 4HOYA 5M2QA 3PPIA 4JQZA 4CLRA 3OCUA 1NKSA 2PWBA 2YTZA 3G0OA 3U6BA 1NVMB 4TXHA 1UFRA 2PEYA 3QPUA 1Z6TA 1VDMA 2IY9A 3OQHA 3CTPA 2Y1FA 3M1YA 4LYGA 3TM4A 3ZWXA 5HZGA 1YR7A 3GT4A 3MJEA 3PJRA 1U2DC 1THMA 3NHPA 4QUKA 4YAFA 3BPSA 4UOZA 1KPGA 1DIHA 5GP1A 1PJ8A 3OHPA 2OCXA 2YFKA 2E9SA 4M76B 1F3OA 2Q3MA 4CM6A 1PR1A 3U3MA 1H8EA 4IKOA 2VHEA 3BGSA 3P0RA 1BGXT 3BZWA 3OIFA 3MOSA 3NAQA 2I6SA 1S2LA 1U1FA 2QSUA 2XE6A 1F60A 4IDGA 3HQ4O 3O8NA 4B45A 3W7BA 4X84A 3FOBA 1P7CA 1HNNA 5GAJA 1LK0A 1AQUA 4NPCA 4DLZA 3WLOA 3CX8A 1I36A 5SZHB 2R8ZA 2B7CA 4Q6WA 4AKHA 1VDZA 3GB9A 5FBVB 1P3DA 1PNOA 5KHAA 1IJBA 1ZH2A 3FM9A 5ENZA 1M0EA 3H3XA 4LK2A 3LVFO 1QIMA 1SBQA 2CMKA 3QYFA 2AUMA 1V3VA 4M86A 5ECWA 2CVOA 4IDPA 3LCVB 2EL9A 5JYBA 1M2NA 1W6RA 1WQ3A 1ISMA 3U2QA 2GS9A 4UXHA 2M2IA 4LCBA 1YO6A 1NBWB 2NZVG 3AVUA 3ND6A 3O92A 5TVGA 4CEIA 1V4VA 1VGRA 4ZDKA 3ZDRA 3WYNA 4U9UA 1Y8CA 4L7QA 3VH4A 3I9JA 2LBPA 3ANNA 3DOOA 5AXCA 4XW2A 1G38A 1FYEA 1TQHA 3BCSA 4B3SB 4INJA 2FGKA 1KZYC 2V7VA 3O9MA 1A5AB 3OHMA 4P3NA 5BSTA 4KO8A 3T1OA 3JALA 3HCFA 2QNIA 4BNGA 1XRJA 2FMXA 1M8GA 1W87A 2A7XA 4E2WA 1E4EA 2GZMA 2O2IA 2NO9A 2AOUA 5DZSA 5EZYA 3FMIA 1QUFA 3FG9A 2R1TB 1OMOA 5GY7A 4DBLC 3VPGA 2VHYA 2KLHA 2ZSFA 5LMNB 3RSFA 2OHOA 4OHRA 2UV8A 3N8NA 4XWOA 2VHZA 1WHTA 3W6UA 2XQKA 1U7ZA 3H2SA 4TTVA 3IEUA 2YXNA 1Z0ZA 2Q1WA 2RHHA 3OJWA 3PICA 4ZAZA 3SLRA 4E21A 3EEQA 4KFCA 3COJA 3JD2A 1A9RA 1GOTA 2FFAA 4FFOA 4GUAA 1E3SA 1W2GA 4DLKA 4YALA 2TMYA 4DUGA 3DB1A 4HFMA 1AQJA 4JR1A 3MMSA 3L1HA 4MV7A 1G8GA 5AHRA 3S1SA 5EZQA 1SK9A 4BL5A 4HRAA 4JEMA 4C9BA 2ZRCA 4BJ3A 3D43A 1RKXA 4E5DA 3SX0A 3W2EA 2F8SA 4HSEA 3U49A 3O95A 1EWTA 4RVCA 3REFA 1Z63A 2XBMA 3K1TA 5KNCD 2IOYA 3CIFA 4HRVA 3JATA 1QDEA 1J5PA 4FFLA 4ME6A 2YZ2A 3T4EA 3GP5A 3BAZA 1R8SA 3A6DA 4PIPA 1YIDA 1JHVA 4Q19A 3AF0A 3QVTA 4Z2AA 5HOQA 1OZFA 3RPEA 3FPBA 1MBZA 2YJ4A 1NN0A 4XJTA 4BN4A 3UNXA 4D1YA 2IEZA 2WLTA 3EGIA 4BN0A 5MF6A 5T7BA 3ZPXA 1EEHA 3NBQA 4RZUA 5CT6A 3LHFA 1GRQA 4RH1A 2Z9CA 1ZM4A 2HNAA 4RULA 1L7VC 1TCUA 1JLKA 3LNTA 4XVCA 4QDTA 1FFXB 2ZIVB 3DL4A 3WJ7A 2X3FA 4R01A 1IHXA 4DR1B 1H1DA 2V4MA 3JD1A 5J59A 1GKKA 3OPMA 1CUSA 1BQ3A 2CLIB 4H17A 4MW7A 1W36C 5E6UA 1RQXA 1AGPA 2I4IA 3G2OA 5A7GA 5HYVA 1A5ZA 1IVYA 1O8CA 4C0LA 1NBME 1VCNA 3F9CA 3C4QA 3LK7A 4NONA 5MFZA 2B1JA 2ZKIA 1RXWA 3OWXA 3THYA 2A0KA 1I3MA 2GLTA 3R5SA 5AM0A 3RU7A 4ENVA 1R1DA 3P0EA 4URUR 1K6IA 4JL5A 2XKJE 3TSOA 1TU3A 3GDGA 2POQX 4ODIA 1JA0A 1SAYA 2P75A 2RGBA 4BQOA 4CYMA 3K5HA 1EA5A 1LF0A 5FX2A 1GPLA 3IDQA 1KY4A 2I6QA 1LJLA 4P0PB 3NNDA 5TS3A 5J9FA 1FSFA 3DUFB 5AK6A 1MOPA 2QLMA 4FKMA 3U9SA 3I01A 3H11B 4TLLB 4YPVA 3SKXA 1P7WA 1UPUA 5H16A 2OBXA 3P0IA 4IH9A 3E70C 4PZCA 4YCCA 1GQFA 1F4LA 1E5QA 1W48A 2XWQA 3IDFA 3NYQA 4BYGA 3QOWA 2ONJA 3RSSA 1YNSA 4IBOA 4IJMA 3FBTA 1X1SA 4ENQA 3DDWA 2C7BA 3KE9A 1H2XA 4I5FA 4ZT2A 4AO6A 2HXYA 1RRMA 3MAJA 1O6FA 4O8CA 3PGVA 1ENZA 3UJBA 5LJLA 4CF5A 1MPXA 1XTKA 3D7NA 3B1YA 3VMFA 4AKTA 1HE3A 1LLUA 5HHTA 3B9RA 3AY0A 3LG2A 2ONZA 4HEA6 2AW3A 4CF6A 2WNHA 4IV0A 5KVSA 5IS2A 2FZ5A 4UM7A 3W5VA 5LQCA 1YB1A 2RGAA 1L5RA 2ZSKA 3SFZA 2AB0A 3X0DA 4N0PA 4RNCA 4DTIA 5EMNA 4D2IA 6NULA 3A14A 1AU9A 3GOQA 3GLFA 1U9IC 4JUFA 3PUKA 3VPDA 2HDWA 2BFPA 3FRHA 5LFAA 4XSGA 5ICFA 5LP1A 1YQWA 3REGA 3H4TA 5BOSA 3F6BX 3ABZA 1L5SA 2BTOA 3PGMA 2JLXA 1UBGA 1EP9A 4F1KA 1QHNA 2PMCA 2V3VA 2EFDB 1MJHA 3TUIC 4B6JA 1NP6A 4B85A 3TQHA 2BTQA 1MCZA 3K53A 1SZJG 5CYFA 1FU7A 1IG0A 3AM5A 4PFQA 3S2FA 3HHPA 4HLNA 2HMSA 2F43B 3IVCA 4QULA 4ZRDA 3OQNA 2I0FA 3MJ4A 1LW6E 4K87A 2GO1A 3NT5A 3LXMA 5AVUA 2XB4A 5JQGA 1Z39A 5DPMA 5KTTA 2PXCA 5LJIA 2HSJA 2GSDA 1F2VA 3JQ7B 5EOVA 3AVVA 1WZIA 2CXTA 1EZ1A 4M21A 1PT6A 2QUKA 1IN6A 2OFOA 4H7EA 2CFIA 1GCIA 2QD5A 4BFCA 1T4BA 5K0ZA 2ZQYA 4LSZA 4O2AB 2UUBB 1WSBA 1TAQA 1L8XA 1GADO 1JZSA 1YVDA 1DO0A 2YVLA 4M83A 3MS7A 4HH4A 1C3EA 4GGPA 2ZWOA 4FGKA 4OQPA 4L95C 3DDSA 3V97A 3D6VA 4PFJA 1I4OA 1LK5A 2HO4A 5LKRA 4P86A 4M9CA 5FTJA 2F43A 3JXEA 3QXGA 1HFJA 1ZL0A 4JLSA 4KPGA 1XRMA 3PUWA 4JYPA 4QHTA 4R1QA 3RVRA 1KHTA 3OJ0A 4Q15A 5A4KA 2VDMB 3CCFA 5DV9A 3EGDB 3PNLA 3PNVA 4TLBA 3PGJA 1BS2A 4MGIR 1V16B 4Q9HA 3T38A 1BE0A 1H2RS 1R0LA 3KEGA 4XIGS 5ALNA 4I0WB 4KREA 4EHIA 4JVSB 3SSOA 3RYHA 1L4KA 1E66A 4FP9A 3UWSA 3FHCB 3UAVA 2HLHA 1G19A 3BRSA 3MBKA 3O7MA 4R51A 5AVXA 5JHGB 1RQ2A 1EHYA 4LYYA 4YCDA 2J48A 3UT0A 1E32A 2JIDA 2AVNA 4B5KA 1JH9A 3AI1A 4RIEA 3IO3A 3OSZA 3ADKA 3BCHA 3TLMA 3SK0A 2G7MC 2GX6A 4PSCA 1E8NA 3UAZA 2PUVA 4O4HA 2QLNA 1LS6A 5IAKA 3RC1A 3V80A 4REQA 4LYEA 3S2SA 2X4GA 2K7ZA 1CUBA 5AOVA 3C5VA 2VR1A 3LDGA 4KB5A 2NZ8A 2MTBA 4D6PA 3PC7A 2ZRHA 1CB0A 3FNEA 3LC1O 4YA6A 2Z2JA 5JE8A 1KQFA 1G60A 4GPZA 2C7OA 3W3AH 3WRXC 1GQRA 3HR8A 4LPKA 3SQDA 2W9XA 2G72A 3G8DA 3IEKA 1E9DA 3RS4A 2QD1A 4ZVVA 2D3WA 3GUCA 5EHIA 3E2MA 2HJGA 5JU6A 3O9ZA 1OLSA 3IKJA 2B98A 1E1CA 1KPIA 2F6RA 2H4WA 3J7AC 4EY3A 1V4NA 3OIWA 1W29A 5BSFA 1CZUA 4OHCA 4ARSA 4ND5A 1XA0A 1C7JA 3UUWA 5L8VA 2A5YB 3AEYA 2PX4A 4IJKA 4R2XA 3SDSA 5AVQA 4DUZB 2CYCA 3WRVA 4KSBA 1SA0B 2DWCA 1XCMA 4LOHA 5ALMA 4O0MA 5AR1A 1CUFA 2Z3VA 4B7UA 1ZNQO 3KC2A 4YJ2F 5KI6A 3R24A 5A02A 3KQOA 2C5EA 4DMUB 1DKMA 2E4XA 2H65A 2HQBA 2RHWA 3K9HA 4LOLA 3LWDA 2Q1TA 1XU9A 1ZJYA 1K27A 3EXFA 1E59A 3AR9A 3O03A 4IIYA 4NFHA 1RAHA 4BC0A 1NW8A 1P8AA 3BF8A 3DZJA 1JE1A 4DMMA 1CHDA 1R3DA 5FPYA 1PT8A 1FPMA 3W7AA 1EK6A 1DBPA 1E3QA 3I9NA 3KKZA 1ENOA 4Z1MD 5FPHA 2FB9A 4MUBA 4OMFG 5HJ7A 2YV1A 2YS7A 4AQDA 2V8BA 1HKUA 1I5EA 2CZQA 2QQFA 4HD8A 1ECLA 4E07A 2J33A 3WHPA 4AKSA 1RLJA 4FD3A 2RJNA 3B1JA 2FWRA 4OOFA 2MIIA 2WJ6A 2OO3A 5AKGA 3THWB 2BN4A 5AK3A 4DMCA 2HF2A 3EPRA 3HP7A 2QG9A 4NF2A 2XUZA 5FB3A 3RV4A 3W6PA 4BKUA 4FFVA 3UAWA 4MV0A 2DBVO 3SYLA 3HV2A 3NHUA 1N5IA 1PJ2A 5DMXA 2PCJA 2OCIA 3JQRA 3ZHYA 1L5OA 3UFBA 2I3ZA 1V1JA 3C6ZA 2HCTA 4BFWA 4BKQA 3ITKA 3EZNA 4I55A 2VAVA 3N7TA 2Z98A 4MVCA 3IKTA 4ND8A 4BMNA 4J91A 5F73A 3RASA 1SQ6A 1XVIA 2Y68A 4O4HF 4YHBA 2MDTA 3ZLUA 3DVAA 5DTJA 2O3JA 4PAWA 2IIBA 2PRYA 3ZY2A 1Z6PA 2I8CA 3N39C 4CKCA 1T0HB 3B1ZA 4YIHA 3HUTA 4DM3A 2G9VA 1JNXX 4FEAA 5ALKA 2YJ5A 5HDBB 3BREA 2EW1A 5G0VA 4KN9S 1NWHA 2C9DA 4PN3A 1TO2E 1IOWA 2ZI7A 2WE8A 1XD9A 2XT6A 3GJ0A 3IHWA 5JNSA 5LUAA 4JI8B 3SP1A 3HHEA 4XRGA 1E99A 1W59A 2AXNA 3KWLA 4NL4H 1P5ZB 2GK6A 4QOGA 1W52X 5FWYB 3BFJA 4IF4A 5EKSA 2YRWA 4P83A 1MO5A 1HYGA 1KYZA 4TRJA 2PGJA 4XTRA 4EO7A 3DE3X 1W47A 4ND8B 1FMFA 1QPZA 3QG1A 4Y2TA 3EC1A 4II7A 1GU1A 4I1RA 4O4JF 1NL3A 1PZGA 3PHIA 2SNIE 5DM1A 4YNBA 2OKCA 1JAXA 3QF7A 2ETVA 5HFNA 3KLMX 3TQRA 1ODFA 1AGNA 3CO5A 1N7IA 5EUCA 4EGQA 1DWPA 1HH4A 1ZVJA 2ZRKA 1U7HA 5LMUB 5EZSA 3PFHA 4UHDA 2I4TA 3PWTA 2LIVA 4C0SA 3DMRA 1OXKB 2AS0A 4WT7A 1N5OX 3DD5A 2JFBA 3DEFA 3M70A 1XXHE 4TT8A 5BRAA 3HC7A 3RUFA 1DDGA 2AN9A 1QXSA 4W5RA 3TL6A 4OAOA 2R6AA 4D8XA 4F8YA 3VKGA 1HTTA 4JP8A 4CKBA 1CQJA 1OV6A 1WPRA 2F90A 4M60A 4JC8A 4GFDA 3MTIA 1U0SY 2Q3HA 1EHIA 2NX2A 3JVEA 3KZXA 2HGSA 4MVJH 5U4QA 4IGFA 1XZMA 1QYDA 2P8SA 1NQVA 2YASA 4IILA 4Z4HA 1D1SA 4NWIA 1LLFA 4OGKA 4YDHB 4QM6A 3INNA 3KQKA 4GE3A 3ZCSA 6Q21A 2GHRA 4RPHA 1GU7A 3W2TA 3A10A 3TLJA 1ZHHA 5G3YA 2VTBB 3NTVA 1T5SA 5L51A 2XAAA 5DM70 2FNAA 2IEYA 3QYAA 4XCXA 3HDJA 4HVLA 3I72A 3L0OA 3E5NA 3L0CA 3L1IA 3TSAA 1UJNA 1B0ZA 3LZDA 1K3UB 4PGAA 4LAFA 1V95A 2HRBA 3F6EX 1U2ZA 4LXUA 1X7WA 2YZ7A 3KDPA 5D7BA 5K3FB 4KR2A 4G2NA 4Y0NA 3AY3A 3VTKA 1G7CA 2YS6A 3GGOA 3D8HA 2EC5A 5AOCA 4DV1B 2H18A 5D5PA 1J4AA 4PYLA 4Q66C 1MAWA 4Y9RA 4YP0A 4ZVMA 3GRZA 1D2EA 3VYSB 2AN5A 4FBMA 2Y05A 4BLWA 2Y3IA 4D5GA 3JV7A 3MQFA 4P7KA 2NXWA 1Q14A 1T8UA 2UYOA 4LV6A 4ZCIA 3IP6A 1U2PA 1Y1QA 5G40A 1OQAA 1JVBA 2MSNA 3E9ZA 4OQDA 4AQYB 4LSMA 1JZTA 1XOIA 2H17A 2IKSA 5I4IA 2GAIA 2BM1A 4KXLA 2MR5A 4BE7B 1U8EA 1B2RA 1CUEA 2NG1A 3CZQA 4NE2A 1ZVKA 3DQZA 4B2YA 2GETA 1HLGA 1KI4A 1NJ6A 3HB4X 5J2TA 1XEXB 5M5BA 2WJGA 1LRKA 4WN9A 3FDZB 4DCSA 4LBWA 1RQLA 3V33A 2P1ZA 2XNHA 5EIBD 1WMSA 5F33A 5HKBA 2Y67A 5MN4A 5LPNA 4HDNB 2HPHA 4MWBA 2IGBA 1J09A 2FFQA 5BV1A 1EX9A 4I50B 3SXUB 1WPGA 1J8MF 3AUJB 3LK6A 3N2IA 5H83A 3MMZA 1P8JA 2DSNA 1TKRA 4DB4A 3HU3A 4RD6A 3WL4A 1O6GA 2JGFA 4QXMA 4BZXA 5EFOA 4E4RA 1Z08A 2P69A 4EHBA 4ZOLB 3FKQA 5K9ZA 1T5LA 1C9KA 2GJ8A 2OZEA 4UJ3A 3UK6A 4AL4A 4HNUA 4Q4AB 2EJBA 3PZBA 3HJRA 4MKHA 4QBKA 4TYQA 1KY5A 3HADA 1HR0B 4QGHA 2NPOA 3LE8A 4BFZA 3R7AA 5AQ1A 1T2DA 3BJZA 2HTFA 4NZZA 3SYNA 3AQ4A 1N75A 4YJFA 3T3PB 3L2OB 3QZUA 3QUAA 3MTEA 2A0XA 4X8HA 1Y82A 5ER9A 3J81k 5LMZA 4MKZA 4RTOA 3V2UA 1GLGA 2OFFA 3BMNB 3T35A 2E82A 4JL8A 5EE5B 2Q99A 2SKCA 4K88A 2GESA 1W94A 4URFA 2EP7A 4MXDA 5K3EA 1RP7A 4JU8A 4DLUA 4NMMA 3L77A 3E1GA 3PC6A 2WF8A 2QXYA 2ZANA 3UJPA 1CJCA 4ECAA 4ZQGA 1MFZA 1DG3A 5BWMA 4HWGA 4LPSA 1US8B 2W2KB 4RDCA 5LZ5A 3T94A 1E5TA 1W4BA 4W8GA 2EKPA 4YQEA 1S7CA 2FZWA 2ZCUA 5BVHB 5A4JA 4RVHA 2DQYA 3AP1A 4O4LA 5U1PA 1N2EA 4WCFC 2NUAA 2QTNA 1TF7A 5FA6A 4NLLA 4PSUA 5FNZA 2IBTA 4M8IA 1AZWA 3BE8A 5AVYA 5DW0A 1KO1A 4RPLA 4D26A 1GVNB 1J99A 5A2QA 3GJ3A 2ODTX 3IO5A 3A4NA 4G84A 4NTZA 3V2HA 4C0BA 4RCZA 2G7ZA 4BO1A 4TQAA 3ROZA 4RXTA 3LNCA 1Y33E 4TYPA 3WLEA 1UMBB 2JHFA 2WT9A 3RRZA 2OK8A 5LIPA 3VR0A 2D5CA 4HQ0A 3V9AA 2IPOA 2EZUA 2WKPA 4JB2A 4HP8A 5CT4A 4QOJA 5C7LO 2FZCA 2JAPA 1T13A 2IVZA 3ZWWA 4OBWA 1SN7A 5DBHX 4LNHA 4EENA 1VA5A 3ESDA 1E9AA 2IS1A 2O52A 2QUIA 3F1LA 3RQSA 4EJSC 2PQ2A 5IABA 3KZ1E 3V8QA 2CZGA 3EGCA 3PX2A 2NVUB 2M6KA 4PQRA 5E6RB 1QYIA 4ROSA 4GI3A 3EYAA 7YASA 1QYCA 2VI5A 3E3OA 4PLTA 4LOJA 2H0AA 3L0YA 3TIXB 1P1JA 4ASUA 4B4VA 4B3HA 4F8JA 3UW3A 3PPXA 1C7EA 1U3DA 2IVFA 3QXSA 5LXTB 2EKDA 2FHPA 4RMJA 2BGRA 1KFJB 2XGJA 3L05A 2I1WA 1DUVG 3X1KA 4G09A 3OPXA 4NZNA 4QFBA 1PZNA 2WC1A 1VE9A 3AR5A 4GDFA 1EFRD 4TL7A 3ZI7A 4CIWA 3CWZA 3NALA 2ZIWB 3OFSA 2XB8A 3PHJA 2C5AA 4AYWA 2CBGA 1NWCA 3ZC3A 5DBIA 2PEZA 3I1IA 1DFGA 2AJCA 4RJIA 1FMJA 1NP7A 4B46A 5BSHA 4NG4A 2D7CA 3N2YA 3BWBA 3N8DA 3TQTA 5LQJA 4F93B 3JQGA 1ACLA 1U2SA 4V0ME 3WR5A 1I01A 1N5JA 1T2NA 1JG7A 2CUNA 2VSYA 4FZJA 3ZXUB 3A25A 1ZMXA 4A3SA 1FZQA 3L40A 3WYCA 2JVIA 2CLHB 2R8BA 4WFKA 4BZQA 1TW3A 1ABEA 1Z75A 4K9OA 1Z4NA 3IS3A 4DAOA 3N58A 3N53A 1ILWA 1CY2A 2ORED 3PCRB 3OZFA 3RYIA 1QHGA 4KZPA 3SAJA 3PNKA 2ZBEA 5F23A 2C5BA 3GGCA 3MMPA 1DO2A 2C4MA 3OU7A 4QEDA 4RSGA 4EYGA 5JO0A 1K98A 1X7YB 1TK2A 1A4UA 3B1WA 3TG8A 1WUJS 1TTQB 1I2MA 3G2HA 4GWGA 3KJZA 4X64B 1JHAA 1LQ2A 1QG0A 1U0HC 3PIDA 3PUYA 1LDEA 2FSUA 2OFPA 3NKFA 1S96A 1FBTA 3H84A 1U94A 3D4PA 4Z51A 3BIJA 5CA1A 3D8BA 1H3NA 4JOBA 5DX8A 4ZGGA 5LR6A 1SUEA 2O6HA 2D8MA 4QG7A 3REQA 1OLUA 1ESMA 1H9AA 1M6VA 3QELA 2XEXA 4PZUA 3O38A 1IH8A 1K0UA 1NKTA 4U2DA 1EGAA 5KVVA 4TL8A 5MHTA 1E1MA 3QTLA 2DAPA 2QVZX 1BFKA 1SXJC 1JEYB 2ZWPA 1K7SN 3OTHA 1H4QA 1MJ5A 4DIUA 1VKJA 4ER5A 2B5VA 1UPFA 4D56A 1XNGA 2JLWA 3K4PA 1RR6A 1U28C 5KHOC 1U2TA 3K9QO 4K2AA 3W5DA 2P3OA 4IDHA 4MKXA 3GA5A 4L0DA 2IP2A 4Z0NA 3SSMA 4CL3A 3CLVA 3X1ZA 2X2FA 1DIRA 1E58A 1RQRA 2G9NA 1XJQA 3DLCA 4FNMA 4DXDA 2IS6A 2ZVPX 3AHJA 4WNYA 3RKRA 2AYZA 4AJ4A 4BRSA 2O9JA 3WIUA 3NYIA 4NULA 1RI1A 3JYNA 3GD7A 1XQ6A 2Y1LA 1F5NA 5ECYA 3NJ8A 2A0FA 1T26A 2E6KA 4EO9A 3AMVA 4YJDA 4B4UA 1DBVO 1G8FA 2FEPA 3HKDB 5BSWA 4JGIA 4TKVA 3ZQJA 4AURA 3HJUA 4MIEA 1D9ZA 2QE6A 6REQA 3R7NA 4ALKA 2I65A 3V1YA 1L8LA 1JIJA 3T7TA 3P0HA 4C4OA 1PR4A 2V6IA 4J4BA 4RX1A 1CUGA 1TADA 1UL1X 2FLVA 3K35A 3RRFA 3GQVA 1UAAA 1ONBA 3MJVA 3IH5A 1X1CA 5CT9A 2RHDA 3GWGA 2AK2A 4NCKA 4UE3S 3SF0A 4AMYA 2ZYDA 1JL3A 1EM6A 2PGNA 5F1KA 3GPIA 4GPTA 4ARZB 4MYSA 4J0GA 4WDRA 4XQCA 1W0CA 1G0NA 3WKAA 2WYUA 3AFNA 1RACA 3GROA 1RVV1 1JQEA 3CH5A 2HNKA 1AN0A 3F6PA 2BPOA 1GWNA 4YT5A 3ZDAA 2DHDA 3L0PA 4FKZA 5IDQA 1OU4A 5IAGA 2GD6A 1E2GA 2FVXA 4L9RA 4BUCA 2PGXA 2FOIA 1AXRA 2ZAIA 2NVUA 4TXLA 1A9OA 1SB9A 1TTPB 3AO0B 3CB4A 3KFVA 1YTUA 1KSFX 1OD6A 3P9IA 1C0IA 1BRMA 3I64A 4TV9B 4G5YA 4ZVOA 3B13B 4IQ4A 4REQB 2J0UB 5JS2A 5G4LA 4LGMA 1I3LA 4KQKA 4ABYA 1QCZA 2L19A 3DW1X 4MGKR 4AUMA 5HM8A 3FNRA 5BXQC 4G0VA 2D1RA 3BICA 1KAGA 4L5YA 3E9MA 2PR2A 4JBHA 4RDIA 5AMXA 2XT9A 5CFRA 2CK3D 3FOCA 1W30A 4BO2A 1Z0JA 2WHYA 4EGAA 2ZJ7A 5IFLA 4RZSA 1IM8A 4HDRB 3K31A 1M2KA 1YKFA 2O2SA 5LP6A 4YO7A 3U81A 5INTA 4ZVTA 2EBHX 1O54A 3KKOA 2C7RA 1TQ4A 2AOTB 3UFXA 4HJRA 4B8ZA 1EFPB 1VL0A 3EDRA 3L6EA 3RLFA 2X4DA 3OPQA 4MWTA 4QEKA 1C4XA 5FNVF 2UYHA 4S24A 2F4VB 1NVDA 2W8ZA 3ZV7A 5L3VA 5AO9A 4C0QC 5B3JA 1K86A 1T9ZA 3RKUA 3QEOA 4MR9B 5CT8A 4J9VA 3G9ZA 1R15A 1Q1AA 1ZOOA 2AI2A 4GKVA 4QQNA 1R4MB 4MUJA 3HU1A 2DETA 5IJXA 1PUIA 5EHQA 3LVQE 1BYUA 4HEJA 4MJ7A 1B93A 5A5FA 1HL3A 1RZ3A 4TWIA 4WX2B 4ATNA 2FG5A 4BRZA 1VG8A 2AXPA 3CEMA 3N2KA 4IJWA 4EMTA 2JK1A 4QRIA 2BRUA 5DHAA 1V1MA 4LISA 1NUPA 4A2WA 5EZ6B 2WHXA 3DHVA 3QVOA 1T1IA 2BOVA 4RVFA 1BJTA 1YS6A 2VAWA 3NTUA 1JIVA 4G5RA 4MRPA 3TKAA 1TYZA 1WIWA 1M6VB 1JHDA 4K05A 1SCKA 1EFHA 3IAAA 3INYA 4N6OA 4ETMA 2VCHA 2PQMA 4KLZA 5CVUA 2B4TO 5CDGA 4WKGA 1FYWA 2GPNA 3RS8A 1PFVA 4N7MA 2HJHA 2PA3A 4R41A 3NOOA 4KPUB 4BQEA 3DFFA 4YWJA 4BASA 2PCLA 2GEVA 2QZ4A 1OAAA 3GCZA 2GEBA 1KZ1A 1EH5A 4YRNA 4FE3A 4EA9A 4YT8A 2Z9BA 1JEAA 2BHLA 5GJVC 3EVBA 5KC8A 1S8AA 4G9BA 4MW1A 1MA0A 3NVKI 1MORA 1TT5A 3VZQA 4P81A 5GOTA 2PUDA 1QC5A 2AF4C 1BG6A 2CHVA 4QU5A 2VP9A 3QQ5A 3AGPA 1JEDA 4ENTA 5BY2A 2V8OA 1AKWA 3W2GA 2O2JA 4Q39A 1J8DA 5ALDA 4WNAA 4CGYA 3L02A 1FSGA 4R8LA 3KT0A 4M4SA 3A4IA 2FTKE 4MHOA 5FFMA 3T12A 2UZ3A 4Y6SA 3KSRA 3W2FA 2C2KA 1Q12A 2EG5A 4Q12A 4F4DA 3W06A 1D6SA 1T5BA 1SCUB 4UTPA 2P6UA 3L5OA 3ZCPA 1P9WA 5JZ9A 2JFXA 2ZBRA 2I6FA 3EZ7A 5BMVA 3R6TA 2DGDA 3FBWA 1USIA 3BWMA 5T4BA 3ONVA 3T41A 5JLAA 3T9CA 2FWIA 1E1QA 2JBWA 4NEQA 2GF0A 5DTIA 1NVEA 3AM4A 1XDDA 2HJVA 1NVTA 2OCBA 3H6HA 2P9ZA 1AKQA 4QQRA 1N0UA 1AGYA 2YXDA 3GFFA 3ZWPA 4DSTA 5KSZA 1E6WA 1USWA 4YQZA 1M2JA 4FYMA 2OCDA 3IE2A 3TTTA 4EBBA 1XMVA 1YDWA 4YCMA 2PAAA 4L27A 3N2NA 2C4NA 2IOQA 3GLVA 1BRTA 1YCHA 2Q7XA 1NZJA 1CIPA 2FHSA 2IUUA 5IKXA 1NURA 2RKOA 2PJZA 3AR7A 1N4DA 2WFAA 2WSLA 1NUTA 4HNSA 2IX9A 5E7QA 3AH8A 1MC4A 1NC3A 3ICOA 3CNBA 4NOJA 1C3XA 2WF7A 3RUCA 5C8VA 5HK8A 1UBOS 1Z5NA 3K8QA 1ABBA 4NNOA 5IZCA 4Y6LA 5C35A 5TDHA 2XVZA 2F1HA 3C97A 3JYOA 1RWVA 3VVMA 3GLGE 4QPCA 1X77A 3UAGA 3UMBA 1W0JD 4IP0A 4K9RA 2NO7A 3EEIA 1N2BA 1KOLA 2FEXA 4R1LA 4TS3A 3H5AA 4RY2A 4JCOA 5EIHA 3DG9A 3PJFA 1QG2A 2O0LA 4OXXA 5CNIA 3VXKA 5A4MS 3K0SA 4X63A 2QRZA 2QWXA 4TTAA 1H6CA 1DCFA 1OW3B 2J1LA 3M5WA 4YCAA 5DEOA 4JKYA 5LP6B 4Z7QB 1KVRA 4KFTA 2OC9A 3O9VA 1A2BA 1HDIA 3OKCA 4BJHB 2QF7A 2V4ZA 1O87A 1R5OA 3WGUA 1YFKA 3GUYA 3PUIA 4BV3A 4UNQA 3DMPA 3HKEB 3GDHA 1T2CA 4EM6A 3U13A 4L2IB 2VK4A 1OXUA 3GGDA 4ILEA 3AF6A 4QRHA 3B3JA 1PN3A 4ZYYA 5DGXA 5EVCA 2BJHA 5DT2A 2E87A 1DAHA 1CX9B 1Z4QA 3DP9A 3DXFA 3GFPA 4A15A 2WWTA 1UXKA 3K05A 1NVAA 3LUJA 2F1JA 1LDNA 3SBEA 2VLIA 3KQLA 2FPIB 2TMGA 1I3KA 4ALLA 4EVQA 3EZXA 1XYVA 3FZGA 4KAAA 4JI1B 2DFNA 2UYGA 3MJCA 1O0BA 3BF7A 2GRUA 4XDGA 1RYFA 1TIPA 3OIUA 3QWIA 4E0BA 2H59A 2Z6QA 1V8DA 2VF5X 3I9LA 3SEZA 4BQPA 4BY9E 3KTOA 2HD4A 5K1ZA 1NVGA 1QIIA 4YX9A 3G0BA 3PEVA 4UBLA 2F8MA 5EIOA 2BSQA 3A1FA 1FYVA 3CX3A 3ODGA 4JT8A 4IV8A 1Y5LA 1CY7A 2FW1A 3K94A 3EMKA 3WGQA 1O57A 5B7NA 3DYVA 3VVCA 1R0BA 4L9WA 5U4XA 2GM9A 4YJGB 2VTDA 3RIXA 3INTA 1HOXA 1FTSA 1WKCA 3U7HB 1Y8RB 2EZ8A 1AKVA 1R7RA 3SE0A 1QTNA 3O8BA 5K0NA 2C07A 3ZY5A 2QTTA 2ZDHA 2FPIA 4G97A 4GLOA 2QR2A 4IS2A 1LVGA 1E1KA 4GAEA 3GGPA 1K4MA 1NW6A 1SUBA 3F8WA 3DLIA 5HGJA 2OYCA 3N76A 3CH7A 3V4RA 3QK7A 1Q57A 3VNUA 1T5IA 4RKRA 3JWHA 1J2TA 2O1XA 3HXLA 4PHHA 4MTCA 4CE6A 4IAOA 5AVKA 4CQLA 3OZUA 1KZ7B 2DSTA 4ERXA 2XZOA 3A4TA 1KJ9A 4PCUA 1DAMA 1L7RA 3H0KA 4QC2A 2NLOA 1Q7RA 3BKWA 3FPJA 5DNAA 4D9FA 4PLWA 4H4CA 1WCXA 4F85A 2WMYA 3VPBA 3H2GA 4CN8A 2FZ4A 1T2UA 1EU1A 1Z47A 1C4WA 1T4CB 2FPPB 1C1DB 3FRIA 4FDVA 4NI5A 5JCJD 3LPAA 4LXXA 2YNMD 4MUKA 2WD7A 4YRBA 4ALJA 1XMJA 1GFSA 2ZWMA 3K0EA 4HAUA 4UAUA 4QATA 1AUVA 4EVSA 2BTEA 3DL7A 4IFTA 1OLXB 2VDPB 1JKJB 3GQBA 5M3BA 1WB5A 2SKDA 3BK2A 5CBKA 1KRWA 2PZFA 2Q2NA 3DBHB 1YZUA 2WOOA 3EBPA 4NYJR 2Q4EA 2FQQA 2KHZA 1FQKA 1X19A 2QT0A 1LI5A 3RC8A 3UMSA 3P9CA 4KG7A 2O2ZA 1DC4A 1GA1A 4RKYA 1JR3E 1MEJA 1M3SA 1XVAA 3ADCA 2QMOA 3HN6A 3ZGOA 4YUXA 4RS4A 3ADOA 5KIAA 3H1AA 2F1IA 1FP1D 1ZVVA 4EVIA 3KT6A 2ON6A 2JIOA 3NHMA 1N92A 2X0EA 1P44A 4K6FA 4Q47A 1ZC4A 5DM2A 1JXMA 3QKIA 2GNAA 4JFAA 4YXWD 4QPNA 4QM7A 4RD3A 2Z2KA 2QSZA 4FFSA 2F3SA 1JEOA 3FVQA 3PNYA 3LOPA 3FTQA 5IPFA 5EKTA 1KSJA 2TECE 4MVJF 2RAFA 1KEPA 4W5HA 4HYTA 5EYPA 3I6ZA 3IRUA 2CNOA 4KQGA 5BNIA 2ZM5A 4AF7A 2HWUA 3AT1A 1D2NA 3L0SA 3TB6A 4MP3A 5AT1A 4FYYA 3C8DA 4BRUA 1B8NA 4L57A 1GJRA 3A27A 5AI6A 4GC5A 4PQEA 4ZWNA 3WRYC 2XHZA 1HFEL 1MG5A 3L1VA 5GPBA 2GYUA 3GEBA 3HZRA 4U3JB 2C2HA 1TM3E 2UZ1A 1CULC 4IIJA 4G23A 3GPBA 4I7EA 2VPYA 2JZNA 3PTZA 4M37A 4YRPA 3ZIDA 4DLNA 1AKRA 1KMMA 2X2PA 2X6TA 1TZJA 1PZEA 1HG1A 1TJ5A 2O1WA 3K9LA 1LPAB 3BERA 4BAZA 3UWOA 1Z25A 2ZATA 3OTOB 2AFHE 2XLBA 4QTTB 2IZ5A 1WSWA 3TUJC 3I5XA 2XD9A 3JTEA 2ZTUA 2E4YA 3RVNA 1AXEA 2AG1A 2OK7A 2RGEA 3V4PB 2XMCA 3GMDA 1SBNE 1S8OA 2IIQA 3KQSA 2OPBA 4UUMA 1FRVA 5CGZA 4C1NA 4DLBA 1GSIA 2A0WA 2TRSB 3GC6A 1U9CA 3RUEA 2YCBA 4B6SA 3D1VA 3T7AA 4OJQA 1LFAA 1TL7C 1WHTB 3WYEA 1AUPA 1G4UR 2W43A 3NETA 4BU1A 2H1CA 3CNLA 3KQHA 4CWAA 4C78A 1IBCA 3MYYA 1C1HA 3LQFA 4HB0A 4GNRA 4FGSA 3HLYA 3E6AA 4IGAA 3V2IA 4B7CA 1P31A 5K8LA 1DWOA 3VYTB 2BGMA 5K99A 2Q6KA 2VKTA 1YNOA 1P7ZA 5ARDA 4XE5A 1BXKA 4OUKX 2YXBA 2GARA 1ZM7A 3T7CA 1IMOA 4NENB 3VZSA 3EAGA 3U56A 1EA7A 4AZ0B 4HX2A 3RVPA 5G1PA 2I55A 2ZSHA 4OG2A 1FQJA 1GCUA 2VK2A 1XXHA 5AK5A 1RAGA 3FVVA 5H3CA 4NOKA 2WTAA 3C6XA 4FX2A 1I1OA 3R9XA 3DE0X 3NOQA 3OZXA 4EJ2A 2WR8A 1PFYA 3JATB 2JHAA 1MC8A 2ZK7A 3RTCA 3NIDB 3X1YA 1VLVA 1OA1A 3PRHA 4H0CA 3W5BA 1MC5A 3MCUA 1E0SA 2P2CA 4G1BA 5A6VA 5HUHA 5IKEA 1J2EA 4XX1A 2E55A 1GTSA 3IJPA 5LQSA 1YK0A 1OYWA 3KB2A 1ZN2A 3NASA 4QPZA 4C6RA 2I3GA 1XNQB 3WSTA 4ND4A 2NQ8A 2SICE 4FDTA 4ZJZA 2OQ2A 4RZ2A 4Q3LA 1CRPA 1FZTA 2P9TA 1XXHB 2BFNA 2VJCA 3QTTA 1JWBB 5ERGB 3TIIA 3S6JA 3FPLA 5KAPA 1DOZA 1Y5MA 2IEGA 3V4FA 1ICIA 1EMDA 3LU1A 1GNSA 5GONB 2C1EA 3UPTA 2JGNA 3NCHA 1B1CA 5IAEA 2ZKLA 4DLLA 4C4TA 4PZYA 2DFDA 3F9RA 3TSYA 4TLEA 1JFFB 3KSZO 5CIQA 4AJJA 1W8DA 3UWKA 3LDAA 5E1DA 1JBEA 1DEAA 1NQWA 3PUJA 1RP1A 4KP7A 1DLIA 3H5NA 3WMWA 5HUQA 3KZKA 3A6FA 3JQ6A 4ACAA 1TVMA 2J7KA 3B48A 2B7LA 4JHXA 5DP1A 4HMQA 4B4WA 4K46A 5H3HA 1DJQA 3GX1A 1BAPA 1O08A 3I2YX 4FINA 4R3WA 2Z3ZA 1ZVMA 3RQIA 3SPXA 1W5AA 2I33A 2OG2A 4GVLA 5JDIA 4MMXB 1FRQA 1G63A 4UD2A 2IS4A 1VLLA 1D0IA 3U7GA 3GVPA 1GAXA 1Z6GA 3KUXA 4CCAA 1ECFA 1Q0PA 3AEUA 4I9NA 4OJYA 3WL5A 4EMSA 1E62A 2YOGA 3G02A 1SU4A 2I4OA 4FZ5A 4LTNA 2PLNA 3RAGA 4ACBA 4B87A 1PS0A 2YCLA 5KQLA 1P7PA 3ICCA 1YL5A 3MVEA 3QWFA 2FMTA 3M5PA 3ZVMA 4MNTA 2Q6IA 4BNXA 3SIRA 4QYIB 2PFSA 1GNQA 1VPVA 4YMIA 3A9CA 3AG6A 2ZW9A 3AW9A 5CVVA 3B2EA 5C51B 1K3TA 2G17A 3R2JA 1M6YA 3K20A 3GJSA 3RIGA 4RV9A 4KHPB 3ZDYB 1X87A 4YT4A 4CTNA 1QBGA 1KAHA 1QGUA 2EOAA 1FP2A 2QUZA 3WDSA 1AS0A 1C8KA 1G20E 2AJTA 4TRMA 4ZI5A 4DCUA 5I6DA 1A9XA 3NTXA 3DE4X 2GDJA 3TQQA 1OVGA 2A1TS 3AEUB 1NVVR 3HB9A 4LCEA 1PKXA 4O5AA 1NRXA 1GAWA 2L17A 2G9RA 4FMDB 4TTIA 1USKA 4Q1AA 1WD7A 4E2ZA 4RIIA 3ZJVA 4UZEA 3G6WA 5FI3A 1JH8A 1G9XA 3B6ZA 4MPPA 2BELA 2E6UX 3P4UA 2RIRA 4PPYA 3NW9A 3ZBUA 1XNHA 2FUEA 3JZFA 4IDEA 5JBIA 9ABPA 2JFNA 1YZYA 4RZXA 3ELBA 5IKOA 2JK0A 5AVTA 4UDXX 1T1JA 4OK6A 4DY4A 1E94E 3C3JA 1CUVA 4B47A 5GADl 2DPYA 3DLAA 4QU0A 1EG7A 1VFNA 2GZDA 3GEGA 3J7TA 3LBFA 4G0PA 5F7XA 1MB0A 1OXXK 1FDIA 1YUNA 4YAJA 5KCMA 5CCXA 4UOEA 4EKIA 3E81A 2HMAA 3ZGNA 1YC5A