4QPJC

2.7 angstrom structure of a phosphotransferase in complex with a receiver domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
120
structure length
120
Chain Sequence
GSMRVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGIDLGKLYDYDIILLDLNLPDMSGYEVLRTLRLSKVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIHAIVRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphotransferase
publication title Structural asymmetry in a conserved signaling system that regulates division, replication, and virulence of an intracellular pathogen.
pubmed doi rcsb
source organism Brucella abortus
molecule tags Signaling protein/dna binding protein
total genus 41
structure length 120
sequence length 120
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qpjC00
4Z99A 4MS1A 5TQJA 1S8NA 3EQZA 1PNRA 3OMWA 1QQBA 3OM1A 3KJXA 4Q7EA 1VRVA 2IDMA 3MF4A 1T34A 1U2PA 4LDZA 2MYUA 2FTKE 3RVRA 2H0AA 4N47A 5KQLA 4W5OA 4Z4IA 4F3TA 4JB2A 4CBVA 3O21A 5JS1A 3GBVA 1EFAA 2FQXA 1TJYA 2QZJA 4LE2A 1APBA 4W5NA 4KZKA 5TPWB 5DGCA 2V0NA 4KMRA 1L5ZA 1YS7A 1DG9A 3HS3A 3MIZA 3MA0A 2L2QA 3O75A 5FWYB 2IPMA 3VNBA 2E4UA 2LBPA 5KQMA 3DGEC 1YS6A 3KYJB 5CNMA 5B3JA 5TPZD 5FWXB 4MS3B 5JNRA 2HJ9A 2M1ZA 3JPWA 2LUOA 1Z2EA 4P98A 4Q6WA 3OQMA 5EWLB 4Z4GA 1TVMA 4ZYLA 3OLZA 3OM0A 1FSPA 4D6YA 1DRJA 3T95A 4KNYA 3LFTA 3HUUA 1XHEA 3N8IA 4MPTA 4RXMA 3VNAA 4RXTA 2RJNA 3C6QA 1SD5A 1FFWA 3O2QB 3OLWA 3S99A 3I09A 4L4UA 3HDVA 1C4WA 4G0OA 1R8JA 3LTEA 1GCGA 1BAPA 1JL3A 2CHEA 9ABPA 3IP5A 3CKMA 1MB3A 3O2SB 4MQEA 5C5CA 2PUAA 3CG4A 5HQJA 4N0PA 3A3KA 4H3HB 2NZUG 2IOYA 1YMVA 1OXBB 2WJWA 4RY9A 1U0SY 2JCGA 3O74A 4IMIB 3NNSA 4YGXB 2VYCA 2TMYA 3GBPA 3RVNA 4F06A 2H3HA 1YK0A 1QNLA 2LPMA 4MS3A 5EWJA 4UHKA 1J56A 1U2QA 3RVOA 1MIHA 2WMYA 1QMPA 4LX8A 3MMNA 4XXHA 3N0WA 2CWDA 2E4VA 2MSKA 2YHBA 2PLNA 4OLAA 2MYTA 3LUGA 1VLZA 2QU7A 3GWGA 3BILA 3M9XA 4OATA 1NXPA 1JBEA 5DTEA 2OENG 2OQRA 3H6HA 3HZHA 1Z12A 5CNJA 3NHZA 3RQIA 5DCLA 1TM2A 1QO0D 5JNVA 2A9QA 3DLHA 2QV0A 3I5AA 5FBKA 3RH0A 1LBHA 1VKRA 2B4AA 1LK0A 3G85A 3JY6A 2PE5A 2PUBA 1SXHA 1NATA 1USIA 2L18A 2MYNA 3HJFA 4XLTA 4P1ZA 3IPCA 2FEWB 4NICA 4G0ZA 4N76A 4N0QA 3KLOA 1YVUA 4DN6A 2GI4A 3T6KA 3FFWA 2J48A 3HM9A 2X7XA 4EYQA 1Z18A 2L17A 4XASA 4S05A 5IUNC 2FN9A 4MRMA 3DLBA 1L5YA 2PL9A 4F8JA 1QP0A 5JNTA 1XHFA 5CNIA 3D8UA 3E3MA 1NXOA 3EJWA 4KRFA 4N03A 4N41A 3GYBA 4LDAA 4G86A 4MQFB 4EYGA 3EULA 3RVKA 2WJAA 4B09A 4WXEA 2P9HA 1UDRA 4YP9A 4W5RA 3M9WA 2E4YA 4LZLA 2ID9A 3HDGA 4JASB 3NHMA 1DZ3A 1Y1LA 1RXEA 1DP4A 4WT7A 2R25B 1LJUA 3GRCA 3LKBA 1VPWA 4OLBA 4JOQA 4OTZA 4Z0NA 2CHFA 3I42A 4IF4A 5B3JC 3TD9A 4YLEA 4TLLB 3BRQA 2FLKA 1WETA 1M2EA 3QLTA 4JP1A 4HYEA 4RK7A 1Z26A 1NY5A 2FMHA 6CHYA 4HNSA 1A04A 2RGYA 2GKGA 4RY0A 1KMIY 4PEVA 1P8AA 4W5TA 1USGA 1ZITA 4YR7A 1DCFA 4MQFA 1QKKA 5KC8A 5ED4A 2JK1A 5IBQA 3JVIA 2FEPA 1ZY2A 1D5WA 3RVLA 3N6VA 4F12A 5KWSA 5IEBA 3F7NA 2E4XA 1JDNA 3OO0A 5IEJA 2PL1A 5HKOA 1YK1A 4RXUA 2FQYA 4QYWA 4RWEA 4ZMRA 4KFCA 4MGEA 1NTRA 4O1HA 1EWTA 3FMVA 4MS4B 3EQ2A 3TMYA 2IYNA 4PZ0A 4L85A 1TLFA 1Z15A 1Z2DA 2RJOA 4QICA 3UUGA 3DBIA 4HNQA 4QPJC 1MAVA 3HEBA 2R48A 3Q7SA 1HEYA 3GT7A 1E6KA 2IPNA 3JPYA 5JNSA 3JVDA 2PAFA 2NT3A 4KK3A 2WWVD 1PEYA 4NCBA 1TMYA 5TPZA 2JRLA 1DBWA 5E3JA 5HM6A 2JBAB 4IMJB 5BRAA 3QK7A 3B2NA 2LIVA 2BGGA 1ZHHA 1DCMA 3MYYA 4ML3A 1NXVA 2P4UA 2NUBA 1DC8A 4FE7A 5TPWA 5JNUA 1JDPA 1K68A 1Z25A 2AYZA 1ZH4A 4OBBA 4EVRA 3HV2A 2MSWA 5DKFA 5FWYA 4G0QA 4EYOA 4MS4A 1PNTA 4E7OA 1USKA 2XDYA 3G1WA 4Z9BA 5BQ3A 1JX6A 2IPLA 1GCAA 5FWXA 2PUGA 4IGAA 3BREA 4MAAA 1BDJA 3MM4A 3NBMA 5EWLA 2FSPA 2N9UA 1NXSA 1U8TA 3QEMB 3T38A 1FFSA 3EDCA 1EAYA 2DRIA 3CLKA 3LUHA 4QYMA 4H60A 3GA5A 1GUBA 3LKVA 2F8SA 1M5TA 2R4QA 1D4ZA 1P6UA 3H75A 3RVSA 4PE5B 2HQRA 1EHCA 4PICA 2FW0A 3A10A 5KI6A 1SXIA 2A9PA 3RVPA 4RK1A 2KYRA 2ID7A 4RS3A 5BRJA 1F4VA 3N0XA 1ISSA 3K4HA 4YV7A 1JFTA 2FN8A 5KQPA 5JS2A 3URMA 3TB6A 3H5WA 1D2AA 1DCKA 1BA2A 1ZGGA 3A0RB 4ZJPA 4LE1A 1DJMA 3SQNA 5TQ0B 1QO0A 3SNKA 1JWLA 3OMXA 5DLEA 2PUCA 3OQNA 5D2CA 1P6QA 2ZWMA 3EGCA 2MSLA 3KTOA 2RDMA 3QELB 3H6GA 4O1IA 2M98A 1P2FA 2GX6A 5CNKA 3QEMA 3FFXA 1E6MA 4LRQA 5EWMB 4YWHA 4D74A 4ETMA 1KRWA 1PUXA 3N53A 3C3MA 1DRKA 2JB9A 1JF8A 3JS5A 2B1JA 4RY8A 5GQSA 3NNDA 4Z4FA 5BR1A 3HUTA 1AB6A 3HVRA 1CEYA 2IKSA 4TMYA 4KREA 2IPAB 1QP7A 2HQBA 2FVYA 4MR8B 4XARA 5IUJC 1QP4A 2R47A 1D1QA 1RNLA 4MR9B 3ILHA 3CFYA 4MS1B 3LOPA 4XAQA 4RKRA 4F11A 1H9CA 1Z17A 4KQ9A 3UK0A 1GLGA 2QSJA 2E4WA 4GPAA 5TQ0A 5GOTA 3HSYA 1RZRD 3DGFC 2JVKA 4YS6A 3O2JA 3F73A 3Q9SA 3EODA 2JVJA 5HSGA 3KHTA 1QQAA 4ETIA 1PEAA 2A9RA 3LUKA 3LUAA 6ABPA 3QELA 1NXWA 4EVQA 4FE4A 4MLCA 1JYFA 4LE0A 1BVHA 5JNWA 2I6FA 4Y9TA 1LBIA 2PJUA 5PNTA 1E2BA 1D1PA 3C3KA 3N0RA 3H5VA 3T8YA 3A0UA 3L6UA 4KK4A 4RK4A 3LUCA 1F51E 3LUJA 2PKXA 1ABFA 1A2OA 3W9SA 4TN5A 2PMCA 4G0XA 4RV5A 3I45A 3H1EA 3ILYA 4WXMA 4RK5A 5IUKC 2HPHA 4NV3A 1SXGA 3LUDA 2FMKA 1DBQA 1W25A 2F8TA 1EWKA 3QX8A 3C3WA 3H5TA 2A9OA 3R0JA 2JVIA 3KS9A 4Z4CA 3IDOA 3P9YA 3CRNA 3CU5A 4Z9AA 4G0MA 1C0EA 5CHYA 1ZESA 4IILA 2HSGA 4MYRA 4YCSA 4MQEB 3QLUA 3CZ5A 4G0YA 5T3YA 4WZZA 2QXYA 3M6MD 4G0PA 4RSMA 5ABPA 1YTUA 3H5LA 4KQCA 3TX6A 4WUTA 4RK6A 2QR3A 3QLVC 3EAFA 3OO1A 3E61A 5TQ2B 4EUKA 5KC9A 3Q7RA 3K9CA 1IIBA 3JTEA 3HO1A 2QVGA 1ISRA 2E4ZA 3KCNA 4GNRA 5EWJB 1ZAYA 1PHRA 3H5IA 1JHZA 1RXIA 3Q15C 3SAJA 3O1IC 2FEKA 1Z16A 1ZGZA 1AB5A 4TLMB 3L49A 1M5UA 1ZN2A 3KSMA 2LP4Y 3Q41A 4ZPJA 4MR7B 3SY8A 2WY2D 3UKJA 3FGZA 4ETNA 3OLXA 1ZH2A 4Z4HA 8ABPA 2W42A 3IP7A 5IX8A 3OQOA 3NNNA 3Q7TA 5C5EA 3CS3A 3IPAA 4S04A 2PUEA 3LUFA 2FMIA 2Q5CA 2WB4A 2JBAA 3QLVA 3HCWA 1NXXA 4KVFA 3HK2A 3CG0A 1SRRA 5TQ2A 3HXMA 3ROFA 4NCAA 3GL9A 3H1FA 5F64A 3LMKA 3CTPA 1JFVA 4RDCA 4YO7A 3BRSA 4MLDA 2QW1A 3BBLA 3H1GA 2FMFA 3CNBA 3H5OA 4MRMB 3KKEA 4RK0A 1BDHA 1CHNA 1NXTA 3FDFA 4W5QA 1ABEA 3KYIB 4PYRA 2ZAYA 1JFSA 3SM9A 4DADA 2HQOA 1LJLA 2WRZA 3IP9A 4YRZA 1JLKA 2FKAA 2GWRA 4MR7A 7ABPA 4EVSA 2QVCA 4E7PA 1ZDMA 1K66A 2PUFA 5I4CA 4JB0A 5IC5A 1DBPA 2NZVG 3N75A 1ZVVA 3O1JC 3O1HB 1M2FA 3MQ4A 4Z4EA 3TO5A 2NT4A 4D6XA 1YMUA 4XFKA 1KGSA 1B00A 4ZMSA 5KQGA 3D02A 1QPZA 1I3CA 1Z13A 1JYEA 3F6CA 5TE9A 2O20A 1YIOA 2FXIA 2VUHB 4KV7A 2VK2A 4EY3A 2L19A 3C97A 3F6PA 5IULC 4OG2A 3ROTA 4HNRA 3QEKA 3DZDA 4WWHA 1URPA 3IP6A 1MB0A 4RZSA 4JAVC 4FB4A 4EGSA 4NQRA 3OLYA 1RPJA 1W9HA 4Q6BA 1U04A 1KRXA 1OXKB 5T7BA 2PUDA 4EYKA 1FFGA 1XWWA 3CZCA 3KG2A 4G97A 3OLVA 1MVOA 4IRXA 3RVQA 1JH9A 1E6LA 5EWMA 4DQDA 2VUIB 4O5AA 1A0OA 2YHAA 1DC7A 1GUDA 3RVMA 3QLUC 1RZRA 1FQWA 4UHJA 3RVJA 4H3KB 1BDIA 2FQWA 3FFTA 3CHYA 4JA2A 3SG0A 2FLWA 2MYPA 3KLNA 2CD7A 4MR8A 4RKQA 2AYXA 3GV0A 2GBPA 1EWVA 4KPYA 3QX9A 4M88A 4MR9A 4RU1A 5FBHA 1CYEA
chains in the Genus database with same CATH superfamily
3G82C 2MU1A 3CMMA 3RSFA 2REQB 3REQA 4K9NA 4AM8A 4JI8B 3CONA 3FD8A 2FX3A 3GVPA 2IDMA 3N8GA 2X8BA 4L02A 5BSFA 1JAXA 3TL3A 4MWSA 2H0AA 1E1CA 1M1YA 1JFFB 4MB6A 1L5QA 1N1MA 1Z5PA 4V0ME 2J9FB 4DCPA 4IF6A 4CBVA 2QLFA 3NIWA 4IO1A 3G88A 3KTFA 1EFAA 2JIPA 2YJNA 1OFUA 1S7GA 1WUJS 2ZJ3A 3C3PA 2EW1A 3GHHA 1QHEA 4WTOA 4Z8XA 1DG1G 1Y5NA 1MV8A 1HDOA 5FWYB 1KI3A 4BLOA 4H1HA 4P5PA 2ACKA 2C7OA 5K3SA 4GUDA 2QIOA 5CNMA 5AVQA 3WGNA 5FWXB 1PG2A 3OZSA 2HJ9A 4C4OA 1R9GA 1NJ1A 5DF1A 2EGHA 1TOAA 1E5QA 3L92A 1LI4A 1BCSA 4AX8A 3QKSA 3R9IA 4B9AA 4D8XA 1ACMA 5JARA 2AXQA 2YOGA 3T95A 1KR5A 3L40A 2XDQA 4W9RA 4B48A 2QBYA 3O94A 4PX5A 1YACA 4BNTA 2Z43A 2Z3VA 2QSYA 3TZHA 4EG1A 4ER5A 5GJWC 2H48A 2WLTA 4I9FA 1ODTC 3D5EA 4EJMA 1DS6A 4E30A 1AZWA 3LCCA 4RE6A 5JSFA 2I2XB 4BECA 2JGIA 1TVCA 4QUGA 4UE2A 3GLFE 1VJGA 5IM4A 5DBOA 2QE6A 1MABA 3FB4A 1J7JA 2PX4A 1XRMA 1EFDN 2XKBA 3HA7A 3PEVA 5E6RA 3LLSA 4EL5A 3VZDA 5FV4A 3P2KA 1A72A 1QE3A 3D8SA 3WV5A 2P2NA 5JVDF 4RTPA 3C4JA 5D3ZA 4K2HA 2GNAA 5LZ2A 2JLXA 2I91A 3DUWA 3U26A 4EAQA 1FC0A 2I55A 2O2HA 4N18A 2OVBA 3C87A 1K3UB 1L0BA 3VH3A 2OCBA 2JPDA 1VMEA 2CLDX 4M9UA 1ZYUA 3AONB 3I8OA 4RANA 4P3PA 4BE7B 4KN5A 3AIOA 1V96A 3JQ8B 4MGKR 1MIHA 4JX8A 1BXKA 1DKNA 1W1UA 1D2HA 1LBSA 2V96A 3AHFA 3MWDA 4ZGBA 1PWEA 1X39A 5E1DA 5AI8A 2BP7B 2MSKA 1OI3A 2AL7A 2A84A 1ST3A 3HNRA 5AK4A 3ZR4B 3B12A 4TUYF 4DZRA 1CUGA 2AC2A 1ZUWA 1ZHOA 1WQ4A 3BILA 3DOEA 1HDIA 3MJDA 2RK6A 3DTVB 5HKKA 4KRXA 4JT4A 4E3WA 4JJ4A 4WBXC 1JMVA 4BAGA 1N2HA 1SBHA 2PXCA 3DLHA 2EDAA 1F17A 3EHDA 4YCDA 1JAHA 1L7MA 3MB8A 1UOEA 4HJRA 4Y6PA 4F9TA 4HFJA 1E9CA 3Q5GA 2MYNA 5ELLA 3W9YA 3L0BA 1QLHA 4NMLA 4FS3A 3PNQA 2AHOA 2HBZA 1IG0A 1QVZA 4O4HA 2BE9A 1VYTA 5JOQA 2QKYA 1YBMA 4OQNA 5KTOA 2O7NA 2D4HA 1UWCA 2P68A 3KLOA 3ZX4A 3ZCUA 5F2EA 4F85A 3FFWA 1FVHA 3HM9A 1PK7A 5JYCA 4LVUA 1CFZA 1TTHA 2VHXA 2Z8YM 4XASA 3T35A 2QSUA 1JFLA 3PGXA 3U40A 1VYHA 1M66A 4KJXA 3I30X 5CNIA 4LC1A 3RC1A 1Z07A 4AJ2A 2NO9A 4NYIQ 5AJYA 1EUCB 4CLHA 4N41A 4FHCA 4WCFB 2MR5A 3UJBA 4LDAA 2G1KA 3H84A 3C8DA 4TXHA 4WAUA 4R0MA 4X8HA 3U4CA 4XVCA 2P9QA 4B0PA 3NT2A 2ZVPX 3GLHB 3KLBA 1M7GA 1U9ZA 5EE0A 2GBFA 2JFYA 4LZNA 2YWXA 4ZXPA 4LXXA 5GZ6A 1OLSB 3S2SA 3WGZA 4UU7A 4NBUA 3FCAA 2KBEA 4EFNA 5I7HA 1SMKA 2O8VA 2GO1A 2V7PA 4KO4S 4GRIA 2A7QA 3R8CA 4DW8A 3OX3A 1YB4A 3RNLA 2ORVA 3DZBA 3ZGLA 1TI7A 3JWHA 2WUGA 3JWGA 1Y4UA 4JOQA 4KGDA 4V0KA 3JRXA 4I6JA 4LQ4A 5AW5A 1NLUA 3U3KA 1BMFA 2PKQP 3GLTA 2WJVA 4EUEA 1A4IA 1BQEA 4C5BA 2PS3A 2QX4A 2OT3B 4D3XA 2ZJ8A 1TKRA 4J8PA 5D8DA 4RK7A 4DRYA 2XXBA 4D97A 5IF3A 2AR7A 1CVRA 2I3DA 3OHMA 4XDYA 1Q1GA 1EG7A 4GT1A 4U7WA 4P31A 2YZ2A 3ZLVA 1MHPA 3PQ3A 4QXMA 3UJAA 5CM2Z 5B7NA 1EUDA 1G8FA 2VHQA 4PBSA 2Q6IA 1EFVB 2E6KA 5JXGA 2QD5A 1JZTA 3IEIA 5LU9A 1WS6A 3HR7A 1UL1X 2BEWB 4QL3A 4ZO7A 3RVLA 2HRRA 5K99A 2VHJA 2HA3A 4N82A 2QT1A 4XEHA 4F12A 4FFBA 1JV2B 4KLAA 1JLLA 5JZ9A 1N9GA 5EMHA 5C8YA 4DZZA 5CEEA 3DE0X 3HU5A 1NP7A 4RWEA 4URHA 1SK8A 2Q5EA 1FY2A 3E9RA 4RCZA 2GASA 3WE7A 5FTKA 3B1JA 1JXOA 5G40A 1Z4KA 2QLLA 3A9CA 5DSTA 4AG5A 3ZH9B 4CL3A 4CIYA 1PDOA 3OZTA 4ND5A 4L85A 3N8NA 3A2LA 2VNAA 3EEQA 4KEAA 1RRGA 2IT1A 3MILA 5FPKA 4UBMA 2IXAA 5FYQA 3UUGA 1DCTA 3HVUA 3O4FA 3O8QA 4KI7A 4Q4AB 1GGMA 3QUQA 3ED1A 2E4AA 3PFFA 4LGCA 1UIMA 2BGMA 4NV0A 4WZBE 3RAFC 2ZBRA 3PPIA 3K9HA 3OPMA 4NU5A 3LZCA 2B0CA 4HEA6 1RHRA 1H4QA 2FDCA 2JRLA 2OUKA 3CKLA 4CF7A 2V7QA 1KO8A 1BRTA 121PA 2EQBA 4U8GA 5EZYA 1X38A 2C4UA 1I30A 2AKYA 4E2ZA 3INNA 3T5PA 3T94A 1U2TA 2QP4A 1OW3B 5TJ9A 3UQYS 4P9NA 4AIRA 3TRIA 2JFOA 3GXOA 4UZEA 1MLDA 5MFZA 3LLVA 3G3EA 3C85A 2I4OA 3BZBA 3SX2A 1FFAA 5A5GA 2WHPA 5EIOA 1ZNYA 5JVDB 4EVRA 4LYFA 2A2ZA 2XOEA 3AEKB 4YRQA 4MXDA 4H1WA 4TZ6A 3AFNA 3N70A 1QVAA 1Z5OA 2DHDA 3O5AA 5DHAA 5AI9A 5JJCA 2GF2A 1FX0B 3FG9A 3P71T 5H82A 3DMYA 4U7FA 1FMFA 4GBGA 3M49A 3PFBA 4IZOA 4IHAA 3ZWBA 3OEHA 4JXZA 5D87A 2QXUA 1XWFA 4ZZ2A 5GIOE 3V8EA 5EMNA 4BLSA 1FFSA 3EDCA 5G02A 2C97A 5IAOA 3DF7A 4QYMA 3NJ4A 1IJEA 3LKVA 4G36A 5ICCA 1M5TA 2R6GA 3WKAA 4BY9E 2FQQA 3WA7A 4TUYB 2BEVA 3FMGA 3LSYA 4V1CI 4YMLA 4B1FA 4Z53A 1DTWB 4NC9A 3P9KA 1B1CA 1ZL0A 4A1OA 1L3BA 4D3SA 3UMJA 3ICEA 2GNPA 3GLQA 2ID7A 3FKSD 1L7EA 3BJIC 3HY3A 2RH8A 3FBGA 4AZ3B 1V9LA 4B4UA 3K4HA 1INLA 1EKXA 3U3RA 4EGFA 1BVYF 3EDQA 1BOFA 4WOJA 1V7QA 2FCAA 4FBGA 4KXLA 5AW2A 1KK0A 1XL0A 3M8KA 5ALLA 4FYIA 1EK6A 1ND6A 3ITKA 1D2AA 4TS1A 3TB6A 4MCHA 1DJMA 4M9ZA 3MS7A 3SQNA 5BNZA 1JWLA 3M1LA 2C95A 1P44A 3OQNA 1SBQA 1WV0A 4JLUA 3HR4A 3CNOA 3BXFA 4RHUA 3QEMA 4UAUA 1FS6A 2AXEA 4RV9A 1A8HA 3ERCA 3STYA 1DIBA 3JZDA 4JJKA 4NNOA 2AMJA 2WNIA 1OFHA 2B1JA 3I9KA 3II6X 4QARA 1ZWLA 5T3UA 4Z4FA 2IZ7A 1Z6PA 4LGVA 4L5JA 3BWVA 1LPMA 3QTTA 2OOKA 2QW8A 4NMXB 2CVHA 3E84A 1SKBA 1LWNA 1SIUA 1IATA 4N3NA 2OB2A 4ATNA 1B41A 3WKEA 4HUTA 4G1MB 5FL3A 4UNQA 3A6JA 2BFCA 4W5WA 5FNZA 1XLUA 5CMLA 3K7EA 1J49A 4I99A 4KP7A 2QD4A 3ONEA 5LMZA 1AN0A 1EWQA 2GAIA 4HO1X 2B7BA 2CBZA 4IPTA 4Z0PA 1IUKA 2BGUA 1UQUA 3WGGA 5GOTA 2JZOA 4B3JA 3LDUA 1RXWA 2JVJA 1ZICA 2G28A 1FLNA 4IQ0A 5IJ0B 1TC2A 4EVQA 4KIFA 4FE4A 5IBRA 1E58A 1BDMA 2QUIA 2OECA 2V9CA 5EP1A 1XQ1A 2E5WA 3C7CB 3RANA 2HBQA 3FPJA 1C5KA 4J9UE 1CD5A 3ZU2A 1U3UA 3TZEA 1T3SA 3KOMA 3G0OA 3TRDA 1WMSA 1W2HA 2BAGA 3HEAA 3IR5A 4J7XA 3N2EA 1PN3A 1D0IA 1MH9A 3GZJA 4TMFA 3TLKA 3KFXA 3G1UA 3KZNA 4GZLA 1AU9A 4M36A 1DDIA 8AT1A 3U60B 4QOEA 2R68A 3AESA 3NBQA 1ZS9A 4HS4A 4LQLA 3ORHA 3S29A 4CT5A 2UYHA 2O5CA 3W9SA 3VHLB 1PCXA 4YCAA 2PV7A 3QVSA 4XGIA 5HCNA 4Z7QB 1VE7A 4P81A 1XZGA 2C61A 2XCLA 2XDAA 4P3XA 4PSCA 4Y1GA 4CEHB 5A2GA 1KJ8A 3KPUA 3NEYA 4KLNA 4ZU1X 4BNIA 3LS2A 4ZDIA 3GZTB 1FFDA 5IVKA 3MOSA 1E9SA 1KQFA 1YUBA 2ZIUB 4OH7A 3QEAZ 1PUJA 1W0JD 2C8KA 2P30A 3QPDA 1P73A 3MT9A 4RA6A 3DE7X 2R9VA 2W2MA 4DIDA 2O2GA 1DJLA 3ESZA 1ZESA 3EARA 4DWVA 1E6UA 3L04A 1PR6A 4CQMD 1GHTA 4YCCA 3M6MD 4KQ1A 5SY9A 4CKWA 1GNQA 3GLGE 4CODB 5LZ7A 3KEGA 2EAUA 1JEEA 1U28A 4PC7A 3TAXA 1UBMS 5HRUA 4PGFA 1CUAA 1NW6A 1Y8RB 2OSBA 1JXMA 3DT9A 1E3JA 4LAFA 1PJAA 1G38A 3JTEA 5L7TA 5LIRA 2HDOA 2YS6A 1US8B 1SUDA 4UHDA 2Y77A 2VJQA 4OBXA 1C4KA 2H92A 3MLBA 5F33A 1TAGA 1CRZA 2BFWA 1E2EA 3QVMA 4M8NE 1Y6QA 4BBAA 4HR7A 1W1IA 2FAXA 5IARA 5IW8A 2HADA 3ZVRA 4DSZA 1T2CA 5CFNA 4UOQA 4F4CA 1DJOA 1Z33A 3IRUA 3IKLA 3DL2A 3RYFA 2PXAA 3AZQA 4E07A 1FXWA 4A6PA 4FFVA 2VRNA 4LRSB 4PAOA 5EINA 4FXOA 2P6NA 4PLZA 3BJZA 5ALUA 2BGRA 3ILXA 4R51A 3BTSA 5IX8A 4BVHA 2W42A 4H15A 2FPOA 2GZRA 3C6KA 1CUIA 1NBOA 3DLPX 4KXUA 4MUIA 1RM0A 3DVAA 5AI4A 3D7KA 5P8WA 2EC5A 2EU8A 2VNJA 1QG2A 1U7UA 1ZP6A 2OG1A 5LCXA 1L7PA 4URFA 4BL5A 5CFZA 2FMIA 2IH4A 5HYVA 1E3TA 3KQPA 3QKTA 4YHBA 3NKVA 3ZVNA 1K86A 2R65A 5HIMA 1S3IA 2QR5A 5IVPA 5REQA 3DCNA 4J3FA 1A4XA 3W2TA 4AN4A 3AX6A 4B3HA 1AKWA 4UUNA 2R1ZA 2ECQA 2DQSA 3IAHA 2QM7A 3MQ2A 1IMJA 1JR3E 4YROA 4ETWA 1SU7A 5JASA 2VQSA 3FDFA 5IT0A 4DDWA 3VKGA 2OLEA 3QHAA 3FZYA 3DC2A 1AS2A 1UJCA 1DFIA 4YH1A 2FPIB 2YUTA 3KQYA 2ENWA 1IG3A 3RS0A 2BFNA 4PR0A 1DELA 4RZHA 4Z51A 1LDBA 3F8SA 3U0BA 3EWAA 1WLYA 4E1VA 4ZCTA 3MTIA 5EJAA 3GFTA 1S2IA 3UWPA 3FHTA 1MC8A 1RWBA 1XZLA 3HXPA 3I83A 5TVGA 4C7KA 2D2IA 2IBMA 4FUQA 4N12A 1KK1A 3LM8A 3GLFB 4DLSA 4Y6GB 3ROPA 5ES4B 4F71A 1UPCA 4R9SA 4BNJA 1II0A 1CS0A 4YV1A 3CE9A 3ZD9A 1BHJA 3GQVA 2ZB3A 4NPCA 2B9EA 4NZOA 4QRDA 3A1UA 4DRXB 2EJVA 3U7RA 5LC1A 2ADFA 2O3JA 4LJ4A 5L7WA 2ZT7A 4XYMA 4XE5A 3AWDA 4URUR 4FQ8A 1IJFA 4JXKA 4ZQFA 5ESDA 1G9XA 1A82A 4GBJA 5ES3A 2XB8A 2GXAA 4DNQA 2R7LA 4FYMA 4V1CB 3UH1A 4P3OA 4ZCSA 3FROA 2ORIA 1YCDA 5CG2A 1KRXA 3IYLW 2EYQA 3IEXA 2PUDA 4EFKA 4L16A 4F46A 4MOWA 3KG2A 1KARA 4PCAA 3SM3A 5E1MA 1Y8QB 3ZWKA 2I8CA 4K0RA 3ZK9A 1KO4A 2X22A 3YASA 1XNQB 1E32A 3A4TA 1CQZA 1GUDA 2P0AA 2VWGA 3AFOA 4OLJA 4J16C 2V0CA 4UHJA 1H5QA 2RGRA 1ZZEA 1C1XA 1F6WA 5ALSA 4CF5A 2DFNA 3ZLBA 2PNFA 3ER6A 4QBHA 1W85A 2AYYA 4DANA 2CXUA 3DZ8A 3URKA 2VDWB 1O3YA 4OI4A 4BASA 4TSRA 3KPYA 2W6PA 3AJEA 1DU4A 3BWYA 3GDHA 5CGQB 3UMRA 1VKHA 3UMSA 2OCGA 4INOA 4DC9A 2X0RA 3QE4A 1ENPA 3JQBA 4P0QB 4KXYA 4Q3NA 3AI3A 1OI2A 2EX4A 3OT1B 1CDZA 1ENZA 4JFAA 4BVJA 4DR1B 1OOEA 5FFNA 2ADOA 5T5QA 2RHGB 4LF6B 2CCKA 3GCWA 1J42A 1NRIA 1C9KA 4CM8B 1YVPA 3WSWA 5TV2A 5IAEA 3W3AH 3WWYA 2J0UA 4UE6A 2Y1OA 3B52X 3R44A 1K89A 1LPOA 5ALGA 1JEDA 1EB9A 5D00A 2H5IA 4Q47A 5IH3A 2YVAA 2A33A 3TBKA 3MJ4A 4BNWA 2Y1LA 3ZLTA 4HVLA 1JLMA 4OI1A 1RXVA 5FPQA 3WNQA 1SZJG 1NAHA 3MK31 1G6KA 1K7SN 4OBWA 2JLYA 1QYWA 4BFLA 1PWHA 3KKKA 3B7PA 3BL8A 1N0WA 4HDMA 5EA2A 2LUOA 1WXHA 5KO2A 4B74A 2GLXA 1N4DA 5AXBA 4EHAA 2AKEA 3IHLA 3AR6A 3ON5A 4PNZA 3RAPR 4CCAA 3VC2A 2DWPA 4I3HA 4R84A 1F8YA 1PJ4A 3HUUA 3PQ7A 1SCDA 2LR0A 3N8IA 5P21A 3FLAA 1SKQA 4DY6A 4WBNA 2X8WA 4UNPA 1HYHA 5CTJA 2GRAA 1OLOA 2VS1A 5LB2A 3BSWA 1RJFA 1XTPA 4IZHA 3HCRA 1IY2A 3UYKA 1CF9A 4N3AA 3LTEA 3V2IA 1PF7E 3C39A 4XYEA 3WB9A 4EY8A 9ABPA 4FQ7A 4UPEA 1NW3A 1QK5A 5G4LA 3QUAA 4AO6A 3K9GA 1A9PA 2NV2B 2QN3A 1UFKA 5IANA 2P3OA 2ICAA 3D0QA 4TMTA 2WD9A 2NX2A 5MN6A 1JQ3A 2CFIA 1WD7A 1MAAA 1NGSA 1W5EA 2DFPA 3GROA 3NNSA 4XX1A 5A3RA 1B1AA 3A28A 1QH0A 3GBPA 4W82A 4ZOLF 5NLLA 1SVMA 1YQXA 1CWUA 2GCNA 3RWBA 3B3FA 1QKIA 3KQTA 1OYVA 5DTMA 5GV8A 3SLGA 2ZCJA 4KDEA 4GNKA 1ILWA 5CURA 5JMOA 3MVEA 4WZBB 2B4RO 4JUFA 4HHEA 4L9AA 4ZJYA 1VFPA 5BPFA 3DONA 3KAPA 1M8JA 3Q2KA 1BMQA 1OX4A 3WADA 4B7CA 1MO4A 1VLZA 3JZMA 3MWEA 3E4CA 1XRJA 1HNNA 1M2OB 1RAAA 3LQ4A 3NWJA 3L8YA 1AUQA 4EPWA 1SWWA 1Z12A 2JAHA 2XE8A 4QVIA 3C70A 2QGNA 3NVKI 1QZZA 4E2FA 4QDTA 1CYDA 1QMGA 1QP8A 3JY6A 3PS9A 4UZFA 2GF0A 3QY9A 3UENA 2N46A 1G59A 2AZTA 2FWRA 4O08A 1ND5A 3E0QA 4RCYA 3OMLA 4FYHA 3BKWA 2ZROA 4NICA 3KYDB 2DHQA 3SZGA 1KAMA 4S24A 3RC7A 4F6CA 4HV4A 2Q62A 2DFDA 5TT0A 3CGWA 2MSDB 3V9AA 4H31A 1SKYE 3HB1A 4KAFA 1YRQA 4FCCA 1M0TA 2VJMB 2AZDA 4FKZA 4MRMA 1L5YA 3KR0A 4LDJA 5F2OA 5B64A 2BIFA 3PTLA 5JDIA 2L42A 5JSZA 2QRKA 3NC0C 1EZ1A 1H3NA 2BPOA 2W2VA 1UWVA 4TS3A 2P5SA 1A50B 2OXCA 4C6TA 2QN6A 1NFFA 1V71A 3EULA 3LIPA 3VOTA 5JC1A 4LYHA 1GEEA 3VYSB 5A02A 2I2WA 5F1KA 2A58A 2ID9A 2AKAB 2XT0A 4KL8S 4XTCS 4JJ6A 1JSLA 2EFJA 4D1YA 3LXXA 2GD1O 5CVTA 4FTWA 4GPBA 2EF1A 1IC6A 2EQ5A 1TF5A 3F90A 2QZSA 3HFSA 1EJ2A 2RHHA 3JXEA 3PDIB 4LZPA 4JXXA 1XEWX 2NU9A 4IXMA 3Q3CA 2M6LA 3PRKE 4R0VA 4FIDA 3MELA 4JT2A 1QIEA 1ORDA 3X1WA 3IL2A 4B85A 1TUBB 2OK7A 1GYPA 2IP1A 1NLMA 3R8FA 4URWR 1Y63A 3T9FA 3SJUA 2JFWA 1Z26A 5G41A 1CUFA 3KQSA 2YCBA 4EPXA 3IAS6 4Y9RA 4MUEA 4ZN6A 1XSEA 3H2HA 2IXBA 2BJWA 4V2IA 3CLSC 4W5TA 5C37A 2QIPA 1GUFA 3ELBA 3PXUA 3WLLA 3H2KA 1FVXA 3KIPA 1U3VA 5HRAA 2UZ4A 3E5MA 3PR2B 5KWSA 1C7IA 1U6IA 1JXAA 3M6UA 3WL6A 1UMKA 3WR5A 1E3WA 1TEXA 1J9EA 1YK1A 2IUEA 1C8KA 4ZMRA 3GY0A 2ZWPA 2D3WA 1R0KA 3PA6A 2QNBA 3C15C 1W0CA 3IRVA 4MB0A 4MP8A 3T12A 1XKQA 4YT5A 1GRCA 1Y3HA 4TSFA 1DDOA 3N6RA 2IYNA 1DV1A 4NPHA 3K9FC 1AXRA 4GVPA 3HLKA 5CFPA 3P9NA 2FN7A 3PU6A 4FSDA 3EX7C 2C9CA 2HLPA 4Z5XA 3LK7A 5IJ0A 2I9KA 2CFTA 4O59O 4WVLA 1VE3A 1AZTA 3QGMA 4P2BA 1IRIA 1XLTA 1N57A 1Y7IA 3OKFA 4GQBA 4YRRA 3F6BX 3OJLA 3VHXB 4DLBA 3TZBA 1DEHA 1PEYA 4IR7A 2AX4A 2WA2A 3U7HB 3AOGA 2ACWA 4UE3S 5JZOA 1NDHA 2DHCA 1W5TA 4MUYA 4IMJB 2Y1CA 1K3FA 2RG7A 4PTLA 3PE3A 4C6RA 4YT4A 4N65A 1R00A 4AMVA 3RAEC 4R8LA 3MJEA 3BBPA 1M6VA 4U00A 3WLSA 3IVXA 2YMQA 2H9AA 1K68A 1MX5A 4PPYA 3NHUA 3L0ZA 3H13A 2ZBUA 3QWFA 5EZ6B 1WVGA 3R7NA 4LY6A 3SZMA 1F4PA 1N78A 4JLVA 2PGOA 3D1VA 1R6AA 4EMBA 4X20A 1H8HA 3KWJA 3I12A 4YDQA 1C3XA 1W47A 2HLDD 4YFVA 2G88A 2JAXA 3KTAB 1CRLA 4ZOLB 2C8LA 2IJGX 5A1JA 4RVFA 3BA1A 4IIJF 1JWAB 3FSGA 2NV0A 4BTLA 3VO8A 4MTLA 4I8XA 2YRXA 4OXYA 1ZIPA 1ISMA 1L9KA 4FD2A 2XVZA 4LBWA 1U6KA 1GPNA 1S5PA 2G07A 3GA5A 2C9OA 3FF1A 3QTLA 4NI5A 1SM4A 2GQ0A 3IURA 1P6UA 2BFEA 2GYYA 3WZLA 3O4GA 5DN9A 2FW0A 1H9BA 2BFDA 2AS0A 3BMQB 3DOIA 5FORA 3GLGB 4L6IA 2KYRA 1PT7A 1IFXA 4QASA 1U1IA 2CL0X 1JP7A 2QL5A 3IVMA 1ISSA 3FPLA 3FRIA 2ZJ5A 4RX1A 4Q1AA 2IHZA 2XMGA 4QBFA 3T52A 4AJ4A 1XHLA 4BNYA 4QT4A 5C3MA 3O8RA 2Z2XA 1JFTA 5D6OA 2GXUA 2C82A 4QFBA 1XD9A 3ZUGA 2ZIXB 1X0VA 3OG9A 4B6QA 5BV1A 1BA2A 4CMHA 1P1JA 3ENNA 2IXTA 1XC7A 3V1LA 3ZK8A 2PYIA 1UFRA 4BVAA 4BX2A 4COKA 2RB5A 1PSWA 2CMFA 3HHEA 4JEHA 4O29A 3W6PA 2YFYA 1M2VA 1O6ZA 1LNSA 2Y1WA 4MO9A 2CZQA 2HJSA 2F59A 4RELA 1EYZA 1YJ8A 3G7NA 3HP4A 3BC1A 3IMGA 1BGVA 3OOEA 4L8FA 1OV6A 1ZIOA 2JLZA 1GAQA 1FXSA 3BYZA 4S2UA 1GUYA 2DECA 4HGNA 3T4XA 2FSVC 4DMFA 3KSZO 1TO1E 1I4WA 2XD4A 2FZEA 2WMNB 4DBLE 1L5MA 1HRDA 2GD6A 2RI1A 2ZBVA 3B6IA 3HUTA 4F6RA 4WLFA 2BH2A 3Q10A 4JJFA 1D6NA 2VDPB 4PZYA 3S1SA 4HG2A 3FPEA 2GPJA 1H2BA 3E1SA 3OI7A 1VG1A 1YDFA 4JGIA 3F49S 3MUOA 1RIFA 5KSPA 4YJGB 4ASUA 3AP2A 3CFYA 4MS1B 4TOIA 4UTRA 4FBMA 4L7QA 1ISIA 3QEJA 4RKRA 5ADWA 5ICGA 5JSUA 2N3ZA 1OBVA 4LJRA 3GJQA 3ECAA 1M0EA 4BE9A 4XEUA 2MCFA 4G26A 3KQQA 2QW0X 3UAZA 2XUHA 3BMNA 5JSKA 3GNTA 3Q9SA 1Q74A 3OE7A 3UA4A 3V1UA 1C3EA 3WP1B 4F5DA 1CU1A 3WSVA 5K7SA 3L41A 3LUAA 3H8SA 1W30A 3GDWA 4E0BA 1MT0A 2PBLA 2WJZB 3RHZA 5TT1A 4GYKA 4YJHA 3QBDA 4MV3A 4MRAA 3SSOA 1NW5A 4DGSA 5IYZF 2ZYRA 2O2JA 3G2QA 3K9BA 3RREA 4B73A 5L3QB 1R9JA 3IPRA 3QFTA 1T6BY 2GSWA 1ZIDA 3EOAI 1XEAA 2FGJA 1VMIA 3K32A 1SCQA 1KQ3A 4WVFA 3TLMA 3H97A 2IOFA 3MOGA 4A8HA 1XVIA 1UOPA 2PT7A 3BQ9A 3HFJA 3BOSA 3DCIA 1Z34A 3D8BA 3BB4A 2W83A 5CCDA 3ZZ0A 4A73A 1B76A 4HEA1 1TT7A 3NBAA 3T9AA 5K03A 3C5EA 4ENTA 2CJWB 4I1SA 5HBGA 5NULA 3VA7A 4HDCA 4C3VA 2GM3A 4O0LA 1U8ZA 1MZVA 4A6DA 2AMVA 1AUPA 1CE8A 1GDTA 4Z9AA 1GNLA 1Z5UA 3W2GA 4CTKA 3UTCA 3DF9A 1XU9A 4R7GA 1H0SA 3Q11A 4LY0A 2OE2A 3KAKA 2QMEA 3OFNA 4KBYA 4X94A 3MUEA 4HWOA 4YAEA 1V11A 4WZZA 2X0NA 4EMTA 5ABPA 1RKQA 3GIDA 2AXPA 3PUZA 2NXCA 3R3VA 4S1OA 4WUTA 4RK6A 5I9BA 4YRCA 4JUCA 1Z4MA 1FFYA 1GP2A 1TRKA 3PQFA 4CG1A 1KFKB 3E9QA 2JIOA 16PKA 1PFWA 3BDAA 2JKZA 4OUDB 2GCOB 3WKDA 1ADGA 3IBSA 3JWJA 4PGAA 4TVBA 5HF9A 4A0SA 2HJWA 4C0BA 2ZXUA 5AR1A 4DCCA 3H2JA 3SAJA 3H5AA 3DFZA 1L7OA 1SQFA 5LXTA 3WZMA 5KCZA 3P27A 4A2QA 1E69A 1DMRA 3REFA 3R7WA 2FWJA 2PLFA 3DPSA 3IE0A 4HK4A 2CVZA 3TQCA 1H93A 4YMTA 3N2KA 2NUPB 3ABIA 3TIXB 4D9KA 4ABTA 1EVIA 1RR6A 1RHJA 2EP8A 4EARA 3BEDA 1NBME 1VBMA 2X76A 4K81B 3ZGOA 1HG1A 2C4VA 3PUWA 4BJ6A 3C3CA 2JBAA 3K8YA 1DKQA 3EGOA 1YI0A 4TMZA 2A9VA 5EKDA 5ESWA 4ZYWA 1YDWA 3CG0A 2IIBA 2BD0A 4YUVA 2GK7A 4WPGA 1YB6A 1F0YA 4YCLA 1UP7A 4GMGA 2V59A 2H2GA 4I4CA 1QTRA 2VH5R 2QW1A 4K9QA 3D6VA 2V1XA 2RHRA 4KO2S 2QQ5A 1XNJA 3WMGA 1NQAO 2QLNA 2PVSA 2VQ3A 4BJ5A 1O95D 2PS9A 1H23A 2YMLA 1JQBA 4R1QA 4QOSA 4X3CA 4N48A 4MKGA 5CCXA 2YJ5A 4X6XA 3T1HB 5K01A 5JRJA 1CZRA 4QGFA 3FNFA 3B60A 1XPUA 1YU6A 3G2OA 1EQUA 4HB2A 1HF3A 4WEOA 4ZOAA 3QJ5A 4FCWA 1SJ9A 1U7HA 1GNTA 1YDGA 2MTBA 4P86A 2HKIA 1DBPA 1NUQA 3W5HA 1RPNA 5K0CA 3A58B 4MW7A 1PW5A 5DH9A 4B6FA 5K3CA 4GX5A 4WE3A 2IUTA 7MDHA 3TO5A 3THXA 2Y0BA 2IYYA 5EJ5A 1V35A 5KQGA 1IBCA 1M74A 1QF7A 2X3UA 4IRMA 2I6TA 4PW0A 1ZA2A 4YY3B 3ZBUA 1ESNA 1T6ZA 3O84A 3U7QB 1JEJA 1Y5IA 2O1XA 1PFVA 3JALA 5G1NA 3WDMA 3TQQA 3F67A 5JPCA 1ZGHA 4G8CA 3SZLA 3VDMA 2Q46A 2YYSA 4GRDA 1J06A 2NPIA 2BKVA 5B6PA 3PRJA 3WAGA 3BHNA 1PR5A 4RD1A 5BR4A 2ZZMA 1DHTA 4JL6A 4Y2VA 1CY2A 1L4FA 1ZWKA 1M1XB 3I04A 3I32A 1YQTA 4Q6BA 5HEKA 3S2GA 3ZDEA 1EJBA 1FMTA 1BHQ1 3WO1A 3WOHA 5A03A 3WRVA 1KZ9A 4WESB 1AV7A 1M1YB 5DM2A 1ACJA 3MWFA 5H68A 2ODAA 3RIXA 3QKWA 1NG9A 1IOZA 1PNOA 5AW1A 5KSWB 2DQKA 2CD9A 1E3EA 4NCJA 4E88A 1QGUB 3GLIA 5DHTA 1A9SA 1OX6A 1PR1A 1RXUA 1UZNA 2QUBA 4PAGA 4RVCA 2VHWA 2ZRHA 5DBFA 1W8IA 3DEFA 4ZQEA 4UVIA 3ZZMA 3ZWAA 5BVHB 2DX7A 1D6MA 4JOCA 2JHAA 4COOA 3NBYC 2OV8A 4TX1A 1KDZA 4UD6A 3WGQA 2G0AA 3L0IB 3WHLA 2O8CA 3AILA 3RABA 1N8TA 3SNHA 2IEAA 1ZD2P 2JGDB 1SPBS 4QHSA 2R4UA 3MJCA 3VVBA 4J4HA 3WMXA 4AU1A 4U6QA 4EPYA 1EGQA 3HRHA 3ZNNA 3KKQA 3HBAA 5HS6A 1ACLA 1SKYB 4D3DA 1Y7LA 2NZ2A 3QKSB 4UASA 1EA5A 3OLCX 1I2AA 2XDQB 4AD8A 2JZCA 1RJGA 1VRVA 4O63O 4DIUA 3ZE6A 1T4BA 1NVGA 2PIDA 1YRHA 2RIPA 4ZTUB 4BKQA 2AMFA 2AR9A 4FT4A 4G1EB 4IIGA 4OHRA 4YFYA 4QM7A 3A2MA 1HSZA 3H5NA 5KYGA 3RBVA 2ZM5A 1EVZA 4U9IS 5IKMA 3NM6B 2X8LA 4FK8A 4IDHA 3V5NA 2W22A 4BO1A 2HAEA 4EYEA 5E6RB 4BGDA 1DBIA 5LQAA 1K9VF 1EFHA 4MUFA 3QX3A 2Q8NA 3T61A 2BKAA 4LC9A 3CIFA 4J91A 5A0TA 1FX1A 1JJFA 4DSOA 3FN4A 5FT9A 3COWA 1JA1A 2A1TS 4L0DA 3RTBA 4BJHB 3NT5A 5ITWA 2VATA 3LZDA 4P98A 1P0PA 5FWNA 1DAKA 4KMMA 3D43A 2CLOB 4NMHA 2HPZA 1Q0PA 3RUPA 3DWEX 3P0FA 1OTXA 1WTAA 4K88A 2G04A 1M34E 2AG1A 5FHQA 5LMCA 1ZM4A 1K7CA 2ZREA 5E9WA 1Y7HA 3HE3A 1N77A 2EBUA 4RXMA 1RP7A 3C6QA 5K8TA 4RTNA 4L22A 1UJ5A 2QR2A 3FGOA 3AEUA 4KN8A 4M1MA 3K70D 2B82A 1UWKA 1YIDA 4G0OA 4PFKA 4RF2A 2QJOA 1R8JA 5BSMA 2FK7A 2WTBA 5IT4A 4Y30A 5M5BA 3RSQA 3DFKA 1GQQA 4G3XA 1FSGA 4C5AA 1A7AA 1QFXA 1YQDA 2YBDA 3D31A 1IY8A 3DYIA 4QDZA 4F4HA 1Q1AA 1LS6A 1BX0A 3A3KA 3PQ6A 2VZ9A 3LYLA 4MCAA 4QECA 3TQIA 4CG3A 3VOBA 5CDUA 1W36B 4B3SB 4RY9A 5T4BA 4AZTA 2QUJA 3LBAA 3WYGA 2ZUTA 3OIUA 4I5DA 1YDEA 1P0QA 1XJWA 4K86A 1U8FO 2VA9A 3BG5A 3HU1A 3R1IA 4ACBA 3W5CA 2WMYA 4M1SA 1OYYA 1FNMA 5LNK6 2XIQA 1MB2A 2I6XA 4XPIA 1JSXA 1P5RA 1QYVA 4XJXA 3TIFA 4D8UA 4FT2A 1CF4A 1V0JA 3GA0A 4CU5A 4FD3A 2WILA 3LVBA 3JWEA 4D3ZA 2JIZA 3QYAA 5I4KA 1RM4A 2LD4A 1MOSA 4XLLA 2C4HA 3P2YA 4UARA 2R84A 2WAYA 1XTKA 4FILA 1OCEA 2BWJA 3Q6IA 1SXHA 3H2YA 2X6QA 2GH1A 4WCVA 4FYKA 1G42A 1SOUA 4TYYA 3LW8A 1TFRA 2PGNA 3CEAA 3P5SA 4F5YA 3UPUA 3FTQA 2AQIA 3E2IA 3HVJA 4N0QA 1MFZA 1V48A 4JKIA 3ANNA 4QGBA 4UHFA 1ETUA 4L95C 3PFCA 3WNVA 1VCHA 2OC4A 5DTIA 2VFAA 1XF1A 2CKMA 1GTJ1 4UEWA 3NDIA 4EYQA 2JJ8A 5EUQB 1SU6A 1ZOIA 4RL4A 3THWB 5E8RA 3FDXA 1QP0A 3AJAA 4MYDA 3A9UA 4MAFA 1WHTA 4JDUA 4YRSA 1EUDB 2P6PA 4ZTBA 3INRA 3BIWA 3Q98A 4MVCA 3UTDA 2VTEA 3AL0C 4GPD1 3V2HA 1OBHA 1LRJA 4AZ0A 1CZOA 1JTEA 2AB0A 2P9HA 2VP5A 3FTEA 2XA1A 3HCFA 2BFBB 3EW7A 4H4DA 3U3MA 5I9SA 5KNCH 1XYVA 2IYXA 2E4YA 2QM3A 3AGQA 4BWVA 3O4HA 4FX5A 2FCRA 5C8YB 1SHKA 2QVYX 1SPXA 4QUHA 3UIEA 4WT7A 5JXHA 2NN3C 2OL4A 2P8JA 2R25B 3R4VA 3DOOA 2DU8A 1N2CA 3ZHUA 1N3IA 3MD0A 4ZVUA 3TFQA 2QGZA 4H6PA 4I66A 3KB8A 4KWHA 3BRQA 1IM2A 1MOZA 3O8QB 1FFEA 2EYUA 2C4MA 3PQ2A 3CNQS 2JEYA 4C2AA 4B32A 5C1PA 1PQUA 3ZIAA 4HDSA 4R83A 3Q1KA 5CLLA 2IRWA 5TF4A 3GJ3A 1FP2A 2JAUA 4G56A 4ZIRA 3VJRA 4KH1A 1IUNA 3EVNA 4HAIA 4BX8A 3I01M 1JG2A 1DKOA 5JS8A 5B1IA 3IT0A 4D0SA 4TMVA 4BFSA 4DMKA 4RVOA 3L4JA 1ZXBA 2XZTA 2XUPA 5JAUA 1JQEA 4KLCA 1AQUA 4QAJA 4FEYA 4WN9A 3C74A 5LP1A 1OGYA 1YC5A 5GINE 4OEHA 1TQ4A 1BCRA 1FYFA 1LPNA 3CZ9A 5E3HA 3I4CA 2X1HA 3ZHYA 4KHPB 3H1TA 3SIXA 1DEOA 1R8SA 3FCXA 4ACAA 1KHHA 3EEOA 1YFLA 3C1OA 1YGYA 2FRVA 3FMVA 3OTWA 1BH2A 1B42A 1QG6A 3VKFA 2BE7A 1S02A 1U7PA 4J1SA 1M76A 1Q0HA 3IERA 3C5VA 1KDRA 4DYHA 2KS6A 2OCDA 1GQRA 1Y3IA 1LGYA 4WXHA 3C7DB 1FNSA 4HH0A 4OP1A 4G24A 4DCVA 4OREX 3S27A 2DWCA 2B7CA 1FLDA 1YR7A 2O5VA 4L08A 1BDBA 3IUJA 4FN4A 3R7BA 2DR2A 2QWXA 2DC1A 1JJ7A 4GG1A 1G6Q1 1JE0A 3LXMA 4LHEA 4Y6SA 3PGJA 1MRSA 2ZJAA 1PDVA 4L0QA 3GFQA 2FSFA 3AI7A 4F8YA 3PITA 1EDZA 1RWXA 1NNLA 2I78A 2VYNA 4CG2A 1ZUNA 2ZE6A 3ROEA 4JY7A 4HFRA 2AZXA 4NU8X 2NUBA 3KKMA 4FE7A 4H35A 4DV5B 1RE1A 2ISSD 1JKXA 1GQYA 1VJTA 3FMIA 4YUXA 1B3RA 4GXNA 1ZSVA 3DMFA 2PTGA 3F74A 3L5OA 4FKMA 5CDHA 4JI2B 2MSWA 3IT1A 3JU3A 2WHRA 4PLFA 5ADUS 4X71A 2CXPA 3E3LA 4HLDA 4MP3A 4Z9BA 4EG3A 5BQ3A 4TWZA 4IGAA 1BDJA 4F1KA 1K06A 3BFKA 5EPUA 2IEZA 2DSNA 1OLUA 2JZNA 5B58C 2A0UA 3D2BA 3QEMB 4PRLA 2K7ZA 3F5QA 4ZC8A 2B36A 2HL6A 4J1QA 5GY7A 3UK7A 3O8DA 1OE0A 5A71A 3RK1A 1E3IA 3BICA 3DDWA 3TW6A 2XF2A 4A15A 2V9ZA 2G5GX 1NRWA 3HYSA 5AUQA 5K0NA 1G5IA 1KOLA 4XVRA 4V0OA 5CTAA 4RK1A 3CVJA 4HB3A 5JFTA 1VLMA 3PUKA 5BRJA 1DQRA 1SCUA 3TLBA 2UYCA 2I7DA 3EIFA 1QSGA 2BFCB 1A8QA 4CKXA 2CUKA 4C04A 1U2GA 4PZDA 1R12A 4OHFA 1ADJA 2D2EA 3A25A 2FH5B 1R9MA 3SNKA 4CMBA 3ZNPA 4B5KA 1BJKA 4ROSA 3TW8A 1N36B 3OMXA 1NR7A 3OZRA 4KN9S 5AJHA 4L3VA 5A4IS 3ISTA 2B1RA 1AQLA 5J3JA 1P2FA 1DEAA 3A6PC 3UC5A 1ZU4A 2IU0A 2XUZA 4GOLD 2G77B 2NW6A 2YICA 1U7ZA 3I28A 3CH7A 4Q21A 2XHEA 1Z5NA 5IVIA 4B40A 1DQYA 1ZX1A 2D2VA 3SHTA 1LA2A 5LD2C 2CXQA 3CZAA 4V0NA 2HU5A 4CYMA 3FHJA 5TJHA 2QD3A 2J3MA 4JI6B 2RE8A 1CEYA 3R5TA 3PCTA 4OMDA 4A5SA 5DCWA 4I1UA 2OGZA 2BTQB 2YX1A 5DN6A 1J70A 2CZCA 2VF5X 3G2LA 2I6SA 4Y0NA 4YLGA 2BTOA 3AESB 3W05A 4ENSA 4C87A 4JEIA 3Q9NA 3MJRA 1QV9A 3ORQA 2FB9A 2Y76A 1JPNA 1J2TA 5E8JA 5JD3A 3MBKA 4MYHA 4TV9F 3PQ8A 1J2UA 4N5MA 5DHUA 1Z17A 5JU6A 2WVGA 1NVMB 3Q40A 3K6JA 4YO8A 4ESEA 2VPWA 3DKKA 2JJYA 3CT4A 2Q49A 3AG6A 3QH4A 4PHHA 4TT3D 1SQ6A 3HQ4O 1DFHA 2Z8XA 5E6SA 5H7XA 2BISA 3PT5A 1QQAA 5H3HA 3R3ZA 1PEAA 3RHFA 5B1DA 2C0PA 4EYSA 2VRCD 2JI6A 5T57A 2JJMA 1GGHA 3IQZA 4OKIA 2GA8A 1FBTA 2CVQA 5DNWA 3T3OA 3HGMA 2C5HA 1QAMA 3QUSA 3W1WA 4EJSC 1NNEA 4JSRA 4M1EA 1UWLA 4U0KA 3RGGA 1IM8A 4DA8A 1LBIA 4CDNA 3E5HA 3E7PA 2WU0A 2VSQA 1SURA 1AZLA 3AM4A 1CG6A 2B2CA 1RWQA 4K03A 5BWBA 3PZRA 5CLIA 4JI3B 3NBXX 1YV9A 4H27A 3QE3A 1Y33E 3R0VA 5LQDA 5KU7A 1XPRA 2OWDA 5CB4F 2NYAA 4JOBA 1LJ8A 4OP2A 3EQ7A 4XD7D 5INTA 1D9XA 4CV0A 3EZ6A 4F86A 1ZBQA 3O6VA 2Y1FA 2VA8A 4FBLA 3F7TA 4I50F 4OI0A 1YI1A 1Y5LA 1Z62A 4IZIA 1G5HA 2K2QB 2WU1A 3EZ9A 4CUJA 2Q2VA 4ER3A 5L8VA 2HB6A 2G36A 1SQGA 2V45A 3P9YA 2FOIA 1OAOC 1L8AA 3P0JA 4HUQA 5GV7A 1WCXA 1ZK2A 3DWIA 3D3QA 1ZEMA 2QMZA 5F51A 1NVKA 2GAOA 1WNFA 1WTCA 2Y8EA 2IX9A 3IMKA 5DLYA 5JD6A 1E20A 2HU8A 2AA3A 2VSXA 3HJCA 3W79A 3JTMA 1CUBA 3ETCA 3QLUA 4E5UA 1TJNA 3I0ZA 1L5SA 1NULA 1XALA 2XITA 3DDSA 1EXDA 2FETA 1TCAA 2O8EB 2W4QA 1AG9A 1FTNA 2F3QA 3CV3A 4UUOA 3RUAA 1WXWA 4EUKA 4BE4A 1YA8A 3CLSD 4PFQA 1PGPA 3E7DA 4AG6A 4Z1MD 1VKJA 3X1XA 4Q05A 2XEDA 2A8YA 2IU4A 2VT6A 3DDOA 1MQ9A 5HZKA 3CSSA 5GJCA 3FWPA 3KSDO 1L7RA 3BTOA 4G9EA 5DGHA 3JVVA 3Q41A 3PNYA 1D5CA 3SY8A 4ZT5A 4JQOA 4XIGS 4PLGA 3FCOA 3WS7A 4DEVA 4DLLA 1FP4A 3AIMA 2HYIC 3VKHA 1P0MA 2GETA 3LHDA 2YY6A 4PF1A 1W5SA 2XRMA 3PPXA 2IV3A 4II7A 2GPAA 3CUVA 3D4PA 3M4XA 3QFCA 3FUWA 2BONA 4LS3A 4N5DA 1XCLA 5DMHA 2AOUB 4YJ2A 4R2XA 2R6R1 4HEHA 5TQ2A 2VL7A 5ADHA 4XYGA 3ZLUA 2J3QA 3WAJA 1QF9A 1U0GA 3QEOA 1JFVA 1NBAA 3AM5A 4LQDA 5H1YA 3HCBA 3OBBA 5A0FA 4E2YA 3OTOB 4HQLA 1JJIA 1A2KC 3OEYA 4ALLA 3STUA 1PQWA 1OTYA 1PQYA 5E2AA 4CR6A 3A4YA 1WXFA 3KYIB 5IF9A 1E1LA 3U3OA 1DAGA 2V4MA 1NY6A 3B36A 3ZY2A 3BMXA 4OYLA 1XR3A 2CLEB 1M34B 3HCPA 1LJLA 4CWAA 2H8KA 2ZYVX 1TEVA 2KE5A 2Z2KA 4UJ5A 3HRKA 5FFFA 3NEJA 3S5JA 3PL1A 4JBNA 2W6OA 3BKXA 4K40A 5I4CA 4DCMA 2GM4A 2YV1A 3V4LA 2IEGA 1OHHA 4HMQA 4Y2JA 5IN5A 3V55A 1OT3A 2CW5A 3O1HB 2JDID 1O5TA 1EU1A 3D3NA 1I6WA 4WCFC 2RHOA 1C1XB 1YR2A 1JVBA 1B00A 3BK2A 2GTPA 3MC1A 5CW1A 1Z13A 4RVNA 1OGJA 1UEIA 2TMKA 2CHQA 1RXCA 1ZD4A 4WZ6A 5JDCA 2VNIA 4EG6A 1XEXA 4G89A 3RIMA 2AMLA 1JHUA 1M75A 1XMVA 3RASA 1E4EA 3EGXB 2FP4A 3HA5A 3VVMA 1ECCA 3ZTWA 1T0HB 4TPKA 2C98A 3ORYA 4INAA 4LXYA 4BRZA 1VPDA 4Q93A 4RBNA 3OQHA 1BMTA 4BCDA 2EKPA 1AKTA 3ZJUA 3GUVA 2BKEA 1X3SA 1X7XA 2AOXA 1QIMA 1XI2A 2NQ2C 1P5FA 3IMEA 3LY9A 4G97A 4PZUA 4DTCA 5TLSA 4S35A 2QY6A 2XYHA 3R7SA 1RE0A 1CUCA 2JFPA 4CMIB 3ZVKA 1JQLB 3HZRA 4U7GA 2BCEA 5CIYA 1UXOA 2A14A 4QHYA 1RFLA 2P1ZA 3NYWA 1CW2B 5KYXB 2QPOA 3N7TA 4E5VA 3FNIA 3BTUA 3I53A 3OQIB 1KEEA 3C16C 2XNJA 4MW6A 4OM7A 3P9ZA 5IXYA 2UXCB 1K6IA 1JEQB 1XA4A 2O0HA 3GOHA 5ALVA 3U80A 2FUKA 3QXHA 1TM4E 4J6FA 1GD1O 1K0FA 2VRWA 3MGCA 4WDRA 3QQ5A 2XCRB 1SUWA 2R6CA 3EMKA 3GEHA 4OHUA 3VKVA 1E96A 1Z8HA 4GKJB 4Z99A 5MF6A 3PTZA 1THMA 2YW9A 3D4IA 1B4DA 4F3YA 1RI2A 1N5LA 1DJNA 4QGGA 2YWJA 3KJXA 3B3AA 4CM6A 4WBNB 2ENUA 3FRJA 3W6ZA 3ZWDA 2W2NA 3MLEA 1G8MA 5KQLA 1GTMA 2JGMA 3LGAA 5LDHA 4NJMB 2HMAA 4YMSA 2G09A 1E2KA 3WICA 1KBZA 1F0PA 1UBGA 4R1MA 5TPWB 3JYNA 1JDUA 4FNGA 5CB6A 1EINA 1EX9A 1SBIA 2DQ4A 4S3MA 2JLWA 1E2FA 4WFJA 1H2ZA 5G0UA 1RAIA 2E4UA 3D3WA 3KZMA 3OH8A 4M9QA 5FOXA 3SJBA 2YWHA 4GOOD 4C20A 4NJEA 2HV9A 3PP8A 1IPFA 3EIWA 5HDQA 3ZHXA 3DB1A 4MV6A 4AK9A 1V8ZA 3FMPB 4RMGA 3G2IA 3VM6A 5F7OA 2JI9A 4PYNA 5D6NA 4NVRA 2VYVD 4B35A 4EPVA 1X8KA 5AMXA 1DVRA 2QQFA 3N2ZB 4N7BA 4MPTA 4D25A 2AV6A 1G8YA 2I6UA 4ARUA 2IDJA 2RJNA 4WRRA 2QI9F 5FLXA 4HVCA 4OHBA 1A2QA 4BBZA 5IJWA 5B53A 4DUGD 3IELA 2VT2A 1NUSA 2WKWA 1L5FA 2SHKA 2GA9A 3CUUA 3S44A 3V4OA 1C7ZA 2COUA 3PNKA 1FVOA 2FZKA 3RSHA 1HEUA 3BZUA 5D5PA 4YYZA 5FFMA 4WKCA 2TSYB 2P2ZA 4Y1RB 1WZ2A 1W75A 5JLJA 4LV5B 1RWMA 2J3HA 2ZQ5A 3TOVA 3UAGA 3VKWA 4ZT2A 1PJ3A 4M89A 3BH6A 2R2GA 3DNFA 2C4KA 2FG5A 5BMVA 1A9ZA 2GB4A 2WU8A 3GJXC 1IUOA 2C3OA 1QKJA 3MMNA 1GFSA 1UMDB 3MS2A 4FXPA 4IHJF 2E4VA 4KWTA 4IV5A 5AW9A 3RLIA 4YXFA 3QWHA 2MYTA 3T4UA 4DLPA 1KORA 3ZCXA 4C6TB 5EKSA 3ER8A 2Q45A 5E4FA 4EATA 2VF4X 4FGWA 4X1IB 3B6JA 3R5JA 2BDTA 9ATCA 2W71A 3WK8A 2MIIA 1RC1A 3RQIA 3THXB 4JNCA 4X60A 3V7WA 1K6MA 3FYCA 3I5AA 3RH0A 1JE1A 3KQVA 3V46A 1EGVB 1KC3A 3BRWD 3OETA 1N6IA 1F9AA 2A3NA 3N87A 4YAWA 3C7AA 5EKXA 4D96A 4WLVA 1K8ZB 2C94A 4DIEA 2ST1A 2XWBF 4G1VA 4DIMA 4D41A 3ADOA 4N76A 2HTFA 1LF5A 2NU9B 3AR9A 1EHIA 4LQCA 3WB2A 1YHYA 3H0EA 2J48A 2QA5A 4P82A 1CCWA 1N2OA 4ER0A 1T3GA 3C6MA 4G4SP 4XSVA 4S05A 2CMGA 4Z2AA 2JGKA 2JS7A 2IBSA 3PR1A 3WMWA 2X8AA 1I51A 4MI1A 1WB9A 2J7PD 1M1NA 1TK2A 2ZW9A 2VPPA 3IQIX 4CKEB 3D8NA 1QBGA 4RPJA 3H8WA 2D7DA 2QN2A 4HDKA 1ODJA 4TWIA 5FKJA 1N0VC 1KQNA 1UJ2A 4MROA 5KPJA 3R3YA 3L82B 2OV2A 3PLAE 1HKHA 1UDRA 3HBLA 5GM1A 4XUCA 3H9JA 4ZQGA 2Q2QA 5HBRA 4LVNA 6REQB 3S81A 2BGWA 3UUWA 4M0MA 3V1NA 3TIIA 5A1TA 5JWRA 4DR7B 3L2OB 2A88A 3ZOZA 3MHTA 2IP4A 2ZB8A 5AUOB 1SCIA 1GU1A 3DB2A 3I2YX 5IAGA 3FYTA 3M83A 3W8EA 4PPFA 1IEQA 4QXRA 1FCJA 3I5MA 3UJDA 1CJSA 2GFQA 4LZAA 4Z0NA 1NW7A 1PT5A 4MUNA 4NZPA 4JKOA 4PAMA 5IKEA 1L7AA 1YA6A 1SBCA 4TLLB 4ARBA 1COZA 2ZAGA 2YTZA 4JBIA 4UEQA 1P45A 4R68A 4BC0A 2YN2A 4WKGA 4Q3KA 1U4SA 3DEKA 3IODA 4IEIA 3WY9A 5GZ1A 3KPWA 2GKGA 1KJWA 4RY0A 4C88A 4PEVA 1D04A 4YBRA 3G0CA 5L6MB 1T9ZA 3CF6R 2G9NA 4DB2A 4CLOA 3UY4A 4R5HA 1SZDA 1YFKA 3IFSA 2RGGA 4EZEA 4KO3S 4UHHA 6PFKA 3ENKA 3GFRA 4PU0A 1AKQA 3DE6X 1I4DD 2UXDB 1M6VB 2G4VA 1QAQA 2HLHA 2J07A 4XSHA 5AKLA 1QB8A 3DAOA 4D80A 2ZYSA 2PL1A 2GAFA 2Q3EA 3VPSA 1L4EA 2FQYA 2HIHA 1WLSA 4GLOA 3WIOA 2O06A 4PC6A 1I6KA 5IABA 2QMQA 4NQZA 1NQ5A 4I9NA 4PGGA 3EQ2A 4B45A 3NDJA 2OZVA 2F1HA 4DPMA 1A3CA 1CJTC 1ST2A 1M0SA 1V7ZA 3TQTA 4AWAA 3RFXA 2WEKA 1VJRA 2QG4A 1XQYA 1H1TA 2UZAA 3L1IA 2RFLA 3LAWA 2Z4RA 1HEYA 4ZI2A 2DMRA 4JYZA 2IF0A 1NWHA 2QPLA 5E7MA 5LLDA 1F06A 4IDOA 4A92A 2PAFA 2WK1A 2NP7A 1O97C 4ITUA 5HZHA 4L4ZA 1RBZA 4UQLA 2XUOA 3I2GA 2BFEB 3WKBA 1YVDA 2FN3A 4OHCA 3T0FA 4CKCA 1Z0UA 2AI1A 2W2OA 5E3JA 1K5DA 1T24A 2BFDB 3PHBE 1QRDA 1DIOB 3HXTA 5CJ2A 4JC8A 3JD3A 3AYXB 4BNMA 4ILEA 2A78A 3BGDA 3CR3C 3OPQA 2RIRA 5E4YA 3CSUA 1E1QD 2B94A 2B8EA 2ONYA 2BHNA 1RYDA 3CEHA 2AYZA 4BAUA 3AVTA 1EGHA 1N2CE 4OBBA 1RQPA 2PRIA 5E6UA 4ZI7F 3WK7A 2GZSA 3KXIA 3B6KA 2Z1NA 4KAXA 4LBVA 4OHKA 8ATCA 1Q16A 2EARA 3ME5A 1PNTA 3NHLA 4Y9SA 5I7FA 2PJRA 1XQVA 1M2VB 4WLUA 1RYBA 4Z6KA 3TMKA 1Z6GA 5IMSA 4CLRB 4G5YA 2H16A 3TNYA 3SI7A 2OAGA 4II2A 2C99A 3OQBA 1NNI1 3HJRA 4U2FA 3ZDQA 5HKLA 4AIIA 4K0KB 3LUPA 2WM2A 3PVSA 1WNTA 3KV1A 2EZ8A 4KX5A 5K6TA 3OE1A 4HMPA 4KO1S 4MUMA 2R4QA 3W9BA 3L1HA 4Z3KA 1CUUA 3T5MA 1X74A 3A10A 5ITSA 2O57A 1PT8A 1QORA 1RLMA 2YQZA 5JAHA 2JBHA 3R40A 1JEAA 5IASA 5JMPA 3KV3O 1I2BA 4PONA 2DM6A 1GR1A 2WAMA 3FPHA 5EYPA 3EC1A 3OOSA 4QQFA 8ADHA 4MEJA 2WJPA 1ONSA 1T1SA 4FOLA 2OMKA 3ND5A 4Y7CA 3EHEA 2A1UB 4KE7A 1K8XB 2J67A 2WF9A 2OZEA 4LE1A 4ZOEA 1X42A 1VQ1A 3QKRA 4BWFB 4OXRA 1PJTA 3O47A 1XG5A 1Y6RA 5EEHA 5K8UA 3UMYA 1BE0A 2RHCA 2IIQA 1S1CA 5D2CA 4ARZB 2HXGA 1ZR2A 2CXNA 2DFTA 5B1HA 2IYTA 1E4VA 1E6MA 2HUNA 3FFXA 1KRWA 3GDFA 1VPTA 1WABA 4OJMX 4HQRA 4YJHB 3CUSA 3IA2A 3WJ1A 5AK5A 1E7WA 2MINA 3FTCA 3R5HA 4MUGA 2JJ2D 2ZK7A 3HB9A 2EERA 5CVCA 1Z47A 3N6XA 3QITA 4EG5A 3S5UA 3SVLA 5BYJA 3D3EA 3EUEA 3UUEA 4MIEA 5H9WA 4WBSA 3T7RA 5J58A 1D1QA 1RNLA 2WYIA 3PCXA 1V1MB 3GZNA 5HUHA 1IJBA 1YZUA 1MJFA 5I9MA 4AKSA 4O2RA 2XWPA 3SEFA 4EFMA 2HCJB 2O2EA 4IJKA 3DAGA 1Z38A 3HU3A 1NU6A 4AZSA 3WNCA 3CVUA 2VJCA 2P2LA 2WPDA 3AC0A 3IIIA 1WB5A 3L7KA 2BMDA 5DB4A 1OIVA 3L6CA 5SV2A 4JB3A 3IUNA 1JG3A 1HSOA 2MHCA 2AK3A 4MA4A 3G8YA 4MIOA 1EEHA 3K5WA 4W8GA 1DOZA 4EF5A 4RPHA 4U63A 4U2DA 3I64A 2CUNA 3HHPA 1L1RA 3I62A 2VAVA 3RYCA 3F7MA 2HHHB 2E18A 4X64B 3WLRA 1WAMA 2PGXA 4RMNA 4KVGA 4G5OA 4D9GA 4URVR 2PD4A 3AEQA 1CZUA 1H2XA 1VMKA 4IMPA 1TT5B 3RWOA 1NVAA 3TVYA 4RK4A 5KINB 4XM2A 1VLQA 1OI7A 3NMUF 4AF8A 4IJMA 1CK4A 4CMEA 3T15A 1KKLA 1S4QA 1ZR4A 3I45A 3ILYA 1G8HA 3BIXA 2H18A 3LYHA 4GZ6A 3GLVA 1BWSA 2YWGA 3B7GA 3GPDG 4P0PB 3W90A 3ZGZA 3UMFA 1P60A 2EFEB 2AMYA 2E85A 1YMQA 3CCFA 4B82A 4DB4A 3KQKA 2NXNA 3IDOA 3OJEA 2XA9A 3N2KB 1KRHA 3WGIA 4TXLA 5C46F 2W93A 2GO7A 4IILA 5DXFA 2F00A 4N3BA 3OX4A 2AWNA 4MQEB 4JN6B 3MCWA 1OWPA 4R98A 4EJFA 3MTDA 2LWIA 4BMPB 4K87A 3LKDA 2QR3A 2EJUA 3KOOA 2O8BA 4BO7A 4Q03A 3HCDA 4CUKA 4DLWA 2P78A 3VGPA 1P62B 4I5EA 4E46A 2N0SA 3OP4A 5EWJB 1NF2A 1S2GA 5TS3A 3VZPA 3L0SA 1VDZA 4N3CA 3D8TA 3JQRA 3H42B 4GXRA 4YVFA 4ZRMA 3RR2A 4ZI7B 1EAMA 5AM2A 4YCNA 2CSXA 4DKXA 1DQPA 1RXIA 2DFVA 4XJVA 3SJZA 2Y99A 3GT4A 4JBWA 2P9BA 4LYDA 5ALKA 1FNCA 3VJKA 1OU4A 1ZN2A 3FAZA 3MSCA 4JLSA 1GLVA 4WZAE 1A1SA 1Y34E 2LP4Y 5GJVC 5JTUA 5LL6P 3I2IA 2XAUA 4FR2A 1T10A 4IYRA 3GQBA 13PKA 3HVHA 3ADPA 2EWVA 2Z09A 3C4QA 4KQKA 3KYBA 1TECE 5ALXA 4ZARA 1YR1A 4TKLA 1DC5A 1JJVA 5C5EA 2UUAB 2Q1UA 3QF7A 1OYOA 2Q3MA 3PQCA 2H1SA 2DTEA 2N1MA 3AV0B 3Q9UA 1ML4A 2CLSA 3JQ7B 4I55A 3TH5A 2OGWA 2WB4A 1QH9A 4IIXA 1W46A 2H31A 3K2EA 4LWQA 1QQTA 4KHZA 4Q7JB 4R2LA 1NV8A 2VDMB 2VUSA 3N3AC 3WP0A 3V8NA 1EP2B 4F45A 3DFMA 3PD7A 5JXWA 4HAZA 3LRPA 5F3WB 1E9VA 4E11A 3GCDA 1LLFA 4U9UA 3LMKA 5F64A 4YN3A 3STVA 1NOKA 4DVJA 3GI1A 1AK2A 3W06A 1N7GA 3QXCA 4TKMA 1IEVA 2E37A 4O3FA 3ZPXA 5IBPA 4I9UA 3ZCPA 4POOA 5I9NA 4W5QA 3U3ZA 2PMEA 3S2ZA 4XWWA 4F5EA 2JCXA 1XA0A 3GO4A 3FKSA 2HK9A 1P18A 4M0UA 2ZU0C 4N6NA 3SM9A 2OR3A 5BQXA 3GMSA 1QHGA 2FRDA 3IP9A 2XCSB 4RM2A 3RSSA 3OESA 4K9LA 5BR7A 4GKBA 3IO3A 5K09A 1AA6A 1EP1B 1GQ2A 1Q7CA 3UPTA 3G9TA 1K4YA 2FG6C 3UWKA 4BQQA 4F4IA 4H2DA 3G6WA 4XA8A 4P33A 2IFTA 5ARDA 1Y80A 4YP7A 4IDQA 5IDYA 3S2EA 2P75A 4WK2B 1UEJA 1Q0SA 4PLCA 4QFDA 5F52A 3O4VA 5KEIA 3TVDA 1XEFA 2HN9A 1UBSB 4QYIB 3ZU6A 5IULC 1KP2A 4OO3A 4GL2A 3NONA 4AYWA 4UNIA 4V39A 1I6MA 4BFZA 2Y0CA 1OBFO 5K0ZA 1NHGA 1L5RA 2I7VA 4M87A 4ZVPA 1E61A 2BW0A 3R5KA 4NS4A 2B5VA 1PT6A 2Y0EA 3GLRA 2VJBA 1XQWA 3GGGA 5JWHA 5A9RA 3F46A 4JC4A 4FZJA 3SXUB 4EHIA 4YQYA 3IIMA 3A31A 4EKGA 5JRZA 4X65B 2PH3A 1RD4A 1AQ6A 4BGVA 2AEMA 4XDHA 2G67A 1WBDA 3PIRA 4MWDA 1TU4A 4BFVA 2O19A 3NO4A 3ZDBA 4I36A 4PC1A 1E5LA 3ZWCA 5I6DA 1VCOA 4G09A 4UUAA 1TZMA 2H9IA 3M5WA 4WA7A 5CLGA 5FOWA 5C31A 2HDWA 2WBLC 1VXOA 5J1TB 1SVOA 1JU9A 3DWFA 4GR5A 4ZA2A 2FPGA 2IHKA 2QMHA 4WNCA 3TNLA 1C9JA 1PV2A 3BM5A 5AVKA 4H0NA 2X5OA 3CC8A 4LKOA 1P7VA 1Z2CA 2CYAA 4E5NA 1KZ7B 2Q2WA 2GPNA 2I7XA 3M4JA 3WK9A 4O2AA 3I92A 3KTDA 3MFQA 4YGYA 3GGJA 1X2EA 3BE8A 4AZWA 3QG1A 4OI2A 1BX3A 4DLYA 1NG1A 1GOTA 4HDNB 2CSUA 4I3GA 4KXFB 1VTKA 3GBVA 5AWFC 3A9SA 3LJKA 3E35A 1G8PA 2HR1A 2ID4A 1GNSA 3CO5A 1PGJA 5K51A 2R1VA 1GXSA 3G5AA 3RJ5A 1BFKA 1CR2A 3BTVA 4G4GA 4Y67A 1P5JA 5CR9A 3VR5D 2OAQ1 2OGSA 1NURA 4MKIA 1YS6A 1H05A 4BKOA 5TPZD 1TYBE 1JDBC 3N7UA 3PBKA 4DHWA 2ID8A 4CQMA 5KJ6A 2WUEA 4YAGA 2GR9A 4EKYA 4CJXA 1G21A 1TVMA 3AOEA 4H4CA 3WI7A 5ICEA 2W2PA 1CUDA 1NF9A 1R0ZA 3KUXA 3OURA 4BQRA 2DERA 2BOVA 2YMMA 4C07A 5BQOA 4XPIB 1BOOA 2GPYA 2GXQA 3VPGA 1PQPA 3UZUA 3M5DA 3ZGXA 3E5NA 2AEJA 2F1OA 5DT2A 3ZV7A 5J4LA 4Q3DA 4EB8A 5KHAA 1JH8A 3FPAA 3UGJA 3TEFA 1WZUA 3K0EA 4TXMA 2WIAA 2ZAMA 1BAPA 3U0VA 3ZE9A 1KI6A 4M2LA 4R41A 3SDZA 5JAMA 1PG5A 4RUKA 4JEUA 3O2SB 3L9WA 1FSZA 2FMUA 1WJGA 2R97A 1HO3A 2E1PA 5HQJA 3VDRA 3KVYA 3OJ0A 4GLBA 1ZC3A 2QTVA 4XWTA 3ELYA 3EEBA 1BS2A 1XZBA 3HDJA 4QRIA 2OP1A 2ANCA 3OEEA 2ZBDA 1E1NA 1QGYA 1YJAA 2VYCA 1ZGJA 5JROA 1RCFA 2BM8A 5AK3A 3B6EA 3VQTA 3AEYA 4XQGA 2FEXA 4C4YA 4E5KA 3RVOA 1C1DA 5AW4A 1Z08A 1JHDA 2GRUA 4AJKA 4E03A 1B8UA 4ZDKA 4IJWA 2MOKA 1X80B 3P52A 3RRZA 3EDYA 5BW6B 4JJIA 5DNDA 4UMFA 4RIIA 1FRNA 3OOWA 4OHPA 1EA7A 1M6HA 3B2QA 1PGOA 5FF9A 3GWGA 1A5AB 1H5UA 2FPMA 1YB1A 4HADA 1UBHS 1ZOOA 3U1VA 3LPAA 4KLZA 4PY2A 5D3MB 2QV0A 4RQAA 4LV8B 4I81A 4UCXA 5CVDA 1J1ZA 3DT8A 1KVQA 4OK3A 1A9YA 1BVHA 4HLUA 4P38A 5IAAA 3J7AC 1E2PA 3D6MA 1D09A 4MUJA 2HJRA 3L4SO 5EE5B 2OCIA 1U0OC 1I0LA 3BWDD 3O91A 1N2CB 4IXNA 1ZG3A 5FR2A 4GPZA 3PWTA 4JBHA 3WQQA 4JJ8A 3E03A 4RH0A 2Y1KA 1WDWB 1LKZA 3GUUA 4EH1A 2O54A 4LC0A 4BKMA 3ROKA 3DTVD 2CXTA 2JLRA 4IUCS 5BOSB 4OFXA 5H9VA 5EP4A 1UJ4A 3VI4B 2J3JA 4ED9A 4ZD6A 2Y1DA 1AT1A 2VR1A 3DHVA 2I67A 3HCAA 5HTKA 4NFYA 5C34B 4ZIRB 1YO6A 2J5QA 4OOEA 3ENWA 3ABQB 4YI5A 5ECYA 2Z9CA 4UTZA 3B1ZA 5LP6F 1BH6A 1JAZA 1KOFA 1N8KA 1OQAA 1I1OA 1ULSA 4QEKA 3TSZA 2J5XA 2FPSA 2YV2A 3MTEA 2WJAA 4LOAA 3VR1A 4GP9A 8OHMA 3A3OA 1I1QB 4CM1A 1PJ8A 5IS2A 4QJ3A 1T2EA 4ZOQI 2HHCA 4JP5A 3KL4A 4RD0A 1NYLA 1BCRB 3NHMA 4OX9B 2RAVA 3SP1A 1Z22A 4J94A 1Z3IX 4UMEA 5TMDA 3I61A 3DLTA 1Y3AA 2V8BA 3UJNA 1C3OB 3H8JA 5CJJA 4ND1A 1HNWB 2IUSA 3JQCA 5HQ3B 4UXJA 3COVA 4OGGA 2FUG6 4K8RB 3EJ6A 3P94A 4PNEA 3M1YA 4N5HX 2CHFA 1X7ZB 1Z37A 1XVVA 5EIBC 1VLLA 3VSDA 5EERA 1P39A 1NLFA 5B3JC 4YLEA 1CUZA 5C3UA 5CDGA 5MGBA 5TY0A 1E77A 2FLKA 2PR2A 2PWPA 3A3YA 3IIKA 3RJZA 2ZTVA 3QLTA 2X41A 1HWYA 2ASEA 4XOIA 4YAUA 1HEIA 1NMEA 2VPYA 3LHKA 2GDJA 4D9NA 3DT6A 3ASZA 2EJCA 2IW1A 3DBRA 2HIMA 5AM1A 3B5EA 4BLQA 5LQRA 4PYOA 4G8BA 2GVDC 4QFCA 3ORRA 4B9EA 7ADHA 4LJ5A 2WHQA 2Q2OA 3AF5A 1UBUS 4JDPA 1LNZA 3SSMA 1E3QA 3VSBA 4BB9A 3EQ6A 1IZ0A 5CK5A 3W78A 3G8BA 3AF2A 4BNZA 4ND8A 3JRNA 4ND4A 4A91A 2NO6A 3BFVA 3MXOA 1KJIA 5BNWA 1WEHA 5CD9A 1IY0A 3E70C 4QYWA 4YJ3A 4UTNA 4KFCA 4M1QA 2W6ID 4HXFB 4PVCA 3E3OA 3A9VA 2GT1A 1A7UA 3CZMA 3FLMA 4RE5A 4ZPXA 3DXYA 3TVTA 3NP7A 4YP6A 1E64A 5BSRA 3DFFA 1KSJA 1EX1A 2HFJA 1NM5A 1BMDA 1X7YB 3B1KA 3DUFA 4KDFA 5CH8A 4EUNA 5F7JA 5BYKA 1CV2A 4PYIA 2PS1A 1S7CA 3AB8A 3WB0A 5LKAA 1CUYA 5COQA 3UJ6A 1V47A 5DYNA 4CCSA 2W6ZA 3BX1A 4CM9D 4B6OA 3HFRA 1QJ4A 3WJ2A 3ZJYA 1H66A 3JASB 4XKJA 1Q0LA 5BSGA 3N2IA 1TMYA 2BYTA 4MW9A 4Q7QA 4AURA 2CL7X 3VZQA 1AKMA 4Q4JB 2WV7A 2QX9A 4L9WA 5LYJA 1UPXA 4DILA 1SCUB 4PIMA 4M0CA 2GLTA 3UAYA 3KUKA 1E2UA 4IJUA 1P7WA 4MW2A 4E5PA 5KYUA 4GRAA 5FPTA 3T5DA 1OLXA 1U2GC 4BFTA 2AJTA 5KTNA 4WLNA 2KLBA 5DKFA 4QLOA 3MINA 2QRNA 2JH9A 3LX8A 4J6EA 4W1SA 1XCGB 1Y1TA 3DLAA 1Q92A 3OTIA 1W581 2IPLA 5HGJA 2ZYTX 3GGCA 4QLAA 2OQIA 1FFCA 2AFVA 2CMKA 5FTJA 3A1DA 1UFOA 4TWBA 1KI7A 3VPAA 5C32A 4B44A 1CY1A 2H8GA 2BMAA 2BBSA 4HDRA 3ESRA 3JVUA 4KNVA 1SUFA 1Z28A 4WY2A 2IS4A 2XJ4A 3A4IA 1A88A 3I9OA 4TLAA 2XI4A 4MKXA 1IN1A 2CK3A 3RVSA 4JLJA 5KI6A 4L74A 3IPLA 4QXPA 3RVPA 4DG9A 2PA3A 2GD0A 2HSWA 4DLVA 3VNSA 5DLPA 5J1SB 3KJFA 1AKUA 2PS0A 4YK7A 4DRZA 3P5BA 1FQOA 1ZM2A 1NOJA 3UF0A 3AWIA 4HH4A 2BF4A 1KS2A 4DMUB 3Q7PA 1OWOA 2WTEA 3H19A 4JIMA 3IJ5A 5EMKA 2O3TA 2QS9A 3K9QO 5JSQA 1TL7C 5G0TA 3RI3A 1W52X 4JT8A 4ZOBA 5EXSA