4QPQA

Mechanistic basis of plasmid-specific dna binding of the f plasmid regulatory protein, tram
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
50
structure length
50
Chain Sequence
AKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic Basis of Plasmid-Specific DNA Binding of the F Plasmid Regulatory Protein, TraM.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords Relaxosome protein TraM
total genus 13
structure length 50
sequence length 50
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.450 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4qpqA00
4QPOA 4QPQA 3OMYA 1DP3A
chains in the Genus database with same CATH superfamily
4LJZF 1R7JA 2KJBA 4S0HB 5J4YA 4GO1A 2NVYJ 3CP8A 3VWBA 1B6AA 2DA2A 1YHQI 4UUTA 2BV6A 2OQRA 4BHBA 4A3CJ 4FX4A 2GIZA 3FBNB 3AAFA 4G12A 2MH9A 3JSPA 5TISC 4UVAA 1R58A 1W4MA 4OIPF 2LMDA 2KPMA 4RLQA 4BKXA 4YRVA 3E5XA 3CC4I 2ZXJA 1QZZA 1ZKGA 1V5GA 1B59A 4N9IA 3L2RA 5CVUA 5E1WA 4UUSA 3JRGA 5TRDA 2W24A 1E0EA 4CXFA 1LFUP 4EV0A 1F43A 3OY9A 4G9YA 1B8IA 4NBQA 2F4MB 1H89C 2UXXA 1Y0NA 1W7PD 5FD5A 1T38A 2L7KA 1HSJA 2CUFA 2YS9A 4EJUA 1ZN2A 1YX3A 5DUIA 5M5YJ 3P9IA 3MWMA 5ICEA 1WJDA 2W1OA 4PFOA 2DDBA 3ZMTA 3VFZA 2FUG2 1E3PA 2DXIA 1Y8QB 4EEFG 3RKQA 4Z2YA 2LFBA 1HA8A 1Z05A 5J47A 1SVOA 2AHQA 2L3DA 3KYLA 4E7KA 3P5JA 3FDYA 4ASNA 5EG0A 3A0HC 3O3KA 3MMYB 3RPUA 1MJBA 4BXUA 1TWGJ 2Y31A 4HNTA 5LHHA 3PFYA 1APLC 1Y8RB 2RQQA 3MKZA 2F4IA 1ITYA 2K02A 4R79A 4D9JA 4Y7NJ 2R7OA 1WGXA 5D8KB 1IV6A 4EJTA 2QZ8A 2FRHA 3KZYA 4II2A 3LSJA 1A6QA 5FJ8J 2EPFA 4YG2F 4NC7A 3B02A 1X4OA 3T1BA 1V4RA 5BPIA 3T8RA 2DMTA 2ZMEB 4KISA 2IAIA 2VQHA 1VQ5I 2D2WA 2CFOA 4KJZA 3QP6A 4HQEA 1JKPC 5LGNA 5LEKA 2LBFB 1ZARA 4LK1F 2R5ZA 1D0XA 1P6RA 2JWTA 3T0YA 2DTZA 3M07A 3A1YA 4JX6A 1Q1VA 1R9TJ 3ASOH 4CICA 4ZYHA 2XIGA 3VYTB 4LLLA 2P4WA 3PFIA 2XAGA 3GX4X 1FSHA 5LRRA 3PUBA 1SD5A 2NS7A 5J4VA 3K4BA 2X1DA 1LFPA 1ENHA 4M3GA 4HDVA 3PL8A 1BIBA 1VQ7I 3IKVA 5IP9J 1NTCA 4B48A 3HKZN 4D7NA 2XSDC 3S2WA 2IS4A 1MMDA 1B72A 3OS1A 4XRSA 4GGGA 4F7ZA 4PGGA 4M6XA 4FCYA 4M9ZA 4N9HA 4U88A 2L9NA 2AQFA 4RMNA 1QPIA 2A6HF 3EDPA 2ME6A 4DGWB 2VE9A 1IXRC 1PVEA 3ZOBA 2X4HA 3LMMA 4OMZA 5IT9Z 2KKOA 1R00A 2HTJA 1R71A 1JHHA 4MO7A 2EIJH 5BOXA 4R8HA 1I27A 3MAJA 2XB0X 2A07F 4BUPA 2W85A 2QEXI 1G2HA 1Z0XA 3OS2A 2E1CA 1P2FA 2Z3YA 3QOEA 4PUSA 4GCVA 1EA3A 1BA5A 2L7MP 3GBGA 3M8JA 3BPVA 4OINF 1PP8F 5KCMA 3LSIA 3HUGB 3ZN1A 2CU7A 2KZGA 2DK8A 2M2EA 3FXUA 3L2QA 5L3DA 3FHNA 1R22A 1JTXA 2FNPA 2IA1A 5F0CA 3B6CA 1BI3A 2H94A 3MQ0A 4U7BA 4RA2A 1H0MA 1K61A 1XGMA 1VQ9I 5HS8A 1UG2A 5LLQA 4BU2A 2QGUA 3H35A 3QPTA 2F2EA 3WGGA 2P5LC 2ESHA 1IF1A 1I5ZA 5IOZA 1YO5C 4P9FA 1RC9A 3TBIA 2M34A 1Z21A 2DCEA 1BBYA 4ZZDA 2LREA 2O5RA 2K9MA 4D5CA 3WE2A 5GAHJ 1IZ1A 1IGNA 3DPTA 1SFKA 2JUCA 2I5UA 4UHTA 3U1KA 3SJMA 2CV0A 1ULYA 3EETA 2Z9OA 2XB5A 1BR4A 3W6KB 3L00A 5J1RA 2VXDA 1KU2A 3L2CA 2XDVA 2LY2A 5FROA 5K5QA 1EF4A 2AS5F 1EH6A 2QKMB 1R5HA 2DO7A 3BG9A 4LB6B 1CQTA 1U8RA 4ZDPA 2W82A 5E3OA 3CCEI 2K5CA 3CCSI 5H6RA 2R7UA 2DA4A 5FKOA 2HXIA 3HRTA 3G1OA 3H0GJ 2IGNA 3J7AY 2DFFA 1OKRA 1UCRA 1XS9A 1F1ZA 2EA4A 4B09A 2MC3A 4ON0A 2UV1A 3C1DA 3F21A 4LIUA 1JUPA 2JA8J 3GFMA 1TNTA 2HYJA 2QUFA 1OCPA 2GWRA 1RUNA 1ZGWA 4O3MA 3L2UA 3BR6A 3S32A 3BOQA 4I0BA 3S17J 3BCAA 1IN5A 1FMWA 1XGSA 1X3WB 2GQQA 1ZHFA 1J59A 2Y30A 1SEUA 2BHYA 2ZJQF 3CJNA 3GVAA 4A3GJ 1SD4A 2JVGA 3QU3A 1S29A 4XLCA 2X6OA 4CCJA 3JR9A 2CS3A 1ZG3A 2FOWA 1ZG5A 3JRCA 5TGTA 2R5YB 2YX7A 1U5TA 1MJ9A 2HKOA 3F0CA 2DOEA 3BQZA 2KP6A 2O8XA 2E7WA 2HQNA 3K70D 4KUMA 1MDMB 4G7OF 5J8FA 2A6EF 4YFXF 2HWVA 2V9VA 1Y39A 4QPQA 1D1CA 1XB4A 4M3BA 3O8HA 1VQNI 4XRFA 3NRVA 2Z16A 1RUOA 4EM1A 3HM5A 1B9MA 5L3FA 4BBSJ 2DYRH 4FE4A 5E1XA 3DU5A 1TBXA 2Z1DA 3SEZA 1O7FA 2PX9A 1KQ0A 2X6YA 2PFBA 1UB9A 4OIQF 4ETSA 1R1UA 2VQGA 1USSA 2BYVE 2PEXA 3KIOA 4U87A 3S8PA 4IOCF 2MFZA 3VEPA 4Y52J 2BY3A 4KIGA 2HZTA 3COAC 1BL0A 4C2UA 2DFHA 1YOVB 2R7WA 1EKEA 3I53A 2DK5A 2JA2A 2VKHA 4EGYA 1QA6A 5KHDA 3FK6A 5DDGA 2FA5A 3GCMA 1HOMA 1R1TA 1TWHJ 2OA4A 5B1AH 1F4KA 3GTMJ 4L9JA 3KLNA 1DGRM 2GAUA 3FMQA 1I1GA 3HHGA 4Y4RA 3JCUC 1W36D 3SHFA 5GAEJ 1QHGA 3BJAA 3DBHB 3K1NA 3D5LA 2NS0A 5ILUA 3J81K 3AL0C 2EIMH 2IVMA 1O4XA 2GA2A 2JJ7A 3M1EA 2CW7A 4PZJA 4XKCA 4A0XA 1VQMI 2QQ9A 5H2FC 1LB2A 2K85A 3SZTA 3H5AA 3WODF 1S8NA 1QRYA 1DDNA 3I59B 4L9NA 4NQWB 3DQVC 3E6DA 3GFIA 1FP2A 4IXAA 4ZYAA 2DN0A 3G4SI 1TLHB 1LPQA 4J01A 2HDWA 3E0JB 1UG0A 1JUSA 3GFJA 3OWTA 4E7IA 2HFHA 4DYQA 2V6EA 3TO6A 4XLEA 4GYGA 1RIOH 5FB2A 1JKRC 2DQLA 1P4XA 3LQRA 4NDLA 3RSNA 3PIPF 4V2GA 3QYBA 1KZHA 2QQAA 3KP5A 2E60A 5EEAA 2IRFG 4Y33A 2PJRB 2DYSH 4Q5SF 3BZCA 1S7EA 2OPTA 2QM3A 2BVLA 4S04A 3OIPA 4BL0B 2V79A 2L2OA 3KP7A 2NNNA 3ML6A 3ROUA 3DTIA 5E79C 3N05A 3QAHA 4IEJA 3L2VA 2DT6A 3TO9A 4HG2A 4HDUA 2JZYA 4BJ6C 3QQAA 4LFUA 1VNDA 2Y75A 1XX5A 1J09A 2ZFWA 1FJLA 2X6XA 4ZDLA 2KIMA 1W7PA 1W5CC 2KJCA 5GTHC 4NNJA 3BR3A 5L3EA 3CUOA 1ONVA 5M5WJ 2EK5A 3CDLA 4F92B 4KDPA 4MQ9F 4K2EA 3DBLB 3SFIA 1D0ZA 1KU3A 3H5RA 3CC2I 1T56A 2WAQN 2QSHX 2MD5A 3E3VA 2LKXA 1MNMC 4Y3OA 5FKKA 2QVOA 3ZGKA 2WAQA 5IPAA 3FX3A 1FOYA 4UB8C 3EYYA 2E19A 1G4DA 2E1MC 3ZQFA 4BDYA 3HDDA 3BCBA 4B4CA 2XGEA 3QYFA 1IC8A 3UKGA 5IYCJ 5HLHA 2DMNA 1H88C 2WAEA 1MMGA 2CFXA 2MA3A 1OCZH 1MBJA 4N4OB 4HLYA 1G6NA 1JTYA 3LL7A 4CCLA 2L7ZA 2VT2A 3I3LA 4AIDA 3LNQA 2LNBA 4G6QA 3K1MA 4G8XA 2EWNA 2X48A 5F08A 1IN6A 2VL8A 3E6BA 1TQMA 4DYRA 4PFPA 3CZ6A 5L3CA 4ENKA 4NC6A 4ESFA 4FASD 2HYFA 4CZCA 2HPMA 2OUMA 1CF7A 4A3MJ 3U1DA 2EINH 2L54A 2XASA 4Q4ZF 3L09A 4NUBA 1WJEA 4FETA 1WHUA 2X85A 3TKYA 4NHJA 2MD0A 3C2BA 4LG0A 1PUFA 5EZGA 3DTKA 3EUAA 3ZMDA 1X1BA 5JFRA 4M6YA 1T6SA 1ZGAA 1RNLA 4MFEA 1HC8A 2WV0A 1O7LA 5E8IA 1SD6A 2HR3A 1FOKA 3AG1H 1RKTA 1FMVA 2AXTC 4I01A 1I6HJ 4EMSA 3ZMSA 3BZKA 2NRAC 1FTZA 2L02A 1GLNA 3RYRA 1Z3XA 4B8XA 2WB1A 2P81A 4LITA 3DTEA 2ZBKA 3DPLC 3X2QH 3K4CA 4EJOA 5JVGF 2LG4A 1R49A 2NS8A 3S15J 1BOAA 2EZLA 3CJQB 4HRIA 2JVHA 2IGOA 3RPUD 3J80K 2F6CA 1T98A 4XN3A 2DFEA 3LWFA 4LD5A 3FKJA 1KQ9A 1X19A 2ELJA 5AIPA 2KRFA 2FQ4A 2NVTJ 1D8KA 4HSTA 1ZH5A 1P4WA 2CV2A 3F8BA 2HXOA 2M3AA 3M9AA 3WTUC 1FEXA 1ODDA 2JT1A 2AXLA 1W0TA 4AC0A 1REPC 2F5FA 3M1CA 3JRFA 3D1NI 2VIXA 4AIJA 1XDUA 2XSJC 3V4GA 1CGPA 4W1UA 2OF7A 1R6RA 2OC6A 1Y6IA 2QLZA 2OZ6A 2EJRA 3CCQI 5CLSA 1ETXA 3B73A 4RAFA 4PCQA 4KITB 2VBYA 3CCYA 2R7VA 2EFNA 3ABTA 2JPBA 3ESWB 4OAZA 4HBLA 3SZPA 4GDFA 3CMYA 1EH8A 3H3VK 5K5RA 1ZG1A 1D0YA 1GDTA 2E1OA 5HDNA 1HW1A 5HODA 1JKOC 3HBLA 2HVSA 5CPRB 2FJ1A 2XPWA 3MZYA 1LDKB 3WTYC 3FMSA 3QOPA 1L3LA 1N75A 5KK1A 3LFKA 4MTEA 4A0ZA 5HNHA 2JQ7A 5B1BH 2WV1A 3V7SA 2OTJI 3P7NA 1YRNA 3FWEA 3PJRA 3KEYA 3CCRI 2FE3A 2RC4A 4P9UA 1LEBA 1VI0A 1EV7A 1YE9A 4U0WA 3GZ5A 4LOCA 3RZOJ 1R5ID 4XONA 2TDXA 3HC7A 3OOUA 1U6GA 3P9CA 3JSOA 4Y17A 3R60A 4UXNA 1JT0A 1TNSA 1HF0A 3Q0UA 5M3MJ 5FKMA 3JW4A 4AVZA 2LF7A 1YJNI 1ZK8A 1BM9A 2LVSA 4RGUA 1PUFB 4IRIA 2K3PA 4RM3A 3I55I 2VC0A 4OU0A 4PDKA 3DU6A 4CA0A 1USTA 2M0MA 5HDKA 4F55A 1SFUA 3OL3A 3JAMZ 2OZUA 2OD5A 2R3SA 2ECCA 3CMMA 1U0JA 1FBUA 1C0WA 1JGSA 2DLLA 4CCMA 3ZQQA 3H1CA 5J6XA 2FBKA 4C2MJ 3O2PE 3RIRA 3OSGA 4QSHA 4E70A 1GV5A 1YS7A 3QP5A 3HPHA 4I0AA 3HEFA 1ETQA 2KRCA 2LDUA 3HG9A 4CUGA 3KETA 2HZDA 5F1JA 4YEJA 4D5FA 2HDCA 3JAMK 1N78A 4EM2A 4BEHB 1Z6TA 4F93B 4YFKF 1SAUA 3K2AA 4KIFA 2O61A 2E71A 2STTA 2H09A 3LA2A 1GUUA 4G6TB 2EQRA 4N0BA 3ZXSA 5JHFA 4MQVA 4RS8A 2XF6A 2L7FP 5FFXA 1H8AC 4HZFA 3DKXA 2R7TA 1ZELA 4BY1J 3S16J 1OCRH 2DI3A 2VN2A 3S1RJ 4R1HA 1TQPA 2JRTA 4CO8A 2FOKA 1IXCA 1GXPA 1RR7A 1XGNA 2LKPA 1X3ZB 2DA7A 3IUOA 2W57A 1Y1VJ 3RKXA 1P7IA 2QQ8A 5HVQC 4BXFA 1ZGJA 2L4AA 3E5UA 1IN8A 4MNUA 3ZQ7A 2VBWA 2ZB9A 2V1XA 4JP0A 1XD7A 3ERMA 4IRHA 1AHDP 2EA2A 3J7AO 2MYSA 1I6XA 5D5WB 3CDHA 3BC8A 3ZR8X 2CJJA 1WJCA 2OTLI 4MHGA 3ZQCA 4V2FA 1STZA 3AL0B 5LFAA 1FIPA 4XBFA 2PLYA 4ZC3A 1MKMA 2O9LA 2V6CA 4HSRA 4ITVA 2BVMA 5IT9K 2PMUA 5IYDJ 2J5PA 2F5DA 1P4AA 2H1LA 4AWXB 1OMIA 3RQIA 1ORKA 3AG2H 1IRGA 2HOEA 2A61A 2DA5A 5EGOA 4ZYGA 4IHTA 4AD9A 2KDZA 3L2WA 1TQIA 2H27A 3M4OJ 2M7BA 1HLVA 3K9TA 1XMXA 5FO5A 2JPCA 3F8FA 1MH3A 1P7JA 4BEHA 5DM6F 2ZJRF 1O57A 2G7UA 1GHCA 2P8TA 2HOAA 4UV9A 2MGQA 4HNVA 3V7CA 3E6MA 2WTEA 1CF7B 2ZSIB 3TOBA 1HDDC 1R36A 3IWFA 3OR2C 2STWA 3G73A 2EIKH 3I59A 1FX7A 4DZJA 1B1BA 3BTLA 1JJ8C 5ICFA 1WPKA 2MLGA 1IG7A 1HW5A 3DLLF 2VE8A 3CC7I 2HQAA 1QVUA 1DU6A 1YITI 1HKSA 2ZJ2A 3U9GA 4BACA 3BG3A 3C2GA 4XKVA 3TO7A 5GTIC 2HS5A 5E18F 3HUGA 5KAIC 2ZKZA 3DWLE 4BQNA 3VOEA 4MEXF 3CO6C 2V1NA 4O5VA 5GAGJ 2VUMJ 3F23A 2ESNA 1QBJA 1W7PB 1TT0A 5C3EJ 2V26A 4O6JA 2ISZA 3HZJA 1PP7U 3RCOA 3E1SA 3SDGA 5ED4A 2EFPA 1H9TA 1KGSA 4A0YA 1F36A 2KDOA 5DCMA 2VBZA 1TL8A 3G3ZA 2TRTA 2KL4A 5HDGA 2K9LA 4C3HJ 4IRGA 2OV7A 3J81Z 3QU6A 4XLHA 1FTTA 1OR7C 5H20A 4AIKA 1YFHA 2D45A 5H6QA 4XNFA 5F27A 2B9SA 4A2UA 2DA6A 2CQ7A 4PGHA 3R4KA 1D5VA 1MIJA 2DMUA 3I64A 4HA8A 3SXYA 3CLQA 1WCMJ 2DODA 2QYOA 3TP3A 4FE7A 5ILSA 4M6VA 2NYXA 2V7FA 3CLOA 2E5NA 3FXLA 2P5KA 1FZPB 1XSVA 5IYBJ 2BW3B 3IWZA 3DEUA 5D5UB 3DFGA 2R0QC 4HW0A 4ZZLA 2B0LA 3BG7A 3K2ZA 2H6BA 5EYRA 1TC3C 4RB3C 4XOTA 2W84A 4UUSB 3ZQLA 1B9NA 3OV8A 2MG4A 3A02A 2Q0OA 1ZLJA 2WC2A 2ID3A 3FF5A 3A01B 4L5JA 3TDUC 2DAOA 3PIOF 4CCKA 1D1AA 2R7DA 2JMWA 1D8JA 1TW2A 1V55H 1X4PA 4XLAA 4BE1A 2H6CA 2EILH 3PNTA 5ILVA 3HYIA 3DKWA 3OYLA 1OFCX 2DTRA 5CVIA 2LY1A 1ETOA 1T2KA 5K7ZA 5CQEA 3HGYA 1UMQA 1BJAA 2KT0A 4HV5A 1YX5A 3OMYA 5FFZA 2OBPA 1ETWA 5AIQA 3W2WA 4I2OA 4BE0A 3ZP5A 1YW7A 4OWRB 3A2KA 2XV4S 4BAYA 1QHHD 2P6SA 2EV5A 5E3NA 3CCMI 4LK0F 3OYAA 2HVQA 1WSUA 3HXLA 4ZYEA 3RQ4A 1DP7P 4IOAF 3KP4A 2BW3A 3KX2A 3OIQA 2L01A 2XAUA 2IT0A 3HOZJ 3IH4A 1KU9A 4JOMA 5HLGA 2NVXJ 2GXGA 4F91B 2FEZA 2ZMEA 3CESA 3KEQA 5CJ9A 4XICA 2GM4A 2Y0MA 4C3JJ 5BMZA 3A4CA 2HKXA 2LY9A 4JYKA 3OYIA 1MNEA 1W5SA 3MKYB 3S3OA 4B47A 3PO2J 5D4RA 3V8JA 3GEZA 3H3ZA 2XAHA 2Q2EA 3F8MA 3PSFA 2O0YA 2BOLA 3TP0A 2X9DA 1JXSA 5LHGA 1RR8C 5C4XJ 1U9NA 1U5TC 1WH7A 3HSEA 4DW6A 1G3SA 2A5YB 4ZJZA 2K3FA 2M45A 5DEQA 4A3EJ 2GA1A 3F9KA 2JRMA 2XGXA 3GXOA 1X1PA 2VODA 5KNLA 2R7QA 2BY2A 1QZYA 2K86A 4RDUA 4CCOA 3IC7A 1E3HA 1SD7A 4BQOA 4M9XA 2OCEA 2VASA 3BR5A 4RB0A 3S1NJ 4DIQA 3NWSA 2XF5A 5LGTA 1BR2A 2VLAA 2VC1A 1VQ6I 2FMYA 4DNCA 1FSEA 2DPUA 2F5CA 5F64A 4XLPF 2CO5A 2CQNA 1DQUA 2HNHA 5BS6A 2O6GE 3H3UA 3H9GA 3L9FA 4RLFA 3LSPA 2GOMA 3TQNA 3BTCA 1FIAA 1NK2P 2IA2A 1Z67A 3V8LA 1TZLA 3MVPA 2QKLB 4JQFA 2LSOA 3BLYA 1LUJB 5E3MA 4OMYA 3AFHA 3K4LA 3PUFA 3VSKA 1QNTA 3R0AA 2VJ5A 4QPOA 3BTIA 1Y1WJ 2XRLA 3E5QA 3MD2A 3WTTC 1X3UA 1RETA 1ETVA 4E7ZA 4RAYA 1DP3A 4KMUX 4DBQA 3BDDA 1I3AA 2M30A 4KT5C 2H8RA 5JLXA 3G71I 3WGHA 1R4MB 1JUMA 5A2QK 1HXDA 2CW8A 3DF8A 4LG3A 1NH3A 2QENA 4RB2C 2K7LA 1E2XA 1YJWI 3QODA 4DBRA 1VQOI 4LB5A 2COBA 2R4GA 4RB1A 3VYRB 1OCTC 2XKPA 1YW8A 2KQRA 2ZC2A 1PDNC 1FBQA 2GXBA 4BNCA 2QSGX 2NVQJ 3GTOJ 3EUHA 3KPHA 3Q9VA 1U5TB 4ENMA 4ZH4F 2BGCA 2PBIA 5A2QZ 2E1MB 4HPQA 4XK4A 4ZYDA 4ZTFA 2Y69H 4A3IJ 1VQKI 4HX4A 2YUSA 4RBOA 3BY6A 1ZREA 4UY8I 1ETYA 5J3LA 3ZCOA 3SFZA 5GPAA 4UUVA 1WJBA 1K6YA 3BZ6A 2KHMA 2LF8A 2CG4A 3FM3A 3NWTA 4BE2A 3G1LA 3RI4A 2CQXA 4CGZA 2N8GA 3U21A 3WU2C 3F6VA 1OYYA 4ESBA 4LMYA 1YIJI 1RESA 4BGDA 2O7OA 3MKLA 1KYWA 3UNGC 2R7XA 3LSHA 1QPMA 2V1DA 3V7RA 2COMA 3ULQB 3KE2A 5K7HA 4M3FA 1LVKA 2W00A 2C6YA 3GLXA 1Z7LA 2R5ZB 3HOSA 2HU9A 3K10A 5E20A 4GXOA 2P6TA 2XPVA 4QWQA 1IN7A 3HB9A 3WU0A 2W48A 2FD5A 2K9NA 4BY7J 2Z33A 4AVPA 5EJCA 4IO9F 9ANTA 5J40A 2PMZA 2HPIA 2IP2A 3VPRA 1OCOH 3WTZA 3HRUA 4I09A 1K79A 3C7JA 3OYCA 2DW4A 3I56I 1F9NA 3KCCA 1SVMA 3FMRA 1OISA 2DT7B 1FPQA 1R1VA 3BTJA 3TMOA 2Z5UA 1J9IA 1X1CA 2ID6A 5K1YA 3CO7C 2E34A 3M3YJ 2DJIA 1XTAA 1NG6A 4M3EA 5GPCA 2R7FA 5D5XB 1SANA 4UV8A 2K9QA 2XUBA 3V42A 2K4BA 2WBMA 2XRNA 3L7WA 1O3TA 5IY5H 3K7AJ 3IAM2 1JGGA 2ZSHB 1BJZA 1WVRA 4A6EA 4DOZA 1F5TA 3WTWC 1BR1A 2M8GX 2ZNZA 5L3BA 4Z6YA 1YQAA 2JUGA 4UVBA 1UJ8A 2NOJB 2VKEA 2L0KA 5DTDA 1IRZA 2QF7A 2FMLA 3H92A 2Y0SN 5JHUA 2ECBA 3H36A 3KEOA 2Q1ZB 4XL9A 1RKWA 4P5OA 1GVDA 1TWFJ 4I6ZA 1OCCH 1WZ2A 4BBRJ 4Y15A 1IRFA 4KIBA 1NHAA 2DJNA 3LSGA 2ZFUA 4CZZA 3DPUA 3Q0WA 3G2BA 3A03A 4BHCA 4KMFA 3EPZA 3IH2A 4IHVA 3NARA 3TGNA 5C44J 2RNGA 1XCBA 2IA0A 4F52A 2EH3A 3WTXC 3WU1B 2RDPA 2I8DA 4E6KG 1MDMA 2D5VA 3TL4X 2W4SA 1BC7C 2EZKA 2UWMA 3CCVI 3F72A 4MEYF 2CH0A 2WWYA 4WF2A 2O03A 2BY1A 2QA4I 4JX5A 3IP4B 2V4JC 2CWEA 3H0DA 3N97A 3N4MA 2RQPA 1TW3A 1WQ2A 1FNNA 2DA3A 3KLOA 1Q1HA 3CUQC 1BW6A 1OPCA 4YIFA 4E7HA 1NG7A 2M4GA 1D1BA 2M87A 1VFCA 2DOFA 3D5SC 5FLMJ 2R7RA 2LOOA 2BZTA 2B7EA 4B43A 4QTRA 4E7JA 1TTYA 3ZPLA 2JN6A 4LIVA 3EQLF 4LLGF 2YR2A 3H9JA 3BG6A 2XPUA 3FZVA 3T5XA 2QBYA 1S3JA 2ELHA 4HX8A 1D5YA 3M8EA 3ZQGA 1IXSB 3HSFA 4CYCB 5KVRA 3ABMH 1ON1A 4M72A 2PJRA 1JHFA 3E7LA 1QGPA 3M7GA 3I0TA 1G3YA 1UHSA 2KZVA 2DDAA 1HKQA 4AIHA 1Z91A 2PN6A 3GTGJ 1S5LC 3Q3SA 5EEGA 1N25A 1AKHB 3OYNA 2VOOA 1J2XA 2A6TA 2D1HA 3LSKA 2VQLA 2R93J 1IRXA 1VQ8I 2R92J 4I02A 2EB7A 4X1EA 4HV6A 2P7CB 2FNAA 4ANJA 4KFCA 4WX9A 2BY0A 4IL6C 2JK3A 1JT6A 4WXDA 4YFNF 2VQCA 3BJOA 2LRDA 1FWZA 1AA7A 1DPRA 1MBFA 4EQQA 1K83J 3QWLA 3IHUA 3ERED 3OR1C 5FGMA 2BE5F 3CUQB 1JJ6C 4UVCA 1S9HA 2EV0A 1R23A 5D6FA 2FBHA 4G7ZF 1D3YA 2A05A 1MMSA 5LEJA 1HDPA 1U3EM 2JA7J 1SMYF 3FXOA 3K4MA 2K40A 3S3NA 3FXJA 2W7NA 3ZMZA 3BG5A 2IEKA 3FBIB 2P5VA 4XKBA 1LJ9A 1XC5A 3HHHA 4MLOA 1ZQ3P 4A93J 4C3IJ 5IP6A 3OYMA 2IW5A 1NK3P 2CUZA 3RDIA 2IGKA 5F04A 1AKHA 5ICGA 4H0EA 1SFXA 3CF5F 4C9YA 2G9WA 1XMKA 1IW7F 1MBKA 2LH9A 2E2IJ 3HPGA 1IUYA 1Z9CA 3HTSB 5E3LA 1WWXA 1ZLKA 2NVUB 3KP2A 2KFDA 3O8GA 1S7OA 3JRDA 2ZJPF 3OYBA 3FK7A 2O3FA 3EYIA 3LAPA 2RREA 2UUZA 4PK4A 3VODA 3ZMUA 1YLFA 2P0WA 2QBYB 2ZXWH 4B3AA 2EZIA 2ZO4A 2GOXB 4L9TA 3GTQJ 3ZQHA 5E1ZB 4A69C 2V1UA 5E17F 2E2JJ 3GW2A 3E6CC 1XSDA 1TWCJ 1IDYA 1V5EA 3BWGA 3WGIA 5ERIA 4RGXA 3A0BC 3F22A 4C2TA 1AU7A 2XHKA 4DYCA 1QQIA 3OSFA 1WH5A 4TV7A 3RZDJ 1WKMA 3GTLJ 3AKZA 2ZCWA 1BOBA 2M1BA 2QQBA 1Z3YA 4XLNF 1BN5A 3LQQA 1T39A 2DPDA 3ECHA 5DCFA 4CDGA 5EEHA 1UAAA 4XR6A 1BI0A 3S1MJ 4ENNA 4I98B 1VF9A 3LFUA 4KA4A 1MBHA 3VSLA 2A69F 4RAZA 1W5TA 1Z7UA 1WJAA 2VT3A 3HOUJ 3OOPA 4HAMA 2R7ZJ 3JRAA 1XMAA 3J7ZI 4RGRA 1B4AA 3I4NJ 3CCJI 3MKWB 5FRMA 2HQ5A 4NC8A 2VKDA 3F6OA 2V9KA 3HOVJ 1HSTA 2JTVA 1A04A 4KT6A 5L3GA 2Z99A 1YI2I 4D7MA 1E17A 2M4KA 2LLKA 2HEOA 2F4OB 3Q0VA 3IRQA 1U8BA 2VXZA 3FXMA 1T08B 2X1CA 2CV1A 5M3FJ 1GT0C 4HF2A 1O3RA 2EZHA 1MJAA 4BQQA 3JTGA 1E3OC 5F0FA 1LE8A 3GMEA 5EDNA 4J00A 1LEAA 1ZRFA 2L9VA 2BXZA 5CQGA 4IF4A 1LDJA 3HGGA 1Y56A 4EM0B 1G8XA 1YG2A 1UHMA 1U9OA 2VJJA 1K6OA 1KA8A 1WRJA 3R0JA 4KN4X 3ASNH 3WG7H 3B6AA 1HKTA 1BC8C 4XOPA 4ZTJA 3DV8A 5FRNA 5EGOB 2YX4A 3IRRA 2PI0A 4PSXA 2IBDA 3ZMVA 4XN0A 2MABA 3ABKH 1KONA 2ACJA 4H4KC 3QYEA 2AQEA 2A3SA 4P55A 5DUKA 1Z77A 3CUQA 3R61A 4HF0A 3W3CA 4A3KJ 2VJ4A 4BXXJ 3HIFA 4CYCA 4BH9A 3MCZA 1A36A 4IHSA 3FM5A 3NQOA 1MD0A 3CJTB 1MZBA 2VB6A 3SQNA 1UELB 1QVTA 1WI3A 4M73A 2GIVA 4KNYA 5LHIA 3EUKL 3RTRA 4MFDA 5CVVA 4NQWA 3KZZA 4GYIA 2B63J 3BT9A 2WADA 3ISPA 1A31A 3S3MA 3FHZA 1YRNB 1P9QC 1XG1A 1MMAA 4JX4A 3J80Z 3CD6I 1IN4A 3VDXA 4XLFA 1JE8A 3K4NA 2FSWA 4S05A 5JI6A 5J8CA 2RNJA 3I4PA 3S2DJ 3BQYA 1VTNC 4MGRA 1IUFA 1J0RA 3CMEI 5BNGA 1T0FC 1V3FA 5HLIA 3SDBA 1DPUA 2E1NA 1I3QJ 4AUXA 2DMQA 3GZ6A 3GLLA 1FBSA 1HCRA 4XM3A 1MBGA 2Z2SB 1GXQA 4JK1X 2X1EA 4HYEA 2ZNYA 4Q48A 3QPHA 2XGCA 3SYTA 3W6JB 1I1SA 4B44A 4IKFA 2Y9YA 1XPXA 1POGA 2YU3A 1DU0A 2OQGA 2H1KA 1FC3A 1ZR4A 4XORA 2DBBA 2ETHA 1OYWA 3LSTA 2HDDA 1KYZA 4LGWA 2DQRA 5LD2C 4EVIA 2HVRA 4OAYA 2F5EA 3FXKA 5EZHA 1ZYRF 1LKXA 2NAZA 2DT5A 3GTPJ 2VBXA 1QU3A 1SFEA 2HI3A 3KP3A 2GXAA 3GFLA 1Y0UA 1FY7A 2WY7Q 3C18A 1O3QA 3WTSC 2IS1A 3AG3H 2DFIA 4XRMA 2LTPA 4BQAA 4P1WA 1X58A 2FF4A 4DZPA 2FXAA 3CJRB 4F3QA 1K78A 2L4MA 4OIOF 3PO3J 2AO9A 2JA6J 2EFWA 3EUHC 3TEDA 3LA7A 1MSFC 1FYLA 1T95A 4L5IA 5D8LB 1IV8A 1YW9A 3D0SA 3DLAA 1B72B 4I7HA 4BS9A 2FU4A 2IJLA 2MW8A 4PSWA 4EGZA 2RN7A 4EATA 2X0LA 3PNVA 3S1QJ 3CDIA 3O6BB 2FQ3A 2Y9ZA 4WWCA 3F3XA 4N4NB 1J5YA 4XMYA 4D1QA 4FT8A 3K70C 4WCGA 3MFKA 1A5JA 3K0LA 4KYWA 2KIFA 5C4JJ 4G7HF 4UNOA 4V19K 3OYJA 3FXRA 5HNFA 3F8NA 2MBFA 2MC4A 3K4JA 1G3TA 4IPAA 3NEUA 1BW5A 1FYKA 2W25A 2KMUA 2X6WA 4CSWA 4G94A 3BR2A 5CYVA 3ABUA 2DOAA 3BR1A 3S93A 3IV5A 3TW6A 1I50J 1IJWC 4X0GA 3SEQA 1WJ5A 2L9RA 4XIDA 3VYSB 1FP1D 1YTYA 1YJ9I 4RGSA 4HF1A 5E8GA 1AOYA 1T8IA 2M9HA 3GWZA 1RI7A 4GRIA 4HX7A 3V8KA 4IJAA 3CCLI 3OYKA 4A3LJ 1KQ8A 1R5GA 2PMZN 1S72I 2E5ZA 3CCUI 4IHWA 2VJIA 1WFXA 3JRIA 1LNWA 1Z6RA 3GO5A 3W6VA 2Q2EB 5BQTA 2DA1A 2VOPA 1W0UA 2IXSA 4A5MA 5EG0B 2HGCA 2LP0A 3IL2A 1OYIA 3QPSA 2HOTA 2PG4A 1P92A 5HLTA 4BJ5C 3HKZA 1TP4A 5B5EC 1LQ1A 1ETKA 4Y13A 3H5NA 4P96A 1VZ0A 4HNUA 3GTKJ 4XSXF 2G0EA 4ZDOA 2RGVA 3WE3A 2GLOA 2E7XA 2BXYA 2RKHA 3PM1A 2NXNB 1SAXA 4L5EA 1S6LA 1I39A 3GUDA 4A3BJ 4RAGA 3SZGA 4E7SA 2I10A 2PMHA 1SC7A 1M1EB 4UB6C 4L0ZB 1HQCA 1V54H 3TDZC 2L5QA 1Z1DA 5LRSA 5JVTA 5BPDA 1RZ4A 2CUEA 5F1RA 5K7FA 3HL2A 4A3DJ 3ZQIA 4BYYA 3K1PA 1FOWA 3D5RC 1KU7A 1MW7A 4A3FJ 1LVAA 2L9SA 4U0VA 4JBAA 4E7LA 2ZMEC 2MLKA 3RKYA 5DD8A 1K4TA 4IHXA 1J7KA 1X1AA 3OIOA 1SVLA 1T33A 5FKNA 5J1YA 4MIMA 3HOWJ 2EFQA 1YIOA 2M7AA 4IVNA 1OR7A 4G6DA 1RPWA 2CQQA 3MZ8A 2HYGD 4U7DA 1PJRA 4LG0B 1AWCA 3H9QA 4BHPA 5B3SH 1QZEA 3WHCA 1YS6A 1U78A 2QCOA 3Q5FA 3GF2A 4OIRF 1MNDA 1LFBA 4HLXA 3ONQA 4CYDA 1H9GA 3G1MA 4QIWN 3A01A 1IDZA 2HTSA 4W97A 2BHZA 3LAJA 5IP7J 2XKOA 2EV6A 4A3JJ 4II3A 4PJLA 1TWAJ 4PJJA 2V9PA 3LOCA 3T8TA 2E2HJ 2M0CA 1UFMA 2A68F 1R4NB 2PQ8A 4YIRX 1BIAA 1XN7A 1W1WE 2ISYA 3G6EI 2X51A 2Y48A 1MGTA 3S2HJ 1LE8B 4IQ4A 2NOGA 3FKIJ 4FISA 1UZCA 4I76A 1ZAOA 1UHWA 1MSEC 5JLWA 3KYDB 3OYGA 2UZKA 2EBIA 3HOYJ 3DEWA 2CQKA 4ESJA 3PSIA 4C30A 2LYCA 4WXCA 5AONA 2YU9J 3RKWA 3DXJF 4WXHA 3MZHA 5EF6A 5GADJ 3KYCB 4LLNA 3R6SA 5ICCA 2RV8A 3HOXJ 1FT9A 2KRHA 3BJ6A 3REOA 1BI1A 5LGUA 2DU9A 5IOYA 2ZXIA 2F5VA 2KIUA 3QPLA 1QO0D 3DKYA 5DYMA 3OYFA 4HOBA 4XSZF 2CW0F 2K27A 3C2HA 3ABLH 3CMAI 4I99C 4XRSG 1OQYA 1HW2A 1SFOJ 3FISA 2RAEA 3HSRA 3CQZJ 2WAFA 4HQMA 1X1DA 5FD6A 1JI8A 2GBYA 3RJPA 5HS7A 5TJJA 5D5VB 4M71A 2WA0A 5HS9A 4KICA 2F48A 4AM3A 4BJTA 3BROA 2IS2A 2VI6A 3KP6A 1S7AA 5LBQA 4FX0A 1K7AA 3QRFF 2HQRA 1DUXC 2R5YA 3DCFA 2VPRA 3IH3A 3GZNB 2JSCA 5HOOA 3MN2A 1BI2A 2KIQA 4HEA2 2MH2A 2GZWA 3W2VA 4IQJA 1G59A 4A5NA 4EJWA 2XAFA 4KN7X 2JSPA 4CCNA 1XGOA 2LD5A 1B8IB 5JR3A 2IGMA 3RPQA 5D4SA 5F6FA 1ERDA 1ZRCA 3FIWA 5KAFC 3F8CA 5DS9A 1ON2A 3FXQA 4NB5A 1MMNA 2IS6A 2ZXHA 2EFOA 2DMPA 5F0HA 1OJLA 5FLVA 5J1UA 2A5WA 1A35A 2D1VA 3RYPA 4PJMA 5DCMB 4M3DA 3BPXA 5B66C 1PUEE 3CF2A 1PYVA 3Q9SA 5CVRA 1SMTA 4YIIA 2NNYA 2VPLA 3OYDA 4RM2A 2TCTA 1MH4A 2XAJA 3IAS2 3HRSA 3UR3C 4IX7A 4FQGA 2ME0A 4X6AJ 3LSMA 4D0PA 1EJ9A 3U2RA 2OJED 1X2MA 3JRHA 5GP9A 2JA5J 2G7HA 1FLIA 1MBEA 3KZIC 3PQKA 3CTAA 3DEEA 1N77A 2UXNA 2CMPA 1XSXA 4PJNA 4U0YA 2FX0A 3WG9A 3GTJJ 4AU7A 2WY8Q 2XC7A 1ZRDA 1K78B 3K6GA 4XQFA 5CVJA 2CRGA 5K5OA 2OCCH 1HBXG 2ADUA 2E36A 4DQ2A 3OYHA 4A12A 2VONA 3S14J 5FLXK 1ZR2A 4L0YB 2OU2A 2K9SA 1GVJA 2RVCA 1JKQC 1OLTA 1T0FA 3VB2A 4ABZA 2XGDA 3PQJA 3HOTA 1IO2A 3VYUB 2OAZA 3I71A 3IKTA 3C3WA 3I9V2 3JTHA 3LA3A 3GYHX 1VQ4I 2Q8KA 2LK2A 1FYMA 3HRMA 2YSRA 2LR8A 2E35A 4A6DA 5FLXZ 2MSYA 4L18B 1U2WA 3HJEA 3TW7A 3BR0A 2O8KA 4YELA 1FOXA 3OS0A 2K4JA 2CYYA 3NAUA 3W2AA 1RRJA 2XAQA 1WI9A 3J7YJ 2R7SA 3K4KA 1DGWY 3I54A 2XVCA 3K69A 1GV2A 3PNYA 5DM7F 3JREA 1VQPI 2LC2A 5M5XJ 1O3SA 2J5OA 2Y0SA 3DP7A 1A6IA 3KFWX 5CKTA 2YPRA 4FHTA 3TOAA 4BDZA 2P7VB 3AG4H 2CGPA 4EJVA 2BBYA 5DD4A 3BP8A 4CH7A 2FBIA 4CHUA 3WHBA 1TT5B 3CP2A 2CUJA 2LKSA 4QLCU 4WK8F 2KLOA 4DJAA 1XDSA 3P9KA 3WTVC 4OOIA 1J75A 4E4HA 2PJPA 4J19A 1V5FA 2IPQX 2VKVA 3ELKA 1L0OC 3ZRGA 1VQLI 3M8FA 4IZZA 3OL4A 4AYBN 3ZN0A 1K4SA 4M74A 3E97A 2ELKA 3DBRB 3L1PA 3HTUA 2M8EA 1G3WA 3MEXA 1W36C 2LBFA 1YYVA 2CSOA 1XCVA 3LSRA 4XKWA 4AYBA 4MTDA 1IAWA 2ICWG 4M9SA 3I4MJ 2QSFX 5D6EA 5DV5A 4Q47A 3JRBA 2M5WA 4IHYA 2XF7A 6PAXA 4B1RA 1LDDA 4FTHA 2WB1N 1ACIA 2HOSA 1X2NA 4L9VA 2BEOA 1WJFA 2H8WA 2QWWA 1EH7A 3ECOA 2KISA 3I58A 3I5UA 4PJ0C 5FKLA 5IT3A 2XROA 2Y2ZA 1ZTRA 4GFBA 4ENJA 4B3XA 3OYEA
chains in the Genus database with same CATH topology
1T0FC 4NUBA 1WJEA 4FETA 3SDBA 1TZLA 3CP8A 2QKLB 2X85A 4JQFA 3VWBA 3BLYA 4XM3A 2Z2SB 2MD0A 2X1EA 3AFHA 3K4LA 3VSKA 3FBNB 2VJ5A 4QPOA 3DTKA 3EUAA 3SYTA 1X1BA 3MD2A 4B44A 4IKFA 4E7ZA 1DP3A 2KPMA 4RLQA 4YRVA 4DBQA 1FMVA 4XORA 1V5GA 1GLNA 3L2RA 1Z3XA 2CW8A 4LG3A 5LD2C 2HVRA 2WB1A 4OAYA 1E0EA 4LITA 3DTEA 3OY9A 3DPLC 3K4CA 2LG4A 1LKXA 3QODA 1QU3A 4DBRA 2WY7Q 2R4GA 2L7KA 3CJQB 2JVHA 2IGOA 3VYRB 4HRIA 3RPUD 2IS1A 2KQRA 2F6CA 1YX3A 4XN3A 3FKJA 1WJDA 1X19A 2ELJA 4P1WA 2W1OA 4PFOA 3CJRB 2E1MB 4HPQA 4F3QA 4ZTFA 4HSTA 3EUHC 2FUG2 2DXIA 2CV2A 2M3AA 1T95A 3ZCOA 1HA8A 3KYLA 1WJBA 4E7KA 1K6YA 3M1CA 2KHMA 2VIXA 3DLAA 3FDYA 3NWTA 3MMYB 2XSJC 4BS9A 4BE2A 4HNTA 1R6RA 3PFYA 4PSWA 3U21A 4EATA 2RQQA 2OC6A 1Y6IA 3PNVA 3MKZA 2F4IA 4R79A 4D9JA 2R7OA 4N4NB 4KITB 4XMYA 4D1QA 4BGDA 4II2A 3K70C 2R7VA 3UNGC 2R7XA 4OAZA 3LSHA 4NC7A 1X4OA 3OYJA 5HNFA 2MC4A 1LVKA 2W00A 3K4JA 1D0YA 1Z7LA 4KISA 2VQHA 3HOSA 4CSWA 2KMUA 2X6WA 2HU9A 3K10A 2CFOA 4KJZA 2DOAA 2LBFB 3S93A 2HVSA 5CPRB 4X0GA 3SEQA 1WJ5A 1D0XA 1LDKB 3VYSB 3A1YA 1N75A 5HNHA 2PMZA 2HPIA 3VYTB 3PJRA 3KEYA 3OYCA 4GRIA 3PUBA 1YE9A 3OYKA 3K4BA 4XONA 2X1DA 2E5ZA 3HC7A 3OOUA 2VJIA 2DT7B 1LFPA 1WFXA 3PL8A 3TMOA 1X1CA 4B48A 2Q2EB 2IS4A 1MMDA 2DJIA 2IXSA 1NG6A 3OS1A 4AVZA 5HLTA 4BJ5C 3HKZA 2L9NA 2AQFA 4RMNA 3V42A 3H5NA 4DGWB 2K3PA 4RM3A 1VZ0A 2WBMA 4HNUA 3DU6A 3LMMA 4ZDOA 4CA0A 3IAM2 2ZSHB 4DOZA 2M0MA 1BR1A 4F55A 3OL3A 3SZGA 4E7SA 4BUPA 3CMMA 2JUGA 1U0JA 2NOJB 4CCMA 3OS2A 3ZQQA 2L5QA 3QOEA 4PUSA 2Q1ZB 4XL9A 4P5OA 1EA3A 3GBGA 3M8JA 3HL2A 3HPHA 3D5RC 1MW7A 5KCMA 3HG9A 2KRCA 4CUGA 2L9SA 3LSIA 3HUGB 2HZDA 3LSGA 2ZFUA 4E7LA 3DPUA 4YEJA 3L2QA 3G2BA 1X1AA 3FHNA 1N78A 3EPZA 4BEHB 4F93B 4U7BA 2M7AA 4BU2A 1SAUA 2RNGA 1PJRA 4F52A 3H35A 3H9QA 4G6TB 3ZXSA 2I8DA 5JHFA 4E6KG 2XF6A 3TBIA 3DKXA 3TL4X 2W4SA 2R7TA 1ZELA 1Z21A 2DCEA 2UWMA 2LREA 2O5RA 2K9MA 1MNDA 3DPTA 1SFKA 3ONQA 2CH0A 2CV0A 3IP4B 1BR4A 2V4JC 3H0DA 2VXDA 2XDVA 2LY2A 5FROA 3IUOA 2QKMB 4II3A 4PJLA 5HVQC 4BXFA 4E7HA 1NG7A 2M4GA 1D1BA 2W82A 4PJJA 4ZDPA 3D5SC 2R7RA 2K5CA 2LOOA 4B43A 4E7JA 2R7UA 2MYSA 4LIVA 2X51A 3BC8A 3H9JA 2IGNA 3ZR8X 3BG6A 3J7AY 1WJCA 4IQ4A 3AL0B 2PJRA 3OYGA 2UV1A 5LFAA 4LIUA 4ZC3A 4HSRA 2KZVA 4ITVA 2BVMA 3PSIA 4C30A 2LYCA 3L2UA 3S32A 3OYNA 3BCAA 1FMWA 2A6TA 3LSKA 2KRHA 2VQLA 3L2WA 1IRXA 2M7BA 2JVGA 4BEHA 2ZXIA 4XLCA 4ANJA 4CCJA 2F5VA 2CS3A 3DKYA 5TGTA 3OYFA 3C2HA 2KP6A 2ZSIB 3K70D 3OR2C 2VQCA 2LRDA 1AA7A 4QPQA 1D1CA 2HQAA 2WAFA 1X1DA 1JI8A 3OR1C 1S9HA 2WA0A 4BACA 3C2GA 2Z16A 4XKVA 4BJTA 2IS2A 3DWLE 4BQNA 3DU5A 3K4MA 2Z1DA 3SEZA 3S3NA 2W7NA 5HOOA 2X6YA 3FBIB 2V1NA 4XKBA 4HEA2 4IQJA 3W2VA 2VQGA 1G59A 4CCNA 2JSPA 4MLOA 1TT0A 2V26A 2IGMA 4U87A 3S8PA 3OYMA 2MFZA 3RCOA 3E1SA 2CUZA 1ERDA 4C2UA 2KDOA 2IGKA 2KL4A 4C9YA 2R7WA 2IS6A 1MMNA 2K9LA 2ZXHA 2JA2A 2VKHA 2LH9A 2OV7A 4XLHA 5KHDA 1OR7C 3HPGA 2A5WA 4PJMA 4XNFA 3CF2A 1PYVA 2VPLA 3OYBA 3OYDA 1DGRM 2RREA 2UUZA 4PK4A 2P0WA 4RM2A 3IAS2 4Y4RA 3UR3C 1W36D 4IX7A 1QHGA 2V7FA 2GOXB 2E5NA 3D5LA 3AL0C 3LSMA 2BW3B 1V5EA 2CW7A 4XKCA 4C2TA 3DEEA 3BG7A 1N77A 3AKZA 1BOBA 2CMPA 4XOTA 4PJNA 1Z3YA 3H5AA 4AU7A 2WY8Q 2XC7A 3K6GA 4NQWB 3DQVC 4XQFA 1UAAA 4ZYAA 4XR6A 4CCKA 1D1AA 3OYHA 4J01A 2HDWA 1X4PA 3LFUA 4XLAA 3VSLA 4BE1A 3PNTA 1OLTA 1UG0A 1WJAA 3E0JB 3OYLA 3OWTA 4E7IA 2LY1A 3VYUB 3HOTA 2V6EA 3I9V2 5CQEA 3MKWB 5FRMA 4NC8A 2VKDA 2V9KA 4KT6A 4XLEA 1YX5A 3OMYA 2M4KA 3RSNA 3QYBA 3W2WA 2E60A 4BE0A 2VXZA 4OWRB 4Y33A 2CV1A 2X1CA 2PJRB 3A2KA 4YELA 1QHHD 2BVLA 3OS0A 3OIPA 4BL0B 4BQQA 2L2OA 3DTIA 3OYAA 3W2AA 2HVQA 3N05A 3L2VA 2DT6A 3HXLA 3RQ4A 4HG2A 4BJ6C 2R7SA 4J00A 3K4KA 1DGWY 2BW3A 3KX2A 3OIQA 3PNYA 5CQGA 2XAUA 2LC2A 1Y56A 4JOMA 1J09A 1G8XA 4F91B 2X6XA 2Y0SA 2VJJA 3CESA 4ZDLA 5CKTA 3A4CA 4BDZA 4NNJA 4XOPA 4ZTJA 4CH7A 5FRNA 3OYIA 1MNEA 3S3OA 3MKYB 4F92B 4B47A 4PSXA 3CP2A 4XN0A 2CUJA 3PSFA 2MABA 1D0ZA 3H5RA 1KONA 2KLOA 4DJAA 2BOLA 4H4KC 3QYEA 2AQEA 4Y3OA 4E4HA 3W3CA 1V5FA 3ZGKA 2WAQA 2VJ4A 3ZRGA 4ZJZA 2E1MC 4IZZA 4BDYA 3OL4A 3BCBA 3F9KA 2VB6A 1UELB 3QYFA 5KNLA 2R7QA 1W36C 2LBFA 2WAEA 3EUKL 3RTRA 1MMGA 4XKWA 4N4OB 4AYBA 4CCOA 4CCLA 3LL7A 4BQOA 3I3LA 2VASA 2WADA 3S3MA 2XF7A 4DIQA 2VL8A 1P9QC 2XF5A 3NWSA 1MMAA 1BR2A 4PFPA 2VLAA 3VDXA 3CZ6A 4XLFA 1WJFA 3K4NA 4FASD 2HPMA 4CZCA 2OUMA 1DQUA 2HNHA 3H9GA 4RLFA 2GOMA 4B3XA 3OYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QPO A;  4QPQ A;  3OMY A;  1DP3 A; 
#chains in the Genus database with same CATH topology
 4LJZ F;  1R7J A;  2KJB A;  4S0H B;  5J4Y A;  4GO1 A;  2NVY J;  3CP8 A;  3VWB A;  1B6A A;  2DA2 A;  1YHQ I;  4UUT A;  2BV6 A;  2OQR A;  4BHB A;  4A3C J;  4FX4 A;  2GIZ A;  3FBN B;  3AAF A;  4G12 A;  2MH9 A;  3JSP A;  5TIS C;  4UVA A;  1R58 A;  1W4M A;  4OIP F;  2LMD A;  2KPM A;  4RLQ A;  4BKX A;  4YRV A;  3E5X A;  3CC4 I;  2ZXJ A;  1QZZ A;  1ZKG A;  1V5G A;  1B59 A;  4N9I A;  3L2R A;  5CVU A;  5E1W A;  4UUS A;  3JRG A;  5TRD A;  2W24 A;  1E0E A;  4CXF A;  1LFU P;  4EV0 A;  1F43 A;  3OY9 A;  4G9Y A;  1B8I A;  4NBQ A;  2F4M B;  1H89 C;  2UXX A;  1Y0N A;  1W7P D;  5FD5 A;  1T38 A;  2L7K A;  1HSJ A;  2CUF A;  2YS9 A;  4EJU A;  1ZN2 A;  1YX3 A;  5DUI A;  5M5Y J;  3P9I A;  3MWM A;  5ICE A;  1WJD A;  2W1O A;  4PFO A;  2DDB A;  3ZMT A;  3VFZ A;  2FUG 2;  1E3P A;  2DXI A;  1Y8Q B;  4EEF G;  3RKQ A;  4Z2Y A;  2LFB A;  1HA8 A;  1Z05 A;  5J47 A;  1SVO A;  2AHQ A;  2L3D A;  3KYL A;  4E7K A;  3P5J A;  3FDY A;  4ASN A;  5EG0 A;  3A0H C;  3O3K A;  3MMY B;  3RPU A;  1MJB A;  4BXU A;  1TWG J;  2Y31 A;  4HNT A;  5LHH A;  3PFY A;  1APL C;  1Y8R B;  2RQQ A;  3MKZ A;  2F4I A;  1ITY A;  2K02 A;  4R79 A;  4D9J A;  4Y7N J;  2R7O A;  1WGX A;  5D8K B;  1IV6 A;  4EJT A;  2QZ8 A;  2FRH A;  3KZY A;  4II2 A;  3LSJ A;  1A6Q A;  5FJ8 J;  2EPF A;  4YG2 F;  4NC7 A;  3B02 A;  1X4O A;  3T1B A;  1V4R A;  5BPI A;  3T8R A;  2DMT A;  2ZME B;  4KIS A;  2IAI A;  2VQH A;  1VQ5 I;  2D2W A;  2CFO A;  4KJZ A;  3QP6 A;  4HQE A;  1JKP C;  5LGN A;  5LEK A;  2LBF B;  1ZAR A;  4LK1 F;  2R5Z A;  1D0X A;  1P6R A;  2JWT A;  3T0Y A;  2DTZ A;  3M07 A;  3A1Y A;  4JX6 A;  1Q1V A;  1R9T J;  3ASO H;  4CIC A;  4ZYH A;  2XIG A;  3VYT B;  4LLL A;  2P4W A;  3PFI A;  2XAG A;  3GX4 X;  1FSH A;  5LRR A;  3PUB A;  1SD5 A;  2NS7 A;  5J4V A;  3K4B A;  2X1D A;  1LFP A;  1ENH A;  4M3G A;  4HDV A;  3PL8 A;  1BIB A;  1VQ7 I;  3IKV A;  5IP9 J;  1NTC A;  4B48 A;  3HKZ N;  4D7N A;  2XSD C;  3S2W A;  2IS4 A;  1MMD A;  1B72 A;  3OS1 A;  4XRS A;  4GGG A;  4F7Z A;  4PGG A;  4M6X A;  4FCY A;  4M9Z A;  4N9H A;  4U88 A;  2L9N A;  2AQF A;  4RMN A;  1QPI A;  2A6H F;  3EDP A;  2ME6 A;  4DGW B;  2VE9 A;  1IXR C;  1PVE A;  3ZOB A;  2X4H A;  3LMM A;  4OMZ A;  5IT9 Z;  2KKO A;  1R00 A;  2HTJ A;  1R71 A;  1JHH A;  4MO7 A;  2EIJ H;  5BOX A;  4R8H A;  1I27 A;  3MAJ A;  2XB0 X;  2A07 F;  4BUP A;  2W85 A;  2QEX I;  1G2H A;  1Z0X A;  3OS2 A;  2E1C A;  1P2F A;  2Z3Y A;  3QOE A;  4PUS A;  4GCV A;  1EA3 A;  1BA5 A;  2L7M P;  3GBG A;  3M8J A;  3BPV A;  4OIN F;  1PP8 F;  5KCM A;  3LSI A;  3HUG B;  3ZN1 A;  2CU7 A;  2KZG A;  2DK8 A;  2M2E A;  3FXU A;  3L2Q A;  5L3D A;  3FHN A;  1R22 A;  1JTX A;  2FNP A;  2IA1 A;  5F0C A;  3B6C A;  1BI3 A;  2H94 A;  3MQ0 A;  4U7B A;  4RA2 A;  1H0M A;  1K61 A;  1XGM A;  1VQ9 I;  5HS8 A;  1UG2 A;  5LLQ A;  4BU2 A;  2QGU A;  3H35 A;  3QPT A;  2F2E A;  3WGG A;  2P5L C;  2ESH A;  1IF1 A;  1I5Z A;  5IOZ A;  1YO5 C;  4P9F A;  1RC9 A;  3TBI A;  2M34 A;  1Z21 A;  2DCE A;  1BBY A;  4ZZD A;  2LRE A;  2O5R A;  2K9M A;  4D5C A;  3WE2 A;  5GAH J;  1IZ1 A;  1IGN A;  3DPT A;  1SFK A;  2JUC A;  2I5U A;  4UHT A;  3U1K A;  3SJM A;  2CV0 A;  1ULY A;  3EET A;  2Z9O A;  2XB5 A;  1BR4 A;  3W6K B;  3L00 A;  5J1R A;  2VXD A;  1KU2 A;  3L2C A;  2XDV A;  2LY2 A;  5FRO A;  5K5Q A;  1EF4 A;  2AS5 F;  1EH6 A;  2QKM B;  1R5H A;  2DO7 A;  3BG9 A;  4LB6 B;  1CQT A;  1U8R A;  4ZDP A;  2W82 A;  5E3O A;  3CCE I;  2K5C A;  3CCS I;  5H6R A;  2R7U A;  2DA4 A;  5FKO A;  2HXI A;  3HRT A;  3G1O A;  3H0G J;  2IGN A;  3J7A Y;  2DFF A;  1OKR A;  1UCR A;  1XS9 A;  1F1Z A;  2EA4 A;  4B09 A;  2MC3 A;  4ON0 A;  2UV1 A;  3C1D A;  3F21 A;  4LIU A;  1JUP A;  2JA8 J;  3GFM A;  1TNT A;  2HYJ A;  2QUF A;  1OCP A;  2GWR A;  1RUN A;  1ZGW A;  4O3M A;  3L2U A;  3BR6 A;  3S32 A;  3BOQ A;  4I0B A;  3S17 J;  3BCA A;  1IN5 A;  1FMW A;  1XGS A;  1X3W B;  2GQQ A;  1ZHF A;  1J59 A;  2Y30 A;  1SEU A;  2BHY A;  2ZJQ F;  3CJN A;  3GVA A;  4A3G J;  1SD4 A;  2JVG A;  3QU3 A;  1S29 A;  4XLC A;  2X6O A;  4CCJ A;  3JR9 A;  2CS3 A;  1ZG3 A;  2FOW A;  1ZG5 A;  3JRC A;  5TGT A;  2R5Y B;  2YX7 A;  1U5T A;  1MJ9 A;  2HKO A;  3F0C A;  2DOE A;  3BQZ A;  2KP6 A;  2O8X A;  2E7W A;  2HQN A;  3K70 D;  4KUM A;  1MDM B;  4G7O F;  5J8F A;  2A6E F;  4YFX F;  2HWV A;  2V9V A;  1Y39 A;  4QPQ A;  1D1C A;  1XB4 A;  4M3B A;  3O8H A;  1VQN I;  4XRF A;  3NRV A;  2Z16 A;  1RUO A;  4EM1 A;  3HM5 A;  1B9M A;  5L3F A;  4BBS J;  2DYR H;  4FE4 A;  5E1X A;  3DU5 A;  1TBX A;  2Z1D A;  3SEZ A;  1O7F A;  2PX9 A;  1KQ0 A;  2X6Y A;  2PFB A;  1UB9 A;  4OIQ F;  4ETS A;  1R1U A;  2VQG A;  1USS A;  2BYV E;  2PEX A;  3KIO A;  4U87 A;  3S8P A;  4IOC F;  2MFZ A;  3VEP A;  4Y52 J;  2BY3 A;  4KIG A;  2HZT A;  3COA C;  1BL0 A;  4C2U A;  2DFH A;  1YOV B;  2R7W A;  1EKE A;  3I53 A;  2DK5 A;  2JA2 A;  2VKH A;  4EGY A;  1QA6 A;  5KHD A;  3FK6 A;  5DDG A;  2FA5 A;  3GCM A;  1HOM A;  1R1T A;  1TWH J;  2OA4 A;  5B1A H;  1F4K A;  3GTM J;  4L9J A;  3KLN A;  1DGR M;  2GAU A;  3FMQ A;  1I1G A;  3HHG A;  4Y4R A;  3JCU C;  1W36 D;  3SHF A;  5GAE J;  1QHG A;  3BJA A;  3DBH B;  3K1N A;  3D5L A;  2NS0 A;  5ILU A;  3J81 K;  3AL0 C;  2EIM H;  2IVM A;  1O4X A;  2GA2 A;  2JJ7 A;  3M1E A;  2CW7 A;  4PZJ A;  4XKC A;  4A0X A;  1VQM I;  2QQ9 A;  5H2F C;  1LB2 A;  2K85 A;  3SZT A;  3H5A A;  3WOD F;  1S8N A;  1QRY A;  1DDN A;  3I59 B;  4L9N A;  4NQW B;  3DQV C;  3E6D A;  3GFI A;  1FP2 A;  4IXA A;  4ZYA A;  2DN0 A;  3G4S I;  1TLH B;  1LPQ A;  4J01 A;  2HDW A;  3E0J B;  1UG0 A;  1JUS A;  3GFJ A;  3OWT A;  4E7I A;  2HFH A;  4DYQ A;  2V6E A;  3TO6 A;  4XLE A;  4GYG A;  1RIO H;  5FB2 A;  1JKR C;  2DQL A;  1P4X A;  3LQR A;  4NDL A;  3RSN A;  3PIP F;  4V2G A;  3QYB A;  1KZH A;  2QQA A;  3KP5 A;  2E60 A;  5EEA A;  2IRF G;  4Y33 A;  2PJR B;  2DYS H;  4Q5S F;  3BZC A;  1S7E A;  2OPT A;  2QM3 A;  2BVL A;  4S04 A;  3OIP A;  4BL0 B;  2V79 A;  2L2O A;  3KP7 A;  2NNN A;  3ML6 A;  3ROU A;  3DTI A;  5E79 C;  3N05 A;  3QAH A;  4IEJ A;  3L2V A;  2DT6 A;  3TO9 A;  4HG2 A;  4HDU A;  2JZY A;  4BJ6 C;  3QQA A;  4LFU A;  1VND A;  2Y75 A;  1XX5 A;  1J09 A;  2ZFW A;  1FJL A;  2X6X A;  4ZDL A;  2KIM A;  1W7P A;  1W5C C;  2KJC A;  5GTH C;  4NNJ A;  3BR3 A;  5L3E A;  3CUO A;  1ONV A;  5M5W J;  2EK5 A;  3CDL A;  4F92 B;  4KDP A;  4MQ9 F;  4K2E A;  3DBL B;  3SFI A;  1D0Z A;  1KU3 A;  3H5R A;  3CC2 I;  1T56 A;  2WAQ N;  2QSH X;  2MD5 A;  3E3V A;  2LKX A;  1MNM C;  4Y3O A;  5FKK A;  2QVO A;  3ZGK A;  2WAQ A;  5IPA A;  3FX3 A;  1FOY A;  4UB8 C;  3EYY A;  2E19 A;  1G4D A;  2E1M C;  3ZQF A;  4BDY A;  3HDD A;  3BCB A;  4B4C A;  2XGE A;  3QYF A;  1IC8 A;  3UKG A;  5IYC J;  5HLH A;  2DMN A;  1H88 C;  2WAE A;  1MMG A;  2CFX A;  2MA3 A;  1OCZ H;  1MBJ A;  4N4O B;  4HLY A;  1G6N A;  1JTY A;  3LL7 A;  4CCL A;  2L7Z A;  2VT2 A;  3I3L A;  4AID A;  3LNQ A;  2LNB A;  4G6Q A;  3K1M A;  4G8X A;  2EWN A;  2X48 A;  5F08 A;  1IN6 A;  2VL8 A;  3E6B A;  1TQM A;  4DYR A;  4PFP A;  3CZ6 A;  5L3C A;  4ENK A;  4NC6 A;  4ESF A;  4FAS D;  2HYF A;  4CZC A;  2HPM A;  2OUM A;  1CF7 A;  4A3M J;  3U1D A;  2EIN H;  2L54 A;  2XAS A;  4Q4Z F;  3L09 A;  4NUB A;  1WJE A;  4FET A;  1WHU A;  2X85 A;  3TKY A;  4NHJ A;  2MD0 A;  3C2B A;  4LG0 A;  1PUF A;  5EZG A;  3DTK A;  3EUA A;  3ZMD A;  1X1B A;  5JFR A;  4M6Y A;  1T6S A;  1ZGA A;  1RNL A;  4MFE A;  1HC8 A;  2WV0 A;  1O7L A;  5E8I A;  1SD6 A;  2HR3 A;  1FOK A;  3AG1 H;  1RKT A;  1FMV A;  2AXT C;  4I01 A;  1I6H J;  4EMS A;  3ZMS A;  3BZK A;  2NRA C;  1FTZ A;  2L02 A;  1GLN A;  3RYR A;  1Z3X A;  4B8X A;  2WB1 A;  2P81 A;  4LIT A;  3DTE A;  2ZBK A;  3DPL C;  3X2Q H;  3K4C A;  4EJO A;  5JVG F;  2LG4 A;  1R49 A;  2NS8 A;  3S15 J;  1BOA A;  2EZL A;  3CJQ B;  4HRI A;  2JVH A;  2IGO A;  3RPU D;  3J80 K;  2F6C A;  1T98 A;  4XN3 A;  2DFE A;  3LWF A;  4LD5 A;  3FKJ A;  1KQ9 A;  1X19 A;  2ELJ A;  5AIP A;  2KRF A;  2FQ4 A;  2NVT J;  1D8K A;  4HST A;  1ZH5 A;  1P4W A;  2CV2 A;  3F8B A;  2HXO A;  2M3A A;  3M9A A;  3WTU C;  1FEX A;  1ODD A;  2JT1 A;  2AXL A;  1W0T A;  4AC0 A;  1REP C;  2F5F A;  3M1C A;  3JRF A;  3D1N I;  2VIX A;  4AIJ A;  1XDU A;  2XSJ C;  3V4G A;  1CGP A;  4W1U A;  2OF7 A;  1R6R A;  2OC6 A;  1Y6I A;  2QLZ A;  2OZ6 A;  2EJR A;  3CCQ I;  5CLS A;  1ETX A;  3B73 A;  4RAF A;  4PCQ A;  4KIT B;  2VBY A;  3CCY A;  2R7V A;  2EFN A;  3ABT A;  2JPB A;  3ESW B;  4OAZ A;  4HBL A;  3SZP A;  4GDF A;  3CMY A;  1EH8 A;  3H3V K;  5K5R A;  1ZG1 A;  1D0Y A;  1GDT A;  2E1O A;  5HDN A;  1HW1 A;  5HOD A;  1JKO C;  3HBL A;  2HVS A;  5CPR B;  2FJ1 A;  2XPW A;  3MZY A;  1LDK B;  3WTY C;  3FMS A;  3QOP A;  1L3L A;  1N75 A;  5KK1 A;  3LFK A;  4MTE A;  4A0Z A;  5HNH A;  2JQ7 A;  5B1B H;  2WV1 A;  3V7S A;  2OTJ I;  3P7N A;  1YRN A;  3FWE A;  3PJR A;  3KEY A;  3CCR I;  2FE3 A;  2RC4 A;  4P9U A;  1LEB A;  1VI0 A;  1EV7 A;  1YE9 A;  4U0W A;  3GZ5 A;  4LOC A;  3RZO J;  1R5I D;  4XON A;  2TDX A;  3HC7 A;  3OOU A;  1U6G A;  3P9C A;  3JSO A;  4Y17 A;  3R60 A;  4UXN A;  1JT0 A;  1TNS A;  1HF0 A;  3Q0U A;  5M3M J;  5FKM A;  3JW4 A;  4AVZ A;  2LF7 A;  1YJN I;  1ZK8 A;  1BM9 A;  2LVS A;  4RGU A;  1PUF B;  4IRI A;  2K3P A;  4RM3 A;  3I55 I;  2VC0 A;  4OU0 A;  4PDK A;  3DU6 A;  4CA0 A;  1UST A;  2M0M A;  5HDK A;  4F55 A;  1SFU A;  3OL3 A;  3JAM Z;  2OZU A;  2OD5 A;  2R3S A;  2ECC A;  3CMM A;  1U0J A;  1FBU A;  1C0W A;  1JGS A;  2DLL A;  4CCM A;  3ZQQ A;  3H1C A;  5J6X A;  2FBK A;  4C2M J;  3O2P E;  3RIR A;  3OSG A;  4QSH A;  4E70 A;  1GV5 A;  1YS7 A;  3QP5 A;  3HPH A;  4I0A A;  3HEF A;  1ETQ A;  2KRC A;  2LDU A;  3HG9 A;  4CUG A;  3KET A;  2HZD A;  5F1J A;  4YEJ A;  4D5F A;  2HDC A;  3JAM K;  1N78 A;  4EM2 A;  4BEH B;  1Z6T A;  4F93 B;  4YFK F;  1SAU A;  3K2A A;  4KIF A;  2O61 A;  2E71 A;  2STT A;  2H09 A;  3LA2 A;  1GUU A;  4G6T B;  2EQR A;  4N0B A;  3ZXS A;  5JHF A;  4MQV A;  4RS8 A;  2XF6 A;  2L7F P;  5FFX A;  1H8A C;  4HZF A;  3DKX A;  2R7T A;  1ZEL A;  4BY1 J;  3S16 J;  1OCR H;  2DI3 A;  2VN2 A;  3S1R J;  4R1H A;  1TQP A;  2JRT A;  4CO8 A;  2FOK A;  1IXC A;  1GXP A;  1RR7 A;  1XGN A;  2LKP A;  1X3Z B;  2DA7 A;  3IUO A;  2W57 A;  1Y1V J;  3RKX A;  1P7I A;  2QQ8 A;  5HVQ C;  4BXF A;  1ZGJ A;  2L4A A;  3E5U A;  1IN8 A;  4MNU A;  3ZQ7 A;  2VBW A;  2ZB9 A;  2V1X A;  4JP0 A;  1XD7 A;  3ERM A;  4IRH A;  1AHD P;  2EA2 A;  3J7A O;  2MYS A;  1I6X A;  5D5W B;  3CDH A;  3BC8 A;  3ZR8 X;  2CJJ A;  1WJC A;  2OTL I;  4MHG A;  3ZQC A;  4V2F A;  1STZ A;  3AL0 B;  5LFA A;  1FIP A;  4XBF A;  2PLY A;  4ZC3 A;  1MKM A;  2O9L A;  2V6C A;  4HSR A;  4ITV A;  2BVM A;  5IT9 K;  2PMU A;  5IYD J;  2J5P A;  2F5D A;  1P4A A;  2H1L A;  4AWX B;  1OMI A;  3RQI A;  1ORK A;  3AG2 H;  1IRG A;  2HOE A;  2A61 A;  2DA5 A;  5EGO A;  4ZYG A;  4IHT A;  4AD9 A;  2KDZ A;  3L2W A;  1TQI A;  2H27 A;  3M4O J;  2M7B A;  1HLV A;  3K9T A;  1XMX A;  5FO5 A;  2JPC A;  3F8F A;  1MH3 A;  1P7J A;  4BEH A;  5DM6 F;  2ZJR F;  1O57 A;  2G7U A;  1GHC A;  2P8T A;  2HOA A;  4UV9 A;  2MGQ A;  4HNV A;  3V7C A;  3E6M A;  2WTE A;  1CF7 B;  2ZSI B;  3TOB A;  1HDD C;  1R36 A;  3IWF A;  3OR2 C;  2STW A;  3G73 A;  2EIK H;  3I59 A;  1FX7 A;  4DZJ A;  1B1B A;  3BTL A;  1JJ8 C;  5ICF A;  1WPK A;  2MLG A;  1IG7 A;  1HW5 A;  3DLL F;  2VE8 A;  3CC7 I;  2HQA A;  1QVU A;  1DU6 A;  1YIT I;  1HKS A;  2ZJ2 A;  3U9G A;  4BAC A;  3BG3 A;  3C2G A;  4XKV A;  3TO7 A;  5GTI C;  2HS5 A;  5E18 F;  3HUG A;  5KAI C;  2ZKZ A;  3DWL E;  4BQN A;  3VOE A;  4MEX F;  3CO6 C;  2V1N A;  4O5V A;  5GAG J;  2VUM J;  3F23 A;  2ESN A;  1QBJ A;  1W7P B;  1TT0 A;  5C3E J;  2V26 A;  4O6J A;  2ISZ A;  3HZJ A;  1PP7 U;  3RCO A;  3E1S A;  3SDG A;  5ED4 A;  2EFP A;  1H9T A;  1KGS A;  4A0Y A;  1F36 A;  2KDO A;  5DCM A;  2VBZ A;  1TL8 A;  3G3Z A;  2TRT A;  2KL4 A;  5HDG A;  2K9L A;  4C3H J;  4IRG A;  2OV7 A;  3J81 Z;  3QU6 A;  4XLH A;  1FTT A;  1OR7 C;  5H20 A;  4AIK A;  1YFH A;  2D45 A;  5H6Q A;  4XNF A;  5F27 A;  2B9S A;  4A2U A;  2DA6 A;  2CQ7 A;  4PGH A;  3R4K A;  1D5V A;  1MIJ A;  2DMU A;  3I64 A;  4HA8 A;  3SXY A;  3CLQ A;  1WCM J;  2DOD A;  2QYO A;  3TP3 A;  4FE7 A;  5ILS A;  4M6V A;  2NYX A;  2V7F A;  3CLO A;  2E5N A;  3FXL A;  2P5K A;  1FZP B;  1XSV A;  5IYB J;  2BW3 B;  3IWZ A;  3DEU A;  5D5U B;  3DFG A;  2R0Q C;  4HW0 A;  4ZZL A;  2B0L A;  3BG7 A;  3K2Z A;  2H6B A;  5EYR A;  1TC3 C;  4RB3 C;  4XOT A;  2W84 A;  4UUS B;  3ZQL A;  1B9N A;  3OV8 A;  2MG4 A;  3A02 A;  2Q0O A;  1ZLJ A;  2WC2 A;  2ID3 A;  3FF5 A;  3A01 B;  4L5J A;  3TDU C;  2DAO A;  3PIO F;  4CCK A;  1D1A A;  2R7D A;  2JMW A;  1D8J A;  1TW2 A;  1V55 H;  1X4P A;  4XLA A;  4BE1 A;  2H6C A;  2EIL H;  3PNT A;  5ILV A;  3HYI A;  3DKW A;  3OYL A;  1OFC X;  2DTR A;  5CVI A;  2LY1 A;  1ETO A;  1T2K A;  5K7Z A;  5CQE A;  3HGY A;  1UMQ A;  1BJA A;  2KT0 A;  4HV5 A;  1YX5 A;  3OMY A;  5FFZ A;  2OBP A;  1ETW A;  5AIQ A;  3W2W A;  4I2O A;  4BE0 A;  3ZP5 A;  1YW7 A;  4OWR B;  3A2K A;  2XV4 S;  4BAY A;  1QHH D;  2P6S A;  2EV5 A;  5E3N A;  3CCM I;  4LK0 F;  3OYA A;  2HVQ A;  1WSU A;  3HXL A;  4ZYE A;  3RQ4 A;  1DP7 P;  4IOA F;  3KP4 A;  2BW3 A;  3KX2 A;  3OIQ A;  2L01 A;  2XAU A;  2IT0 A;  3HOZ J;  3IH4 A;  1KU9 A;  4JOM A;  5HLG A;  2NVX J;  2GXG A;  4F91 B;  2FEZ A;  2ZME A;  3CES A;  3KEQ A;  5CJ9 A;  4XIC A;  2GM4 A;  2Y0M A;  4C3J J;  5BMZ A;  3A4C A;  2HKX A;  2LY9 A;  4JYK A;  3OYI A;  1MNE A;  1W5S A;  3MKY B;  3S3O A;  4B47 A;  3PO2 J;  5D4R A;  3V8J A;  3GEZ A;  3H3Z A;  2XAH A;  2Q2E A;  3F8M A;  3PSF A;  2O0Y A;  2BOL A;  3TP0 A;  2X9D A;  1JXS A;  5LHG A;  1RR8 C;  5C4X J;  1U9N A;  1U5T C;  1WH7 A;  3HSE A;  4DW6 A;  1G3S A;  2A5Y B;  4ZJZ A;  2K3F A;  2M45 A;  5DEQ A;  4A3E J;  2GA1 A;  3F9K A;  2JRM A;  2XGX A;  3GXO A;  1X1P A;  2VOD A;  5KNL A;  2R7Q A;  2BY2 A;  1QZY A;  2K86 A;  4RDU A;  4CCO A;  3IC7 A;  1E3H A;  1SD7 A;  4BQO A;  4M9X A;  2OCE A;  2VAS A;  3BR5 A;  4RB0 A;  3S1N J;  4DIQ A;  3NWS A;  2XF5 A;  5LGT A;  1BR2 A;  2VLA A;  2VC1 A;  1VQ6 I;  2FMY A;  4DNC A;  1FSE A;  2DPU A;  2F5C A;  5F64 A;  4XLP F;  2CO5 A;  2CQN A;  1DQU A;  2HNH A;  5BS6 A;  2O6G E;  3H3U A;  3H9G A;  3L9F A;  4RLF A;  3LSP A;  2GOM A;  3TQN A;  3BTC A;  1FIA A;  1NK2 P;  2IA2 A;  1Z67 A;  3V8L A;  1TZL A;  3MVP A;  2QKL B;  4JQF A;  2LSO A;  3BLY A;  1LUJ B;  5E3M A;  4OMY A;  3AFH A;  3K4L A;  3PUF A;  3VSK A;  1QNT A;  3R0A A;  2VJ5 A;  4QPO A;  3BTI A;  1Y1W J;  2XRL A;  3E5Q A;  3MD2 A;  3WTT C;  1X3U A;  1RET A;  1ETV A;  4E7Z A;  4RAY A;  1DP3 A;  4KMU X;  4DBQ A;  3BDD A;  1I3A A;  2M30 A;  4KT5 C;  2H8R A;  5JLX A;  3G71 I;  3WGH A;  1R4M B;  1JUM A;  5A2Q K;  1HXD A;  2CW8 A;  3DF8 A;  4LG3 A;  1NH3 A;  2QEN A;  4RB2 C;  2K7L A;  1E2X A;  1YJW I;  3QOD A;  4DBR A;  1VQO I;  4LB5 A;  2COB A;  2R4G A;  4RB1 A;  3VYR B;  1OCT C;  2XKP A;  1YW8 A;  2KQR A;  2ZC2 A;  1PDN C;  1FBQ A;  2GXB A;  4BNC A;  2QSG X;  2NVQ J;  3GTO J;  3EUH A;  3KPH A;  3Q9V A;  1U5T B;  4ENM A;  4ZH4 F;  2BGC A;  2PBI A;  5A2Q Z;  2E1M B;  4HPQ A;  4XK4 A;  4ZYD A;  4ZTF A;  2Y69 H;  4A3I J;  1VQK I;  4HX4 A;  2YUS A;  4RBO A;  3BY6 A;  1ZRE A;  4UY8 I;  1ETY A;  5J3L A;  3ZCO A;  3SFZ A;  5GPA A;  4UUV A;  1WJB A;  1K6Y A;  3BZ6 A;  2KHM A;  2LF8 A;  2CG4 A;  3FM3 A;  3NWT A;  4BE2 A;  3G1L A;  3RI4 A;  2CQX A;  4CGZ A;  2N8G A;  3U21 A;  3WU2 C;  3F6V A;  1OYY A;  4ESB A;  4LMY A;  1YIJ I;  1RES A;  4BGD A;  2O7O A;  3MKL A;  1KYW A;  3UNG C;  2R7X A;  3LSH A;  1QPM A;  2V1D A;  3V7R A;  2COM A;  3ULQ B;  3KE2 A;  5K7H A;  4M3F A;  1LVK A;  2W00 A;  2C6Y A;  3GLX A;  1Z7L A;  2R5Z B;  3HOS A;  2HU9 A;  3K10 A;  5E20 A;  4GXO A;  2P6T A;  2XPV A;  4QWQ A;  1IN7 A;  3HB9 A;  3WU0 A;  2W48 A;  2FD5 A;  2K9N A;  4BY7 J;  2Z33 A;  4AVP A;  5EJC A;  4IO9 F;  9ANT A;  5J40 A;  2PMZ A;  2HPI A;  2IP2 A;  3VPR A;  1OCO H;  3WTZ A;  3HRU A;  4I09 A;  1K79 A;  3C7J A;  3OYC A;  2DW4 A;  3I56 I;  1F9N A;  3KCC A;  1SVM A;  3FMR A;  1OIS A;  2DT7 B;  1FPQ A;  1R1V A;  3BTJ A;  3TMO A;  2Z5U A;  1J9I A;  1X1C A;  2ID6 A;  5K1Y A;  3CO7 C;  2E34 A;  3M3Y J;  2DJI A;  1XTA A;  1NG6 A;  4M3E A;  5GPC A;  2R7F A;  5D5X B;  1SAN A;  4UV8 A;  2K9Q A;  2XUB A;  3V42 A;  2K4B A;  2WBM A;  2XRN A;  3L7W A;  1O3T A;  5IY5 H;  3K7A J;  3IAM 2;  1JGG A;  2ZSH B;  1BJZ A;  1WVR A;  4A6E A;  4DOZ A;  1F5T A;  3WTW C;  1BR1 A;  2M8G X;  2ZNZ A;  5L3B A;  4Z6Y A;  1YQA A;  2JUG A;  4UVB A;  1UJ8 A;  2NOJ B;  2VKE A;  2L0K A;  5DTD A;  1IRZ A;  2QF7 A;  2FML A;  3H92 A;  2Y0S N;  5JHU A;  2ECB A;  3H36 A;  3KEO A;  2Q1Z B;  4XL9 A;  1RKW A;  4P5O A;  1GVD A;  1TWF J;  4I6Z A;  1OCC H;  1WZ2 A;  4BBR J;  4Y15 A;  1IRF A;  4KIB A;  1NHA A;  2DJN A;  3LSG A;  2ZFU A;  4CZZ A;  3DPU A;  3Q0W A;  3G2B A;  3A03 A;  4BHC A;  4KMF A;  3EPZ A;  3IH2 A;  4IHV A;  3NAR A;  3TGN A;  5C44 J;  2RNG A;  1XCB A;  2IA0 A;  4F52 A;  2EH3 A;  3WTX C;  3WU1 B;  2RDP A;  2I8D A;  4E6K G;  1MDM A;  2D5V A;  3TL4 X;  2W4S A;  1BC7 C;  2EZK A;  2UWM A;  3CCV I;  3F72 A;  4MEY F;  2CH0 A;  2WWY A;  4WF2 A;  2O03 A;  2BY1 A;  2QA4 I;  4JX5 A;  3IP4 B;  2V4J C;  2CWE A;  3H0D A;  3N97 A;  3N4M A;  2RQP A;  1TW3 A;  1WQ2 A;  1FNN A;  2DA3 A;  3KLO A;  1Q1H A;  3CUQ C;  1BW6 A;  1OPC A;  4YIF A;  4E7H A;  1NG7 A;  2M4G A;  1D1B A;  2M87 A;  1VFC A;  2DOF A;  3D5S C;  5FLM J;  2R7R A;  2LOO A;  2BZT A;  2B7E A;  4B43 A;  4QTR A;  4E7J A;  1TTY A;  3ZPL A;  2JN6 A;  4LIV A;  3EQL F;  4LLG F;  2YR2 A;  3H9J A;  3BG6 A;  2XPU A;  3FZV A;  3T5X A;  2QBY A;  1S3J A;  2ELH A;  4HX8 A;  1D5Y A;  3M8E A;  3ZQG A;  1IXS B;  3HSF A;  4CYC B;  5KVR A;  3ABM H;  1ON1 A;  4M72 A;  2PJR A;  1JHF A;  3E7L A;  1QGP A;  3M7G A;  3I0T A;  1G3Y A;  1UHS A;  2KZV A;  2DDA A;  1HKQ A;  4AIH A;  1Z91 A;  2PN6 A;  3GTG J;  1S5L C;  3Q3S A;  5EEG A;  1N25 A;  1AKH B;  3OYN A;  2VOO A;  1J2X A;  2A6T A;  2D1H A;  3LSK A;  2VQL A;  2R93 J;  1IRX A;  1VQ8 I;  2R92 J;  4I02 A;  2EB7 A;  4X1E A;  4HV6 A;  2P7C B;  2FNA A;  4ANJ A;  4KFC A;  4WX9 A;  2BY0 A;  4IL6 C;  2JK3 A;  1JT6 A;  4WXD A;  4YFN F;  2VQC A;  3BJO A;  2LRD A;  1FWZ A;  1AA7 A;  1DPR A;  1MBF A;  4EQQ A;  1K83 J;  3QWL A;  3IHU A;  3ERE D;  3OR1 C;  5FGM A;  2BE5 F;  3CUQ B;  1JJ6 C;  4UVC A;  1S9H A;  2EV0 A;  1R23 A;  5D6F A;  2FBH A;  4G7Z F;  1D3Y A;  2A05 A;  1MMS A;  5LEJ A;  1HDP A;  1U3E M;  2JA7 J;  1SMY F;  3FXO A;  3K4M A;  2K40 A;  3S3N A;  3FXJ A;  2W7N A;  3ZMZ A;  3BG5 A;  2IEK A;  3FBI B;  2P5V A;  4XKB A;  1LJ9 A;  1XC5 A;  3HHH A;  4MLO A;  1ZQ3 P;  4A93 J;  4C3I J;  5IP6 A;  3OYM A;  2IW5 A;  1NK3 P;  2CUZ A;  3RDI A;  2IGK A;  5F04 A;  1AKH A;  5ICG A;  4H0E A;  1SFX A;  3CF5 F;  4C9Y A;  2G9W A;  1XMK A;  1IW7 F;  1MBK A;  2LH9 A;  2E2I J;  3HPG A;  1IUY A;  1Z9C A;  3HTS B;  5E3L A;  1WWX A;  1ZLK A;  2NVU B;  3KP2 A;  2KFD A;  3O8G A;  1S7O A;  3JRD A;  2ZJP F;  3OYB A;  3FK7 A;  2O3F A;  3EYI A;  3LAP A;  2RRE A;  2UUZ A;  4PK4 A;  3VOD A;  3ZMU A;  1YLF A;  2P0W A;  2QBY B;  2ZXW H;  4B3A A;  2EZI A;  2ZO4 A;  2GOX B;  4L9T A;  3GTQ J;  3ZQH A;  5E1Z B;  4A69 C;  2V1U A;  5E17 F;  2E2J J;  3GW2 A;  3E6C C;  1XSD A;  1TWC J;  1IDY A;  1V5E A;  3BWG A;  3WGI A;  5ERI A;  4RGX A;  3A0B C;  3F22 A;  4C2T A;  1AU7 A;  2XHK A;  4DYC A;  1QQI A;  3OSF A;  1WH5 A;  4TV7 A;  3RZD J;  1WKM A;  3GTL J;  3AKZ A;  2ZCW A;  1BOB A;  2M1B A;  2QQB A;  1Z3Y A;  4XLN F;  1BN5 A;  3LQQ A;  1T39 A;  2DPD A;  3ECH A;  5DCF A;  4CDG A;  5EEH A;  1UAA A;  4XR6 A;  1BI0 A;  3S1M J;  4ENN A;  4I98 B;  1VF9 A;  3LFU A;  4KA4 A;  1MBH A;  3VSL A;  2A69 F;  4RAZ A;  1W5T A;  1Z7U A;  1WJA A;  2VT3 A;  3HOU J;  3OOP A;  4HAM A;  2R7Z J;  3JRA A;  1XMA A;  3J7Z I;  4RGR A;  1B4A A;  3I4N J;  3CCJ I;  3MKW B;  5FRM A;  2HQ5 A;  4NC8 A;  2VKD A;  3F6O A;  2V9K A;  3HOV J;  1HST A;  2JTV A;  1A04 A;  4KT6 A;  5L3G A;  2Z99 A;  1YI2 I;  4D7M A;  1E17 A;  2M4K A;  2LLK A;  2HEO A;  2F4O B;  3Q0V A;  3IRQ A;  1U8B A;  2VXZ A;  3FXM A;  1T08 B;  2X1C A;  2CV1 A;  5M3F J;  1GT0 C;  4HF2 A;  1O3R A;  2EZH A;  1MJA A;  4BQQ A;  3JTG A;  1E3O C;  5F0F A;  1LE8 A;  3GME A;  5EDN A;  4J00 A;  1LEA A;  1ZRF A;  2L9V A;  2BXZ A;  5CQG A;  4IF4 A;  1LDJ A;  3HGG A;  1Y56 A;  4EM0 B;  1G8X A;  1YG2 A;  1UHM A;  1U9O A;  2VJJ A;  1K6O A;  1KA8 A;  1WRJ A;  3R0J A;  4KN4 X;  3ASN H;  3WG7 H;  3B6A A;  1HKT A;  1BC8 C;  4XOP A;  4ZTJ A;  3DV8 A;  5FRN A;  5EGO B;  2YX4 A;  3IRR A;  2PI0 A;  4PSX A;  2IBD A;  3ZMV A;  4XN0 A;  2MAB A;  3ABK H;  1KON A;  2ACJ A;  4H4K C;  3QYE A;  2AQE A;  2A3S A;  4P55 A;  5DUK A;  1Z77 A;  3CUQ A;  3R61 A;  4HF0 A;  3W3C A;  4A3K J;  2VJ4 A;  4BXX J;  3HIF A;  4CYC A;  4BH9 A;  3MCZ A;  1A36 A;  4IHS A;  3FM5 A;  3NQO A;  1MD0 A;  3CJT B;  1MZB A;  2VB6 A;  3SQN A;  1UEL B;  1QVT A;  1WI3 A;  4M73 A;  2GIV A;  4KNY A;  5LHI A;  3EUK L;  3RTR A;  4MFD A;  5CVV A;  4NQW A;  3KZZ A;  4GYI A;  2B63 J;  3BT9 A;  2WAD A;  3ISP A;  1A31 A;  3S3M A;  3FHZ A;  1YRN B;  1P9Q C;  1XG1 A;  1MMA A;  4JX4 A;  3J80 Z;  3CD6 I;  1IN4 A;  3VDX A;  4XLF A;  1JE8 A;  3K4N A;  2FSW A;  4S05 A;  5JI6 A;  5J8C A;  2RNJ A;  3I4P A;  3S2D J;  3BQY A;  1VTN C;  4MGR A;  1IUF A;  1J0R A;  3CME I;  5BNG A;  1T0F C;  1V3F A;  5HLI A;  3SDB A;  1DPU A;  2E1N A;  1I3Q J;  4AUX A;  2DMQ A;  3GZ6 A;  3GLL A;  1FBS A;  1HCR A;  4XM3 A;  1MBG A;  2Z2S B;  1GXQ A;  4JK1 X;  2X1E A;  4HYE A;  2ZNY A;  4Q48 A;  3QPH A;  2XGC A;  3SYT A;  3W6J B;  1I1S A;  4B44 A;  4IKF A;  2Y9Y A;  1XPX A;  1POG A;  2YU3 A;  1DU0 A;  2OQG A;  2H1K A;  1FC3 A;  1ZR4 A;  4XOR A;  2DBB A;  2ETH A;  1OYW A;  3LST A;  2HDD A;  1KYZ A;  4LGW A;  2DQR A;  5LD2 C;  4EVI A;  2HVR A;  4OAY A;  2F5E A;  3FXK A;  5EZH A;  1ZYR F;  1LKX A;  2NAZ A;  2DT5 A;  3GTP J;  2VBX A;  1QU3 A;  1SFE A;  2HI3 A;  3KP3 A;  2GXA A;  3GFL A;  1Y0U A;  1FY7 A;  2WY7 Q;  3C18 A;  1O3Q A;  3WTS C;  2IS1 A;  3AG3 H;  2DFI A;  4XRM A;  2LTP A;  4BQA A;  4P1W A;  1X58 A;  2FF4 A;  4DZP A;  2FXA A;  3CJR B;  4F3Q A;  1K78 A;  2L4M A;  4OIO F;  3PO3 J;  2AO9 A;  2JA6 J;  2EFW A;  3EUH C;  3TED A;  3LA7 A;  1MSF C;  1FYL A;  1T95 A;  4L5I A;  5D8L B;  1IV8 A;  1YW9 A;  3D0S A;  3DLA A;  1B72 B;  4I7H A;  4BS9 A;  2FU4 A;  2IJL A;  2MW8 A;  4PSW A;  4EGZ A;  2RN7 A;  4EAT A;  2X0L A;  3PNV A;  3S1Q J;  3CDI A;  3O6B B;  2FQ3 A;  2Y9Z A;  4WWC A;  3F3X A;  4N4N B;  1J5Y A;  4XMY A;  4D1Q A;  4FT8 A;  3K70 C;  4WCG A;  3MFK A;  1A5J A;  3K0L A;  4KYW A;  2KIF A;  5C4J J;  4G7H F;  4UNO A;  4V19 K;  3OYJ A;  3FXR A;  5HNF A;  3F8N A;  2MBF A;  2MC4 A;  3K4J A;  1G3T A;  4IPA A;  3NEU A;  1BW5 A;  1FYK A;  2W25 A;  2KMU A;  2X6W A;  4CSW A;  4G94 A;  3BR2 A;  5CYV A;  3ABU A;  2DOA A;  3BR1 A;  3S93 A;  3IV5 A;  3TW6 A;  1I50 J;  1IJW C;  4X0G A;  3SEQ A;  1WJ5 A;  2L9R A;  4XID A;  3VYS B;  1FP1 D;  1YTY A;  1YJ9 I;  4RGS A;  4HF1 A;  5E8G A;  1AOY A;  1T8I A;  2M9H A;  3GWZ A;  1RI7 A;  4GRI A;  4HX7 A;  3V8K A;  4IJA A;  3CCL I;  3OYK A;  4A3L J;  1KQ8 A;  1R5G A;  2PMZ N;  1S72 I;  2E5Z A;  3CCU I;  4IHW A;  2VJI A;  1WFX A;  3JRI A;  1LNW A;  1Z6R A;  3GO5 A;  3W6V A;  2Q2E B;  5BQT A;  2DA1 A;  2VOP A;  1W0U A;  2IXS A;  4A5M A;  5EG0 B;  2HGC A;  2LP0 A;  3IL2 A;  1OYI A;  3QPS A;  2HOT A;  2PG4 A;  1P92 A;  5HLT A;  4BJ5 C;  3HKZ A;  1TP4 A;  5B5E C;  1LQ1 A;  1ETK A;  4Y13 A;  3H5N A;  4P96 A;  1VZ0 A;  4HNU A;  3GTK J;  4XSX F;  2G0E A;  4ZDO A;  2RGV A;  3WE3 A;  2GLO A;  2E7X A;  2BXY A;  2RKH A;  3PM1 A;  2NXN B;  1SAX A;  4L5E A;  1S6L A;  1I39 A;  3GUD A;  4A3B J;  4RAG A;  3SZG A;  4E7S A;  2I10 A;  2PMH A;  1SC7 A;  1M1E B;  4UB6 C;  4L0Z B;  1HQC A;  1V54 H;  3TDZ C;  2L5Q A;  1Z1D A;  5LRS A;  5JVT A;  5BPD A;  1RZ4 A;  2CUE A;  5F1R A;  5K7F A;  3HL2 A;  4A3D J;  3ZQI A;  4BYY A;  3K1P A;  1FOW A;  3D5R C;  1KU7 A;  1MW7 A;  4A3F J;  1LVA A;  2L9S A;  4U0V A;  4JBA A;  4E7L A;  2ZME C;  2MLK A;  3RKY A;  5DD8 A;  1K4T A;  4IHX A;  1J7K A;  1X1A A;  3OIO A;  1SVL A;  1T33 A;  5FKN A;  5J1Y A;  4MIM A;  3HOW J;  2EFQ A;  1YIO A;  2M7A A;  4IVN A;  1OR7 A;  4G6D A;  1RPW A;  2CQQ A;  3MZ8 A;  2HYG D;  4U7D A;  1PJR A;  4LG0 B;  1AWC A;  3H9Q A;  4BHP A;  5B3S H;  1QZE A;  3WHC A;  1YS6 A;  1U78 A;  2QCO A;  3Q5F A;  3GF2 A;  4OIR F;  1MND A;  1LFB A;  4HLX A;  3ONQ A;  4CYD A;  1H9G A;  3G1M A;  4QIW N;  3A01 A;  1IDZ A;  2HTS A;  4W97 A;  2BHZ A;  3LAJ A;  5IP7 J;  2XKO A;  2EV6 A;  4A3J J;  4II3 A;  4PJL A;  1TWA J;  4PJJ A;  2V9P A;  3LOC A;  3T8T A;  2E2H J;  2M0C A;  1UFM A;  2A68 F;  1R4N B;  2PQ8 A;  4YIR X;  1BIA A;  1XN7 A;  1W1W E;  2ISY A;  3G6E I;  2X51 A;  2Y48 A;  1MGT A;  3S2H J;  1LE8 B;  4IQ4 A;  2NOG A;  3FKI J;  4FIS A;  1UZC A;  4I76 A;  1ZAO A;  1UHW A;  1MSE C;  5JLW A;  3KYD B;  3OYG A;  2UZK A;  2EBI A;  3HOY J;  3DEW A;  2CQK A;  4ESJ A;  3PSI A;  4C30 A;  2LYC A;  4WXC A;  5AON A;  2YU9 J;  3RKW A;  3DXJ F;  4WXH A;  3MZH A;  5EF6 A;  5GAD J;  3KYC B;  4LLN A;  3R6S A;  5ICC A;  2RV8 A;  3HOX J;  1FT9 A;  2KRH A;  3BJ6 A;  3REO A;  1BI1 A;  5LGU A;  2DU9 A;  5IOY A;  2ZXI A;  2F5V A;  2KIU A;  3QPL A;  1QO0 D;  3DKY A;  5DYM A;  3OYF A;  4HOB A;  4XSZ F;  2CW0 F;  2K27 A;  3C2H A;  3ABL H;  3CMA I;  4I99 C;  4XRS G;  1OQY A;  1HW2 A;  1SFO J;  3FIS A;  2RAE A;  3HSR A;  3CQZ J;  2WAF A;  4HQM A;  1X1D A;  5FD6 A;  1JI8 A;  2GBY A;  3RJP A;  5HS7 A;  5TJJ A;  5D5V B;  4M71 A;  2WA0 A;  5HS9 A;  4KIC A;  2F48 A;  4AM3 A;  4BJT A;  3BRO A;  2IS2 A;  2VI6 A;  3KP6 A;  1S7A A;  5LBQ A;  4FX0 A;  1K7A A;  3QRF F;  2HQR A;  1DUX C;  2R5Y A;  3DCF A;  2VPR A;  3IH3 A;  3GZN B;  2JSC A;  5HOO A;  3MN2 A;  1BI2 A;  2KIQ A;  4HEA 2;  2MH2 A;  2GZW A;  3W2V A;  4IQJ A;  1G59 A;  4A5N A;  4EJW A;  2XAF A;  4KN7 X;  2JSP A;  4CCN A;  1XGO A;  2LD5 A;  1B8I B;  5JR3 A;  2IGM A;  3RPQ A;  5D4S A;  5F6F A;  1ERD A;  1ZRC A;  3FIW A;  5KAF C;  3F8C A;  5DS9 A;  1ON2 A;  3FXQ A;  4NB5 A;  1MMN A;  2IS6 A;  2ZXH A;  2EFO A;  2DMP A;  5F0H A;  1OJL A;  5FLV A;  5J1U A;  2A5W A;  1A35 A;  2D1V A;  3RYP A;  4PJM A;  5DCM B;  4M3D A;  3BPX A;  5B66 C;  1PUE E;  3CF2 A;  1PYV A;  3Q9S A;  5CVR A;  1SMT A;  4YII A;  2NNY A;  2VPL A;  3OYD A;  4RM2 A;  2TCT A;  1MH4 A;  2XAJ A;  3IAS 2;  3HRS A;  3UR3 C;  4IX7 A;  4FQG A;  2ME0 A;  4X6A J;  3LSM A;  4D0P A;  1EJ9 A;  3U2R A;  2OJE D;  1X2M A;  3JRH A;  5GP9 A;  2JA5 J;  2G7H A;  1FLI A;  1MBE A;  3KZI C;  3PQK A;  3CTA A;  3DEE A;  1N77 A;  2UXN A;  2CMP A;  1XSX A;  4PJN A;  4U0Y A;  2FX0 A;  3WG9 A;  3GTJ J;  4AU7 A;  2WY8 Q;  2XC7 A;  1ZRD A;  1K78 B;  3K6G A;  4XQF A;  5CVJ A;  2CRG A;  5K5O A;  2OCC H;  1HBX G;  2ADU A;  2E36 A;  4DQ2 A;  3OYH A;  4A12 A;  2VON A;  3S14 J;  5FLX K;  1ZR2 A;  4L0Y B;  2OU2 A;  2K9S A;  1GVJ A;  2RVC A;  1JKQ C;  1OLT A;  1T0F A;  3VB2 A;  4ABZ A;  2XGD A;  3PQJ A;  3HOT A;  1IO2 A;  3VYU B;  2OAZ A;  3I71 A;  3IKT A;  3C3W A;  3I9V 2;  3JTH A;  3LA3 A;  3GYH X;  1VQ4 I;  2Q8K A;  2LK2 A;  1FYM A;  3HRM A;  2YSR A;  2LR8 A;  2E35 A;  4A6D A;  5FLX Z;  2MSY A;  4L18 B;  1U2W A;  3HJE A;  3TW7 A;  3BR0 A;  2O8K A;  4YEL A;  1FOX A;  3OS0 A;  2K4J A;  2CYY A;  3NAU A;  3W2A A;  1RRJ A;  2XAQ A;  1WI9 A;  3J7Y J;  2R7S A;  3K4K A;  1DGW Y;  3I54 A;  2XVC A;  3K69 A;  1GV2 A;  3PNY A;  5DM7 F;  3JRE A;  1VQP I;  2LC2 A;  5M5X J;  1O3S A;  2J5O A;  2Y0S A;  3DP7 A;  1A6I A;  3KFW X;  5CKT A;  2YPR A;  4FHT A;  3TOA A;  4BDZ A;  2P7V B;  3AG4 H;  2CGP A;  4EJV A;  2BBY A;  5DD4 A;  3BP8 A;  4CH7 A;  2FBI A;  4CHU A;  3WHB A;  1TT5 B;  3CP2 A;  2CUJ A;  2LKS A;  4QLC U;  4WK8 F;  2KLO A;  4DJA A;  1XDS A;  3P9K A;  3WTV C;  4OOI A;  1J75 A;  4E4H A;  2PJP A;  4J19 A;  1V5F A;  2IPQ X;  2VKV A;  3ELK A;  1L0O C;  3ZRG A;  1VQL I;  3M8F A;  4IZZ A;  3OL4 A;  4AYB N;  3ZN0 A;  1K4S A;  4M74 A;  3E97 A;  2ELK A;  3DBR B;  3L1P A;  3HTU A;  2M8E A;  1G3W A;  3MEX A;  1W36 C;  2LBF A;  1YYV A;  2CSO A;  1XCV A;  3LSR A;  4XKW A;  4AYB A;  4MTD A;  1IAW A;  2ICW G;  4M9S A;  3I4M J;  2QSF X;  5D6E A;  5DV5 A;  4Q47 A;  3JRB A;  2M5W A;  4IHY A;  2XF7 A;  6PAX A;  4B1R A;  1LDD A;  4FTH A;  2WB1 N;  1ACI A;  2HOS A;  1X2N A;  4L9V A;  2BEO A;  1WJF A;  2H8W A;  2QWW A;  1EH7 A;  3ECO A;  2KIS A;  3I58 A;  3I5U A;  4PJ0 C;  5FKL A;  5IT3 A;  2XRO A;  2Y2Z A;  1ZTR A;  4GFB A;  4ENJ A;  4B3X A;  3OYE A; 
#chains in the Genus database with same CATH homology
 1T0F C;  4NUB A;  1WJE A;  4FET A;  3SDB A;  1TZL A;  3CP8 A;  2QKL B;  2X85 A;  4JQF A;  3VWB A;  3BLY A;  4XM3 A;  2Z2S B;  2MD0 A;  2X1E A;  3AFH A;  3K4L A;  3VSK A;  3FBN B;  2VJ5 A;  4QPO A;  3DTK A;  3EUA A;  3SYT A;  1X1B A;  3MD2 A;  4B44 A;  4IKF A;  4E7Z A;  1DP3 A;  2KPM A;  4RLQ A;  4YRV A;  4DBQ A;  1FMV A;  4XOR A;  1V5G A;  1GLN A;  3L2R A;  1Z3X A;  2CW8 A;  4LG3 A;  5LD2 C;  2HVR A;  2WB1 A;  4OAY A;  1E0E A;  4LIT A;  3DTE A;  3OY9 A;  3DPL C;  3K4C A;  2LG4 A;  1LKX A;  3QOD A;  1QU3 A;  4DBR A;  2WY7 Q;  2R4G A;  2L7K A;  3CJQ B;  2JVH A;  2IGO A;  3VYR B;  4HRI A;  3RPU D;  2IS1 A;  2KQR A;  2F6C A;  1YX3 A;  4XN3 A;  3FKJ A;  1WJD A;  1X19 A;  2ELJ A;  4P1W A;  2W1O A;  4PFO A;  3CJR B;  2E1M B;  4HPQ A;  4F3Q A;  4ZTF A;  4HST A;  3EUH C;  2FUG 2;  2DXI A;  2CV2 A;  2M3A A;  1T95 A;  3ZCO A;  1HA8 A;  3KYL A;  1WJB A;  4E7K A;  1K6Y A;  3M1C A;  2KHM A;  2VIX A;  3DLA A;  3FDY A;  3NWT A;  3MMY B;  2XSJ C;  4BS9 A;  4BE2 A;  4HNT A;  1R6R A;  3PFY A;  4PSW A;  3U21 A;  4EAT A;  2RQQ A;  2OC6 A;  1Y6I A;  3PNV A;  3MKZ A;  2F4I A;  4R79 A;  4D9J A;  2R7O A;  4N4N B;  4KIT B;  4XMY A;  4D1Q A;  4BGD A;  4II2 A;  3K70 C;  2R7V A;  3UNG C;  2R7X A;  4OAZ A;  3LSH A;  4NC7 A;  1X4O A;  3OYJ A;  5HNF A;  2MC4 A;  1LVK A;  2W00 A;  3K4J A;  1D0Y A;  1Z7L A;  4KIS A;  2VQH A;  3HOS A;  4CSW A;  2KMU A;  2X6W A;  2HU9 A;  3K10 A;  2CFO A;  4KJZ A;  2DOA A;  2LBF B;  3S93 A;  2HVS A;  5CPR B;  4X0G A;  3SEQ A;  1WJ5 A;  1D0X A;  1LDK B;  3VYS B;  3A1Y A;  1N75 A;  5HNH A;  2PMZ A;  2HPI A;  3VYT B;  3PJR A;  3KEY A;  3OYC A;  4GRI A;  3PUB A;  1YE9 A;  3OYK A;  3K4B A;  4XON A;  2X1D A;  2E5Z A;  3HC7 A;  3OOU A;  2VJI A;  2DT7 B;  1LFP A;  1WFX A;  3PL8 A;  3TMO A;  1X1C A;  4B48 A;  2Q2E B;  2IS4 A;  1MMD A;  2DJI A;  2IXS A;  1NG6 A;  3OS1 A;  4AVZ A;  5HLT A;  4BJ5 C;  3HKZ A;  2L9N A;  2AQF A;  4RMN A;  3V42 A;  3H5N A;  4DGW B;  2K3P A;  4RM3 A;  1VZ0 A;  2WBM A;  4HNU A;  3DU6 A;  3LMM A;  4ZDO A;  4CA0 A;  3IAM 2;  2ZSH B;  4DOZ A;  2M0M A;  1BR1 A;  4F55 A;  3OL3 A;  3SZG A;  4E7S A;  4BUP A;  3CMM A;  2JUG A;  1U0J A;  2NOJ B;  4CCM A;  3OS2 A;  3ZQQ A;  2L5Q A;  3QOE A;  4PUS A;  2Q1Z B;  4XL9 A;  4P5O A;  1EA3 A;  3GBG A;  3M8J A;  3HL2 A;  3HPH A;  3D5R C;  1MW7 A;  5KCM A;  3HG9 A;  2KRC A;  4CUG A;  2L9S A;  3LSI A;  3HUG B;  2HZD A;  3LSG A;  2ZFU A;  4E7L A;  3DPU A;  4YEJ A;  3L2Q A;  3G2B A;  1X1A A;  3FHN A;  1N78 A;  3EPZ A;  4BEH B;  4F93 B;  4U7B A;  2M7A A;  4BU2 A;  1SAU A;  2RNG A;  1PJR A;  4F52 A;  3H35 A;  3H9Q A;  4G6T B;  3ZXS A;  2I8D A;  5JHF A;  4E6K G;  2XF6 A;  3TBI A;  3DKX A;  3TL4 X;  2W4S A;  2R7T A;  1ZEL A;  1Z21 A;  2DCE A;  2UWM A;  2LRE A;  2O5R A;  2K9M A;  1MND A;  3DPT A;  1SFK A;  3ONQ A;  2CH0 A;  2CV0 A;  3IP4 B;  1BR4 A;  2V4J C;  3H0D A;  2VXD A;  2XDV A;  2LY2 A;  5FRO A;  3IUO A;  2QKM B;  4II3 A;  4PJL A;  5HVQ C;  4BXF A;  4E7H A;  1NG7 A;  2M4G A;  1D1B A;  2W82 A;  4PJJ A;  4ZDP A;  3D5S C;  2R7R A;  2K5C A;  2LOO A;  4B43 A;  4E7J A;  2R7U A;  2MYS A;  4LIV A;  2X51 A;  3BC8 A;  3H9J A;  2IGN A;  3ZR8 X;  3BG6 A;  3J7A Y;  1WJC A;  4IQ4 A;  3AL0 B;  2PJR A;  3OYG A;  2UV1 A;  5LFA A;  4LIU A;  4ZC3 A;  4HSR A;  2KZV A;  4ITV A;  2BVM A;  3PSI A;  4C30 A;  2LYC A;  3L2U A;  3S32 A;  3OYN A;  3BCA A;  1FMW A;  2A6T A;  3LSK A;  2KRH A;  2VQL A;  3L2W A;  1IRX A;  2M7B A;  2JVG A;  4BEH A;  2ZXI A;  4XLC A;  4ANJ A;  4CCJ A;  2F5V A;  2CS3 A;  3DKY A;  5TGT A;  3OYF A;  3C2H A;  2KP6 A;  2ZSI B;  3K70 D;  3OR2 C;  2VQC A;  2LRD A;  1AA7 A;  4QPQ A;  1D1C A;  2HQA A;  2WAF A;  1X1D A;  1JI8 A;  3OR1 C;  1S9H A;  2WA0 A;  4BAC A;  3C2G A;  2Z16 A;  4XKV A;  4BJT A;  2IS2 A;  3DWL E;  4BQN A;  3DU5 A;  3K4M A;  2Z1D A;  3SEZ A;  3S3N A;  2W7N A;  5HOO A;  2X6Y A;  3FBI B;  2V1N A;  4XKB A;  4HEA 2;  4IQJ A;  3W2V A;  2VQG A;  1G59 A;  4CCN A;  2JSP A;  4MLO A;  1TT0 A;  2V26 A;  2IGM A;  4U87 A;  3S8P A;  3OYM A;  2MFZ A;  3RCO A;  3E1S A;  2CUZ A;  1ERD A;  4C2U A;  2KDO A;  2IGK A;  2KL4 A;  4C9Y A;  2R7W A;  2IS6 A;  1MMN A;  2K9L A;  2ZXH A;  2JA2 A;  2VKH A;  2LH9 A;  2OV7 A;  4XLH A;  5KHD A;  1OR7 C;  3HPG A;  2A5W A;  4PJM A;  4XNF A;  3CF2 A;  1PYV A;  2VPL A;  3OYB A;  3OYD A;  1DGR M;  2RRE A;  2UUZ A;  4PK4 A;  2P0W A;  4RM2 A;  3IAS 2;  4Y4R A;  3UR3 C;  1W36 D;  4IX7 A;  1QHG A;  2V7F A;  2GOX B;  2E5N A;  3D5L A;  3AL0 C;  3LSM A;  2BW3 B;  1V5E A;  2CW7 A;  4XKC A;  4C2T A;  3DEE A;  3BG7 A;  1N77 A;  3AKZ A;  1BOB A;  2CMP A;  4XOT A;  4PJN A;  1Z3Y A;  3H5A A;  4AU7 A;  2WY8 Q;  2XC7 A;  3K6G A;  4NQW B;  3DQV C;  4XQF A;  1UAA A;  4ZYA A;  4XR6 A;  4CCK A;  1D1A A;  3OYH A;  4J01 A;  2HDW A;  1X4P A;  3LFU A;  4XLA A;  3VSL A;  4BE1 A;  3PNT A;  1OLT A;  1UG0 A;  1WJA A;  3E0J B;  3OYL A;  3OWT A;  4E7I A;  2LY1 A;  3VYU B;  3HOT A;  2V6E A;  3I9V 2;  5CQE A;  3MKW B;  5FRM A;  4NC8 A;  2VKD A;  2V9K A;  4KT6 A;  4XLE A;  1YX5 A;  3OMY A;  2M4K A;  3RSN A;  3QYB A;  3W2W A;  2E60 A;  4BE0 A;  2VXZ A;  4OWR B;  4Y33 A;  2CV1 A;  2X1C A;  2PJR B;  3A2K A;  4YEL A;  1QHH D;  2BVL A;  3OS0 A;  3OIP A;  4BL0 B;  4BQQ A;  2L2O A;  3DTI A;  3OYA A;  3W2A A;  2HVQ A;  3N05 A;  3L2V A;  2DT6 A;  3HXL A;  3RQ4 A;  4HG2 A;  4BJ6 C;  2R7S A;  4J00 A;  3K4K A;  1DGW Y;  2BW3 A;  3KX2 A;  3OIQ A;  3PNY A;  5CQG A;  2XAU A;  2LC2 A;  1Y56 A;  4JOM A;  1J09 A;  1G8X A;  4F91 B;  2X6X A;  2Y0S A;  2VJJ A;  3CES A;  4ZDL A;  5CKT A;  3A4C A;  4BDZ A;  4NNJ A;  4XOP A;  4ZTJ A;  4CH7 A;  5FRN A;  3OYI A;  1MNE A;  3S3O A;  3MKY B;  4F92 B;  4B47 A;  4PSX A;  3CP2 A;  4XN0 A;  2CUJ A;  3PSF A;  2MAB A;  1D0Z A;  3H5R A;  1KON A;  2KLO A;  4DJA A;  2BOL A;  4H4K C;  3QYE A;  2AQE A;  4Y3O A;  4E4H A;  3W3C A;  1V5F A;  3ZGK A;  2WAQ A;  2VJ4 A;  3ZRG A;  4ZJZ A;  2E1M C;  4IZZ A;  4BDY A;  3OL4 A;  3BCB A;  3F9K A;  2VB6 A;  1UEL B;  3QYF A;  5KNL A;  2R7Q A;  1W36 C;  2LBF A;  2WAE A;  3EUK L;  3RTR A;  1MMG A;  4XKW A;  4N4O B;  4AYB A;  4CCO A;  4CCL A;  3LL7 A;  4BQO A;  3I3L A;  2VAS A;  2WAD A;  3S3M A;  2XF7 A;  4DIQ A;  2VL8 A;  1P9Q C;  2XF5 A;  3NWS A;  1MMA A;  1BR2 A;  4PFP A;  2VLA A;  3VDX A;  3CZ6 A;  4XLF A;  1WJF A;  3K4N A;  4FAS D;  2HPM A;  4CZC A;  2OUM A;  1DQU A;  2HNH A;  3H9G A;  4RLF A;  2GOM A;  4B3X A;  3OYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...