4QPQA

Mechanistic basis of plasmid-specific dna binding of the f plasmid regulatory protein, tram
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
50
structure length
50
Chain Sequence
AKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Relaxosome protein TraM
publication title Mechanistic Basis of Plasmid-Specific DNA Binding of the F Plasmid Regulatory Protein, TraM.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 13
structure length 50
sequence length 50
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.450 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4qpqA00
4QPQA 1DP3A 4QPOA 3OMYA
chains in the Genus database with same CATH superfamily
3BLYA 4H4KC 1ZK8A 2W82A 3J7YJ 1VQPI 1LVAA 1QVUA 3QWLA 4RLQA 1I50J 1SFEA 1WWXA 2B7EA 2L3DA 4M3DA 2ZJRF 2COMA 3SHFA 4B44A 2ESNA 3S2WA 1OYIA 4JX4A 3WG9A 3JRBA 4O5VA 1WJAA 2CUZA 3KPHA 2DTRA 4XLAA 2ACJA 1HBXG 3SXYA 2FOWA 2XC7A 2LY9A 2K86A 1IDZA 4X1EA 1Z7UA 2OCCH 5E3OA 1P4AA 3FXUA 4DBQA 1X2NA 4LD5A 4ZYEA 2AXTC 3IAS2 3VSLA 3JCUC 4BQOA 3WTZA 3CCSI 1HXDA 4O6JA 4KN4X 3ZQCA 1EV7A 5D5WB 4YRVA 1U9NA 4OIRF 1U5TC 3IRQA 4CZCA 1GUUA 2A69F 4G6DA 3DEWA 4KYWA 5BS6A 3BROA 2ZKZA 5FKLA 2VONA 2A05A 4XKVA 2QZ8A 1TTYA 5ICGA 1Z6TA 4YFKF 2GA2A 4B3AA 5HLTA 4BQQA 4HQEA 2XSDC 4C3JJ 4IHVA 1OLTA 1BBYA 1ORKA 2MH2A 4U7BA 5FGMA 1JUSA 3FXRA 2MG4A 4U88A 4EGZA 4UXNA 2XPWA 3S1QJ 2F4MB 3QPHA 2CW7A 1U3EM 1S9HA 2EZIA 3BQZA 2QSFX 4A5NA 3A0HC 1GHCA 1HKQA 3GTMJ 4PFPA 2VKVA 4XORA 3H0DA 3DQVC 2HPMA 2IW5A 3U1DA 3BR1A 1XGSA 4Y13A 2RC4A 2VE9A 1DGWY 3HOUJ 1XB4A 3W3CA 3LA7A 2ADUA 1ZGJA 1BW6A 1O3SA 2MGQA 3D5SC 1FTZA 2XKPA 1NH3A 1B9MA 5B66C 5E20A 2J5OA 3ZQLA 2A07F 3A1YA 3CP2A 3EUAA 1YO5C 1MJBA 3LSKA 2V6EA 1TT0A 3ZMVA 2XGXA 1DPUA 2DAOA 4ZYGA 2G9WA 2JK3A 2OCEA 3HDDA 4KISA 5IYDJ 2HTSA 2QQAA 4DJAA 4QLCU 4HV6A 4HNUA 4HOBA 3PM1A 1MH3A 2HWVA 5JHFA 5JI6A 4A3BJ 3K0LA 4XSZF 1FMWA 4A3KJ 1B72B 1J59A 2OPTA 4PK4A 1FT9A 1LDDA 2X1DA 2Y9ZA 4XN0A 5DD4A 1UCRA 1FYLA 5F04A 2CFXA 1SVOA 3HEFA 2BW3B 3HOYJ 1HKSA 4QWQA 3WGGA 5K7ZA 1W5SA 5C44J 4FHTA 2XSJC 4A5MA 3FIWA 5FLXZ 4L5EA 3J81Z 3VYRB 4LFUA 3O6BB 5GP9A 1VQ5I 4OOIA 2L02A 3BTLA 4Q47A 3C2BA 1WQ2A 3WODF 1VQ7I 3FHZA 3E6CC 1EH7A 1HC8A 2L2OA 1WFXA 2DA6A 4HX7A 4EJUA 2MD5A 3GTGJ 1SMTA 2F5FA 5F08A 1ZH5A 5DD8A 1Z91A 4E7ZA 4CH7A 4KIBA 3PO3J 1PP8F 3SDBA 4IX7A 2LOOA 2R7QA 1T38A 5F0HA 4I98B 4ESFA 4DIQA 1FOWA 5TRDA 2HKXA 1Z6RA 3NARA 4RMNA 2R7XA 2HOTA 1MIJA 4OMZA 5F0CA 2GAUA 5FKOA 2W48A 4RGUA 4UVCA 5LGUA 2V79A 4BEHA 4A93J 1IV8A 2W84A 2CH0A 5JFRA 1PP7U 1FWZA 3F8FA 1TT5B 2WAEA 2O9LA 1X1DA 4BNCA 2VODA 2Y9YA 4G12A 1T39A 2WAFA 2RQPA 3JREA 1X4OA 1Y56A 3F3XA 4EJTA 3W2AA 2ZFUA 2VXZA 3PNYA 1YW8A 2BY1A 2XAHA 2MSYA 3BJOA 4QPOA 2OTLI 4MTEA 3TDZC 1PDNC 2BY2A 2DYRH 2V1XA 1V5GA 3QOPA 2NVXJ 2LFBA 1SMYF 5EGOB 4RB1A 3OYBA 2CV2A 3D5LA 4A0ZA 4U0WA 3H5AA 1DUXC 4HF0A 2DMUA 1TWCJ 3A0BC 3O2PE 4D7NA 1UMQA 1WZ2A 3BP8A 1H89C 1R5GA 4A3LJ 2HOSA 3QPLA 1ON2A 2BHZA 3TP3A 2IGOA 2DA4A 3PSIA 1H88C 1LNWA 2E1MC 1W0TA 1IF1A 2E71A 3LFKA 3GTJJ 5GAGJ 1QZEA 3AFHA 3HC7A 4RM2A 3QODA 2DDBA 4DYQA 1W7PA 3RTRA 2PJPA 5BMZA 1VQ9I 2DFIA 3FBNB 5L3EA 2VKHA 2OZ6A 2R7WA 1O7LA 1OCTC 1MW7A 2K7LA 5E1WA 2E2JJ 1UAAA 9ANTA 3RKYA 3L00A 4S05A 3IL2A 2LBFA 2R5YA 1BJAA 2DT7B 2RQQA 3F8NA 3EUHA 3ZQQA 2JA2A 3QP6A 1MBFA 2GXAA 1UG2A 3RCOA 5IOZA 2K4BA 1SD7A 1ENHA 2EFWA 4XL9A 2QQ9A 1UHMA 2MFZA 3REOA 3CCEI 2OC6A 1G3TA 3DLLF 4RGXA 2P6SA 3FM5A 1YFHA 5D5UB 4L0ZB 2ZBKA 4OIQF 3DV8A 1W36C 3I56I 4KDPA 3QQAA 5DV5A 5HNHA 3OS1A 2RN7A 2P7CB 4C2TA 3KLNA 3DEUA 3WGIA 1W5CC 5CYVA 1QRYA 3TQNA 4FISA 3AKZA 3WU0A 4ON0A 5CVIA 1DU0A 2P5VA 1O3RA 3WHCA 4S0HB 4GDFA 3I4PA 4X0GA 4WF2A 3DU5A 1Z77A 4BBRJ 2R92J 2Z5UA 4GYIA 5B3SH 4HZFA 2LLKA 4CCMA 3ELKA 3B6AA 4UNOA 3HOWJ 1FIAA 1K78B 3ABUA 1O7FA 2XRLA 5JVTA 4XIDA 4BUPA 3G1MA 4AIDA 1C0WA 4Y3OA 2EV0A 4IRHA 3RDIA 2EZLA 1WSUA 2L0KA 5IP9J 1E2XA 1KYWA 3GXOA 1HW5A 3K7AJ 3I58A 3R61A 4NDLA 1OR7A 3GF2A 4KT5C 4EGYA 3TBIA 2EIKH 2IS4A 5EYRA 2X6OA 1POGA 2DQLA 3DPUA 1X2MA 4YIRX 3SZPA 4I0BA 3ZCOA 4NNJA 3WTSC 3E97A 1Y8QB 4ZZLA 2H94A 2XV4S 4XRFA 2DYSH 1ZKGA 2K40A 2IGKA 1SFOJ 2QEXI 1LDKB 3Q3SA 3NWSA 1SD6A 1ZR2A 4B3XA 1F9NA 2WB1N 4XLHA 4XR6A 2ZC2A 4YFNF 3ESWB 3IRRA 1MNDA 2F4IA 2UWMA 2L54A 2L9VA 2OZUA 1SFXA 4A3CJ 5HS8A 2E2HJ 3HTSB 4NQWA 3JTGA 3S2DJ 2RDPA 4P1WA 2FD5A 5DCFA 4UVAA 1WHUA 3TW6A 1D3YA 1KU9A 2XGDA 2PLYA 3GEZA 2XIGA 1JUPA 3KX2A 1WKMA 1SAUA 1MSEC 2VJ4A 2QKMB 1OFCX 3JTHA 1VI0A 4KIFA 3OYLA 1T8IA 1ZLKA 2P8TA 1Y6IA 3DFGA 3OIPA 3SJMA 1O57A 2M7BA 3BY6A 4PJMA 2L7MP 4L9NA 4X6AJ 2ICWG 4L5IA 3ABLH 2DI3A 2JT1A 4Q5SF 4IXAA 1LDJA 3OV8A 4Y4RA 3CP8A 4EM1A 3OYEA 3SDGA 2FQ3A 1L0OC 1OKRA 2NAZA 3GBGA 3MCZA 3U1KA 1SAXA 4YIIA 1Y1VJ 1P2FA 3ONQA 3R6SA 5K5OA 3ZMSA 2PMUA 3G2BA 1SD5A 4LB6B 3SFIA 2XHKA 2M4KA 2CW0F 3IHUA 4LMYA 3CDLA 2X1EA 2I10A 2I8DA 2IA0A 1TWAJ 2JZYA 1ZG3A 2HKOA 1X1BA 3LSMA 3LQQA 4GO1A 3L1PA 3HUGB 5JVGF 1XCVA 1I3AA 2HZDA 2ZMEA 4UV8A 4W1UA 1V3FA 2GXGA 3ISPA 3TDUC 5D6FA 4BS9A 1MMAA 2BXZA 2M8GX 1TWGJ 2DK8A 1AWCA 5ICEA 5LBQA 4ZC3A 3L2CA 2Y75A 3Q9VA 3AG3H 2ID6A 1X1PA 3TL4X 1O3TA 1YQAA 2XKOA 2CSOA 2IA2A 4FE4A 4PGHA 4PDKA 2DTZA 2NNNA 2DT5A 4QTRA 3HPHA 4ZDPA 1EH8A 3DTEA 4CHUA 3CUOA 2BGCA 3B73A 4A2UA 4ZDLA 2EILH 4E6KG 2XAFA 2O8KA 4XBFA 1BIBA 2FEZA 3E5QA 3JSPA 2LDUA 2BZTA 3TW7A 4TV7A 1F36A 3G1LA 1IGNA 3K2ZA 4DNCA 3CC7I 4OIPF 2DK5A 5E1ZB 3GTKJ 1MSFC 1HKTA 4A3DJ 2Z1DA 3GZ5A 1HDPA 4I01A 2M0CA 1MMNA 1ZRCA 2BVLA 2HXIA 1Z67A 4CZZA 3H35A 3UNGC 3BR2A 2KPMA 4UB8C 4IKFA 3G71I 1FOXA 1FX7A 3CLOA 4FQGA 3H3ZA 1KONA 4BHPA 2FU4A 1J75A 2QF7A 2WA0A 4GGGA 5HLGA 4I7HA 4RGSA 3H0GJ 1U78A 4JP0A 1IN8A 4Y7NJ 4CCKA 5FKMA 3WTXC 2YR2A 1YS6A 2WV0A 5GAHJ 4BDYA 4UUSA 5EG0A 3DEEA 3ABTA 1GV2A 3A03A 5D8LB 5A2QZ 4HW0A 5ILVA 3GYHX 4D0PA 4ZYHA 1VQLI 2VIXA 3JRIA 2E7WA 4XNFA 4CDGA 2CUEA 5HDNA 1Q1VA 1XGOA 3BR6A 2XAJA 3CCJI 2W24A 1MKMA 5KNLA 3IH2A 4MEXF 4MO7A 1VTNC 1AHDP 1DP3A 2W7NA 2FA5A 5FKKA 3QRFF 2R5ZA 2IAIA 3K6GA 2E1OA 2GIVA 2IVMA 2EV6A 1QVTA 1FJLA 3CCLI 1B8IA 1VQ4I 3ZQFA 3H5NA 1FY7A 2V9VA 1X19A 1HCRA 5HS9A 5FLMJ 4B48A 1WJEA 5BPIA 4HLYA 1B9NA 4HX8A 5J1UA 4JQFA 3VEPA 2L01A 2VJ5A 2E1CA 1YX5A 4BQAA 3DKWA 4BH9A 1FTTA 4U7DA 1YS7A 5KAFC 2HQ5A 1RPWA 4IVNA 2X48A 2R7DA 2R7FA 2CV0A 3RPQA 1D1BA 1IDYA 4B8XA 2WY8Q 5KHDA 2VLAA 3HZJA 4M72A 3BG6A 2WWYA 2Z3YA 2VB6A 3M07A 1XC5A 2EB7A 1O4XA 2FBIA 2QCOA 2XVCA 4FE7A 2UXNA 4BE1A 4UY8I 5JLXA 4CO8A 5H20A 3I9V2 1ZHFA 3VPRA 1NHAA 2BE5F 3K1NA 1JUMA 1MZBA 3GTOJ 4PJLA 1RI7A 3LSIA 4IPAA 2XASA 3S16J 1ULYA 3M8FA 2OBPA 1MGTA 2Q2EA 1XD7A 5H2FC 1BR4A 3O8GA 4KITB 2P7VB 2O7OA 1R1UA 1FBSA 1FPQA 3BC8A 3I4NJ 2DBBA 1QBJA 3RKQA 1JGGA 5C4XJ 4KJZA 2E1MB 2PX9A 2ETHA 5CQEA 3GWZA 1D1AA 2ZXJA 2L9NA 1JT6A 3FDYA 4ESJA 4IHSA 4UB6C 2P5KA 2K3PA 3IH3A 1Z7LA 5FJ8J 1V54H 2XRNA 1W1WE 3WTYC 4I6ZA 2VPLA 3TOBA 5M5XJ 2B9SA 4P5OA 4C30A 3CQZJ 4A0XA 3IWZA 3CJQB 2K4JA 1YJNI 2LP0A 3ZMZA 3WG7H 3G6EI 5B1BH 4CGZA 2DOAA 1Q1HA 5D4RA 2KQRA 4Q4ZF 1LKXA 3EYIA 2QENA 1JHHA 3HSEA 2PJRB 1OPCA 1UHWA 1TW2A 4MIMA 2W85A 1R71A 1G6NA 1ZARA 2CFOA 2X1CA 4UV9A 4FASD 2CS3A 3SQNA 2LRDA 5L3GA 2VBXA 1J5YA 3BCAA 1PYVA 2KIUA 2FXAA 2DA1A 4RLFA 1XGMA 3P7NA 1IG7A 1D8KA 2GXBA 1YTYA 1YRNA 1Z05A 1SEUA 3COAC 4LLNA 3CMEI 1E3OC 2HFHA 2HQAA 2ZXIA 1I6XA 3DF8A 3OYGA 3EPZA 4LJZF 3ECOA 1Z3XA 5JLWA 4DYRA 2AO9A 3WTTC 2OD5A 3F23A 1B72A 1I1SA 1VQ8I 3HSRA 4B1RA 1I27A 3M8EA 5DCMB 1IUFA 5GTHC 2EA2A 2MC4A 3TO6A 5E18F 1R9TJ 3E5XA 3CUQC 1WCMJ 3HRUA 2E7XA 5FD5A 5M3FJ 5CVJA 3DLAA 2ZSIB 1XSDA 2VT2A 2YPRA 4G9YA 3M1EA 3FMRA 5DUKA 5E3LA 2BY0A 4C3IJ 4AM3A 4JX6A 1I5ZA 3CMMA 1D0XA 2EZKA 4MNUA 2QGUA 3JRFA 3HL2A 4XLCA 3OS2A 1STZA 3CCYA 3SEQA 3E6DA 1QPMA 1YJWI 2A5WA 1NK3P 4HBLA 5J40A 3ZQGA 4I99C 3T8RA 3HKZN 3FXJA 2JRTA 1Y0UA 4JK1X 3BDDA 2Q8KA 2K27A 3HIFA 4BL0B 1XX5A 4RB3C 1MD0A 1QPIA 2GQQA 2ISYA 4RS8A 4LIUA 1U8BA 3L2WA 1TWHJ 5CVUA 3LAJA 2BHYA 2KIQA 3OSGA 1RR7A 2CQ7A 1WH5A 1AKHA 5L3BA 3W6VA 3GTQJ 3EQLF 2QUFA 4XONA 2JVHA 5B1AH 2M30A 5H6QA 2IJLA 2DW4A 3K4KA 5M5WJ 2HDDA 4O3MA 2DMNA 5LRRA 3DCFA 4P9FA 2R7OA 4LGWA 3KCCA 3VYSB 3PJRA 2F4OB 2J5PA 4AVZA 5AONA 2VUMJ 1HLVA 2IS2A 1ZELA 3C18A 3ML6A 5HLIA 5K5RA 4KICA 1H8AC 5HODA 1WGXA 4AD9A 3ZMTA 2R3SA 2ZJ2A 2Y2ZA 4KIGA 2DPUA 1QHGA 3G73A 1S8NA 1IV6A 3J7AY 1OISA 4WXHA 4PUSA 2XF5A 4A6EA 3E6BA 5BPDA 3G3ZA 3KETA 4BY7J 1EH6A 2VQLA 5EEAA 3BZ6A 3U21A 3RZDJ 3ZQHA 1K79A 1S5LC 5DM7F 4U0YA 4MLOA 1TWFJ 4BQNA 3A01B 3I59B 5FD6A 3QP5A 2AS5F 4XRSA 4HSTA 3C2GA 2EPFA 3SYTA 3ABMH 5LRSA 1HW2A 4D5CA 2CU7A 2VKDA 3PNVA 4NC8A 3T0YA 5LHIA 1MBKA 2MW8A 4HPQA 1BM9A 2EFOA 2OF7A 2XDVA 3GVAA 5EF6A 4L5JA 4M9XA 2K9LA 3LSRA 3I4MJ 4JBAA 4D5FA 4AU7A 2ZJQF 2VJIA 3KEQA 3OYDA 1YITI 1XDUA 1YIJI 3BG9A 1GVJA 5IP7J 3C7JA 1OCZH 2FX0A 2M2EA 3HHGA 3ZGKA 4G7HF 1V55H 4BU2A 5DUIA 2NVYJ 4C3HJ 1T98A 1T0FA 2LREA 2ZNZA 2CO5A 3BJ6A 5J3LA 3DTKA 1LPQA 5IYCJ 5J47A 4A69C 4A0YA 1RKTA 2MABA 1TL8A 4B43A 4A3MJ 2P0WA 1H0MA 2YX7A 1QZZA 3BR3A 2H1LA 3MFKA 5HDGA 1MMGA 1T95A 5ICFA 5J4VA 4EMSA 2ELJA 2M5WA 1I6HJ 2HDCA 1W36D 1J09A 5CJ9A 1WJDA 3WU2C 2O8XA 2JUGA 5IY5H 2WAQN 3WTUC 4XMYA 3HYIA 3PQKA 1LE8A 2STTA 2EV5A 2HYJA 2OQGA 1LQ1A 3V7RA 3I53A 4F93B 1DGRM 2V26A 1VZ0A 1OJLA 4AVPA 3S1RJ 1KA8A 2DJIA 4BKXA 4EM0B 4IOCF 3T8TA 3ZOBA 2DQRA 2ZXHA 5D5VB 4BE0A 2GOMA 2KZGA 3KP2A 3SEZA 1A5JA 4BACA 1FEXA 1QQIA 3K69A 4PCQA 4FX0A 3K70C 3PQJA 4M6XA 2PG4A 3WHBA 3B02A 2O5RA 4M3FA 4CUGA 2EFNA 2LVSA 4F91B 4I02A 4EJOA 3V8KA 3VWBA 2B0LA 2KRCA 2F5VA 3F8BA 3V7CA 5DDGA 4N9HA 4M3GA 3BZCA 4LOCA 2ELHA 4WK8F 1FC3A 2VQGA 3TKYA 4EJVA 4M74A 4A12A 4CCNA 1WI3A 4F52A 3KEYA 3KYLA 2NOJB 3TP0A 2Z33A 1NK2P 2L4MA 2Y0SA 2X6XA 2G7UA 1WJFA 2PMHA 3CF2A 2LF7A 2X6WA 2R7SA 1BC8C 2NS8A 1R4NB 4ZTJA 3JRDA 4HV5A 5LHGA 5HLHA 3DBRB 2NNYA 2CQQA 4BJ6C 1FLIA 5K5QA 1ITYA 4FX4A 3V8LA 1VQKI 5BQTA 3SZGA 4DYCA 2Y48A 5F1RA 5J6XA 4M73A 2A6EF 3FZVA 2VBZA 4UUTA 3I0TA 4BJTA 4KNYA 3T5XA 4NB5A 1MJAA 1XMKA 3VSKA 1ZGWA 1ODDA 1G59A 4J00A 1MBJA 3LQRA 2D1HA 3P5JA 2BXYA 1MMDA 5J8FA 4PJ0C 4E7KA 2LD5A 1IXCA 3ZRGA 1V4RA 3KE2A 3KIOA 3OSFA 2Z2SB 4KFCA 2V1DA 1T33A 2KLOA 4EVIA 1U5TA 3IV5A 1FYKA 2VBYA 4CXFA 3J80K 4M9ZA 2L4AA 5AIQA 4IQ4A 4L9JA 4N0BA 3MZHA 2ID3A 2ME6A 4EQQA 1ON1A 3HXLA 2K9MA 2XAUA 3FXKA 4MHGA 1IO2A 2EJRA 3LAPA 5E3MA 2KZVA 1RUNA 4QSHA 1QHHD 2MC3A 3KEOA 1VQNI 1YI2I 3E0JB 2VL8A 3W2VA 4BEHB 2FNAA 5H6RA 4B47A 1IUYA 2IBDA 1DP7P 3LSTA 2JVGA 3BCBA 1ZYRF 4RAYA 1YG2A 2XPUA 4R8HA 2L5QA 3FK7A 3BWGA 4MFDA 2JA5J 3JR9A 5HDKA 1USTA 2NXNB 4AUXA 2EBIA 3VFZA 3HOZJ 1LFUP 1ZQ3P 2BV6A 4MQVA 2FSWA 2JPBA 1GXPA 4G8XA 1AA7A 2L7FP 3I54A 2FBHA 1GDTA 4BGDA 3H92A 2CWEA 2CYYA 1RUOA 2BY3A 3A2KA 1BI1A 2ZFWA 3F8MA 1S7AA 3H36A 5D6EA 3QOEA 4DZJA 3LA2A 4KA4A 2QWWA 1LEAA 4S04A 2KJBA 3HGGA 3S17J 2O61A 2CGPA 3AG4H 2Z99A 2K85A 3OIQA 2GOXB 1EJ9A 3CMYA 2WBMA 3V42A 1JGSA 3HRTA 3BJAA 2D1VA 1LUJB 3MMYB 4F92B 6PAXA 1U0JA 2C6YA 1TQIA 4H0EA 3S1NJ 1A31A 1E0EA 5ERIA 3F21A 3JW4A 3CUQB 2HQRA 4L9TA 5GPCA 5GADJ 5F1JA 1LEBA 2R5YB 2NYXA 1XMXA 2HU9A 4BBSJ 2IGNA 1GLNA 2EQRA 5J1YA 1XSVA 4IHWA 3M7GA 2HVSA 3GLXA 1G3SA 3TMOA 4G7OF 3OYMA 3MKLA 3DXJF 2HXOA 1PVEA 3QU3A 5J4YA 3F72A 5K7HA 1LB2A 5KCMA 3HHHA 1DQUA 3K10A 2TDXA 4ZTFA 2V7FA 5HS7A 3F8CA 4I2OA 3L9FA 1SD4A 3BOQA 3VDXA 4IZZA 1LVKA 3HGYA 3M8JA 3ROUA 1HDDC 2JQ7A 2HYGD 4OWRB 3N05A 4XSXF 1JKPC 3LOCA 3H3UA 2MD0A 3RQIA 5EDNA 1JTYA 2M45A 1IW7F 1IZ1A 5AIPA 4EATA 1R58A 2KRFA 2EFPA 1RR8C 2GBYA 2GA1A 4DBRA 2MH9A 2ZB9A 3SZTA 5ICCA 4YG2F 1IN7A 4G6QA 2L9RA 3I3LA 3U9GA 4HRIA 1FBUA 3RSNA 2CUJA 2O6GE 3KP5A 3H9GA 4XM3A 4I09A 3GO5A 1TNTA 4A3JJ 1IJWC 4KMUX 3TGNA 2XAGA 3S15J 2O03A 3FXOA 2ZXWH 1REPC 1UG0A 5E79C 1NG6A 1N77A 1R7JA 2F5DA 3OIOA 4CYDA 5D8KB 2NRAC 3F22A 4D9JA 4LITA 3J7AO 1JT0A 1KZHA 4P55A 2UUZA 4LLGF 5E3NA 3HRSA 2Y69H 5C4JJ 1G3YA 2M34A 3IKVA 2IPQX 2IEKA 2LNBA 2YUSA 3CD6I 1P6RA 2V1UA 1FP2A 1VQMI 3OYCA 2WADA 1T08B 3MVPA 3VYUB 3ULQB 1P4XA 3KYDB 4IHTA 2H6CA 2H1KA 3M3YJ 3QYFA 2E1NA 4G6TB 3PSFA 4L0YB 2M7AA 1MBHA 3HSFA 4FTHA 2OAZA 4PJJA 1APLC 4MFEA 1K83J 4HYEA 2TRTA 4XKWA 3G4SI 2LSOA 3K4JA 2CQNA 3ZN1A 4OMYA 2LMDA 3RIRA 1SVMA 4RA2A 1HF0A 1R49A 2PQ8A 2OQRA 3S1MJ 3PNTA 2QSGX 1R4MB 3FXMA 3CCQI 3CJNA 3VOEA 2GWRA 3ZN0A 1XS9A 5D5XB 5CKTA 3OR2C 4CCLA 1TQMA 3S14J 1B4AA 4B4CA 2NVUB 2M8EA 2LC2A 5J8CA 4XQFA 5ILUA 1K61A 2R7VA 1E3HA 2RREA 2H8WA 4MTDA 2VC0A 1ERDA 2VASA 2QBYA 1S29A 1XN7A 3L2VA 3K4LA 1UFMA 3ZQIA 2E5NA 1BR1A 3OYKA 1NG7A 2RNJA 1HOMA 3MKZA 3FX3A 1U8RA 3M1CA 2W1OA 3PL8A 2XPVA 2LYCA 3Q0UA 1T2KA 2CJJA 1F5TA 1IN5A 1I1GA 4NC7A 2ZMEB 3FKIJ 2Z9OA 2GZWA 1B1BA 2Z16A 5B5EC 4IOAF 3DKXA 1Y1WJ 1R5HA 1J9IA 2JMWA 2KL4A 2P81A 3O3KA 1HA8A 3BG3A 1CF7B 3RKWA 3OS0A 3R4KA 1T56A 3BG7A 2EA4A 1XPXA 1W0UA 1R00A 2DODA 3PFYA 1FMVA 3OOUA 2MLGA 4F3QA 4KT6A 4I0AA 2KP6A 4NUBA 3OYIA 2JA8J 4DGWB 3GTLJ 3KP3A 2A3SA 2V6CA 3BTIA 4HSRA 1G4DA 3RYPA 3MZYA 4OAYA 1USSA 4ASNA 2HS5A 1XTAA 1ZRDA 3PFIA 1YW9A 5CLSA 2B63J 4II2A 2NS0A 3DWLE 3KZIC 1ZRFA 3RZOJ 3W6KB 5LLQA 2V9KA 4LK1F 4IO9F 1TBXA 3FBIB 1U2WA 1BOBA 1WRJA 2AQFA 2HVRA 4KN7X 2E34A 3DBHB 3GZ6A 3QPTA 1Z0XA 4P96A 2DO7A 5LGNA 3IP4B 4BY1J 4RGRA 3BTJA 2QYOA 4ABZA 1VFCA 3EUKL 4PSXA 5FLXK 1X1CA 3HRMA 2FF4A 1KU7A 4EM2A 1LFBA 3EETA 3IKTA 4Y33A 2XGEA 1L3LA 2YS9A 2P6TA 4HLXA 1ZREA 4LG3A 5JHUA 2F6CA 4D1QA 4IHXA 1KQ8A 4RBOA 4A3FJ 2JJ7A 1B6AA 1R6RA 3ZMUA 1VNDA 1WI9A 3RQ4A 3CCMI 2DMPA 3H5RA 1DU6A 1ETOA 2RAEA 5DTDA 1JKRC 2DDAA 4IJAA 3BTCA 2KDZA 2LY1A 4XLPF 4CYCB 1H9GA 4RB2C 5GTIC 3CMAI 1YLFA 3ZPLA 3LFUA 3J7ZI 2K02A 1YJ9I 3BG5A 3KLOA 3FISA 3EYYA 1TZLA 4M6VA 4LG0B 1BR2A 1D8JA 1WJBA 2NVQJ 1A04A 1D0YA 2RV8A 3R60A 5ED4A 5K1YA 4NBQA 3L7WA 2N8GA 1RKWA 1B8IB 1X3WB 3UR3C 2STWA 2WC2A 2BW3A 2EK5A 1YOVB 2A61A 3GX4X 1IXSB 1WVRA 2X0LA 3EUHC 2HQNA 4E70A 3PIPF 1JKOC 2ISZA 2QQBA 3GFLA 1I3QJ 2UV1A 3CJRB 2LY2A 2DFEA 2M0MA 2NS7A 4FT8A 3CF5F 1RESA 2X4HA 3OYJA 3LNQA 1V5FA 3CCRI 3Q0WA 2FMLA 2H8RA 4F7ZA 3KZZA 1TP4A 1D5YA 2ESHA 3LSJA 1KU2A 2DCEA 2IT0A 2KKOA 3BZKA 4XLNF 2KIFA 2I5UA 3FMQA 2TCTA 3Q5FA 3HG9A 1E3PA 3P9CA 2R7RA 2LH9A 3IUOA 1ONVA 3I55I 3TO9A 1OCOH 3OY9A 1M1EB 4MEYF 1E17A 3LMMA 2CG4A 2JSPA 4LIVA 5E8GA 1D0ZA 2Q2EB 2FNPA 4XN3A 1N78A 4DQ2A 1VQOI 3S8PA 3ERMA 3F6VA 2DMTA 3ZR8X 2LF8A 3BQYA 4UHTA 2EH3A 2R4GA 2O0YA 4IL6C 3MQ0A 5LFAA 2OA4A 4PGGA 1IRXA 2LKPA 4R79A 4A3EJ 4B09A 2DFHA 4K2EA 2PMZA 3VYTB 2KRHA 4D7MA 1D5VA 5EGOA 1WJCA 1OR7C 1MDMB 4WXCA 4ENJA 4BHBA 3LWFA 5EEHA 1D1CA 2DJNA 4ZYAA 1OYWA 4E7SA 3M9AA 2LR8A 2XROA 5J1RA 5EZHA 5DEQA 3F6OA 3MN2A 5LEJA 1OCPA 3E5UA 3GFIA 2YX4A 3HOTA 1K6YA 3MAJA 3QYBA 3B6CA 4BE2A 2VQCA 1KQ9A 2WB1A 4A6DA 2A6HF 2LTPA 3CO6C 5M5YJ 2QA4I 4GCVA 1YX3A 3MKWB 4J19A 4ETSA 2A6TA 1QNTA 1YRNB 3K70D 1PUFB 2Y31A 4BXXJ 3NQOA 3AG2H 3CTAA 3GLLA 3S3OA 5DS9A 2W25A 1P7JA 3D5RC 4GRIA 2G0EA 4BDZA 5KK1A 4HQMA 4XLFA 4A3IJ 2HEOA 4BXFA 3W2WA 3C2HA 1BIAA 2F48A 1RNLA 3L2UA 1IN4A 3NEUA 2X51A 3DP7A 4CCJA 2VOPA 5BOXA 2MA3A 2M4GA 5HNFA 2PBIA 4P9UA 3E1SA 2CV1A 3KP7A 2KHMA 2E5ZA 4UUVA 3WE2A 2DXIA 3OL3A 4KMFA 1Z3YA 4YFXF 3CDHA 1I39A 5M3MJ 5D4SA 3OOPA 2QKLB 4ITVA 4N4OB 1YW7A 4E7LA 5HVQC 4G7ZF 2IRFG 2FOKA 4HNVA 3CC4I 2YU3A 3OR1C 1OQYA 3FF5A 2GLOA 4NC6A 1H9TA 3KP6A 2HNHA 3IH4A 3JRGA 1FOKA 2HTJA 2EIJH 2ZMEC 4XKBA 2E19A 3JAMK 2RGVA 2COBA 5EJCA 2KT0A 2WV1A 3ZXSA 2VJJA 1P4WA 2K9QA 1UZCA 3E3VA 1WJ5A 1QO0D 1K78A 2Q0OA 1OYYA 3DU6A 4ZZDA 4RAZA 2AHQA 2EWNA 2X85A 2ZO4A 2XB5A 3ZMDA 3NAUA 1XSXA 2VT3A 1UB9A 3IWFA 4ENMA 1J0RA 1AKHB 4EEFG 2JPCA 1N25A 3S3NA 2ZNYA 4CA0A 4UVBA 4BJ5C 1SFUA 5K7FA 2JRMA 1ZG5A 1FNNA 3KYCB 3SFZA 4ZDOA 2H27A 4L18B 1R5ID 4BHCA 1QZYA 1YHQI 2WTEA 1IRGA 1Y8RB 3QYEA 3OYFA 3KP4A 3A4CA 2KIMA 2ME0A 4ZJZA 4OAZA 4V2GA 4JOMA 5KVRA 4Y17A 1W4MA 4WCGA 1IRZA 1BL0A 1Z1DA 3FM3A 3K4BA 2V9PA 4HX4A 1S7EA 4CSWA 3VODA 1F1ZA 4KUMA 2VOOA 1A6IA 4I76A 2BVMA 4BYYA 1JI8A 2W4SA 4XOTA 5IYBJ 2F2EA 4YEJA 2HI3A 3DPTA 3AL0B 3RPUD 1QGPA 3EDPA 2UXXA 2PI0A 5CPRB 4IQJA 4ENKA 4HF2A 2L9SA 4N4NB 1BA5A 3TOAA 4PFOA 1TW3A 1HQCA 4Q48A 3CUQA 2R7TA 2D45A 2MBFA 1TNSA 2E35A 2QLZA 2W00A 1MH4A 3OYNA 4RM3A 3FHNA 1QU3A 2ZSHB 2HZTA 2X9DA 3F9KA 2IA1A 2VXDA 3JRHA 2KJCA 3P9KA 1JJ6C 1IRFA 4LK0F 3VB2A 1FP1D 3FMSA 2DN0A 1SC7A 1K7AA 3CCUI 3OMYA 1YE9A 1R23A 4M71A 3GFJA 4QPQA 1A6QA 1XMAA 2MLKA 3HUGA 4ESBA 2PEXA 2QVOA 1P9QC 3FK6A 2JA6J 1HW1A 4M9SA 4L9VA 3RKXA 5LGTA 1BC7C 2FJ1A 4E7HA 3ASOH 3K4CA 1BI2A 1IN6A 3MWMA 2K3FA 2Y30A 4XRSG 3I71A 3TO7A 4BAYA 3OYAA 2BOLA 4Y52J 2K5CA 3MEXA 4M6YA 1T6SA 2LKXA 2VKEA 4OU0A 2RVCA 5GPAA 4PSWA 2L7KA 1MBEA 3BR0A 1FSEA 2JTVA 3ZQ7A 3E6MA 1LE8B 4IEJA 1ETYA 3HTUA 4MGRA 1LJ9A 3LSPA 2PMZN 4JX5A 5A2QK 4DOZA 2F5EA 1AU7A 2R7UA 1KU3A 1XDSA 3ASNH 1AOYA 4IHYA 1OMIA 1A36A 3BT9A 5TISC 2FQ4A 3WTVC 2R7ZJ 3I64A 4Z6YA 1X1AA 2DOEA 1Z21A 1S7OA 1RRJA 2HOEA 3FXQA 2DA2A 3PUFA 2DA7A 3WU1B 3ECHA 3K9TA 4HDVA 3PIOF 3CJTB 2V4JC 5F64A 4F55A 4EJWA 1U6GA 2ZCWA 1G8XA 5FFZA 1S6LA 1UHSA 2A68F 2BYVE 2Y0MA 3U2RA 3OL4A 3X2QH 4E4HA 1CQTA 1FZPB 3M4OJ 4V2FA 3CZ6A 4MQ9F 3N97A 1K6OA 4EV0A 2AXLA 1R22A 1W7PB 1Y39A 5FRMA 3C3WA 4JYKA 3Q0VA 2XB0X 4CCOA 4YIFA 3FWEA 3HB9A 5HOOA 2PFBA 4C2UA 5IT9K 2G7HA 2DA5A 5IPAA 3JAMZ 2ZJPF 2LBFB 5LHHA 1PJRA 2VE8A 4M3BA 3ERED 3TEDA 4PJNA 1B59A 2A5YB 3UKGA 3QAHA 3Q9SA 3BPVA 3H9QA 2OUMA 2FBKA 5E8IA 2M87A 4AYBA 2XAQA 2D5VA 2L7ZA 2OV7A 4HAMA 2VI6A 1ZGAA 2VC1A 5E17F 1FSHA 1O3QA 5L3DA 5IP6A 1A35A 1ZTRA 3CCVI 2AQEA 2OU2A 2KISA 1BN5A 4YELA 2EINH 2WY7Q 1KYZA 2D2WA 2DMQA 1F4KA 5FB2A 3LL7A 3OWTA 3AG1H 1EF4A 2DA3A 2RKHA 3H1CA 1IC8A 4WX9A 4HEA2 4OINF 3NWTA 1R36A 2QQ8A 3HBLA 1DPRA 4U87A 3OYHA 1U5TB 5LEKA 5CVRA 3V4GA 4Y15A 2HPIA 4AWXB 1DDNA 2HOAA 4BXUA 2VBWA 1JHFA 2ECBA 4GXOA 3W6JB 2DPDA 1J2XA 3MZ8A 2JSCA 1N75A 2LG4A 1W5TA 1K4SA 1ETQA 5TGTA 1ZLJA 2RNGA 1ETWA 1BI0A 4NHJA 4RAFA 3HOSA 1CF7A 2CRGA 4AIKA 3DKYA 3DPLC 1KQ0A 3BPXA 4N9IA 1IAWA 3K2AA 3H3VK 2EIMH 3R0JA 2FE3A 2ECCA 2NOGA 5F27A 3K1MA 4LB5A 2JN6A 4RAGA 4XK4A 4ZH4F 2LKSA 1SANA 3C1DA 3H9JA 1RIOH 4V19K 2DOFA 2UZKA 2Q1ZB 2VN2A 5EZGA 4ENNA 1JE8A 3V8JA 5GAEJ 2EZHA 2OTJI 3GUDA 2R93J 5C3EJ 3K1PA 4IRIA 2GM4A 3HKZA 3RJPA 2F5CA 3CC2I 3GFMA 1RC9A 1HSJA 2CW8A 3S93A 2Y0SN 2E36A 2V1NA 3KZYA 3NRVA 3J80Z 4NQWB 2DFFA 3L2QA 1X3ZB 1OCRH 1P7IA 4W97A 1F43A 2M9HA 4II3A 5DM6F 4IF4A 2X6YA 5FKNA 1G2HA 5E1XA 4DZPA 2FRHA 2FMYA 1SFKA 5F6FA 1NTCA 3GCMA 2NVTJ 3GW2A 5KAIC 1BOAA 2PJRA 1Y0NA 1GXQA 2IS6A 1JTXA 3HJEA 2CQKA 4CICA 3FXLA 1LFPA 1XG1A 2H6BA 3KFWX 1YYVA 5FO5A 3RI4A 5EEGA 1EA3A 2BEOA 2FUG2 1CGPA 1MNMC 4QIWN 4WWCA 1X58A 1GVDA 3T1BA 2KFDA 3E7LA 4FETA 1RETA 4RB0A 2DU9A 4CYCA 5ILSA 3AL0C 3L2RA 2HVQA 3LA3A 3CDIA 4PZJA 2VQHA 3PUBA 2CQXA 2ELKA 4FCYA 1RZ4A 1MNEA 2IP2A 4R1HA 4ANJA 3O8HA 5DCMA 1V5EA 1FBQA 3S32A 4LG0A 5IOYA 2QM3A 1J7KA 3V7SA 1X3UA 3HM5A 2HGCA 3MKYB 4WXDA 3GTPJ 4C9YA 2E60A 4OIOF 2JWTA 2EFQA 1PUEE 3N4MA 1JJ8C 2MYSA 1KGSA 1BW5A 1X4PA 5F0FA 3A02A 3S2HJ 2IGMA 3WTWC 3PO2J 4AC0A 2M1BA 4U0VA 5FFXA 2K9NA 3MD2A 2BBYA 1FIPA 1W7PD 4Z2YA 5FROA 1BI3A 4AIJA 2P4WA 2KMUA 5IT9Z 1BJZA 2P5LC 4RDUA 2H09A 2HDWA 1GV5A 1T0FC 5CVVA 5JR3A 4XICA 4HF1A 1EKEA 4XLEA 3RPUA 1QA6A 2HYFA 1JKQC 2GIZA 1TLHB 3QU6A 3JRCA 1MJ9A 1ETXA 1ZAOA 4IRGA 4XKCA 4XOPA 4DW6A 1UJ8A 3BR5A 3S3MA 4GFBA 3LSGA 2OJED 1ACIA 1P92A 1WPKA 3CO7C 2QSHX 1HSTA 1VQ6I 2VPRA 3JRAA 2DT6A 2XUBA 4C2MJ 1MMSA 2PN6A 1ETVA 1IXRC 2JA7J 5IT3A 1WH7A 2M3AA 3R0AA 1K4TA 2CMPA 2CUFA 2LK2A 2XGCA 1S3JA 2YSRA 5L3CA 3IAM2 4E7IA 3CESA 3HOXJ 2JUCA 2IXSA 3G1OA 3K4MA 4M3EA 3J81K 2WAQA 1VF9A 3HPGA 4HG2A 5TJJA 4HNTA 3LSHA 1UELB 4J01A 3DTIA 2HR3A 1S72I 4GYGA 5L3FA 5FLVA 2W57A 4UUSB 1MDMA 5EG0B 3DBLB 5BNGA 2XF7A 3I5UA 1XGNA 1OCCH 3GMEA 3K4NA 4G94A 4AYBN 3ZP5A 4E7JA 2IS1A 4XRMA 2DLLA 1Z9CA 1R1VA 4HDUA 1U9OA 3IC7A 3CLQA 3RYRA 3QPSA 3FKJA 1GT0C 2YU9J 3AAFA 4A3GJ 1TC3C 1SVLA 3L09A 3JSOA 2K9SA 1R1TA 2XF6A 5CQGA 5DYMA 1ETKA 2R5ZB 1ZR4A 3GZNB 1ZN2A 4HA8A 2R0QC 1G3WA 1TQPA 2KDOA 3ABKH 2E2IJ 1JXSA 1XCBA 1MBGA 3A01A 1ZG1A 5LD2C 3I59A 3D0SA 1FYMA 3D1NI 4AIHA 4ZYDA 2QBYB 3WE3A 1YIOA 3P9IA 1PUFA 4LLLA 3HOVJ 2O3FA 3WGHA 5FRNA 3F0CA 1FOYA
chains in the Genus database with same CATH topology
4BDYA 3BLYA 4H4KC 2W82A 3DEEA 1AA7A 2HNHA 4RLQA 4XKBA 4BGDA 3ZXSA 4B44A 2VJJA 3A2KA 1WJ5A 2VIXA 4XNFA 3QOEA 1WJAA 2CUZA 3DU6A 4XLAA 2X85A 5KNLA 2XC7A 1DP3A 2W7NA 3OIQA 2GOXB 2WBMA 3V42A 3K6GA 4DBQA 3IAS2 3S3NA 3VSLA 4BQOA 4CA0A 4BJ5C 4F92B 3MMYB 1U0JA 3H5NA 1X19A 4YRVA 4B48A 1E0EA 1WJEA 4CZCA 4ZDOA 4JQFA 2VJ5A 1YX5A 3QYEA 3OYFA 3A4CA 2HU9A 4XKVA 4ZJZA 2IGNA 4OAZA 4JOMA 1GLNA 5HLTA 4BQQA 2CV0A 1OLTA 2HVSA 3TMOA 4U7BA 1D1BA 3K4BA 5KHDA 2WY8Q 3OYMA 2VLAA 4CSWA 3BG6A 2VB6A 5KCMA 2CW7A 1S9HA 1DQUA 2BVMA 3K10A 4ZTFA 2V7FA 2W4SA 1JI8A 4XOTA 4PFPA 4YEJA 4XORA 3H0DA 3DPTA 3DQVC 4BE1A 2HPMA 3RPUD 3AL0B 3VDXA 4IZZA 1LVKA 3M8JA 3I9V2 4OWRB 3N05A 5CPRB 4PJLA 4IQJA 1DGWY 2L9SA 3LSIA 4N4NB 2MD0A 3W3CA 4PFOA 4EATA 3D5SC 1BR4A 4KITB 3BC8A 4DBRA 2R7TA 2W00A 4KJZA 2E1MB 3I3LA 4RM3A 3A1YA 3OYNA 3FHNA 3EUAA 3CP2A 2ZSHB 1QU3A 4HRIA 5CQEA 3RSNA 2CUJA 1D1AA 3LSKA 1TT0A 2V6EA 2L9NA 3F9KA 3FDYA 2VXDA 3H9GA 4XM3A 4KISA 2K3PA 1UG0A 1Z7LA 4DJAA 3OMYA 1NG6A 1YE9A 4HNUA 1N77A 2VPLA 5JHFA 4QPQA 4P5OA 1FMWA 4C30A 4D9JA 4PK4A 4LITA 1P9QC 3CJQB 2DOAA 2UUZA 2KQRA 2X1DA 1LKXA 4XN0A 2PJRB 4E7HA 3K4CA 2BW3B 3OYCA 2CFOA 2WADA 3VYUB 2X1CA 3OYAA 4FASD 2BOLA 2K5CA 2XSJC 2CS3A 2LRDA 3QYFA 4G6TB 3BCAA 3PSFA 3VYRB 1PYVA 2M7AA 4PSWA 2L7KA 4RLFA 4PJJA 4DOZA 2HQAA 2ZXIA 3OYGA 3EPZA 2R7UA 4XKWA 2L2OA 1WFXA 1Z3XA 3K4JA 1X1AA 4E7ZA 4CH7A 1Z21A 2MC4A 3SDBA 4IX7A 2LOOA 2R7QA 3PNTA 4DIQA 2R7XA 4RMNA 2V4JC 4F55A 3DLAA 2ZSIB 1G8XA 5CKTA 3OR2C 4CCLA 3OL4A 4BEHA 2CH0A 4E4HA 2WAEA 1X1DA 2LC2A 3CZ6A 2WAFA 3CMMA 4XQFA 1D0XA 2R7VA 2RREA 1X4OA 5FRMA 3HL2A 4XLCA 3OS2A 1Y56A 3W2AA 1ERDA 2VASA 2ZFUA 3SEQA 2VXZA 3PNYA 3L2VA 4QPOA 3K4LA 4CCOA 2A5WA 2E5NA 1BR1A 5HOOA 3OYKA 1NG7A 4C2UA 1V5GA 3MKZA 2LBFB 3OYBA 2CV2A 1PJRA 2W1OA 3D5LA 3M1CA 3PL8A 4PJNA 3H5AA 2LYCA 4BL0B 3H9QA 2OUMA 4NC7A 4AYBA 2Z16A 2OV7A 2IGOA 3DKXA 4LIUA 3PSIA 3L2WA 2KL4A 2E1MC 1HA8A 3OS0A 3BG7A 2AQEA 3AFHA 3HC7A 4YELA 4RM2A 3QODA 3PFYA 3RTRA 2WY7Q 1FMVA 4XONA 3OOUA 2JVHA 4F3QA 4KT6A 3LL7A 3OWTA 3FBNB 2KP6A 3K4KA 2VKHA 4NUBA 3OYIA 2R7WA 4DGWB 4HEA2 1MW7A 3NWTA 1UAAA 2R7OA 4HSRA 4U87A 3VYSB 3PJRA 3OYHA 4AVZA 2LBFA 2DT7B 2RQQA 4OAYA 2IS2A 1ZELA 2HPIA 2JA2A 3ZQQA 3RCOA 4II2A 3DWLE 4XL9A 1N75A 2LG4A 2MFZA 5TGTA 2V9KA 1QHGA 3FBIB 2OC6A 1BOBA 2RNGA 3J7AY 2AQFA 2HVRA 4PUSA 3HOSA 2XF5A 1W36C 3DKYA 3DPLC 5HNHA 2VQLA 3IP4B 3OS1A 4C2TA 3U21A 3EUKL 4MLOA 4PSXA 4BQNA 3AKZA 1X1CA 3H9JA 4HSTA 3C2GA 4Y33A 2Q1ZB 3SYTA 2VKDA 3PNVA 4NC8A 4LG3A 4X0GA 4HPQA 2F6CA 4D1QA 2XDVA 3DU5A 2K9LA 1R6RA 3HKZA 4CCMA 3RQ4A 4AU7A 3H5RA 2CW8A 2VJIA 3S93A 3OYDA 2V1NA 4NQWB 4BUPA 2LY1A 4Y3OA 3L2QA 3ZGKA 4II3A 4BU2A 2X6YA 3LFUA 2LREA 1SFKA 1TZLA 3DTKA 1BR2A 1WJBA 3TBIA 1D0YA 2MABA 2IS4A 4B43A 2PJRA 2P0WA 2IS6A 3DPUA 3UR3C 2BW3A 3ZCOA 4NNJA 1MMGA 1LFPA 1T95A 2ELJA 3EUHC 2IGKA 1LDKB 1EA3A 2FUG2 3NWSA 4B3XA 2UV1A 3CJRB 4XLHA 1J09A 4XR6A 1WJDA 2LY2A 2M0MA 1W36D 2JUGA 4XMYA 1MNDA 2F4IA 4FETA 2UWMA 3OYJA 1V5FA 4P1WA 1DGRM 2V26A 4F93B 3AL0C 1VZ0A 3L2RA 2HVQA 2VQHA 2DCEA 2DJIA 3PUBA 1MNEA 3KX2A 2ZXHA 1SAUA 3HG9A 4ANJA 2GOMA 2VJ4A 2QKMB 3SEZA 4BE0A 1V5EA 3OYLA 4BACA 3S32A 2R7RA 2LH9A 1Y6IA 3IUOA 3OIPA 3K70C 3OY9A 2M7BA 4PJMA 3MKYB 2O5RA 4C9YA 2E60A 4CUGA 3LMMA 4LIVA 2JSPA 1D0ZA 4F91B 2Q2EB 4XN3A 2MYSA 3VWBA 1N78A 4Y4RA 3CP8A 3S8PA 1X4PA 3OYEA 2KRCA 2F5VA 3GBGA 3ZR8X 2IGMA 3ONQA 2R4GA 3MD2A 2VQGA 3G2BA 5FROA 5LFAA 2KMUA 1IRXA 2M4KA 4CCNA 4F52A 3KEYA 4R79A 2NOJB 3KYLA 2HDWA 2Y0SA 1T0FC 2PMZA 2X1EA 2X6XA 1WJFA 2I8DA 2KRHA 3CF2A 3VYTB 2X6WA 1WJCA 2R7SA 1X1BA 1OR7C 4XLEA 4ZTJA 3LSMA 3HUGB 4XKCA 4BJ6C 1D1CA 4XOPA 4ZYAA 3S3MA 2HZDA 3LSGA 4E7SA 3SZGA 4BS9A 1MMAA 2DT6A 4ZC3A 4BJTA 3TL4X 1G59A 2M3AA 3VSKA 3HOTA 1K6YA 4J00A 2CMPA 4E7IA 3QYBA 3IAM2 3CESA 4BE2A 2VQCA 1MMDA 2WB1A 3HPHA 4ZDPA 4E7KA 2IXSA 3K4MA 3ZRGA 3DTEA 1YX3A 2WAQA 3HPGA 2Z2SB 2A6TA 4HG2A 3MKWB 4HNTA 3K70D 3LSHA 1UELB 4ZDLA 4E6KG 4J01A 2KLOA 3DTIA 3S3OA 3D5RC 4GRIA 4BDZA 2XF7A 4IQ4A 4XLFA 4BXFA 3W2WA 3K4NA 3C2HA 3HXLA 2K9MA 3L2UA 2XAUA 4E7JA 2IS1A 2X51A 4CCJA 2Z1DA 3FKJA 2KZVA 1QHHD 2M4GA 5HNFA 3E1SA 3E0JB 2VL8A 3W2VA 2CV1A 1MMNA 2E5ZA 2KHMA 4BEHB 2XF6A 5CQGA 2BVLA 2DXIA 4B47A 3H35A 3OL3A 3UNGC 1Z3YA 2KPMA 4IKFA 2JVGA 2KDOA 3BCBA 1KONA 2L5QA 2QKLB 4ITVA 4N4OB 5LD2C 4E7LA 5HVQC 2WA0A 5FRNA 3OR1C 4CCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QPQ A;  1DP3 A;  4QPO A;  3OMY A; 
#chains in the Genus database with same CATH topology
 3BLY A;  4H4K C;  1ZK8 A;  2W82 A;  3J7Y J;  1VQP I;  1LVA A;  1QVU A;  3QWL A;  4RLQ A;  1I50 J;  1SFE A;  1WWX A;  2B7E A;  2L3D A;  4M3D A;  2ZJR F;  2COM A;  3SHF A;  4B44 A;  2ESN A;  3S2W A;  1OYI A;  4JX4 A;  3WG9 A;  3JRB A;  4O5V A;  1WJA A;  2CUZ A;  3KPH A;  2DTR A;  4XLA A;  2ACJ A;  1HBX G;  3SXY A;  2FOW A;  2XC7 A;  2LY9 A;  2K86 A;  1IDZ A;  4X1E A;  1Z7U A;  2OCC H;  5E3O A;  1P4A A;  3FXU A;  4DBQ A;  1X2N A;  4LD5 A;  4ZYE A;  2AXT C;  3IAS 2;  3VSL A;  3JCU C;  4BQO A;  3WTZ A;  3CCS I;  1HXD A;  4O6J A;  4KN4 X;  3ZQC A;  1EV7 A;  5D5W B;  4YRV A;  1U9N A;  4OIR F;  1U5T C;  3IRQ A;  4CZC A;  1GUU A;  2A69 F;  4G6D A;  3DEW A;  4KYW A;  5BS6 A;  3BRO A;  2ZKZ A;  5FKL A;  2VON A;  2A05 A;  4XKV A;  2QZ8 A;  1TTY A;  5ICG A;  1Z6T A;  4YFK F;  2GA2 A;  4B3A A;  5HLT A;  4BQQ A;  4HQE A;  2XSD C;  4C3J J;  4IHV A;  1OLT A;  1BBY A;  1ORK A;  2MH2 A;  4U7B A;  5FGM A;  1JUS A;  3FXR A;  2MG4 A;  4U88 A;  4EGZ A;  4UXN A;  2XPW A;  3S1Q J;  2F4M B;  3QPH A;  2CW7 A;  1U3E M;  1S9H A;  2EZI A;  3BQZ A;  2QSF X;  4A5N A;  3A0H C;  1GHC A;  1HKQ A;  3GTM J;  4PFP A;  2VKV A;  4XOR A;  3H0D A;  3DQV C;  2HPM A;  2IW5 A;  3U1D A;  3BR1 A;  1XGS A;  4Y13 A;  2RC4 A;  2VE9 A;  1DGW Y;  3HOU J;  1XB4 A;  3W3C A;  3LA7 A;  2ADU A;  1ZGJ A;  1BW6 A;  1O3S A;  2MGQ A;  3D5S C;  1FTZ A;  2XKP A;  1NH3 A;  1B9M A;  5B66 C;  5E20 A;  2J5O A;  3ZQL A;  2A07 F;  3A1Y A;  3CP2 A;  3EUA A;  1YO5 C;  1MJB A;  3LSK A;  2V6E A;  1TT0 A;  3ZMV A;  2XGX A;  1DPU A;  2DAO A;  4ZYG A;  2G9W A;  2JK3 A;  2OCE A;  3HDD A;  4KIS A;  5IYD J;  2HTS A;  2QQA A;  4DJA A;  4QLC U;  4HV6 A;  4HNU A;  4HOB A;  3PM1 A;  1MH3 A;  2HWV A;  5JHF A;  5JI6 A;  4A3B J;  3K0L A;  4XSZ F;  1FMW A;  4A3K J;  1B72 B;  1J59 A;  2OPT A;  4PK4 A;  1FT9 A;  1LDD A;  2X1D A;  2Y9Z A;  4XN0 A;  5DD4 A;  1UCR A;  1FYL A;  5F04 A;  2CFX A;  1SVO A;  3HEF A;  2BW3 B;  3HOY J;  1HKS A;  4QWQ A;  3WGG A;  5K7Z A;  1W5S A;  5C44 J;  4FHT A;  2XSJ C;  4A5M A;  3FIW A;  5FLX Z;  4L5E A;  3J81 Z;  3VYR B;  4LFU A;  3O6B B;  5GP9 A;  1VQ5 I;  4OOI A;  2L02 A;  3BTL A;  4Q47 A;  3C2B A;  1WQ2 A;  3WOD F;  1VQ7 I;  3FHZ A;  3E6C C;  1EH7 A;  1HC8 A;  2L2O A;  1WFX A;  2DA6 A;  4HX7 A;  4EJU A;  2MD5 A;  3GTG J;  1SMT A;  2F5F A;  5F08 A;  1ZH5 A;  5DD8 A;  1Z91 A;  4E7Z A;  4CH7 A;  4KIB A;  3PO3 J;  1PP8 F;  3SDB A;  4IX7 A;  2LOO A;  2R7Q A;  1T38 A;  5F0H A;  4I98 B;  4ESF A;  4DIQ A;  1FOW A;  5TRD A;  2HKX A;  1Z6R A;  3NAR A;  4RMN A;  2R7X A;  2HOT A;  1MIJ A;  4OMZ A;  5F0C A;  2GAU A;  5FKO A;  2W48 A;  4RGU A;  4UVC A;  5LGU A;  2V79 A;  4BEH A;  4A93 J;  1IV8 A;  2W84 A;  2CH0 A;  5JFR A;  1PP7 U;  1FWZ A;  3F8F A;  1TT5 B;  2WAE A;  2O9L A;  1X1D A;  4BNC A;  2VOD A;  2Y9Y A;  4G12 A;  1T39 A;  2WAF A;  2RQP A;  3JRE A;  1X4O A;  1Y56 A;  3F3X A;  4EJT A;  3W2A A;  2ZFU A;  2VXZ A;  3PNY A;  1YW8 A;  2BY1 A;  2XAH A;  2MSY A;  3BJO A;  4QPO A;  2OTL I;  4MTE A;  3TDZ C;  1PDN C;  2BY2 A;  2DYR H;  2V1X A;  1V5G A;  3QOP A;  2NVX J;  2LFB A;  1SMY F;  5EGO B;  4RB1 A;  3OYB A;  2CV2 A;  3D5L A;  4A0Z A;  4U0W A;  3H5A A;  1DUX C;  4HF0 A;  2DMU A;  1TWC J;  3A0B C;  3O2P E;  4D7N A;  1UMQ A;  1WZ2 A;  3BP8 A;  1H89 C;  1R5G A;  4A3L J;  2HOS A;  3QPL A;  1ON2 A;  2BHZ A;  3TP3 A;  2IGO A;  2DA4 A;  3PSI A;  1H88 C;  1LNW A;  2E1M C;  1W0T A;  1IF1 A;  2E71 A;  3LFK A;  3GTJ J;  5GAG J;  1QZE A;  3AFH A;  3HC7 A;  4RM2 A;  3QOD A;  2DDB A;  4DYQ A;  1W7P A;  3RTR A;  2PJP A;  5BMZ A;  1VQ9 I;  2DFI A;  3FBN B;  5L3E A;  2VKH A;  2OZ6 A;  2R7W A;  1O7L A;  1OCT C;  1MW7 A;  2K7L A;  5E1W A;  2E2J J;  1UAA A;  9ANT A;  3RKY A;  3L00 A;  4S05 A;  3IL2 A;  2LBF A;  2R5Y A;  1BJA A;  2DT7 B;  2RQQ A;  3F8N A;  3EUH A;  3ZQQ A;  2JA2 A;  3QP6 A;  1MBF A;  2GXA A;  1UG2 A;  3RCO A;  5IOZ A;  2K4B A;  1SD7 A;  1ENH A;  2EFW A;  4XL9 A;  2QQ9 A;  1UHM A;  2MFZ A;  3REO A;  3CCE I;  2OC6 A;  1G3T A;  3DLL F;  4RGX A;  2P6S A;  3FM5 A;  1YFH A;  5D5U B;  4L0Z B;  2ZBK A;  4OIQ F;  3DV8 A;  1W36 C;  3I56 I;  4KDP A;  3QQA A;  5DV5 A;  5HNH A;  3OS1 A;  2RN7 A;  2P7C B;  4C2T A;  3KLN A;  3DEU A;  3WGI A;  1W5C C;  5CYV A;  1QRY A;  3TQN A;  4FIS A;  3AKZ A;  3WU0 A;  4ON0 A;  5CVI A;  1DU0 A;  2P5V A;  1O3R A;  3WHC A;  4S0H B;  4GDF A;  3I4P A;  4X0G A;  4WF2 A;  3DU5 A;  1Z77 A;  4BBR J;  2R92 J;  2Z5U A;  4GYI A;  5B3S H;  4HZF A;  2LLK A;  4CCM A;  3ELK A;  3B6A A;  4UNO A;  3HOW J;  1FIA A;  1K78 B;  3ABU A;  1O7F A;  2XRL A;  5JVT A;  4XID A;  4BUP A;  3G1M A;  4AID A;  1C0W A;  4Y3O A;  2EV0 A;  4IRH A;  3RDI A;  2EZL A;  1WSU A;  2L0K A;  5IP9 J;  1E2X A;  1KYW A;  3GXO A;  1HW5 A;  3K7A J;  3I58 A;  3R61 A;  4NDL A;  1OR7 A;  3GF2 A;  4KT5 C;  4EGY A;  3TBI A;  2EIK H;  2IS4 A;  5EYR A;  2X6O A;  1POG A;  2DQL A;  3DPU A;  1X2M A;  4YIR X;  3SZP A;  4I0B A;  3ZCO A;  4NNJ A;  3WTS C;  3E97 A;  1Y8Q B;  4ZZL A;  2H94 A;  2XV4 S;  4XRF A;  2DYS H;  1ZKG A;  2K40 A;  2IGK A;  1SFO J;  2QEX I;  1LDK B;  3Q3S A;  3NWS A;  1SD6 A;  1ZR2 A;  4B3X A;  1F9N A;  2WB1 N;  4XLH A;  4XR6 A;  2ZC2 A;  4YFN F;  3ESW B;  3IRR A;  1MND A;  2F4I A;  2UWM A;  2L54 A;  2L9V A;  2OZU A;  1SFX A;  4A3C J;  5HS8 A;  2E2H J;  3HTS B;  4NQW A;  3JTG A;  3S2D J;  2RDP A;  4P1W A;  2FD5 A;  5DCF A;  4UVA A;  1WHU A;  3TW6 A;  1D3Y A;  1KU9 A;  2XGD A;  2PLY A;  3GEZ A;  2XIG A;  1JUP A;  3KX2 A;  1WKM A;  1SAU A;  1MSE C;  2VJ4 A;  2QKM B;  1OFC X;  3JTH A;  1VI0 A;  4KIF A;  3OYL A;  1T8I A;  1ZLK A;  2P8T A;  1Y6I A;  3DFG A;  3OIP A;  3SJM A;  1O57 A;  2M7B A;  3BY6 A;  4PJM A;  2L7M P;  4L9N A;  4X6A J;  2ICW G;  4L5I A;  3ABL H;  2DI3 A;  2JT1 A;  4Q5S F;  4IXA A;  1LDJ A;  3OV8 A;  4Y4R A;  3CP8 A;  4EM1 A;  3OYE A;  3SDG A;  2FQ3 A;  1L0O C;  1OKR A;  2NAZ A;  3GBG A;  3MCZ A;  3U1K A;  1SAX A;  4YII A;  1Y1V J;  1P2F A;  3ONQ A;  3R6S A;  5K5O A;  3ZMS A;  2PMU A;  3G2B A;  1SD5 A;  4LB6 B;  3SFI A;  2XHK A;  2M4K A;  2CW0 F;  3IHU A;  4LMY A;  3CDL A;  2X1E A;  2I10 A;  2I8D A;  2IA0 A;  1TWA J;  2JZY A;  1ZG3 A;  2HKO A;  1X1B A;  3LSM A;  3LQQ A;  4GO1 A;  3L1P A;  3HUG B;  5JVG F;  1XCV A;  1I3A A;  2HZD A;  2ZME A;  4UV8 A;  4W1U A;  1V3F A;  2GXG A;  3ISP A;  3TDU C;  5D6F A;  4BS9 A;  1MMA A;  2BXZ A;  2M8G X;  1TWG J;  2DK8 A;  1AWC A;  5ICE A;  5LBQ A;  4ZC3 A;  3L2C A;  2Y75 A;  3Q9V A;  3AG3 H;  2ID6 A;  1X1P A;  3TL4 X;  1O3T A;  1YQA A;  2XKO A;  2CSO A;  2IA2 A;  4FE4 A;  4PGH A;  4PDK A;  2DTZ A;  2NNN A;  2DT5 A;  4QTR A;  3HPH A;  4ZDP A;  1EH8 A;  3DTE A;  4CHU A;  3CUO A;  2BGC A;  3B73 A;  4A2U A;  4ZDL A;  2EIL H;  4E6K G;  2XAF A;  2O8K A;  4XBF A;  1BIB A;  2FEZ A;  3E5Q A;  3JSP A;  2LDU A;  2BZT A;  3TW7 A;  4TV7 A;  1F36 A;  3G1L A;  1IGN A;  3K2Z A;  4DNC A;  3CC7 I;  4OIP F;  2DK5 A;  5E1Z B;  3GTK J;  1MSF C;  1HKT A;  4A3D J;  2Z1D A;  3GZ5 A;  1HDP A;  4I01 A;  2M0C A;  1MMN A;  1ZRC A;  2BVL A;  2HXI A;  1Z67 A;  4CZZ A;  3H35 A;  3UNG C;  3BR2 A;  2KPM A;  4UB8 C;  4IKF A;  3G71 I;  1FOX A;  1FX7 A;  3CLO A;  4FQG A;  3H3Z A;  1KON A;  4BHP A;  2FU4 A;  1J75 A;  2QF7 A;  2WA0 A;  4GGG A;  5HLG A;  4I7H A;  4RGS A;  3H0G J;  1U78 A;  4JP0 A;  1IN8 A;  4Y7N J;  4CCK A;  5FKM A;  3WTX C;  2YR2 A;  1YS6 A;  2WV0 A;  5GAH J;  4BDY A;  4UUS A;  5EG0 A;  3DEE A;  3ABT A;  1GV2 A;  3A03 A;  5D8L B;  5A2Q Z;  4HW0 A;  5ILV A;  3GYH X;  4D0P A;  4ZYH A;  1VQL I;  2VIX A;  3JRI A;  2E7W A;  4XNF A;  4CDG A;  2CUE A;  5HDN A;  1Q1V A;  1XGO A;  3BR6 A;  2XAJ A;  3CCJ I;  2W24 A;  1MKM A;  5KNL A;  3IH2 A;  4MEX F;  4MO7 A;  1VTN C;  1AHD P;  1DP3 A;  2W7N A;  2FA5 A;  5FKK A;  3QRF F;  2R5Z A;  2IAI A;  3K6G A;  2E1O A;  2GIV A;  2IVM A;  2EV6 A;  1QVT A;  1FJL A;  3CCL I;  1B8I A;  1VQ4 I;  3ZQF A;  3H5N A;  1FY7 A;  2V9V A;  1X19 A;  1HCR A;  5HS9 A;  5FLM J;  4B48 A;  1WJE A;  5BPI A;  4HLY A;  1B9N A;  4HX8 A;  5J1U A;  4JQF A;  3VEP A;  2L01 A;  2VJ5 A;  2E1C A;  1YX5 A;  4BQA A;  3DKW A;  4BH9 A;  1FTT A;  4U7D A;  1YS7 A;  5KAF C;  2HQ5 A;  1RPW A;  4IVN A;  2X48 A;  2R7D A;  2R7F A;  2CV0 A;  3RPQ A;  1D1B A;  1IDY A;  4B8X A;  2WY8 Q;  5KHD A;  2VLA A;  3HZJ A;  4M72 A;  3BG6 A;  2WWY A;  2Z3Y A;  2VB6 A;  3M07 A;  1XC5 A;  2EB7 A;  1O4X A;  2FBI A;  2QCO A;  2XVC A;  4FE7 A;  2UXN A;  4BE1 A;  4UY8 I;  5JLX A;  4CO8 A;  5H20 A;  3I9V 2;  1ZHF A;  3VPR A;  1NHA A;  2BE5 F;  3K1N A;  1JUM A;  1MZB A;  3GTO J;  4PJL A;  1RI7 A;  3LSI A;  4IPA A;  2XAS A;  3S16 J;  1ULY A;  3M8F A;  2OBP A;  1MGT A;  2Q2E A;  1XD7 A;  5H2F C;  1BR4 A;  3O8G A;  4KIT B;  2P7V B;  2O7O A;  1R1U A;  1FBS A;  1FPQ A;  3BC8 A;  3I4N J;  2DBB A;  1QBJ A;  3RKQ A;  1JGG A;  5C4X J;  4KJZ A;  2E1M B;  2PX9 A;  2ETH A;  5CQE A;  3GWZ A;  1D1A A;  2ZXJ A;  2L9N A;  1JT6 A;  3FDY A;  4ESJ A;  4IHS A;  4UB6 C;  2P5K A;  2K3P A;  3IH3 A;  1Z7L A;  5FJ8 J;  1V54 H;  2XRN A;  1W1W E;  3WTY C;  4I6Z A;  2VPL A;  3TOB A;  5M5X J;  2B9S A;  4P5O A;  4C30 A;  3CQZ J;  4A0X A;  3IWZ A;  3CJQ B;  2K4J A;  1YJN I;  2LP0 A;  3ZMZ A;  3WG7 H;  3G6E I;  5B1B H;  4CGZ A;  2DOA A;  1Q1H A;  5D4R A;  2KQR A;  4Q4Z F;  1LKX A;  3EYI A;  2QEN A;  1JHH A;  3HSE A;  2PJR B;  1OPC A;  1UHW A;  1TW2 A;  4MIM A;  2W85 A;  1R71 A;  1G6N A;  1ZAR A;  2CFO A;  2X1C A;  4UV9 A;  4FAS D;  2CS3 A;  3SQN A;  2LRD A;  5L3G A;  2VBX A;  1J5Y A;  3BCA A;  1PYV A;  2KIU A;  2FXA A;  2DA1 A;  4RLF A;  1XGM A;  3P7N A;  1IG7 A;  1D8K A;  2GXB A;  1YTY A;  1YRN A;  1Z05 A;  1SEU A;  3COA C;  4LLN A;  3CME I;  1E3O C;  2HFH A;  2HQA A;  2ZXI A;  1I6X A;  3DF8 A;  3OYG A;  3EPZ A;  4LJZ F;  3ECO A;  1Z3X A;  5JLW A;  4DYR A;  2AO9 A;  3WTT C;  2OD5 A;  3F23 A;  1B72 A;  1I1S A;  1VQ8 I;  3HSR A;  4B1R A;  1I27 A;  3M8E A;  5DCM B;  1IUF A;  5GTH C;  2EA2 A;  2MC4 A;  3TO6 A;  5E18 F;  1R9T J;  3E5X A;  3CUQ C;  1WCM J;  3HRU A;  2E7X A;  5FD5 A;  5M3F J;  5CVJ A;  3DLA A;  2ZSI B;  1XSD A;  2VT2 A;  2YPR A;  4G9Y A;  3M1E A;  3FMR A;  5DUK A;  5E3L A;  2BY0 A;  4C3I J;  4AM3 A;  4JX6 A;  1I5Z A;  3CMM A;  1D0X A;  2EZK A;  4MNU A;  2QGU A;  3JRF A;  3HL2 A;  4XLC A;  3OS2 A;  1STZ A;  3CCY A;  3SEQ A;  3E6D A;  1QPM A;  1YJW I;  2A5W A;  1NK3 P;  4HBL A;  5J40 A;  3ZQG A;  4I99 C;  3T8R A;  3HKZ N;  3FXJ A;  2JRT A;  1Y0U A;  4JK1 X;  3BDD A;  2Q8K A;  2K27 A;  3HIF A;  4BL0 B;  1XX5 A;  4RB3 C;  1MD0 A;  1QPI A;  2GQQ A;  2ISY A;  4RS8 A;  4LIU A;  1U8B A;  3L2W A;  1TWH J;  5CVU A;  3LAJ A;  2BHY A;  2KIQ A;  3OSG A;  1RR7 A;  2CQ7 A;  1WH5 A;  1AKH A;  5L3B A;  3W6V A;  3GTQ J;  3EQL F;  2QUF A;  4XON A;  2JVH A;  5B1A H;  2M30 A;  5H6Q A;  2IJL A;  2DW4 A;  3K4K A;  5M5W J;  2HDD A;  4O3M A;  2DMN A;  5LRR A;  3DCF A;  4P9F A;  2R7O A;  4LGW A;  3KCC A;  3VYS B;  3PJR A;  2F4O B;  2J5P A;  4AVZ A;  5AON A;  2VUM J;  1HLV A;  2IS2 A;  1ZEL A;  3C18 A;  3ML6 A;  5HLI A;  5K5R A;  4KIC A;  1H8A C;  5HOD A;  1WGX A;  4AD9 A;  3ZMT A;  2R3S A;  2ZJ2 A;  2Y2Z A;  4KIG A;  2DPU A;  1QHG A;  3G73 A;  1S8N A;  1IV6 A;  3J7A Y;  1OIS A;  4WXH A;  4PUS A;  2XF5 A;  4A6E A;  3E6B A;  5BPD A;  3G3Z A;  3KET A;  4BY7 J;  1EH6 A;  2VQL A;  5EEA A;  3BZ6 A;  3U21 A;  3RZD J;  3ZQH A;  1K79 A;  1S5L C;  5DM7 F;  4U0Y A;  4MLO A;  1TWF J;  4BQN A;  3A01 B;  3I59 B;  5FD6 A;  3QP5 A;  2AS5 F;  4XRS A;  4HST A;  3C2G A;  2EPF A;  3SYT A;  3ABM H;  5LRS A;  1HW2 A;  4D5C A;  2CU7 A;  2VKD A;  3PNV A;  4NC8 A;  3T0Y A;  5LHI A;  1MBK A;  2MW8 A;  4HPQ A;  1BM9 A;  2EFO A;  2OF7 A;  2XDV A;  3GVA A;  5EF6 A;  4L5J A;  4M9X A;  2K9L A;  3LSR A;  3I4M J;  4JBA A;  4D5F A;  4AU7 A;  2ZJQ F;  2VJI A;  3KEQ A;  3OYD A;  1YIT I;  1XDU A;  1YIJ I;  3BG9 A;  1GVJ A;  5IP7 J;  3C7J A;  1OCZ H;  2FX0 A;  2M2E A;  3HHG A;  3ZGK A;  4G7H F;  1V55 H;  4BU2 A;  5DUI A;  2NVY J;  4C3H J;  1T98 A;  1T0F A;  2LRE A;  2ZNZ A;  2CO5 A;  3BJ6 A;  5J3L A;  3DTK A;  1LPQ A;  5IYC J;  5J47 A;  4A69 C;  4A0Y A;  1RKT A;  2MAB A;  1TL8 A;  4B43 A;  4A3M J;  2P0W A;  1H0M A;  2YX7 A;  1QZZ A;  3BR3 A;  2H1L A;  3MFK A;  5HDG A;  1MMG A;  1T95 A;  5ICF A;  5J4V A;  4EMS A;  2ELJ A;  2M5W A;  1I6H J;  2HDC A;  1W36 D;  1J09 A;  5CJ9 A;  1WJD A;  3WU2 C;  2O8X A;  2JUG A;  5IY5 H;  2WAQ N;  3WTU C;  4XMY A;  3HYI A;  3PQK A;  1LE8 A;  2STT A;  2EV5 A;  2HYJ A;  2OQG A;  1LQ1 A;  3V7R A;  3I53 A;  4F93 B;  1DGR M;  2V26 A;  1VZ0 A;  1OJL A;  4AVP A;  3S1R J;  1KA8 A;  2DJI A;  4BKX A;  4EM0 B;  4IOC F;  3T8T A;  3ZOB A;  2DQR A;  2ZXH A;  5D5V B;  4BE0 A;  2GOM A;  2KZG A;  3KP2 A;  3SEZ A;  1A5J A;  4BAC A;  1FEX A;  1QQI A;  3K69 A;  4PCQ A;  4FX0 A;  3K70 C;  3PQJ A;  4M6X A;  2PG4 A;  3WHB A;  3B02 A;  2O5R A;  4M3F A;  4CUG A;  2EFN A;  2LVS A;  4F91 B;  4I02 A;  4EJO A;  3V8K A;  3VWB A;  2B0L A;  2KRC A;  2F5V A;  3F8B A;  3V7C A;  5DDG A;  4N9H A;  4M3G A;  3BZC A;  4LOC A;  2ELH A;  4WK8 F;  1FC3 A;  2VQG A;  3TKY A;  4EJV A;  4M74 A;  4A12 A;  4CCN A;  1WI3 A;  4F52 A;  3KEY A;  3KYL A;  2NOJ B;  3TP0 A;  2Z33 A;  1NK2 P;  2L4M A;  2Y0S A;  2X6X A;  2G7U A;  1WJF A;  2PMH A;  3CF2 A;  2LF7 A;  2X6W A;  2R7S A;  1BC8 C;  2NS8 A;  1R4N B;  4ZTJ A;  3JRD A;  4HV5 A;  5LHG A;  5HLH A;  3DBR B;  2NNY A;  2CQQ A;  4BJ6 C;  1FLI A;  5K5Q A;  1ITY A;  4FX4 A;  3V8L A;  1VQK I;  5BQT A;  3SZG A;  4DYC A;  2Y48 A;  5F1R A;  5J6X A;  4M73 A;  2A6E F;  3FZV A;  2VBZ A;  4UUT A;  3I0T A;  4BJT A;  4KNY A;  3T5X A;  4NB5 A;  1MJA A;  1XMK A;  3VSK A;  1ZGW A;  1ODD A;  1G59 A;  4J00 A;  1MBJ A;  3LQR A;  2D1H A;  3P5J A;  2BXY A;  1MMD A;  5J8F A;  4PJ0 C;  4E7K A;  2LD5 A;  1IXC A;  3ZRG A;  1V4R A;  3KE2 A;  3KIO A;  3OSF A;  2Z2S B;  4KFC A;  2V1D A;  1T33 A;  2KLO A;  4EVI A;  1U5T A;  3IV5 A;  1FYK A;  2VBY A;  4CXF A;  3J80 K;  4M9Z A;  2L4A A;  5AIQ A;  4IQ4 A;  4L9J A;  4N0B A;  3MZH A;  2ID3 A;  2ME6 A;  4EQQ A;  1ON1 A;  3HXL A;  2K9M A;  2XAU A;  3FXK A;  4MHG A;  1IO2 A;  2EJR A;  3LAP A;  5E3M A;  2KZV A;  1RUN A;  4QSH A;  1QHH D;  2MC3 A;  3KEO A;  1VQN I;  1YI2 I;  3E0J B;  2VL8 A;  3W2V A;  4BEH B;  2FNA A;  5H6R A;  4B47 A;  1IUY A;  2IBD A;  1DP7 P;  3LST A;  2JVG A;  3BCB A;  1ZYR F;  4RAY A;  1YG2 A;  2XPU A;  4R8H A;  2L5Q A;  3FK7 A;  3BWG A;  4MFD A;  2JA5 J;  3JR9 A;  5HDK A;  1UST A;  2NXN B;  4AUX A;  2EBI A;  3VFZ A;  3HOZ J;  1LFU P;  1ZQ3 P;  2BV6 A;  4MQV A;  2FSW A;  2JPB A;  1GXP A;  4G8X A;  1AA7 A;  2L7F P;  3I54 A;  2FBH A;  1GDT A;  4BGD A;  3H92 A;  2CWE A;  2CYY A;  1RUO A;  2BY3 A;  3A2K A;  1BI1 A;  2ZFW A;  3F8M A;  1S7A A;  3H36 A;  5D6E A;  3QOE A;  4DZJ A;  3LA2 A;  4KA4 A;  2QWW A;  1LEA A;  4S04 A;  2KJB A;  3HGG A;  3S17 J;  2O61 A;  2CGP A;  3AG4 H;  2Z99 A;  2K85 A;  3OIQ A;  2GOX B;  1EJ9 A;  3CMY A;  2WBM A;  3V42 A;  1JGS A;  3HRT A;  3BJA A;  2D1V A;  1LUJ B;  3MMY B;  4F92 B;  6PAX A;  1U0J A;  2C6Y A;  1TQI A;  4H0E A;  3S1N J;  1A31 A;  1E0E A;  5ERI A;  3F21 A;  3JW4 A;  3CUQ B;  2HQR A;  4L9T A;  5GPC A;  5GAD J;  5F1J A;  1LEB A;  2R5Y B;  2NYX A;  1XMX A;  2HU9 A;  4BBS J;  2IGN A;  1GLN A;  2EQR A;  5J1Y A;  1XSV A;  4IHW A;  3M7G A;  2HVS A;  3GLX A;  1G3S A;  3TMO A;  4G7O F;  3OYM A;  3MKL A;  3DXJ F;  2HXO A;  1PVE A;  3QU3 A;  5J4Y A;  3F72 A;  5K7H A;  1LB2 A;  5KCM A;  3HHH A;  1DQU A;  3K10 A;  2TDX A;  4ZTF A;  2V7F A;  5HS7 A;  3F8C A;  4I2O A;  3L9F A;  1SD4 A;  3BOQ A;  3VDX A;  4IZZ A;  1LVK A;  3HGY A;  3M8J A;  3ROU A;  1HDD C;  2JQ7 A;  2HYG D;  4OWR B;  3N05 A;  4XSX F;  1JKP C;  3LOC A;  3H3U A;  2MD0 A;  3RQI A;  5EDN A;  1JTY A;  2M45 A;  1IW7 F;  1IZ1 A;  5AIP A;  4EAT A;  1R58 A;  2KRF A;  2EFP A;  1RR8 C;  2GBY A;  2GA1 A;  4DBR A;  2MH9 A;  2ZB9 A;  3SZT A;  5ICC A;  4YG2 F;  1IN7 A;  4G6Q A;  2L9R A;  3I3L A;  3U9G A;  4HRI A;  1FBU A;  3RSN A;  2CUJ A;  2O6G E;  3KP5 A;  3H9G A;  4XM3 A;  4I09 A;  3GO5 A;  1TNT A;  4A3J J;  1IJW C;  4KMU X;  3TGN A;  2XAG A;  3S15 J;  2O03 A;  3FXO A;  2ZXW H;  1REP C;  1UG0 A;  5E79 C;  1NG6 A;  1N77 A;  1R7J A;  2F5D A;  3OIO A;  4CYD A;  5D8K B;  2NRA C;  3F22 A;  4D9J A;  4LIT A;  3J7A O;  1JT0 A;  1KZH A;  4P55 A;  2UUZ A;  4LLG F;  5E3N A;  3HRS A;  2Y69 H;  5C4J J;  1G3Y A;  2M34 A;  3IKV A;  2IPQ X;  2IEK A;  2LNB A;  2YUS A;  3CD6 I;  1P6R A;  2V1U A;  1FP2 A;  1VQM I;  3OYC A;  2WAD A;  1T08 B;  3MVP A;  3VYU B;  3ULQ B;  1P4X A;  3KYD B;  4IHT A;  2H6C A;  2H1K A;  3M3Y J;  3QYF A;  2E1N A;  4G6T B;  3PSF A;  4L0Y B;  2M7A A;  1MBH A;  3HSF A;  4FTH A;  2OAZ A;  4PJJ A;  1APL C;  4MFE A;  1K83 J;  4HYE A;  2TRT A;  4XKW A;  3G4S I;  2LSO A;  3K4J A;  2CQN A;  3ZN1 A;  4OMY A;  2LMD A;  3RIR A;  1SVM A;  4RA2 A;  1HF0 A;  1R49 A;  2PQ8 A;  2OQR A;  3S1M J;  3PNT A;  2QSG X;  1R4M B;  3FXM A;  3CCQ I;  3CJN A;  3VOE A;  2GWR A;  3ZN0 A;  1XS9 A;  5D5X B;  5CKT A;  3OR2 C;  4CCL A;  1TQM A;  3S14 J;  1B4A A;  4B4C A;  2NVU B;  2M8E A;  2LC2 A;  5J8C A;  4XQF A;  5ILU A;  1K61 A;  2R7V A;  1E3H A;  2RRE A;  2H8W A;  4MTD A;  2VC0 A;  1ERD A;  2VAS A;  2QBY A;  1S29 A;  1XN7 A;  3L2V A;  3K4L A;  1UFM A;  3ZQI A;  2E5N A;  1BR1 A;  3OYK A;  1NG7 A;  2RNJ A;  1HOM A;  3MKZ A;  3FX3 A;  1U8R A;  3M1C A;  2W1O A;  3PL8 A;  2XPV A;  2LYC A;  3Q0U A;  1T2K A;  2CJJ A;  1F5T A;  1IN5 A;  1I1G A;  4NC7 A;  2ZME B;  3FKI J;  2Z9O A;  2GZW A;  1B1B A;  2Z16 A;  5B5E C;  4IOA F;  3DKX A;  1Y1W J;  1R5H A;  1J9I A;  2JMW A;  2KL4 A;  2P81 A;  3O3K A;  1HA8 A;  3BG3 A;  1CF7 B;  3RKW A;  3OS0 A;  3R4K A;  1T56 A;  3BG7 A;  2EA4 A;  1XPX A;  1W0U A;  1R00 A;  2DOD A;  3PFY A;  1FMV A;  3OOU A;  2MLG A;  4F3Q A;  4KT6 A;  4I0A A;  2KP6 A;  4NUB A;  3OYI A;  2JA8 J;  4DGW B;  3GTL J;  3KP3 A;  2A3S A;  2V6C A;  3BTI A;  4HSR A;  1G4D A;  3RYP A;  3MZY A;  4OAY A;  1USS A;  4ASN A;  2HS5 A;  1XTA A;  1ZRD A;  3PFI A;  1YW9 A;  5CLS A;  2B63 J;  4II2 A;  2NS0 A;  3DWL E;  3KZI C;  1ZRF A;  3RZO J;  3W6K B;  5LLQ A;  2V9K A;  4LK1 F;  4IO9 F;  1TBX A;  3FBI B;  1U2W A;  1BOB A;  1WRJ A;  2AQF A;  2HVR A;  4KN7 X;  2E34 A;  3DBH B;  3GZ6 A;  3QPT A;  1Z0X A;  4P96 A;  2DO7 A;  5LGN A;  3IP4 B;  4BY1 J;  4RGR A;  3BTJ A;  2QYO A;  4ABZ A;  1VFC A;  3EUK L;  4PSX A;  5FLX K;  1X1C A;  3HRM A;  2FF4 A;  1KU7 A;  4EM2 A;  1LFB A;  3EET A;  3IKT A;  4Y33 A;  2XGE A;  1L3L A;  2YS9 A;  2P6T A;  4HLX A;  1ZRE A;  4LG3 A;  5JHU A;  2F6C A;  4D1Q A;  4IHX A;  1KQ8 A;  4RBO A;  4A3F J;  2JJ7 A;  1B6A A;  1R6R A;  3ZMU A;  1VND A;  1WI9 A;  3RQ4 A;  3CCM I;  2DMP A;  3H5R A;  1DU6 A;  1ETO A;  2RAE A;  5DTD A;  1JKR C;  2DDA A;  4IJA A;  3BTC A;  2KDZ A;  2LY1 A;  4XLP F;  4CYC B;  1H9G A;  4RB2 C;  5GTI C;  3CMA I;  1YLF A;  3ZPL A;  3LFU A;  3J7Z I;  2K02 A;  1YJ9 I;  3BG5 A;  3KLO A;  3FIS A;  3EYY A;  1TZL A;  4M6V A;  4LG0 B;  1BR2 A;  1D8J A;  1WJB A;  2NVQ J;  1A04 A;  1D0Y A;  2RV8 A;  3R60 A;  5ED4 A;  5K1Y A;  4NBQ A;  3L7W A;  2N8G A;  1RKW A;  1B8I B;  1X3W B;  3UR3 C;  2STW A;  2WC2 A;  2BW3 A;  2EK5 A;  1YOV B;  2A61 A;  3GX4 X;  1IXS B;  1WVR A;  2X0L A;  3EUH C;  2HQN A;  4E70 A;  3PIP F;  1JKO C;  2ISZ A;  2QQB A;  3GFL A;  1I3Q J;  2UV1 A;  3CJR B;  2LY2 A;  2DFE A;  2M0M A;  2NS7 A;  4FT8 A;  3CF5 F;  1RES A;  2X4H A;  3OYJ A;  3LNQ A;  1V5F A;  3CCR I;  3Q0W A;  2FML A;  2H8R A;  4F7Z A;  3KZZ A;  1TP4 A;  1D5Y A;  2ESH A;  3LSJ A;  1KU2 A;  2DCE A;  2IT0 A;  2KKO A;  3BZK A;  4XLN F;  2KIF A;  2I5U A;  3FMQ A;  2TCT A;  3Q5F A;  3HG9 A;  1E3P A;  3P9C A;  2R7R A;  2LH9 A;  3IUO A;  1ONV A;  3I55 I;  3TO9 A;  1OCO H;  3OY9 A;  1M1E B;  4MEY F;  1E17 A;  3LMM A;  2CG4 A;  2JSP A;  4LIV A;  5E8G A;  1D0Z A;  2Q2E B;  2FNP A;  4XN3 A;  1N78 A;  4DQ2 A;  1VQO I;  3S8P A;  3ERM A;  3F6V A;  2DMT A;  3ZR8 X;  2LF8 A;  3BQY A;  4UHT A;  2EH3 A;  2R4G A;  2O0Y A;  4IL6 C;  3MQ0 A;  5LFA A;  2OA4 A;  4PGG A;  1IRX A;  2LKP A;  4R79 A;  4A3E J;  4B09 A;  2DFH A;  4K2E A;  2PMZ A;  3VYT B;  2KRH A;  4D7M A;  1D5V A;  5EGO A;  1WJC A;  1OR7 C;  1MDM B;  4WXC A;  4ENJ A;  4BHB A;  3LWF A;  5EEH A;  1D1C A;  2DJN A;  4ZYA A;  1OYW A;  4E7S A;  3M9A A;  2LR8 A;  2XRO A;  5J1R A;  5EZH A;  5DEQ A;  3F6O A;  3MN2 A;  5LEJ A;  1OCP A;  3E5U A;  3GFI A;  2YX4 A;  3HOT A;  1K6Y A;  3MAJ A;  3QYB A;  3B6C A;  4BE2 A;  2VQC A;  1KQ9 A;  2WB1 A;  4A6D A;  2A6H F;  2LTP A;  3CO6 C;  5M5Y J;  2QA4 I;  4GCV A;  1YX3 A;  3MKW B;  4J19 A;  4ETS A;  2A6T A;  1QNT A;  1YRN B;  3K70 D;  1PUF B;  2Y31 A;  4BXX J;  3NQO A;  3AG2 H;  3CTA A;  3GLL A;  3S3O A;  5DS9 A;  2W25 A;  1P7J A;  3D5R C;  4GRI A;  2G0E A;  4BDZ A;  5KK1 A;  4HQM A;  4XLF A;  4A3I J;  2HEO A;  4BXF A;  3W2W A;  3C2H A;  1BIA A;  2F48 A;  1RNL A;  3L2U A;  1IN4 A;  3NEU A;  2X51 A;  3DP7 A;  4CCJ A;  2VOP A;  5BOX A;  2MA3 A;  2M4G A;  5HNF A;  2PBI A;  4P9U A;  3E1S A;  2CV1 A;  3KP7 A;  2KHM A;  2E5Z A;  4UUV A;  3WE2 A;  2DXI A;  3OL3 A;  4KMF A;  1Z3Y A;  4YFX F;  3CDH A;  1I39 A;  5M3M J;  5D4S A;  3OOP A;  2QKL B;  4ITV A;  4N4O B;  1YW7 A;  4E7L A;  5HVQ C;  4G7Z F;  2IRF G;  2FOK A;  4HNV A;  3CC4 I;  2YU3 A;  3OR1 C;  1OQY A;  3FF5 A;  2GLO A;  4NC6 A;  1H9T A;  3KP6 A;  2HNH A;  3IH4 A;  3JRG A;  1FOK A;  2HTJ A;  2EIJ H;  2ZME C;  4XKB A;  2E19 A;  3JAM K;  2RGV A;  2COB A;  5EJC A;  2KT0 A;  2WV1 A;  3ZXS A;  2VJJ A;  1P4W A;  2K9Q A;  1UZC A;  3E3V A;  1WJ5 A;  1QO0 D;  1K78 A;  2Q0O A;  1OYY A;  3DU6 A;  4ZZD A;  4RAZ A;  2AHQ A;  2EWN A;  2X85 A;  2ZO4 A;  2XB5 A;  3ZMD A;  3NAU A;  1XSX A;  2VT3 A;  1UB9 A;  3IWF A;  4ENM A;  1J0R A;  1AKH B;  4EEF G;  2JPC A;  1N25 A;  3S3N A;  2ZNY A;  4CA0 A;  4UVB A;  4BJ5 C;  1SFU A;  5K7F A;  2JRM A;  1ZG5 A;  1FNN A;  3KYC B;  3SFZ A;  4ZDO A;  2H27 A;  4L18 B;  1R5I D;  4BHC A;  1QZY A;  1YHQ I;  2WTE A;  1IRG A;  1Y8R B;  3QYE A;  3OYF A;  3KP4 A;  3A4C A;  2KIM A;  2ME0 A;  4ZJZ A;  4OAZ A;  4V2G A;  4JOM A;  5KVR A;  4Y17 A;  1W4M A;  4WCG A;  1IRZ A;  1BL0 A;  1Z1D A;  3FM3 A;  3K4B A;  2V9P A;  4HX4 A;  1S7E A;  4CSW A;  3VOD A;  1F1Z A;  4KUM A;  2VOO A;  1A6I A;  4I76 A;  2BVM A;  4BYY A;  1JI8 A;  2W4S A;  4XOT A;  5IYB J;  2F2E A;  4YEJ A;  2HI3 A;  3DPT A;  3AL0 B;  3RPU D;  1QGP A;  3EDP A;  2UXX A;  2PI0 A;  5CPR B;  4IQJ A;  4ENK A;  4HF2 A;  2L9S A;  4N4N B;  1BA5 A;  3TOA A;  4PFO A;  1TW3 A;  1HQC A;  4Q48 A;  3CUQ A;  2R7T A;  2D45 A;  2MBF A;  1TNS A;  2E35 A;  2QLZ A;  2W00 A;  1MH4 A;  3OYN A;  4RM3 A;  3FHN A;  1QU3 A;  2ZSH B;  2HZT A;  2X9D A;  3F9K A;  2IA1 A;  2VXD A;  3JRH A;  2KJC A;  3P9K A;  1JJ6 C;  1IRF A;  4LK0 F;  3VB2 A;  1FP1 D;  3FMS A;  2DN0 A;  1SC7 A;  1K7A A;  3CCU I;  3OMY A;  1YE9 A;  1R23 A;  4M71 A;  3GFJ A;  4QPQ A;  1A6Q A;  1XMA A;  2MLK A;  3HUG A;  4ESB A;  2PEX A;  2QVO A;  1P9Q C;  3FK6 A;  2JA6 J;  1HW1 A;  4M9S A;  4L9V A;  3RKX A;  5LGT A;  1BC7 C;  2FJ1 A;  4E7H A;  3ASO H;  3K4C A;  1BI2 A;  1IN6 A;  3MWM A;  2K3F A;  2Y30 A;  4XRS G;  3I71 A;  3TO7 A;  4BAY A;  3OYA A;  2BOL A;  4Y52 J;  2K5C A;  3MEX A;  4M6Y A;  1T6S A;  2LKX A;  2VKE A;  4OU0 A;  2RVC A;  5GPA A;  4PSW A;  2L7K A;  1MBE A;  3BR0 A;  1FSE A;  2JTV A;  3ZQ7 A;  3E6M A;  1LE8 B;  4IEJ A;  1ETY A;  3HTU A;  4MGR A;  1LJ9 A;  3LSP A;  2PMZ N;  4JX5 A;  5A2Q K;  4DOZ A;  2F5E A;  1AU7 A;  2R7U A;  1KU3 A;  1XDS A;  3ASN H;  1AOY A;  4IHY A;  1OMI A;  1A36 A;  3BT9 A;  5TIS C;  2FQ4 A;  3WTV C;  2R7Z J;  3I64 A;  4Z6Y A;  1X1A A;  2DOE A;  1Z21 A;  1S7O A;  1RRJ A;  2HOE A;  3FXQ A;  2DA2 A;  3PUF A;  2DA7 A;  3WU1 B;  3ECH A;  3K9T A;  4HDV A;  3PIO F;  3CJT B;  2V4J C;  5F64 A;  4F55 A;  4EJW A;  1U6G A;  2ZCW A;  1G8X A;  5FFZ A;  1S6L A;  1UHS A;  2A68 F;  2BYV E;  2Y0M A;  3U2R A;  3OL4 A;  3X2Q H;  4E4H A;  1CQT A;  1FZP B;  3M4O J;  4V2F A;  3CZ6 A;  4MQ9 F;  3N97 A;  1K6O A;  4EV0 A;  2AXL A;  1R22 A;  1W7P B;  1Y39 A;  5FRM A;  3C3W A;  4JYK A;  3Q0V A;  2XB0 X;  4CCO A;  4YIF A;  3FWE A;  3HB9 A;  5HOO A;  2PFB A;  4C2U A;  5IT9 K;  2G7H A;  2DA5 A;  5IPA A;  3JAM Z;  2ZJP F;  2LBF B;  5LHH A;  1PJR A;  2VE8 A;  4M3B A;  3ERE D;  3TED A;  4PJN A;  1B59 A;  2A5Y B;  3UKG A;  3QAH A;  3Q9S A;  3BPV A;  3H9Q A;  2OUM A;  2FBK A;  5E8I A;  2M87 A;  4AYB A;  2XAQ A;  2D5V A;  2L7Z A;  2OV7 A;  4HAM A;  2VI6 A;  1ZGA A;  2VC1 A;  5E17 F;  1FSH A;  1O3Q A;  5L3D A;  5IP6 A;  1A35 A;  1ZTR A;  3CCV I;  2AQE A;  2OU2 A;  2KIS A;  1BN5 A;  4YEL A;  2EIN H;  2WY7 Q;  1KYZ A;  2D2W A;  2DMQ A;  1F4K A;  5FB2 A;  3LL7 A;  3OWT A;  3AG1 H;  1EF4 A;  2DA3 A;  2RKH A;  3H1C A;  1IC8 A;  4WX9 A;  4HEA 2;  4OIN F;  3NWT A;  1R36 A;  2QQ8 A;  3HBL A;  1DPR A;  4U87 A;  3OYH A;  1U5T B;  5LEK A;  5CVR A;  3V4G A;  4Y15 A;  2HPI A;  4AWX B;  1DDN A;  2HOA A;  4BXU A;  2VBW A;  1JHF A;  2ECB A;  4GXO A;  3W6J B;  2DPD A;  1J2X A;  3MZ8 A;  2JSC A;  1N75 A;  2LG4 A;  1W5T A;  1K4S A;  1ETQ A;  5TGT A;  1ZLJ A;  2RNG A;  1ETW A;  1BI0 A;  4NHJ A;  4RAF A;  3HOS A;  1CF7 A;  2CRG A;  4AIK A;  3DKY A;  3DPL C;  1KQ0 A;  3BPX A;  4N9I A;  1IAW A;  3K2A A;  3H3V K;  2EIM H;  3R0J A;  2FE3 A;  2ECC A;  2NOG A;  5F27 A;  3K1M A;  4LB5 A;  2JN6 A;  4RAG A;  4XK4 A;  4ZH4 F;  2LKS A;  1SAN A;  3C1D A;  3H9J A;  1RIO H;  4V19 K;  2DOF A;  2UZK A;  2Q1Z B;  2VN2 A;  5EZG A;  4ENN A;  1JE8 A;  3V8J A;  5GAE J;  2EZH A;  2OTJ I;  3GUD A;  2R93 J;  5C3E J;  3K1P A;  4IRI A;  2GM4 A;  3HKZ A;  3RJP A;  2F5C A;  3CC2 I;  3GFM A;  1RC9 A;  1HSJ A;  2CW8 A;  3S93 A;  2Y0S N;  2E36 A;  2V1N A;  3KZY A;  3NRV A;  3J80 Z;  4NQW B;  2DFF A;  3L2Q A;  1X3Z B;  1OCR H;  1P7I A;  4W97 A;  1F43 A;  2M9H A;  4II3 A;  5DM6 F;  4IF4 A;  2X6Y A;  5FKN A;  1G2H A;  5E1X A;  4DZP A;  2FRH A;  2FMY A;  1SFK A;  5F6F A;  1NTC A;  3GCM A;  2NVT J;  3GW2 A;  5KAI C;  1BOA A;  2PJR A;  1Y0N A;  1GXQ A;  2IS6 A;  1JTX A;  3HJE A;  2CQK A;  4CIC A;  3FXL A;  1LFP A;  1XG1 A;  2H6B A;  3KFW X;  1YYV A;  5FO5 A;  3RI4 A;  5EEG A;  1EA3 A;  2BEO A;  2FUG 2;  1CGP A;  1MNM C;  4QIW N;  4WWC A;  1X58 A;  1GVD A;  3T1B A;  2KFD A;  3E7L A;  4FET A;  1RET A;  4RB0 A;  2DU9 A;  4CYC A;  5ILS A;  3AL0 C;  3L2R A;  2HVQ A;  3LA3 A;  3CDI A;  4PZJ A;  2VQH A;  3PUB A;  2CQX A;  2ELK A;  4FCY A;  1RZ4 A;  1MNE A;  2IP2 A;  4R1H A;  4ANJ A;  3O8H A;  5DCM A;  1V5E A;  1FBQ A;  3S32 A;  4LG0 A;  5IOY A;  2QM3 A;  1J7K A;  3V7S A;  1X3U A;  3HM5 A;  2HGC A;  3MKY B;  4WXD A;  3GTP J;  4C9Y A;  2E60 A;  4OIO F;  2JWT A;  2EFQ A;  1PUE E;  3N4M A;  1JJ8 C;  2MYS A;  1KGS A;  1BW5 A;  1X4P A;  5F0F A;  3A02 A;  3S2H J;  2IGM A;  3WTW C;  3PO2 J;  4AC0 A;  2M1B A;  4U0V A;  5FFX A;  2K9N A;  3MD2 A;  2BBY A;  1FIP A;  1W7P D;  4Z2Y A;  5FRO A;  1BI3 A;  4AIJ A;  2P4W A;  2KMU A;  5IT9 Z;  1BJZ A;  2P5L C;  4RDU A;  2H09 A;  2HDW A;  1GV5 A;  1T0F C;  5CVV A;  5JR3 A;  4XIC A;  4HF1 A;  1EKE A;  4XLE A;  3RPU A;  1QA6 A;  2HYF A;  1JKQ C;  2GIZ A;  1TLH B;  3QU6 A;  3JRC A;  1MJ9 A;  1ETX A;  1ZAO A;  4IRG A;  4XKC A;  4XOP A;  4DW6 A;  1UJ8 A;  3BR5 A;  3S3M A;  4GFB A;  3LSG A;  2OJE D;  1ACI A;  1P92 A;  1WPK A;  3CO7 C;  2QSH X;  1HST A;  1VQ6 I;  2VPR A;  3JRA A;  2DT6 A;  2XUB A;  4C2M J;  1MMS A;  2PN6 A;  1ETV A;  1IXR C;  2JA7 J;  5IT3 A;  1WH7 A;  2M3A A;  3R0A A;  1K4T A;  2CMP A;  2CUF A;  2LK2 A;  2XGC A;  1S3J A;  2YSR A;  5L3C A;  3IAM 2;  4E7I A;  3CES A;  3HOX J;  2JUC A;  2IXS A;  3G1O A;  3K4M A;  4M3E A;  3J81 K;  2WAQ A;  1VF9 A;  3HPG A;  4HG2 A;  5TJJ A;  4HNT A;  3LSH A;  1UEL B;  4J01 A;  3DTI A;  2HR3 A;  1S72 I;  4GYG A;  5L3F A;  5FLV A;  2W57 A;  4UUS B;  1MDM A;  5EG0 B;  3DBL B;  5BNG A;  2XF7 A;  3I5U A;  1XGN A;  1OCC H;  3GME A;  3K4N A;  4G94 A;  4AYB N;  3ZP5 A;  4E7J A;  2IS1 A;  4XRM A;  2DLL A;  1Z9C A;  1R1V A;  4HDU A;  1U9O A;  3IC7 A;  3CLQ A;  3RYR A;  3QPS A;  3FKJ A;  1GT0 C;  2YU9 J;  3AAF A;  4A3G J;  1TC3 C;  1SVL A;  3L09 A;  3JSO A;  2K9S A;  1R1T A;  2XF6 A;  5CQG A;  5DYM A;  1ETK A;  2R5Z B;  1ZR4 A;  3GZN B;  1ZN2 A;  4HA8 A;  2R0Q C;  1G3W A;  1TQP A;  2KDO A;  3ABK H;  2E2I J;  1JXS A;  1XCB A;  1MBG A;  3A01 A;  1ZG1 A;  5LD2 C;  3I59 A;  3D0S A;  1FYM A;  3D1N I;  4AIH A;  4ZYD A;  2QBY B;  3WE3 A;  1YIO A;  3P9I A;  1PUF A;  4LLL A;  3HOV J;  2O3F A;  3WGH A;  5FRN A;  3F0C A;  1FOY A; 
#chains in the Genus database with same CATH homology
 4BDY A;  3BLY A;  4H4K C;  2W82 A;  3DEE A;  1AA7 A;  2HNH A;  4RLQ A;  4XKB A;  4BGD A;  3ZXS A;  4B44 A;  2VJJ A;  3A2K A;  1WJ5 A;  2VIX A;  4XNF A;  3QOE A;  1WJA A;  2CUZ A;  3DU6 A;  4XLA A;  2X85 A;  5KNL A;  2XC7 A;  1DP3 A;  2W7N A;  3OIQ A;  2GOX B;  2WBM A;  3V42 A;  3K6G A;  4DBQ A;  3IAS 2;  3S3N A;  3VSL A;  4BQO A;  4CA0 A;  4BJ5 C;  4F92 B;  3MMY B;  1U0J A;  3H5N A;  1X19 A;  4YRV A;  4B48 A;  1E0E A;  1WJE A;  4CZC A;  4ZDO A;  4JQF A;  2VJ5 A;  1YX5 A;  3QYE A;  3OYF A;  3A4C A;  2HU9 A;  4XKV A;  4ZJZ A;  2IGN A;  4OAZ A;  4JOM A;  1GLN A;  5HLT A;  4BQQ A;  2CV0 A;  1OLT A;  2HVS A;  3TMO A;  4U7B A;  1D1B A;  3K4B A;  5KHD A;  2WY8 Q;  3OYM A;  2VLA A;  4CSW A;  3BG6 A;  2VB6 A;  5KCM A;  2CW7 A;  1S9H A;  1DQU A;  2BVM A;  3K10 A;  4ZTF A;  2V7F A;  2W4S A;  1JI8 A;  4XOT A;  4PFP A;  4YEJ A;  4XOR A;  3H0D A;  3DPT A;  3DQV C;  4BE1 A;  2HPM A;  3RPU D;  3AL0 B;  3VDX A;  4IZZ A;  1LVK A;  3M8J A;  3I9V 2;  4OWR B;  3N05 A;  5CPR B;  4PJL A;  4IQJ A;  1DGW Y;  2L9S A;  3LSI A;  4N4N B;  2MD0 A;  3W3C A;  4PFO A;  4EAT A;  3D5S C;  1BR4 A;  4KIT B;  3BC8 A;  4DBR A;  2R7T A;  2W00 A;  4KJZ A;  2E1M B;  3I3L A;  4RM3 A;  3A1Y A;  3OYN A;  3FHN A;  3EUA A;  3CP2 A;  2ZSH B;  1QU3 A;  4HRI A;  5CQE A;  3RSN A;  2CUJ A;  1D1A A;  3LSK A;  1TT0 A;  2V6E A;  2L9N A;  3F9K A;  3FDY A;  2VXD A;  3H9G A;  4XM3 A;  4KIS A;  2K3P A;  1UG0 A;  1Z7L A;  4DJA A;  3OMY A;  1NG6 A;  1YE9 A;  4HNU A;  1N77 A;  2VPL A;  5JHF A;  4QPQ A;  4P5O A;  1FMW A;  4C30 A;  4D9J A;  4PK4 A;  4LIT A;  1P9Q C;  3CJQ B;  2DOA A;  2UUZ A;  2KQR A;  2X1D A;  1LKX A;  4XN0 A;  2PJR B;  4E7H A;  3K4C A;  2BW3 B;  3OYC A;  2CFO A;  2WAD A;  3VYU B;  2X1C A;  3OYA A;  4FAS D;  2BOL A;  2K5C A;  2XSJ C;  2CS3 A;  2LRD A;  3QYF A;  4G6T B;  3BCA A;  3PSF A;  3VYR B;  1PYV A;  2M7A A;  4PSW A;  2L7K A;  4RLF A;  4PJJ A;  4DOZ A;  2HQA A;  2ZXI A;  3OYG A;  3EPZ A;  2R7U A;  4XKW A;  2L2O A;  1WFX A;  1Z3X A;  3K4J A;  1X1A A;  4E7Z A;  4CH7 A;  1Z21 A;  2MC4 A;  3SDB A;  4IX7 A;  2LOO A;  2R7Q A;  3PNT A;  4DIQ A;  2R7X A;  4RMN A;  2V4J C;  4F55 A;  3DLA A;  2ZSI B;  1G8X A;  5CKT A;  3OR2 C;  4CCL A;  3OL4 A;  4BEH A;  2CH0 A;  4E4H A;  2WAE A;  1X1D A;  2LC2 A;  3CZ6 A;  2WAF A;  3CMM A;  4XQF A;  1D0X A;  2R7V A;  2RRE A;  1X4O A;  5FRM A;  3HL2 A;  4XLC A;  3OS2 A;  1Y56 A;  3W2A A;  1ERD A;  2VAS A;  2ZFU A;  3SEQ A;  2VXZ A;  3PNY A;  3L2V A;  4QPO A;  3K4L A;  4CCO A;  2A5W A;  2E5N A;  1BR1 A;  5HOO A;  3OYK A;  1NG7 A;  4C2U A;  1V5G A;  3MKZ A;  2LBF B;  3OYB A;  2CV2 A;  1PJR A;  2W1O A;  3D5L A;  3M1C A;  3PL8 A;  4PJN A;  3H5A A;  2LYC A;  4BL0 B;  3H9Q A;  2OUM A;  4NC7 A;  4AYB A;  2Z16 A;  2OV7 A;  2IGO A;  3DKX A;  4LIU A;  3PSI A;  3L2W A;  2KL4 A;  2E1M C;  1HA8 A;  3OS0 A;  3BG7 A;  2AQE A;  3AFH A;  3HC7 A;  4YEL A;  4RM2 A;  3QOD A;  3PFY A;  3RTR A;  2WY7 Q;  1FMV A;  4XON A;  3OOU A;  2JVH A;  4F3Q A;  4KT6 A;  3LL7 A;  3OWT A;  3FBN B;  2KP6 A;  3K4K A;  2VKH A;  4NUB A;  3OYI A;  2R7W A;  4DGW B;  4HEA 2;  1MW7 A;  3NWT A;  1UAA A;  2R7O A;  4HSR A;  4U87 A;  3VYS B;  3PJR A;  3OYH A;  4AVZ A;  2LBF A;  2DT7 B;  2RQQ A;  4OAY A;  2IS2 A;  1ZEL A;  2HPI A;  2JA2 A;  3ZQQ A;  3RCO A;  4II2 A;  3DWL E;  4XL9 A;  1N75 A;  2LG4 A;  2MFZ A;  5TGT A;  2V9K A;  1QHG A;  3FBI B;  2OC6 A;  1BOB A;  2RNG A;  3J7A Y;  2AQF A;  2HVR A;  4PUS A;  3HOS A;  2XF5 A;  1W36 C;  3DKY A;  3DPL C;  5HNH A;  2VQL A;  3IP4 B;  3OS1 A;  4C2T A;  3U21 A;  3EUK L;  4MLO A;  4PSX A;  4BQN A;  3AKZ A;  1X1C A;  3H9J A;  4HST A;  3C2G A;  4Y33 A;  2Q1Z B;  3SYT A;  2VKD A;  3PNV A;  4NC8 A;  4LG3 A;  4X0G A;  4HPQ A;  2F6C A;  4D1Q A;  2XDV A;  3DU5 A;  2K9L A;  1R6R A;  3HKZ A;  4CCM A;  3RQ4 A;  4AU7 A;  3H5R A;  2CW8 A;  2VJI A;  3S93 A;  3OYD A;  2V1N A;  4NQW B;  4BUP A;  2LY1 A;  4Y3O A;  3L2Q A;  3ZGK A;  4II3 A;  4BU2 A;  2X6Y A;  3LFU A;  2LRE A;  1SFK A;  1TZL A;  3DTK A;  1BR2 A;  1WJB A;  3TBI A;  1D0Y A;  2MAB A;  2IS4 A;  4B43 A;  2PJR A;  2P0W A;  2IS6 A;  3DPU A;  3UR3 C;  2BW3 A;  3ZCO A;  4NNJ A;  1MMG A;  1LFP A;  1T95 A;  2ELJ A;  3EUH C;  2IGK A;  1LDK B;  1EA3 A;  2FUG 2;  3NWS A;  4B3X A;  2UV1 A;  3CJR B;  4XLH A;  1J09 A;  4XR6 A;  1WJD A;  2LY2 A;  2M0M A;  1W36 D;  2JUG A;  4XMY A;  1MND A;  2F4I A;  4FET A;  2UWM A;  3OYJ A;  1V5F A;  4P1W A;  1DGR M;  2V26 A;  4F93 B;  3AL0 C;  1VZ0 A;  3L2R A;  2HVQ A;  2VQH A;  2DCE A;  2DJI A;  3PUB A;  1MNE A;  3KX2 A;  2ZXH A;  1SAU A;  3HG9 A;  4ANJ A;  2GOM A;  2VJ4 A;  2QKM B;  3SEZ A;  4BE0 A;  1V5E A;  3OYL A;  4BAC A;  3S32 A;  2R7R A;  2LH9 A;  1Y6I A;  3IUO A;  3OIP A;  3K70 C;  3OY9 A;  2M7B A;  4PJM A;  3MKY B;  2O5R A;  4C9Y A;  2E60 A;  4CUG A;  3LMM A;  4LIV A;  2JSP A;  1D0Z A;  4F91 B;  2Q2E B;  4XN3 A;  2MYS A;  3VWB A;  1N78 A;  4Y4R A;  3CP8 A;  3S8P A;  1X4P A;  3OYE A;  2KRC A;  2F5V A;  3GBG A;  3ZR8 X;  2IGM A;  3ONQ A;  2R4G A;  3MD2 A;  2VQG A;  3G2B A;  5FRO A;  5LFA A;  2KMU A;  1IRX A;  2M4K A;  4CCN A;  4F52 A;  3KEY A;  4R79 A;  2NOJ B;  3KYL A;  2HDW A;  2Y0S A;  1T0F C;  2PMZ A;  2X1E A;  2X6X A;  1WJF A;  2I8D A;  2KRH A;  3CF2 A;  3VYT B;  2X6W A;  1WJC A;  2R7S A;  1X1B A;  1OR7 C;  4XLE A;  4ZTJ A;  3LSM A;  3HUG B;  4XKC A;  4BJ6 C;  1D1C A;  4XOP A;  4ZYA A;  3S3M A;  2HZD A;  3LSG A;  4E7S A;  3SZG A;  4BS9 A;  1MMA A;  2DT6 A;  4ZC3 A;  4BJT A;  3TL4 X;  1G59 A;  2M3A A;  3VSK A;  3HOT A;  1K6Y A;  4J00 A;  2CMP A;  4E7I A;  3QYB A;  3IAM 2;  3CES A;  4BE2 A;  2VQC A;  1MMD A;  2WB1 A;  3HPH A;  4ZDP A;  4E7K A;  2IXS A;  3K4M A;  3ZRG A;  3DTE A;  1YX3 A;  2WAQ A;  3HPG A;  2Z2S B;  2A6T A;  4HG2 A;  3MKW B;  4HNT A;  3K70 D;  3LSH A;  1UEL B;  4ZDL A;  4E6K G;  4J01 A;  2KLO A;  3DTI A;  3S3O A;  3D5R C;  4GRI A;  4BDZ A;  2XF7 A;  4IQ4 A;  4XLF A;  4BXF A;  3W2W A;  3K4N A;  3C2H A;  3HXL A;  2K9M A;  3L2U A;  2XAU A;  4E7J A;  2IS1 A;  2X51 A;  4CCJ A;  2Z1D A;  3FKJ A;  2KZV A;  1QHH D;  2M4G A;  5HNF A;  3E1S A;  3E0J B;  2VL8 A;  3W2V A;  2CV1 A;  1MMN A;  2E5Z A;  2KHM A;  4BEH B;  2XF6 A;  5CQG A;  2BVL A;  2DXI A;  4B47 A;  3H35 A;  3OL3 A;  3UNG C;  1Z3Y A;  2KPM A;  4IKF A;  2JVG A;  2KDO A;  3BCB A;  1KON A;  2L5Q A;  2QKL B;  4ITV A;  4N4O B;  5LD2 C;  4E7L A;  5HVQ C;  2WA0 A;  5FRN A;  3OR1 C;  4CCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...