4QPWA

Bixyn10a cbm1 with xylohexaose bound
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
142
Chain Sequence
VDKVDYEIDYSTAGYSFWNEVNEEVKETTTIGKNDTEGCLEIKTSVAASQNHFIQYHTADNLPIEIGKEYKLKMMVRGSAEGKLNFGVGPWSGRAEGSFSFNTEWKEYEFSFKAVADGGHVMTQSGLFVGTIQIKYVKITHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Xylan utilization in human gut commensal bacteria is orchestrated by unique modular organization of polysaccharide-degrading enzymes.
pubmed doi rcsb
source organism Bacteroides intestinalis dsm 17393
molecule tags Hydrolase
molecule keywords glycosyl hydrolase family 10
total genus 32
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2014-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qpwA00
3GGLA 4P08A 2ZXQA 2HYXA 3MBWA 1PMHX 2L9LA 3NRUA 3WSOA 1GUIA 3FL7A 4BK5A 4QX2A 1KEXA 5C71A 4GWJA 4ARXA 1GMMA 3VDBA 2VMDA 3P6BA 4MGQA 1BHGA 1PX3A 2VZ1A 3DYPA 4QB6A 2WAAA 2VZPA 3OEAA 2ZEXA 2WO2A 4ZXEA 2VZRA 2VQTA 3I3EA 4CU7A 3FHAA 1H6XA 3JXSA 4DUWA 1OF4A 2C9KA 4JKMA 5LA0A 3T0AA 2V72A 3WNMA 3I3DA 1JYWA 3FN9A 3PUHA 3E1F1 1GOFA 1T2XA 2VMCA 1EUUA 4Z2AA 2Y6GA 2RJ2A 2WABA 2XHNA 2WZEA 3HNBM 4DUXA 1F4AA 1CZVA 3VDAA 1IQDC 4A41A 1W0NA 4M4PA 3I2KA 5DPNA 4UI9L 1UYYA 5EIYB 3HOBA 2QQLA 1NAEA 3BN6A 2W94A 1OH4A 3BGAA 1DLCA 5IFTA 4A6OA 3DYOA 3LQCA 3A22A 1UY2A 2ORZA 4A44A 4TXWA 3EYPA 4MGSA 2QQOA 1EUTA 5G05L 4L0PA 3OGVA 4XUQA 3W5NA 2E32A 4XUNA 5LCWL 1XPWA 4GWIA 4DXRA 5JUVA 3LE0A 1UWWA 2VO5A 2E31A 1H6YA 5IYYA 1CZTA 2XOMA 3ETPA 4CU8A 5IJRA 4CU6A 5G04L 3WF0A 2VR4A 5B4XA 4D8MA 3C7OA 1JYVA 3WF4A 4LPLA 2J1VA 2J1SA 1W9TA 1JZ8A 2X10A 1O8SA 4QX3A 2LW8A 4A42A 2ID4A 4ARYA 1DYOA 2W1UA 2VZOA 3CZJA 4LQRA 1US3A 3K4DA 3IB3A 3I2HA 4W50A 4XVHA 4PT6A 3WNOA 2X09A 2VM9A 1GOGA 4XURA 2VL4A 1K42A 1OT5A 3ACGA 2WQ8A 2YFUA 1JZ4A 4W8JA 1R64A 2BZDA 1ULPA 3I2GA 2ORXA 3LEKA 2VZQA 2YG0A 4JHZA 3I2IA 1SHWB 2CDOA 1O8PA 1SDDB 3C7FA 3ABZA 3MV11 2XONA 5JXIA 2JD9A 2HLEA 3UESA 1PMJX 3A21A 3WEZA 1OD3A 2VZTA 2R7EB 4OMCA 4OUEA 1JYXA 1GNYA 1K45A 4JKKA 4DXSA 2V5DA 4CVUA 5DN2A 2QQIA 4DEVA 4W4ZA 2ZEYA 3F2ZA 4LKSA 4ZZ5A 5J1XA 3MUY1 5HPOA 4M4RA 2VMFA 4E8DA 3WF3A 3J7HA 2VC9A 2B9VA 4OMDA 3WF1A 3T0DA 1K3IA 2ZEZA 5CYYA 3ACIA 3OB8A 1XNTA 4MADA 2RV9A 2Y6LA 2QQMA 3WF2A 1UXZA 3DECA 4RN5A 4QAWA 2EICA 4XUPA 3NQHA 3SKJE 2W1SA 4DEQA 4UOJA 3T08A 3WNLA 4P5YA 4QB1A 2BGPA 4A4AA 1ULOA 2KD7A 2W1QA 2VCBA 1JZ7A 3HNMA 3THDA 4A3ZA 4XUTA 2XQXA 1JZ2A 1DP0A 2Y8KA 2WO1A 4FI9A 4YPJA 1GOHA 3NNGA 1OF3A 1JZ3A 2QQNA 3C7EA 2WYSA 2CDPA 5JXGA 1JU4A 1W8OA 5EJ1B 2J1AA 4E8CA 3UETA 3OEBA 2W5FA 3LEGA 2W95A 1W8NA 3CIHA 1CZSA 5IFPA 2BGOA 4UAPA 3SEEA 3LPGA 2VZVA 1K12A 3PUIA 3NJXA 3VDCA 2VTFA 1CIYA 2B4KA 3WNPA 1UMIA 2Y6KA 1NX9A 4MO3M 5FUIA 2DCJA 2JE8A 2BERA 2WBKA 3HPNA 2C4XA 3DYMA 3K77A 4QX1A 2J1TA 4DXTA 3T2PA 4JKLA 1UYXA 3OG2A 5CZKA 5JXHA 4D0QA 2W3JA 3IAPA 3LEIA 5JMOA 3HJRA 1L7RA 1UY3A 2W92A 3IAQA 4QX0A 1SG3A 2EIBA 1NUKA 4CUCA 4KMQA 4CUAA 2EIDA 3SEPA 3T2OA 3C8XA 4QB2A 3ZM8A 3THCA 3I3BA 2J1EA 4IUGA 3IIIA 1UY1A 3AC0A 2WN3A 4PQQA 4QDSA 2Y6HA 3W5MA 1GQPA 2YC2A 4P02B 2VCAA 4QPWA 3HEIA 3LPFA 3VD7A 2LS6A 3VD4A 5C70A 4BK4A 4OZOA 2VQUA 3A7QA 5JXJA 2DDUA 2RVAA 1J83A 1RYYA 3MV01 3T0BA 2WO3A 1UY0A 3VD3A 1F4HA 4KI5M 2W87A 1LNSA 1W9SA 2YFZA 4LHSA 2E33A 3K4AA 3IDAA 1JYNA 3K46A 1XC6A 2QQJA 5LA2A 1GU3A 1MPXA 2W91A 3A23A 2J1RA 1TVGA 2JKXA 3I2JA 2JDAA 1PX4A 2W46A 3VD5A 4GZ9A 3ACHA 2VZ3A 3T09A 1KGYA 3K75B 2J7MA 1UXXX 4BDVB 3D3AA 3WQBA 5HXMA 3OGSA 1JHJA 3OBAA 4DUVA 2VZSA 2PQSA 4HG6B 1JU3A 2QBXA 4KWUA 3CKHA 4ET7A 3GDBA 1WKYA 4PF1A 3WNKA 3CZUA 4QDRA 4CU9A 3SKVA 3HNYM 2VJXA 1JZ6A 1D7PM 1P8JA 1I5PA 2YC4A 4AG4A 5DMYA 4OYUA 4QDQA 4CUBA 4BJ0A 1WCQA 3EB7A 4TTGA 5I0DA 2Y64A 3I97A 4BXSV 3CMGA 3C7HA 4XUOA 3UNPA 5C7GA 2QQKA 2BBAA 5LA1A 4AAXA 4ZZ8A 3MUZ1 2WDBA 2Y6JA 3T2QA 5JR2A 3WNNA 2VMEA 3OGRA 1W99A 2VOTA 2WN2A 4RYDA 2W1WA 1UZ0A 4P00B 3ACFA 1W9WA 2WAOA 2OKXA 1UY4A 3NJVA 2E26A 1L7QA 5A1AA 1UX7A 4MOAA 2YB7A 3VD9A 1XNAA 4JX0A 1UYZA 2WUHA 3U37A 1CX1A 2Z4FA 2X05A 4A45A 5EJZB 2W47A 2J1UA 3C7GA 2C26A 3I2FA 1JZ5A 2W9XA 1TG7A 2J22A 5B4NA 1J84A 5IHRA 3ECQA 3P1IA 1JI6A 1UMHA 3HN3A 4XZUG 3CDZB 5DQ0A 2DCKA 2ZEWA 3GM8A 2VZUA 3K4ZA 2VCCA 3MO4A 4ZY9A 3CQOA 1HN1A 2V4VA 2EIEA 5F7UA 2WZ8A 3FHQA 1O59A 3GXUA 1US2A 1NKGA 1YQ2A
chains in the Genus database with same CATH superfamily
1ZA7A 3ZKYA 4EN9B 2PAMA 2VW1A 1RUC2 4MX3A 4OHXA 1DGRA 2QKDA 1Z7S1 3AKQA 3IKWA 2SBAA 1WBLA 3DL3A 4K7JA 3K48A 2R061 1CVNA 3SISA 3H7JA 4V2VA 1Y9QA 3KSCA 4QHBA 1HV1A 2XWJB 1FNZA 1LHVA 4ARXA 1AR93 2ETEA 5GALA 5FMDA 1RUE3 1QMJA 1H2KA 2BW8A 5LZ6A 3BIWE 5LY1A 5F3EA 4PDWB 3HD8B 3J8F2 4KL1A 1JUHA 1DZTA 1JOBA 1VBE2 1UNBA 3LFIA 2IFWA 4QQLA 4ES8A 3JD72 1ZBA1 2R49A 4RSUA 4XTPA 3RJ2X 1LULA 4K3UA 3I3EA 3LA3A 4TN7A 1CGPA 3WY6A 5BYNA 1WLDA 2JDYA 1OI6A 2RDSA 5BNOB 3FFZA 4Q0SA 3JXSA 4RS5C 4J6GA 1ZA4A 2C9KA 4EV0A 4CDWB 1AVBA 3ZFGC 5A6XA 2OX0A 3AL5A 2FDKA 2BFUL 1GOFA 1QH7A 4A6SA 3AJYA 3ENRA 4FP3A 5ABJA 2ADEA 1EUUA 3POYA 1XE8A 1LOAA 1HJGA 1XYNA 1KJLA 1WLTA 1GBGA 1ZM1A 2PN5A 5IWFA 3GBWA 3O0XA 2DUOA 3PDQA 3W9AA 2VW2A 3VDAA 1W0NA 4HLTA 2D6KA 4F8AA 3N7MA 4RQPB 3ZXLA 3LEMA 3O1PA 5DPNA 5KC6A 5A1LA 1ST8A 1J3QA 1AL21 1JS9A 2JX9A 3HIFA 2B9UA 4HBNA 4WVMB 5FR3A 1NXD1 2W94A 3ILRA 5T55A 2BVBA 3UL2A 3T4VA 4A6OA 3DUIA 5D2AA 4ZU4A 5BY5A 1ZRIA 4Y3OA 3LQCA 4OLLA 4ONUA 3ZR6A 4INDA 5LA1A 4EROA 4FQ4A 4A44A 4TXWA 3EYPA 1V6IA 1DBNA 1Z7S2 3VKLA 2QQOA 5F5IA 5G05L 1PGW2 1ND2A 2R043 3SXWA 3VBHB 3IDBB 3CJIA 2WNOA 4XUQA 2WNUC 4CE8A 1QOOA 5ANQA 5AC91 4EJRA 4Y1YA 5FZ8A 2WZPP 2BNOA 3KT7A 3KD4A 4PIZA 1UWWA 2VO5A 2E31A 1ULGA 2YBKA 2XOMA 4BWOA 2YBSA 2WZR2 1IPKA 1H8VA 5IJRA 1QEXA 4CU6A 2CV6A 1MS0A 1YQCA 3ZSEA 1SLTA 4KH9A 4LNVA 5B4XA 4LA2A 1OLRA 3QBQA 3NKTA 2VBBA 2VMIA 3LFMA 4LPLA 5GLUA 4BISA 3USUA 3W58A 2NLRA 4IEVA 3RG0A 1OQDA 1LHUA 3R05A 1Y4WA 1O91A 1UZVA 3POGA 4LE4A 4MGKE 3MYXA 2BBVA 1G86A 1HX6A 4YZ3A 4NAOA 1O8SA 3UK9A 1YEWA 4A42A 2E7QA 4N43C 5EQUA 1L3JA 3UYJA 2W1UA 5F2SA 1WLCA 4LO8A 1FPN1 1US3A 3K4DA 1W04A 5HCHA 1VBA1 1RIRA 1AZDA 3LAGA 4Q0PA 4FT8A 1BKZA 1RUOA 3VV1A 2JG9C 2VL4A 5IAXA 1OT5A 5FYIA 2WQ8A 4FOYA 2YFUA 3VDDA 4FTBA 2VUJA 1ASJ2 5KXCA 4Q0VA 3VHRA 2CNAA 3PMSA 1POV0 3BTAA 2UWBA 3SCHA 3FE5A 1RUD1 1CPNA 4Q4Y2 3QH6A 4LBLA 5BV6A 1AL22 2D7FA 3AMHA 4JAAA 2CAVA 1UQXA 1REFA 5FY8A 3AJZA 1W06A 1TZOA 3PVBB 3THTA 3WDVA 4LHKA 1VBE3 3B3QE 2AYHA 3FHIB 5C5TA 3ZYBA 1C4RA 3NL1A 2ZPXA 2GAUA 3POIA 2H0BA 3CO2A 2A6YA 4LEJA 2JDMA 1LGBA 4Q0UA 3USSA 1GQHA 5DAWA 1YIFA 2HWD1 1OD3A 2VZTA 4XDQA 3RMYA 4BIOA 5A3MA 3PIGA 3I49A 4RQPA 4XZPA 4AWDA 3KCYA 4B4QA 3GZAA 4JKKA 5JMCA 2V5DA 4CVUA 4DRVA 4Q2FA 1GR3A 4JGZB 4DEVA 4XW3A 3L2HA 4UBHA 2VECA 5BNPA 5IT6A 4ZZ5A 2XLFA 5HPOA 3AL6A 2NZ9A 3LDBA 1J3RA 5DZFA 4UFMA 3LF7A 2Q30A 5KXDA 4QGMA 4OMDA 4DOUA 3T0DA 3NNJA 4YZ4A 1PGW1 3GALA 5D21A 1DLLA 3ACIA 5FKBA 1MEC1 3OGGA 3FJSA 3VZLA 4AFAA 3J26N 2X8KA 4KWJA 3N7KA 4HVQA 3FLTA 3M3IA 4YG0A 1QOTA 1UZWA 3TNQA 4ASKA 1OA3A 2TNFA 2W1SA 5FZLA 1BBT3 4XJZA 4C90A 4S2DA 4A4AA 5BPXA 1ULOA 4AFDA 4AHZA 4Y1ZA 3KV9A 2XBO2 5JVVA 1JZ7A 3HNMA 1UKGA 4L8QA 4W6XA 3THDA 4A3ZA 5DDJ2 5AFBA 4H14A 1F15A 5IVVA 3OBZA 4UFHA 4AVVA 2UYBA 2VULA 2WNUB 4CTEA 2Y8KA 5BNNA 5FY5A 4L92A 3NV3A 2H6BA 1GYKA 3MIFA 1DGRN 4SLIA 4WVWA 4YPJA 3NNGA 3N9MA 1OF3A 4QQPA 3OD4A 1EAH3 1PO21 1SLLA 3AYCA 3C7EA 4OI1A 2ZCWA 3N7JA 5EPAA 4D3WA 4ZU7A 2GH8A 3UGHA 5JXGA 1JU4A 5FWEA 5CFDA 1BK0A 4MUVA 4E8CA 3UETA 1OOPC 1DGLA 3OEBA 4IEPA 2ZABA 1W8NA 5CFCA 4CEYB 2V09A 4IV3B 4AEDA 2WL1A 1S55A 2XDVA 2DU1A 3SEEA 4ITCA 2DFBA 4CDUB 3ZPOA 3LPGA 1XSRA 5LEKA 1K12A 1POV1 2PHUA 3H1WA 3VBHC 1PIV2 2VQAA 4O65A 4Y5Z0 1OHFA 5FY1A 1PZ9A 2CWMA 2G9FA 5DAQA 4YFZA 5KHHA 1WCSA 2Y6KA 1UPIA 3DGTA 1EY2A 1W6QB 2WJSA 2DF7A 4WVVA 4UW5A 1TNRA 2DCJA 3WDUA 3M3EA 4L9BA 2BERA 3H3ZA 2G9GA 2HKXA 3HPNA 4WV8A 1BEV3 3I54A 4RA0A 4QX1A 2J1TA 3AFGA 1GKBA 3AMQA 1BVP1 5T3NA 3ZFGB 4CCEA 2OQ7A 4P9YA 5T5PA 4DRRA 2C6SA 1H1IA 2JDHA 3OG2A 3RZZA 3O1VA 2BWCA 4O9GA 1VMJA 4XQWA 1MEC2 4UXAA 4NPLA 5I0UA 3IAPA 3MW2A 5JZGC 2A6ZA 2WSVA 4HSJA 5JMOA 1QJU3 2VW0A 3P5BA 2GC1A 5A3WA 1YYNA 3IAQA 1EPWA 1QOSA 3SQOA 5KR7A 1NUKA 5J3UA 1VBC1 3LA2A 5F3IA 4N53C 4M3CB 3WCSA 4QB2A 4PDWC 1GWKA 3LZZA 3WQ7A 2WS91 3LDKA 3ON7A 2Z79A 3THCA 4IUGA 4OZXA 2GU9A 3ZDSA 5FIXA 3IIIA 4YSFA 1NLSA 1POQA 2WN3A 2NMOA 4QDSA 2BNNA 2ERFA 1GQPA 1CAVA 1VBD1 2YC2A 1U12A 2GNBA 2Y38A 3EJKA 4IL7A 4QPWA 4EN6B 1O5LA 4V2WA 1PO22 3MPBA 4AHWA 1LOFA 1NCQA 1BEV1 1WUVA 1DQ4A 2WR9A 2ZGPA 3Q9OA 3VD7A 4BQ4A 4I02A 4NPRA 2RG4A 1D4M1 1NQJA 4B1LA 4M3CA 4MZUA 5GZFA 3RRDA 3OY8B 2BJSA 2XBO1 4FPYA 5FTTC 3TBDA 2IXKA 4HPKA 1DGWA 4QD2A 4E27A 4FTSA 1O3RA 2HYKA 2IXIA 3ILNA 3T0BA 2YPJA 3JUUA 1AF9A 5FXWA 2D40A 1F4HA 4KI5M 3WG4A 1IG3A 2W87A 5JWPA 3ZMNA 3ZYJB 3BVCA 1KITA 1W9SA 2RR11 3G6JB 1QJEA 4MV2A 2IXHA 5FY0A 3WLUA 3VBUC 4BCUA 2VOXA 5FAXA 3K46A 1APNA 4MGZE 4QXCA 3IPVA 1JTZX 3VDDC 5CEHA 1IS4A 5FXVA 1BLZA 1D4VB 4CDQC 1MZEA 4RR3B 5A7SA 1CJDA 2J1RA 2V73A 2XMLA 2YGLA 1RUJ1 4F7ZA 3QD6A 2W46A 5FP4A 1ZRDA 4LIVA 5FZ6A 3RI8A 1PO23 1AR73 1C5HA 3ZO0B 3QLQA 1N1TA 2ZHKA 1KGYA 3ZLIA 1JYTA 2OT7A 3MLJA 2BEOA 4LBQA 1NY72 1VMHA 4MXWA 2VMGA 1QJX3 5D8AA 2J7MA 3BALA 1ODMA 4ATEA 1NCRA 3ELNA 1LRHA 4B4PA 4Z82A 2ARBA 4HVOA 5A33B 2CHHA 3MDPA 2UY8A 4EN7B 3AZYA 4AE2A 4R52A 4H55A 2AUYA 4IE6A 4XFGA 3OGSA 1F31A 3OBAA 3VN4A 3ZFEB 4DUVA 1LAJA 2PQSA 5F39A 2ZKNA 4QPIB 2GALA 1AR62 4LLFA 1UU6A 2WS92 2QBXA 4Q4V1 1RUG2 1WKYA 4JHTA 1DGWX 5FPXA 4XDPA 1R091 1ULCA 4UF0B 1LCLA 4WM7A 3POEA 4GWMA 4QDRA 2E7TA 2WNUA 4YW5A 4FOVA 1LOCA 2A7AA 4Y33A 4NWWA 1AYN1 1CONA 2VJXA 4HXCA 2FDGA 4XHBA 1D7PM 2EAKA 5FMOL 2QQPA 4I3GA 2P3KA 4AG4A 1EPZA 1UKRA 2JENA 2QQWA 4D69A 3URFA 3KCCA 1XOYA 1MZ5A 4E4HA 3B93A 3N9OA 4D7TA 2E7AA 2RS31 4WVZA 1UOJA 3RWKX 4XAAA 1ULEA 2E9QA 3NAPA 2BRTA 3KWVA 4EWDA 1U5YA 4HN1A 1YI7A 4AR2A 3PJYA 2GNMA 4MXVA 3S7IA 1FMD2 5FY4A 2W08A 1OFSA 2DUQA 2WYFA 2ZX1A 1UO9A 1AYM1 1WMDA 1HRI1 4CUGA 5CVRA 1RUG3 1H1AA 2ZZJA 2Y6FA 3WW1A 1IHMA 1LKNA 4ZZ8A 4IQPA 3MUZ1 3VBSA 5A70A 1UYPA 4BH9A 1PNGA 1DZRA 2W39A 5JR2A 3Q8EA 5FJKA 1CD3G 4LORA 1W99A 4FCAA 1ND2C 2B5HA 5K0UC 2WN2A 4DZGA 3KV6A 1OLME 3B9IA 4P00B 4GKYA 3DN7A 1XRUA 2D43A 1TME3 2XVLA 3ACFA 4OCTA 5FZ9A 4YG3A 3RZMA 4J1XA 4NWVA 3NJVA 3PIJA 2E26A 1HIXA 1FT9A 4LO4B 3GJBA 5L9RA 3SCFA 3BIEA 4BU2A 2WNVC 3TN91 3DPRA 5CG8A 4RR3C 1TEIA 2F17A 4RR3A 4XHXA 1RUJ2 5GLZA 2GMPA 1C1FA 1QDOA 3CJXA 4ASLA 4JX0A 1NXMA 5GLTA 4G9SB 2WINB 5KHIA 3U37A 4QT6A 1OURA 2QDRA 1XSQA 1NY71 1W8FA 1LGCA 1KD7A 1U5ZA 1RUG1 1FOD2 1GZ9A 4LHNA 4P9LA 3KVBA 4A45A 4YZ2A 1R081 2W47A 4META 3CNAA 1COV1 4FFHA 3H7YA 5FZ3A 2J22A 1QXRA 3NV1A 4GH4A 1Y9MA 4E4ZA 3LIHA 2HWC2 3B7MA 4XZUG 1A34A 2AENA 2CAUA 2MPFA 2OS2A 1YRZA 3CDZB 4YYOA 1T6BX 4LBMA 3WHUA 3BTXA 2ZEWA 2RMU2 4XFFA 4QPIA 4WBBA 5FBJA 1H1MA 1NA1B 2O8QA 3GM8A 4Q4V2 3NV4A 2HWE1 5FBZA 4A7ZA 4Q4X3 3WW4A 2D44A 4LBQD 3LCPA 1SMVA 1R092 3E5QA 5EXOA 2WZ8A 4JGZA 4I09A 1F35A 2P17A 2WFPA 1MQTB 2ZMNA 3LKJA 4K40A 1PK6A 3AFKA 5FPLA 3ZSJA 3AZWA 3J7MA 2EA7A 3ZFFC 1SCRA 4AF9A 2P3JA 2ZXQA 3AYEA 1ZZ8A 4LIUA 3MBWA 3NRUA 4Y22A 4GAZA 3HN1A 1Y7BA 2KA3A 1W6NA 1RUH3 4YW4A 2HWB3 1QH6A 1HB3A 1KEXA 4QX2A 5C71A 4GWJA 1XNDA 2F4PA 1UMZA 4A3XA 2P3IA 4XE9A 1YFWA 5HCBA 5FYHA 4FQZA 1LR5A 1DF0A 4MGQA 5FZ1A 4QB6A 4KGGA 2GN7A 2VZPA 1FMD1 4LE3A 3B9CA 1S4CA 2FMYA 1MS4A 1G9CA 3SH4A 3GCWA 2WO2A 1XNCA 1KFUL 4ZXEA 1DCSA 3SC7X 4M0NA 5FZDA 5H9RA 4MSVA 1RITA 2VTXJ 3OPZA 3DV8A 1H4HA 1UF2C 3ZYRA 4YW1A 2QJVA 4IEWA 2VQTA 3O1MA 3TN92 2VVDA 4RGKA 4BQWA 3PVNA 1W8WA 2HJIA 3KGZA 2FBEA 4JRAA 4DUWA 1QJFA 4LOTA 1RUJ3 4XEZA 3T0AA 4CCJA 3RZGA 1ZZ9A 2JB8A 1IS6A 4K20A 4AGRA 1JYWA 4ZS2A 4XFCA 3E1F1 1FOD1 1V6NA 4NR1A 2VMCA 5IATA 3TEWA 1JOJA 4CA9A 4XILA 5GM0A 4Z2AA 2JB4A 4QHOA 2QVSB 2WABA 4K21A 2QZ3A 4YW6A 4AYUA 4IV3C 2XHNA 4FFFA 3HVDA 1VR3A 2HBUA 4CEYA 5C5UA 4OI4A 2TEPA 5A7OA 5C4WA 4DUXA 2Y26A 1V00A 2Q8EA 4FPEA 4XJUA 1IQDC 1RC6A 3GBFA 2QQUA 2ARCA 1W2NA 4IW3A 3AM2A 3V56A 4AQ2A 3O0VA 3I2KA 2A5ZA 2ZA9A 4CP0A 1C8M2 1HQLA 1LOEA 2JE7A 1OPMA 2UYAA 4XFBA 3FC0A 1UYYA 4DO0A 2YBPA 1NAEA 3BN6A 1YNAA 5FXZA 1MS1A 1OH4A 2WNVA 3BGAA 3LA7A 4SBVA 4UFJA 2HH9A 3J9SA 2CGPA 1HXS3 1QNYA 1HW5A 2VPVA 2W0XA 5ANNA 1EV12 1G9DA 5FYUA 1ND3C 1VIWB 3SITA 1ZREA 1UY2A 4XFHA 1G9BA 1AX1A 4MGSA 3D8CA 5KXBA 2IWGB 5GLVA 2ZAHA 3E6CC 2RJLA 3OGVA 1W2AX 3HWJA 4LO7A 3KM5A 2GN3A 3AB0A 2D5FA 1LHNA 4CXXA 1DQ2A 1K5MA 3KVAA 4KWLA 2CYFA 2XVGA 4XUNA 2JE9A 3A0KA 1XPWA 4GWIA 4RHV3 4XMAA 1PO11 4AI0A 1GV9A 4CCOA 5JUVA 3LE0A 4FOQA 1H6YA 4WM7B 3ETPA 3RZLA 1ASJ3 5FPZA 3T3YA 4QWNA 5IVCA 2RDQA 5FLJA 2VR4A 2LUWA 5ABJB 3IBMA 4UF0A 3IDCB 2UU8A 4LKEA 4D6RA 5HBAA 4AGVA 1JYNA 4HETA 2WFF1 5JSOA 3VBUB 5A7WA 1I1EA 1W05A 4IGQA 2XL7A 4ASMB 1B09A 1FV2A 4R9DA 4TZDA 1EP0A 1Z78A 5F37A 4AVSA 1QU0A 2YU1A 4NMIA 5LB6A 3AP4A 2VZOA 1D0HA 3CZJA 1PGSA 3VBFC 4AEJA 2XJQA 2YROA 2X5IA 4DPNA 1LGNA 1IOAA 4XVHA 3W59A 4P5HA 4PT6A 1POV3 2ET1A 3UT0A 2Q1ZB 5BNNB 1K42A 3ACGA 5CBLA 1MS5A 2CTVA 3TNPB 4URAA 2BZDA 1R1A3 1ULPA 1Q8SA 3LEKA 1CAWA 2ZJCA 2YG0A 3U11A 4OI0A 2IXLA 1QJY2 2R32A 2FD8A 2W52A 3FUOA 4TLGA 3HR9A 4WM8A 1SEFA 3E6BA 1KDKA 3LOBA 3KZ4C 3I2IA 4A7YA 5F32A 5FQ0A 1XU2A 3V0AA 1BMV1 1O8PA 1KXGA 2MEV1 3C7FA 2WIIB 2K0GA 4NVPA 1A78A 4LHLA 2OW4A 5FYZA 2OXBA 3MV11 5CKMA 2XONA 3ACLA 1H2LA 2JD9A 3UKNA 1PMJX 1STMA 1MVEA 3OY8A 1RUC1 5LASA 2YV8A 4NUBA 1PNFA 2I2SA 2OQ6A 3AKTA 2R7EB 3GJAA 1E5SA 1K45A 1UOGA 5FZFA 1FMD3 3O1RA 5JAXA 4XTMA 2PHLA 1ZRRA 1SBFA 2ZGKA 3MEPA 3PVEA 3WDWA 1YCIA 3AYAA 4GA9A 2AZ5A 4BIFA 2TUNA 2QDNA 4CYDA 1W2TA 4IV1A 1WZXA 1X82A 2HWB1 5FZOA 1RUH1 1V6LA 5IVJA 2VC9A 5SV8A 1MEC3 1HKDA 4R8HA 1VB4A 4ZU5A 4R9CA 1E5HA 3JD71 1XNTA 1OVPA 5FDBA 4MADA 3GHNA 2RV9A 3SH3A 4PQ9A 1J1TA 3ZXEA 4QX8A 4FXGB 2VH9A 3M1HA 1WGPA 1KS4A 5KC5A 1GLHA 1TNFA 2E51A 3JQWA 4GKXA 1SFNA 2HWE3 4DEQA 1Y3TA 4YM0A 2ENRA 3VKMA 3WNLA 4GWNA 5FPVA 2RJKA 1J3PA 2EXHA 2VCBA 2CGOA 3ZN6B 1GICA 3N9NA 3GZUC 1AXYA 1GSLA 2XQXA 4OHWA 1JZ2A 5AFEA 2JIGA 4JQRA 2JKBA 4H7LA 5DZGA 3U75A 1LU2A 5I0RA 1LEDA 4KG0A 1JZ3A 1YFUA 1MS9A 2QQNA 2EF6A 4GB31 1W6NB 5F2WA 2AC1A 4NO4A 3LD8A 3PURA 4GB33 2UWAA 4QXKA 1W8OA 5EJ1B 2J1AA 4IEZA 2Y0IA 1E5RA 1A6CA 1CQ9A 4DY5A 1UAIA 1RMU3 1RUD3 2W5FA 3C2UA 4M01A 5CKQA 2XVKA 3SCGA 1EYBA 5I91A 3ORJA 4QU1A 2AR6A 3U07A 4CP9A 4YM3A 2FDHA 2E63A 3TN93 5BNQA 3O1UA 5LBFA 4OUSA 4X6QB 1KRIA 2P34A 2WQZC 2VZVA 3WHTA 3KLSA 1UL9A 1YI9A 4IXLA 5CISA 1O7FA 3NJXA 3VDCA 3ZFFB 4MH0E 4RFT0 2PHRA 2NP0A 2B4KA 4QPYA 5E88A 3WNPA 2D3RA 4DS0A 2D6OX 2D3SA 4JZRA 2P1BA 1GNHA 3KQ4B 5J09A 2P37A 1IKQA 2CWSA 2JG8A 4MO3M 5FYSA 4QGLA 5AC92 1W03A 2GNTA 1AYN3 2XKOA 3KCXA 4UW4A 2HWB2 3MF6A 3DYMA 1GANA 3JD73 4QKNA 1QNWA 4RL7A 3ZXFA 1JYIA 3CJIB 4B8EA 4TWTA 1QKQA 4JKLA 2R16A 1UYXA 2VBDA 4QHZA 5ERLA 3P3NA 2CU5A 5CZKA 5JXHA 5K8SA 5C9AA 3S7EA 3UJOA 1QXJA 4IEXA 4HT1T 1X9PA 3HJRA 5JPMB 1OOPA 4RD7A 1VBB1 1YLLA 3M3OA 4XJAA 1BXHA 1SG3A 2JXAA 1W39A 5C33A 4DY3A 2RS33 4MHRA 5T5OA 5FP7A 3SEPA 1GNZA 1RUH2 4BLIA 4CXYA 3QCWA 3BB6A 4Y1VA 5JDBA 3JB4C 2WNVB 2J1EA 4AVAA 3E5UA 3AC0A 3D0JA 1PMIA 1AX2A 1VRH2 4NRMA 4XXPA 4A2UA 3W5MA 3T2TA 1X8EA 2XG3A 2UWCA 2VVFA 2VCAA 5LW9A 2WO7A 2EVXA 5D8AC 3ATGA 1ACCA 3ROUA 3VD4A 4KU8A 4QKFA 2VD7A 3FLPA 3GCXA 4JVAA 4CRQA 4IE4A 3RQ0A 5FZAA 4BK4A 2VQUA 3A7QA 3ZKUA 2DDUA 2RVAA 3ZX7A 1J83A 3RDIA 4E2QA 3CBNA 5FWJA 1BYHA 1MS8A 2DWRA 3FX3A 2QUOA 4BB3A 2YY1A 5FYMA 1N3OA 4FXKB 3OD0A 3VD3A 2H6CA 2UY9A 4IGPA 2WA3A 4PI2A 1DFQA 5FZHA 4FOWA 5LBEA 2ZACA 2YXSA 2QTWB 4LHSA 3K4AA 3R4SA 3THPA 4HOOA 4P9JA 3ST7A 1BBT2 1GU3A 1M4WA 4GIQA 1MPXA 1S0FA 2D6LX 2GP5A 2WRAA 4YLZA 4YGDA 3A23A 5I8SA 2A3XA 3N9LA 1TVGA 2JKXA 2JDAA 3I2JA 1C8NA 4JC1A 2PHDA 3EMRA 3ACHA 2IXJA 3B02A 3KGLA 4K6BA 3T09A 5FYVA 3BPZA 3K75B 4XETA 1GWMA 4UBGA 5GZDA 4OQ9A 1R1A1 1E5IA 1W6PA 1OUSA 2O0OA 4KQ7A 4CSWA 5C9AC 4IERA 1HB1A 4ATFA 3Q8CA 4BDVB 2EXIA 2VG9A 3D4KA 4FTEA 2YU2A 3D3AA 3ME2A 5FMOS 4AHXA 1PO13 4R4XA 4EYUA 1VALA 2XWBB 3EBRA 4YGBA 3E6DA 1F8VA 1RUE1 2OUJA 1C8M3 5JCTA 2VXJA 3WW3A 4D7SA 3L9JT 2Q8DA 1JW6A 1QJU1 3JQXA 3K51A 2FCVA 2GC2A 2XGXA 3PL0A 5A6QA 1N47A 1JU3A 1GZCA 1H9WA 1I6XA 3GDBA 4XAEA 4QXHA 4D6QA 1DYKA 1IG0A 3H8XA 4UFKA 3DXUA 2PAEA 3ZN5A 2ZHNA 4MYEA 2ZX0A 1QXPA 2WZR3 1FNYA 3HNYM 4P9WA 5IK5A 3DKQA 1P8JA 3AXEA 2JICA 4AFBA 4Y26A 5JIUA 3MI8A 4YM1A 3SHRA 3GNEA 4AOCA 1V9U1 3I59B 1WBFA 5FRAA 4B4RA 2ES3A 1J59A 2DYCA 4KG8A 4Y4YA 4YGEA 4F3JA 4JDOA 4CDQB 4Z8BA 3VDDB 5GZGA 5JOWA 1HJFA 2XUEA 3ZVXA 3I97A 2NQYA 3PU8A 3WUDA 2BP6A 3PHMA 5IVFA 4XUOA 3F95A 1H4GA 4Y1UA 4MHUA 2ZMKA 5A3OA 4NHYA 5GJ6A 1HQWA 3NJZA 3ZSMA 2QQKA 2D6MA 4QXBA 1K5MC 1NA1C 3FBMA 1PK6B 1MZFA 3LGRA 4MGIE 2J42A 4AAXA 4H3WA 1XJAA 4JCKA 3U14A 2X5IC 3M7AA 1HB2A 3WQ1A 4CP2A 3WNNA 4HK8A 5JPNB 5C4WC 4AVCA 2VMEA 3VL9A 3KV4A 4A7KA 5FY7A 4Q0QA 5JSPA 3AMNA 4MVTA 1VRH3 4OVEA 2VNOA 3ZDVA 2VAUA 1QGLA 1W9WA 1W0PA 3ZN6A 1GWLA 2OKXA 5H9PA 3PJQA 2KM2A 4GH4B 1BBT1 1L7QA 4MOAA 1AX0A 5HCAA 1DQ6A 1SBEA 4LBNA 3VD9A 2ZGQA 3BPSA 1W3XA 1XNAA 1X7NA 4RFRB 5A7PA 3H0OA 4XJ9A 3FMGA 4N53B 3VBHA 4N9HA 3W21A 4XF4A 1CX1A 2BTVC 1CPMA 3HQXA 5FKCA 1R1A2 3VZOA 2HEYF 2Z4FA 3AVSA 1C5IA 1LOBA 5EJZB 1AXZA 5JZGB 3S0MA 3C7GA 2C26A 3V0AB 4QM8A 1H9PA 1JZ5A 4COZA 3VZNA 5EZWA 5H9SA 4EN8B 3ZYGA 4GJZA 3KB5A 3ASIA 1RUE2 3H50A 5JI7A 5F9TA 2A6VA 1G6NA 1BEV2 2V4AA 5DAXA 5A3UA 2PHWA 1V9U2 5FO9B 1ZVFA 2VZUA 2ZZQA 3UJQA 1FPN2 1K5JA 4I3PA 3VHOA 1GQGA 1HN1A 4UW3A 3IM0A 2EIEA 4OHYA 5LRSA 3GXUA 2FCTA 1PIV3 1TE1B 3E5XA 4CDWA 5JOXA 2ZKLA 2GNDA 1VLNA 1CAUA 2HYXA 4CEWA 3WSOA 2C24A 2L9LA 3AMPA 1O3SA 4FPJA 4CDUC 1GUIA 2LRPA 3VBFA 5FPBA 4BK5A 3I2OA 4K9SA 1C28A 4CEYC 3MLLA 2WWJA 1VB2A 4COYA 2KR2A 4Q4X1 1GMMA 3S6PA 3RZJA 3VDBA 5DAVA 2VMDA 3B5LB 2OZ6A 1NCQC 2C5DA 3DYPA 3ZYPA 2WAAA 2JECA 2OPKA 4L99A 1TMF3 2XJTA 2VZRA 4XF1A 1WD4A 3S5QA 4ORFA 5CADA 5FUPA 1JYCA 1Y43B 2QFEA 1VP6A 4QPIC 3HBZA 2RDNA 1DQ0A 1R083 2JG8B 2Z42A 3R0RA 5E6HA 4YZ1A 3ZFEC 5J48A 1H6XA 2ET7A 2AEYA 1OF4A 1O5UA 1SZBA 4YFWA 5FREA 4XBLA 5A32A 3OYWB 2V72A 4QM9A 1Q8QA 3I3DA 4QKDA 3WNMA 1UPSA 3PUHA 3U1XA 1ZBE1 1AYM3 3N4MA 1CAUB 1OMIA 2DTWA 5EYYA 2GP3A 4LT5A 1NE4A 5D8AB 3MLKA 2Y6GA 5J36A 3J4UH 3RMXA 1TMF1 1Y9GA 3H42B 1S2KA 1YQ6A 1QQP2 2A1XA 2ZS6B 4IGOA 2X53S 1NZCA 2OUHA 2Y0OA 1N1YA 4QQHA 5DG1A 5GZEA 1CZVA 1TME1 1WMXA 2WT1A 4FPFA 4XXAA 1RINA 3ES4A 4A41A 2D6PA 4PCRA 4M4PA 3WT3A 4HFSA 1M06G 3KF3A 1OH3A 1ZZBA 1SCSA 4YNIA 5C8CB 4NHKA 3IPVB 2R041 4UI9L 5F3GA 4BQXA 4JGZC 3HOBA 2FHRA 2K2SA 3EQEA 3AVRA 2ARAA 1RXFA 5ACA2 4I0BA 3TAYA 4QKBA 1XQNA 4MGTA 2IVIB 1R093 1NCRC 3BCWA 4EWAA 1Q8VA 1AYM2 1Q56A 2QNKA 4QPGB 4CPBA 4NIHA 4L11A 1LHWA 2NM1A 4FPLA 1PGL2 4AK3A 4UFLA 4NIIA 3HT1A 3W5NA 3T30A 5LCWL 3APBA 3VBSC 3HT2A 1UD1A 4EQVA 3N9QA 5FJHA 1HV0A 1LECA 2OVUA 1CZTA 1X33A 3K2OA 4AQSA 3MGUA 4EN0A 3AKPA 3WF0A 4MLOA 5JOZA 1UZZA 4YARA 4Y22B 4FP2A 5CAZA 1JYVA 5FZKA 1VAKA 2IFRA 5JI9A 1WCUA 1AR71 3WF4A 3JB8A 3MFAA 4I2OA 2A71A 2F6BA 2J1SA 1UZYA 4QGNA 1W9TA 4XYXA 5I93A 3OTFA 5JSRA 2VTXA 1ND3B 4Q4V3 4YG6A 5DUVA 3T4HB 4H2AA 3UGFA 3BKZA 5C3OA 1RVF2 5L7OB 4GXLA 1ZYBA 4XIOA 4QX3A 2LW8A 1ZRFA 4N43A 3K3NA 1ND3A 2ID4A 2RR13 4LBOA 2D6NA 1OQEA 4ARYA 5LEJA 4J1WA 3IB3A 4W50A 2GMMA 3TRSB 3GYDA 2X09A 2VM9A 4IE5A 1QQP1 3MF9A 4IV1C 2Q0AA 4C91A 5TSWA 2P5BA 1QJX1 1JZ4A 3I2GA 1W8TA 2HWC1 4PBOA 3RVHA 4I0AA 4BM8A 4QQ2A 4N90A 4JHZA 3RZKA 2R062 3ZN4A 2P3YA 1KDMA 2WFF3 4NAMA 4CCMA 1WD3A 5FZBA 3M4FA 4XQDA 3NSTA 3R6SA 1TMF2 1LTEA 2CSGA 2BNMA 2BQPA 3I2DA 1DU3D 2ZHMA 3ABZA 2ZGSA 5JXIA 2HLEA 3AKSA 4K8FA 4KWKA 1ZBA3 3UESA 5DAPA 2WS93 4LJHA 4B29A 2G19A 2VY0A 3A21A 3WEZA 4M0HA 3VZMA 4OUEA 1JYXA 1D4M2 4RHV1 3UKVA 2GSYA 1S0EA 1VBC3 2IXCA 5CFDB 1MQTA 3WV6A 4DXSA 1V9U3 5DN2A 4IV1B 4JGYB 1HDKA 4U36A 5ACA1 1AR91 3HBKA 1JMUB 2PMWB 3F2ZA 4LKSA 5LY2A 3WNXA 4ZKTB 5J1XA 3MUY1 3OBRA 4M4RA 2MNGA 2WLQA 4NROA 1UOFA 1XU1A 5BUVA 1OXCA 3WF3A 3NW4A 1MS3A 1S0GA 1DG6A 3JBG2 2ZEZA 5CYYA 4LKDA 3OYWA 3OB8A 1SLCA 3MIEA 1PGL1 3NKGA 3WF2A 5SV5A 3T1LA 1KJRA 1RXGA 3DECA 4BYYA 3H8UA 1WA4A 2K46A 5LBBA 4EZHA 4ZPIA 2EICA 4XUPA 1W2OA 3KQRA 1RVF1 3WZ1A 5JOYA 3NQHA 5K4LA 5A32B 5KHJA 2PFWA 4X6RB 4UOJA 3T08A 2NN8A 3GHMA 4DNYA 4QB1A 2BGPA 3ZXGA 1L7LA 4UYBA 3KT4A 2W1QA 1OA2A 1T6GC 2XUMA 2YYOA 1LB2A 5L7OC 1AR72 4XUTA 1JH5A 1WW4A 1ENXA 3KHCA 3A4UA 2WO1A 1FOD3 1QJX2 1X9TA 3OSDA 4FI9A 5BNNC 3AP9A 4XF9A 3GZEA 3ZYHA 3OF1A 1C3HA 2RM21 5L9BA 3VBFB 2R1DA 4FO9A 4OHZA 3VBOC 4CCCA 5LWBA 1BCXA 2CDPA 4LO5B 3SNMA 4AW7A 1JODA 5FP8A 4GMP3 2HBTA 2LALA 3LEGA 5C3SA 3CIHA 1CWPA 4LOSA 2RMU3 5IFPA 2BGOA 2QCSB 3ETQA 2AH2A 2AACA 2XJPA 5C3PA 3VBSB 1F2NA 1DZQA 1EV11 2R1BA 3V0BB 3AZVA 4HMZA 2VTFA 3FBYA 1W90A 1QWRA 1CIYA 5HV4A 4LKFA 5E8AA 1X36A 2JD4A 3ZR5A 3RSJA 2O14A 5L19A 4HONA 3VKFC 4BZ4A 3HQRA 5FUIA 3SMHA 5A3PA 3CHXA 3G7DA 2WBKA 3WG1A 3ZXDA 2VOVA 2DBIA 4DXTA 2Z5WA 3T2PA 2WNEA 4NIDA 3WG3A 1EAH1 2ZGRA 3RNSA 2FDFA 3D5OA 3RYPA 4IESA 4UT5A 5I0TA 5C8CC 4WZFA 2D98A 4RHV2 3O14A 4JDNA 1SACA 2XQRA 4S2GA 1TQ5A 5JZGA 4OQ8A 4CEWB 2EXKA 2F4LA 2VCMA 2NMNA 4ISRA 4B3NA 5T52A 3PTYA 4QX0A 3ZFEA 5HV0A 3FFQA 1HB4A 3J7LA 4KMQA 1CX4A 5FP9A 1U5XA 2EIDA 3T2OA 2DVGA 3WP3A 3A0NA 2DTYA 2BWAA 5IUQA 3ZM8A 4Q4Y1 1YC61 4ES9A 2WC2A 3ZFFA 3D6EA 2JDUA 4G3YC 5LK5A 3I3BA 3JBG1 1NCQB 4E4SA 2VUCA 1UY1A 5J37A 2WT2A 1XNKA 4OFGA 1LHOA 2EAAA 2O1QA 1CAVB 4P02B 1N1SA 4LBJA 1WCKA 4MG2A 3HEIA 4LK7A 4XPVA 2PLV1 4M3CF 3VGIA 5T50A 2WT0A 4XJ8A 2HWD2 5IVBA 4E4DX 2PAKA 3MPPG 2BOIA 2A3WA 1W6OB 5JXJA 2X29A 1SBDA 1Q3EA 3H1YA 5EHDA 5FZMA 1RYYA 4M00A 3WQ0A 1H0BA 1R082 1F5FA 4AFCA 4Z1VA 2C1FA 4CP1A 5CFCC 4R4ZA 4BQYA 3BU7A 4QU2A 2R30A 1VBA3 3WP4A 3WG2A 2V5YA 1XNBA 1YJLA 4B7KA 4AZZA 4XC9A 2YFZA 4Q1RA 4HPKB 2RM22 3RWNA 1S0CA 2A73B 2E33A 1RMU1 2RMU1 2WWUA 2CGNA 3IDAA 3NVCA 1CAWB 3ZXKA 2AGSA 2HWE2 4GMP1 5LA2A 4IEYA 4MGYE 4RQPC 2DBNA 2XJUA 5E16A 5FQ0B 1V70A 1U5IA 3VD5A 1W6MA 4GZ9A 1UX6A 2VZ3A 1HRI3 1WLWA 3AMMA 3MIHA 3TB0A 2RS53 3UV9A 3J8F1 3AZXA 1UOBA 4B7EA 5FZ4A 3VB9A 4CCKA 1ZBA2 2XJSA 2B7YA 2FMDA 3N36A 5LA9A 5DDJ1 1C1LA 2IZWA 1Q5OA 2FZ1A 5FXXA 3POFA 4CXWA 5FZ0A 4BA6A 4FAHA 1PHMA 4Q26A 2YHJA 3MW4A 3OPWA 4AEDB 4CDWC 3RZHA 1JHJA 5F8PA 3O1TA 2HEWF 1LEMA 3MIGA 5FK8A 3S30A 3WDTA 4HG6B 4BE3A 2Z69A 5C8WA 1OPOA 2BDRA 3B00A 5FYTA 4XF3A 3U10A 3DF0A 1DYPA 2G1MA 3CKHA 4KWUA 4Y20B 1IGOA 1S1AA 2PHFA 4YVSA 4CDXC 2A75A 4YZ5A 4C8DA 1REDA 4J25A 4V1PA 4FBFA 1FYUA 1ENQA 1OBNA 2E6VA 3CZUA 1DHKB 5F3CA 1OUXA 5FLHA 3SKVA 4DXZA 1LOGA 1W6PB 2PXJA 2XL9A 4XQ4A 1K5MB 1AL23 1JZ6A 2PLV2 5FMBA 4GH4C 1HXS2 1I5PA 2PQQA 2JEMA 4NRPA 1FV3A 1ONAA 2YC4A 4GB32 4PIYA 4AAPA 5DMYA 4OYUA 2XKPA 4QDQA 4DIQA 5F1RA 5GZCA 3J7NA 5CU1A 1HRV3 1O4YA 3POJA 4BQ1A 1N1VA 3OBTA 1WCQA 2Q5TA 3EB7A 3GF6A 4EZ4A 5FPAA 3ZXJA 4EE2A 2Y64A 1H2NA 4Y5SA 4HKOA 4RS5A 2ZGOA 2X5IB 3C7HA 4CDXB 4UWDA 1ZRCA 4LA3A 1W9FA 2VUDA 4N53A 5J98B 3VBUA 4PLMA 3VBRA 3VBRC 3BOPA 3P3PA 3PUAA 3CLPA 1RMU2 3ZYFA 4Y5TA 1ZZ7A 2ZX2A 2BBAA 1F5JA 3FUQA 4LUMA 2BU9A 2WDBA 2IVJA 1IZ3A 4KBBA 3TEYA 1YQ8A 1ZZCA 3N3HA 4IV3A 5K0UB 4IEOA 3VZJA 4P14A 5CIRA 1VBC2 1DQ5A 2WA4A 3AKRA 1NG0A 1JXNA 1UZ0A 2HWC3 4O61A 1SQ4A 3JU9A 3PVOA 4Q29A 5HXVA 5LK7B 4IDZA 2VE1A 3SLIA 2XB6C 1Q8OA 2DVBA 4LBQB 5BNPB 1A3KA 1NOVA 1S2EA 4YM2A 5KWRA 4AQ6A 4AI8A 1AR81 4LK6A 1U0AA 1VAVA 1UX7A 3ZSLA 3PU3A 1S2BA 2D5HA 2YB7A 1PO12 3U4SA 4FSJA 1CR7A 2DVDA 1XE7A 4FPHA 3OUHA 3C3VA 1H2MA 2R063 1OLQA 3NO8A 1YHFA 2WUHA 4K1ZA 5C9AB 2W2IA 1MACA 4DINB 5A6ZA 3IT8A 1VJ2A 2DCTA 4PJYA 5FP3A 1OOPB 1I5ZA 3W20A 5I8YA 1VBA2 3IDEA 4X8NA 4BQ2A 4NRQA 2P6HA 3I2FA 1JOPA 2W9XA 2WFF2 2DVAA 5IHRA 5JLVA 3ECQA 1ASJ1 4M3CE 3VZKA 1AJKA 1UCXA 3HN3A 1ODNA 1GZWB 1RUD2 2DCKA 4OULA 2ZGUA 2ZX3A 2B39A 3I3MA 2ATFA 2BYVE 5F5AA 4LO6B 3B94A 1S0JA 3HMYA 5FK7A 4CCLA 1QF3A 4XF0A 3BTZA 2VCCA 2YDEA 3MO4A 4GALA 4ZY9A 1RUF1 3WXPA 1D0GA 3FHQA 1ULDA 4Z92B 2JWPA 5A80A 1D2SA 2DUPA 2FQPA 1O59A 4O7XA 5EJ3A 4GQ7A 3USUB 2VU9A 4N7IA 1Z7S3 1XB9A 3GGLA 4P08A 3RS6A 4BOWA 3LB9A 5L7OA 1OA4A 1HXS1 1VAMA 3DCQA 5HI0A 4HANA 1PMHX 1I9RA 4W6WA 4Y4RA 3M3CA 1QJY1 3FL7A 2TBVA 4XOGA 1CJPA 3R4UA 5FMCA 1BMV2 1WMEA 3H9AA 2MEV2 2Y33A 1WCDJ 5IK7A 3RI9A 1RTVA 3IZOA 3QACA 3ZXAC 3P6BA 1BHGA 1PX3A 2VVEA 2QQVA 2VZ1A 5E1RA 4NIAA 3WCRA 5FYYA 4XFIA 3I59A 1IKPA 3OEAA 1UU5A 2ZEXA 4LMFA 3EXUA 5E89A 5DDJ3 1MVQA 2DV9A 2YPDA 4WM8C 4HKLA 1WWYA 3VHPA 4COVA 2W68A 2RHPA 5AVAA 4I01A 2YUEA 4CU7A 5A7NA 4YW7A 3NAPC 3FHAA 4Q5OA 2RS51 3I7DA 1W6QA 1ZBE3 5DABA 4OUMA 4ZS3A 3DPRB 5K9YA 3NWKA 1JBCA 4JKMA 5LA0A 1OD5A 2FDJA 4NHMA 3LIGA 1QJU2 3WP6A 1W6OA 3FN9A 4GMP0 4QX5A 4W6YA 3CJIC 5IW0A 5FO8B 1CAXB 3EO6A 1T2XA 2HWF1 3D0SA 4Q4W3 4PLNA 4COUA 1AJOA 1HN0A 2RS32 4YVWC 4Z2WA 1B35B 2FDIA 1JN2P 4KNCA 2RJ2A 4AL9A 4CDUA 1AR82 4HZFA 2NPIA 2WZEA 1A8DA 3HNBM 4AI2A 3V65A 1YFXA 1UIKA 3POBA 1IPSA 4CCDA 5K7PA 4C1WA 1F4AA 1E57A 3GZTB 1OC1A 1Z0HA 3INAA 5DUWA 1HRI2 2EALA 5FZEA 4NHLA 3DEMA 2ZMLA 3POWA 4DB5A 1FXZA 5EIYB 4NJ4A 2QQLA 3LSDA 1RUF2 4FFGA 3R4DB 2ZGTA 4KU7A 3T1MA 4N7UA 4QPGA 2JJ6A 1DLCA 3FLRA 5IFTA 2PLV3 3WX5A 1RHI1 1UW8A 4L97A 3DYOA 1WW6A 2BFUS 2DVFA 4YWAA 4DFSA 4FFIA 4OI2A 2PHTA 3NNFA 5IK4A 3A22A 2P4EA 3OUIA 2CY6A 2ORZA 5KXEA 3FWEA 5GKAC 3MW3A 2ZOEB 1PIV1 2I45A 4AEDC 1EUTA 2DURA 4GJYA 2IUWA 4UFIA 5CB7A 4L0PA 2A70A 3I8TA 3AP5A 5A3LA 4C1XA 4U2AA 3RYRA 5FYBA 2R0HA 2E32A 2D97A 1RUI1 1RJ7A 2RS11 3EHKA 4FPCA 4JRLA 5FCCA 4DXRA 3WW2A 1LENA 5EYXA 5IYYA 2R6QA 3CEWA 1RUNA 1CN1A 2HWD3 4CU8A 2ARXA 2B8MA 5FLIA 1Q43A 1J58A 2KXLA 5G04L 2DFCA 1NZIA 1VE0A 3IN9A 4BHPA 3VUOA 1COV3 3ZOIA 4LLOA 2P2KA 3ZIWA 3C7OA 4D8MA 3BI3A 5T5JA 2EXJA 2J1VA 2BOJA 1X50A 3I4IA 3VHNA 1HLCA 2WLPA 1RL3A 1V6OA 1RHI3 5A7WB 4XDOA 1WW7A 5IVYA 1CIWA 3ZSKA 1D2QA 5KHKA 2BV4A 4JTNA 1JZ8A 1BVVA 3KHBA 4Y1XA 5BNOA 1XYPA 4GULA 4XIKA 2X10A 2BGCA 2XHKA 3IIAA 4QX7A 4PHZA 2HWF2 5C3RA 1DYOA 5CG9A 4AI3A 3AZZA 1PZ8A 1UIJA 3NNMA 4LQRA 2PA7A 2XJRA 3HQUA 3WP5A 3I2HA 2XXZA 3WNOA 3BODA 4XURA 1GOGA 1VBD2 4LITA 3MIBA 3KF5A 4HL0A 4E2GA 4IE0A 1RB8G 1SDWA 2Q8OA 2RS52 3S57A 1LODA 3Q8AA 5L73A 1SLAA 1R64A 2G9ZA 4W8JA 3AP6A 2A6WA 5L9VA 1YWKA 2ORXA 2C0ZA 4B1MA 1SLIA 2VZQA 2ZX4A 1W6MB 3PUQA 3WVJA 4AQTA 3WD5A 1W8UA 3U4XA 4YVSB 1QJZA 3Q8FA 4W65A 1SHWB 2CDOA 5IAVA 2B42B 2RM23 4RGGA 4D6SA 5FZCA 3O1OA 1DIWA 1RHI2 4E2SA 1SDDB 3CU7A 1G7YA 1YQ5A 5APAA 5D1IA 4C0BA 4DMIA 3QH7A 2MHFA 5EWSA 2YC0A 1ENSA 2R072 4O9EA 2RR12 1YFYA 4HKWA 3TEZA 1O3TA 4OMCA 2VNGA 1GNYA 4BMBA 3CL1A 4CEWC 1J1LA 4F83A 1G9AA 2ZGNA 3O7OA 2D93A 4FPOB 5AC93 1I3HA 2Q1FA 4BQ3A 4XFAA 4MXWB 2AEZA 2QQIA 2ZGMA 2VNRA 1HQNA 5CNAA 2QZ2A 4W4ZA 3N7LA 1FI2A 3MICA 4Q4X2 4RGAA 2ZEYA 1JHNA 1UU4A 1PZ7A 2JG9A 4WZCA 1N3QA 5DZEA 4IEUA 5FZOB 4XABA 2VMFA 4E8DA 2YMZA 5DUXA 1IS3A 1F9KA 1QJY3 3D82A 3J7HA 4JDMA 2B9VA 4NE9A 3WF1A 1K3IA 1S0DA 3LWCA 1W3VA 3AP7A 3LDRA 3N35A 3QOPA 3WR0A 1G9FA 3TWIA 1QDCA 2ZTNA 1YIPA 4BMEA 2N7GA 2Y6LA 4AI1A 1N3PA 1B35C 1UXZA 1V6MA 1YJKA 2QQMA 4RN5A 4TYSA 1OKQA 4YVWB 5LRRA 5L36A 1RUI2 2H0VA 2RS12 2HEVF 4QAWA 4YW3A 5A7QA 1W8ZA 5KBFA 1RUF3 5ABJC 5CKNA 5J96B 3OPTA 3SKJE 5ACA3 1HRV2 5FZGA 1C8M1 1AR61 4P5YA 1H30A 1V6JA 2RE9A 1UN1A 3RYKA 2XJVA 3ZFGA 2KD7A 4N8MA 2K9ZA 3POSA 2GMEA 3NNLA 4XBQA 4WM7C 3NJYA 2GH2A 3V64A 2D3PA 2Q1MA 4CDQA 1WMFA 1O4ZA 2DCZA 4JTOA 5FY9A 2ZBJA 4DQAA 3E97A 3OGJA 3VKNA 1ALYA 1DP0A 3LOIA 4WM8B 2Q8CA 3VBOB 1AYN2 2JG9B 1REEA 1MZ6A 1GOHA 4WVMA 2A6XA 2VMHA 3RPQA 2VQ0A 1TME2 2BVVA 2WKKA 1R1ZA 4CCNA 4AVTA 1BJQA 2AREA 2WYSA 3JZVA 2ZHLA 4R9AA 1FX5A 1W2UA 1YXWA 4AHYA 1WW5A 5B2GB 4N43B 1NE6A 4HVRA 3JCIA 5FOJB 2PHXA 3H3UA 5JR7B 4HK9A 2IC1A 2YGMA 4L2NA 2W95A 1NQDA 4P9GA 1CZSA 2XH6A 2JDZA 4Z07A 1ZX5A 3M3QA 4IEQA 4UAPA 5FO7B 3WDXA 3L2YA 1AR83 1KFXL 1RGSA 2R071 3O12A 1QQP3 3PUIA 2FZ2A 2UURA 1JUIA 1NA1A 4I0WB 5FFOC 1QIQA 1AXKA 2R073 4FPKA 4YVSC 2XBO3 4AEMA 2B46X 4BQ5A 4CPBD 3O0WA 3O5SA 3TEXA 4HSLA 4LXLA 1UMIA 1D4M3 4PI0A 2PTMA 2JG8C 1NX9A 1IS5A 4ZHNA 1LU1A 4KGQA 5GLWA 5LBCA 4XBNA 2JE8A 3I3QA 5I8TA 2C4XA 3K77A 1XBFA 5F5CA 2LM3A 5LATA 1AHSA 1VBD3 2JDNA 4EWEA 5T54A 3U78A 5C6CA 1XYOA 4R9BA 2ZAAA 3M8LA 3MIDA 4Q8LA 1IPJA 3ZIXA 2I74A 4D0QA 4JGYC 1S0BA 2W3JA 3HAGA 5CFDC 3LEIA 2VBPA 1OFNA 3PLQA 1L7RA 1UY3A 4NPMA 2W92A 2VGDA 2XLAA 2EIBA 4GD4A 3ZMOA 1LESA 1C57A 1PVC3 1NLRA 3ILFA 4CUCA 1AR63 1HRV1 3AXDA 4CUAA 1OVSA 4IETA 4H7MA 3C8XA 1GP5A 4JQTA 4KBZA 3TYJA 1VBB3 3BUCA 1BK1A 3KMHA 2EIGA 5M0TA 3RFRA 1COV2 4S2FA 4PQQA 4Q27A 2Y6HA 2ILMA 1YO8A 4YRDA 3BTYA 5BNPC 1H8TC 3DKWA 3NV2A 3ZYIB 3H1MA 5BXXA 2R0FA 4QQOA 2BUKA 1AUYA 4G4FA 3LPFA 5FV3A 2LS6A 5F6KA 4BPZA 2JDPA 1URXA 2PYTA 2Z2SB 2LROA 2ZGLA 5C70A 4ISQA 2A3YA 4OZOA 5EV7A 5J7MA 5IVEA 2G4IA 3MV01 1KQRA 1SPPB 1B35A 1GZTA 2B45X 2Y60A 4LR4A 4LUKA 4RS5B 1OLMA 5BNOC 3WOGA 4NOTA 1RJ8A 3U0ZA 1CAXA 2WO3A 4BXFA 3Q8BA 1UY0A 1DDLA 1XXNA 3VBRB 4AXOA 3BOWA 1GP6A 1W8HA 4XCBA 4CDXA 5FOBB 1OKOA 4Q4W2 4AVBA 1LNSA 1QHDA 5F5QA 3MZHA 3DXTA 3J8F3 4PDWA 1VMFA 3BU0A 3OJBA 1XC6A 1YUDA 2QQJA 4ZXKA 2W91A 1MQTC 1VPHA 2GDFA 2XR4A 1AR92 1PX4A 1SPPA 2Y34A 3AYDA 2VUAA 3UKTA 2PELA 2E53A 3ZPYA 1V0AA 5ISLA 2XPJA 2I07B 5K0UA 3GBGA 3AK0A 4JGYA 1LJ7A 2VOWA 3JBG3 3VKOA 2BPA2 1UXXX 2OPWA 3FZ3A 4C0HA 2XLGA 4Q4Y3 1PM4A 3LSEA 3WQBA 2VNVA 5C4WB 3IWZA 4LTAA 4Y24A 2DCYA 1RUI3 2RS13 4PIXA 4Y20A 2OYZA 5HXMA 4QPGC 1SFYA 4CP9B 2JDKA 1PK6C 4FPGA 5AVPA 5A33A 3DPRC 3VL8A 3WINE 3IMMA 4TLFA 1NCRB 2VZSA 3B01A 3MFCA 3NAPB 4HN0A 1PVC2 4AGGA 4ET7A 2GZWA 4D7YA 5EP9A 1KS5A 1NLQA 3H8OA 1Q8PA 4PF1A 3WNKA 1DQ1A 1ZNPA 1VRBA 1GP4A 4CU9A 2WSUA 1W9YA 2Q4SA 3PUSA 2SLIA 2NYYA 1OQ1A 1GZWA 3K3OA 5IK8A 1H8TB 4OHVA 2ADDA 3WDYA 1FATA 4FAGA 1OSGA 1ZBE2 1QY4A 1H8TA 4CUBA 1IQAA 4K8RB 4QMAA 3PNAA 2LTNA 4Q8KA 2CL2A 4N9IA 3TOJA 4NIGA 4BJ0A 1ZZ6A 4TTGA 4BLJA 5DXDA 1ND2B 5I0DA 5FUNA 4NHXA 4BXSV 3RGBA 1RUC3 3CMGA 4AI9A 1BZWA 4COWA 5A3TA 3OOXA 3S5AA 2HWF3 4Q4W1 4CZSA 2C9AA 3UNPA 1VBE1 4PBPA 5C7GA 3KS7A 2FCUA 5HCFA 2DU0A 1G8WA 1NT0A 2R042 4P9IA 5DG2A 2MEV3 4FVVA 4E9KA 5F6LB 5CFCB 3N9PA 1O4TA 5CA6A 5FYCA 4P9XA 1W28A 4ZONA 2QE3A 3PTRB 2Y6JA 3ES1A 3NMBA 1VBB2 5H9QA 3T2QA 1BQPA 1O3QA 5A6YA 1A8MA 3OGRA 5C8CA 3PMEA 3OUJA 1GFF2 2VOTA 2YZ4A 4RYDA 1PM7A 5A3NA 2W1WA 3VBOA 4AFMA 4XCAA 2OIIA 4AEKA 3BYWA 3VLBB 1EAH2 1ULFA 3CF6E 4X8PA 2JIJA 2WAOA 1UY4A 4YGCA 5FPUA 3ALQA 4IE7A 1EV13 1FPN3 4NN0A 1NYWA 3H8RA 4XMIA 2GC3A 1VRH1 5A1AA 3OCPA 2P6CA 5T5LA 3X29B 3RJRA 2WWSA 3MHZA 4URTA 5JIAA 5KHGA 4XACA 3IMNA 1SFPA 4UW6A 1UYZA 3SH5A 4LBKA 4I30A 4TSVA 3KV5A 4D94A 2VXRA 3KT1A 3M2MA 1AL0G 4LULA 2X05A 2RDRA 5DUUA 2GC0A 3WUCA 5FZIA 1PVXA 1V6KA 2J1UA 3O1SA 1CESA 4K1YA 5I0SA 1TG7A 4YVWA 5FZ7A 1J84A 4S2HA 2WQ4A 5B4NA 4Q1PA 3P1IA 1FAYA 1XE0A 2OZJA 1JI6A 1UMHA 3AX4A 5C3QA 2VOKA 4PLOA 5DQ0A 1PVC1 1X8MA 1LOFC 1S0IA 2OA2A 1MR5A 3ITQA 1SLBA 2O8OA 3M70A 3K4ZA 3V0BA 4JV4A 1RVF3 3CQOA 1O6UA 2V4VA 5F7UA 1ENRA 4PF5A 3H3LA 1WA6X 4YW2A 4XJWA 1US2A 1NKGA 1W0OA 1YQ2A 3B69A 5A1FA 3UGGA 5EFUA 2WZR1
chains in the Genus database with same CATH topology
3GGLA 4P08A 2ZXQA 2HYXA 3MBWA 1PMHX 2L9LA 3NRUA 3WSOA 1GUIA 3FL7A 4BK5A 4QX2A 1KEXA 5C71A 4GWJA 4ARXA 1GMMA 3VDBA 2VMDA 3P6BA 4MGQA 1BHGA 1PX3A 2VZ1A 3DYPA 4QB6A 2WAAA 2VZPA 3OEAA 2ZEXA 2WO2A 4ZXEA 2VZRA 2VQTA 3I3EA 4CU7A 3FHAA 1H6XA 3JXSA 4DUWA 1OF4A 2C9KA 4JKMA 5LA0A 3T0AA 2V72A 3WNMA 3I3DA 1JYWA 3FN9A 3PUHA 3E1F1 1GOFA 1T2XA 2VMCA 1EUUA 4Z2AA 2Y6GA 2RJ2A 2WABA 2XHNA 2WZEA 3HNBM 4DUXA 1F4AA 1CZVA 3VDAA 1IQDC 4A41A 1W0NA 4M4PA 3I2KA 5DPNA 4UI9L 1UYYA 5EIYB 3HOBA 2QQLA 1NAEA 3BN6A 2W94A 1OH4A 3BGAA 1DLCA 5IFTA 4A6OA 3DYOA 3LQCA 3A22A 1UY2A 2ORZA 4A44A 4TXWA 3EYPA 4MGSA 2QQOA 1EUTA 5G05L 4L0PA 3OGVA 4XUQA 3W5NA 2E32A 4XUNA 5LCWL 1XPWA 4GWIA 4DXRA 5JUVA 3LE0A 1UWWA 2VO5A 2E31A 1H6YA 5IYYA 1CZTA 2XOMA 3ETPA 4CU8A 5IJRA 4CU6A 5G04L 3WF0A 2VR4A 5B4XA 4D8MA 3C7OA 1JYVA 3WF4A 4LPLA 2J1VA 2J1SA 1W9TA 1JZ8A 2X10A 1O8SA 4QX3A 2LW8A 4A42A 2ID4A 4ARYA 1DYOA 2W1UA 2VZOA 3CZJA 4LQRA 1US3A 3K4DA 3IB3A 3I2HA 4W50A 4XVHA 4PT6A 3WNOA 2X09A 2VM9A 1GOGA 4XURA 2VL4A 1K42A 1OT5A 3ACGA 2WQ8A 2YFUA 1JZ4A 4W8JA 1R64A 2BZDA 1ULPA 3I2GA 2ORXA 3LEKA 2VZQA 2YG0A 4JHZA 3I2IA 1SHWB 2CDOA 1O8PA 1SDDB 3C7FA 3ABZA 3MV11 2XONA 5JXIA 2JD9A 2HLEA 3UESA 1PMJX 3A21A 3WEZA 1OD3A 2VZTA 2R7EB 4OMCA 4OUEA 1JYXA 1GNYA 1K45A 4JKKA 4DXSA 2V5DA 4CVUA 5DN2A 2QQIA 4DEVA 4W4ZA 2ZEYA 3F2ZA 4LKSA 4ZZ5A 5J1XA 3MUY1 5HPOA 4M4RA 2VMFA 4E8DA 3WF3A 3J7HA 2VC9A 2B9VA 4OMDA 3WF1A 3T0DA 1K3IA 2ZEZA 5CYYA 3ACIA 3OB8A 1XNTA 4MADA 2RV9A 2Y6LA 2QQMA 3WF2A 1UXZA 3DECA 4RN5A 4QAWA 2EICA 4XUPA 3NQHA 3SKJE 2W1SA 4DEQA 4UOJA 3T08A 3WNLA 4P5YA 4QB1A 2BGPA 4A4AA 1ULOA 2KD7A 2W1QA 2VCBA 1JZ7A 3HNMA 3THDA 4A3ZA 4XUTA 2XQXA 1JZ2A 1DP0A 2Y8KA 2WO1A 4FI9A 4YPJA 1GOHA 3NNGA 1OF3A 1JZ3A 2QQNA 3C7EA 2WYSA 2CDPA 5JXGA 1JU4A 1W8OA 5EJ1B 2J1AA 4E8CA 3UETA 3OEBA 2W5FA 3LEGA 2W95A 1W8NA 3CIHA 1CZSA 5IFPA 2BGOA 4UAPA 3SEEA 3LPGA 2VZVA 1K12A 3PUIA 3NJXA 3VDCA 2VTFA 1CIYA 2B4KA 3WNPA 1UMIA 2Y6KA 1NX9A 4MO3M 5FUIA 2DCJA 2JE8A 2BERA 2WBKA 3HPNA 2C4XA 3DYMA 3K77A 4QX1A 2J1TA 4DXTA 3T2PA 4JKLA 1UYXA 3OG2A 5CZKA 5JXHA 4D0QA 2W3JA 3IAPA 3LEIA 5JMOA 3HJRA 1L7RA 1UY3A 2W92A 3IAQA 4QX0A 1SG3A 2EIBA 1NUKA 4CUCA 4KMQA 4CUAA 2EIDA 3SEPA 3T2OA 3C8XA 4QB2A 3ZM8A 3THCA 3I3BA 2J1EA 4IUGA 3IIIA 1UY1A 3AC0A 2WN3A 4PQQA 4QDSA 2Y6HA 3W5MA 1GQPA 2YC2A 4P02B 2VCAA 4QPWA 3HEIA 3LPFA 3VD7A 2LS6A 3VD4A 5C70A 4BK4A 4OZOA 2VQUA 3A7QA 5JXJA 2DDUA 2RVAA 1J83A 1RYYA 3MV01 3T0BA 2WO3A 1UY0A 3VD3A 1F4HA 4KI5M 2W87A 1LNSA 1W9SA 2YFZA 4LHSA 2E33A 3K4AA 3IDAA 1JYNA 3K46A 1XC6A 2QQJA 5LA2A 1GU3A 1MPXA 2W91A 3A23A 2J1RA 1TVGA 2JKXA 3I2JA 2JDAA 1PX4A 2W46A 3VD5A 4GZ9A 3ACHA 2VZ3A 3T09A 1KGYA 3K75B 2J7MA 1UXXX 4BDVB 3D3AA 3WQBA 5HXMA 3OGSA 1JHJA 3OBAA 4DUVA 2VZSA 2PQSA 4HG6B 1JU3A 2QBXA 4KWUA 3CKHA 4ET7A 3GDBA 1WKYA 4PF1A 3WNKA 3CZUA 4QDRA 4CU9A 3SKVA 3HNYM 2VJXA 1JZ6A 1D7PM 1P8JA 1I5PA 2YC4A 4AG4A 5DMYA 4OYUA 4QDQA 4CUBA 4BJ0A 1WCQA 3EB7A 4TTGA 5I0DA 2Y64A 3I97A 4BXSV 3CMGA 3C7HA 4XUOA 3UNPA 5C7GA 2QQKA 2BBAA 5LA1A 4AAXA 4ZZ8A 3MUZ1 2WDBA 2Y6JA 3T2QA 5JR2A 3WNNA 2VMEA 3OGRA 1W99A 2VOTA 2WN2A 4RYDA 2W1WA 1UZ0A 4P00B 3ACFA 1W9WA 2WAOA 2OKXA 1UY4A 3NJVA 2E26A 1L7QA 5A1AA 1UX7A 4MOAA 2YB7A 3VD9A 1XNAA 4JX0A 1UYZA 2WUHA 3U37A 1CX1A 2Z4FA 2X05A 4A45A 5EJZB 2W47A 2J1UA 3C7GA 2C26A 3I2FA 1JZ5A 2W9XA 1TG7A 2J22A 5B4NA 1J84A 5IHRA 3ECQA 3P1IA 1JI6A 1UMHA 3HN3A 4XZUG 3CDZB 5DQ0A 2DCKA 2ZEWA 3GM8A 2VZUA 3K4ZA 2VCCA 3MO4A 4ZY9A 3CQOA 1HN1A 2V4VA 2EIEA 5F7UA 2WZ8A 3FHQA 1O59A 3GXUA 1US2A 1NKGA 1YQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GGL A;  4P08 A;  2ZXQ A;  2HYX A;  3MBW A;  1PMH X;  2L9L A;  3NRU A;  3WSO A;  1GUI A;  3FL7 A;  4BK5 A;  4QX2 A;  1KEX A;  5C71 A;  4GWJ A;  4ARX A;  1GMM A;  3VDB A;  2VMD A;  3P6B A;  4MGQ A;  1BHG A;  1PX3 A;  2VZ1 A;  3DYP A;  4QB6 A;  2WAA A;  2VZP A;  3OEA A;  2ZEX A;  2WO2 A;  4ZXE A;  2VZR A;  2VQT A;  3I3E A;  4CU7 A;  3FHA A;  1H6X A;  3JXS A;  4DUW A;  1OF4 A;  2C9K A;  4JKM A;  5LA0 A;  3T0A A;  2V72 A;  3WNM A;  3I3D A;  1JYW A;  3FN9 A;  3PUH A;  3E1F 1;  1GOF A;  1T2X A;  2VMC A;  1EUU A;  4Z2A A;  2Y6G A;  2RJ2 A;  2WAB A;  2XHN A;  2WZE A;  3HNB M;  4DUX A;  1F4A A;  1CZV A;  3VDA A;  1IQD C;  4A41 A;  1W0N A;  4M4P A;  3I2K A;  5DPN A;  4UI9 L;  1UYY A;  5EIY B;  3HOB A;  2QQL A;  1NAE A;  3BN6 A;  2W94 A;  1OH4 A;  3BGA A;  1DLC A;  5IFT A;  4A6O A;  3DYO A;  3LQC A;  3A22 A;  1UY2 A;  2ORZ A;  4A44 A;  4TXW A;  3EYP A;  4MGS A;  2QQO A;  1EUT A;  5G05 L;  4L0P A;  3OGV A;  4XUQ A;  3W5N A;  2E32 A;  4XUN A;  5LCW L;  1XPW A;  4GWI A;  4DXR A;  5JUV A;  3LE0 A;  1UWW A;  2VO5 A;  2E31 A;  1H6Y A;  5IYY A;  1CZT A;  2XOM A;  3ETP A;  4CU8 A;  5IJR A;  4CU6 A;  5G04 L;  3WF0 A;  2VR4 A;  5B4X A;  4D8M A;  3C7O A;  1JYV A;  3WF4 A;  4LPL A;  2J1V A;  2J1S A;  1W9T A;  1JZ8 A;  2X10 A;  1O8S A;  4QX3 A;  2LW8 A;  4A42 A;  2ID4 A;  4ARY A;  1DYO A;  2W1U A;  2VZO A;  3CZJ A;  4LQR A;  1US3 A;  3K4D A;  3IB3 A;  3I2H A;  4W50 A;  4XVH A;  4PT6 A;  3WNO A;  2X09 A;  2VM9 A;  1GOG A;  4XUR A;  2VL4 A;  1K42 A;  1OT5 A;  3ACG A;  2WQ8 A;  2YFU A;  1JZ4 A;  4W8J A;  1R64 A;  2BZD A;  1ULP A;  3I2G A;  2ORX A;  3LEK A;  2VZQ A;  2YG0 A;  4JHZ A;  3I2I A;  1SHW B;  2CDO A;  1O8P A;  1SDD B;  3C7F A;  3ABZ A;  3MV1 1;  2XON A;  5JXI A;  2JD9 A;  2HLE A;  3UES A;  1PMJ X;  3A21 A;  3WEZ A;  1OD3 A;  2VZT A;  2R7E B;  4OMC A;  4OUE A;  1JYX A;  1GNY A;  1K45 A;  4JKK A;  4DXS A;  2V5D A;  4CVU A;  5DN2 A;  2QQI A;  4DEV A;  4W4Z A;  2ZEY A;  3F2Z A;  4LKS A;  4ZZ5 A;  5J1X A;  3MUY 1;  5HPO A;  4M4R A;  2VMF A;  4E8D A;  3WF3 A;  3J7H A;  2VC9 A;  2B9V A;  4OMD A;  3WF1 A;  3T0D A;  1K3I A;  2ZEZ A;  5CYY A;  3ACI A;  3OB8 A;  1XNT A;  4MAD A;  2RV9 A;  2Y6L A;  2QQM A;  3WF2 A;  1UXZ A;  3DEC A;  4RN5 A;  4QAW A;  2EIC A;  4XUP A;  3NQH A;  3SKJ E;  2W1S A;  4DEQ A;  4UOJ A;  3T08 A;  3WNL A;  4P5Y A;  4QB1 A;  2BGP A;  4A4A A;  1ULO A;  2KD7 A;  2W1Q A;  2VCB A;  1JZ7 A;  3HNM A;  3THD A;  4A3Z A;  4XUT A;  2XQX A;  1JZ2 A;  1DP0 A;  2Y8K A;  2WO1 A;  4FI9 A;  4YPJ A;  1GOH A;  3NNG A;  1OF3 A;  1JZ3 A;  2QQN A;  3C7E A;  2WYS A;  2CDP A;  5JXG A;  1JU4 A;  1W8O A;  5EJ1 B;  2J1A A;  4E8C A;  3UET A;  3OEB A;  2W5F A;  3LEG A;  2W95 A;  1W8N A;  3CIH A;  1CZS A;  5IFP A;  2BGO A;  4UAP A;  3SEE A;  3LPG A;  2VZV A;  1K12 A;  3PUI A;  3NJX A;  3VDC A;  2VTF A;  1CIY A;  2B4K A;  3WNP A;  1UMI A;  2Y6K A;  1NX9 A;  4MO3 M;  5FUI A;  2DCJ A;  2JE8 A;  2BER A;  2WBK A;  3HPN A;  2C4X A;  3DYM A;  3K77 A;  4QX1 A;  2J1T A;  4DXT A;  3T2P A;  4JKL A;  1UYX A;  3OG2 A;  5CZK A;  5JXH A;  4D0Q A;  2W3J A;  3IAP A;  3LEI A;  5JMO A;  3HJR A;  1L7R A;  1UY3 A;  2W92 A;  3IAQ A;  4QX0 A;  1SG3 A;  2EIB A;  1NUK A;  4CUC A;  4KMQ A;  4CUA A;  2EID A;  3SEP A;  3T2O A;  3C8X A;  4QB2 A;  3ZM8 A;  3THC A;  3I3B A;  2J1E A;  4IUG A;  3III A;  1UY1 A;  3AC0 A;  2WN3 A;  4PQQ A;  4QDS A;  2Y6H A;  3W5M A;  1GQP A;  2YC2 A;  4P02 B;  2VCA A;  4QPW A;  3HEI A;  3LPF A;  3VD7 A;  2LS6 A;  3VD4 A;  5C70 A;  4BK4 A;  4OZO A;  2VQU A;  3A7Q A;  5JXJ A;  2DDU A;  2RVA A;  1J83 A;  1RYY A;  3MV0 1;  3T0B A;  2WO3 A;  1UY0 A;  3VD3 A;  1F4H A;  4KI5 M;  2W87 A;  1LNS A;  1W9S A;  2YFZ A;  4LHS A;  2E33 A;  3K4A A;  3IDA A;  1JYN A;  3K46 A;  1XC6 A;  2QQJ A;  5LA2 A;  1GU3 A;  1MPX A;  2W91 A;  3A23 A;  2J1R A;  1TVG A;  2JKX A;  3I2J A;  2JDA A;  1PX4 A;  2W46 A;  3VD5 A;  4GZ9 A;  3ACH A;  2VZ3 A;  3T09 A;  1KGY A;  3K75 B;  2J7M A;  1UXX X;  4BDV B;  3D3A A;  3WQB A;  5HXM A;  3OGS A;  1JHJ A;  3OBA A;  4DUV A;  2VZS A;  2PQS A;  4HG6 B;  1JU3 A;  2QBX A;  4KWU A;  3CKH A;  4ET7 A;  3GDB A;  1WKY A;  4PF1 A;  3WNK A;  3CZU A;  4QDR A;  4CU9 A;  3SKV A;  3HNY M;  2VJX A;  1JZ6 A;  1D7P M;  1P8J A;  1I5P A;  2YC4 A;  4AG4 A;  5DMY A;  4OYU A;  4QDQ A;  4CUB A;  4BJ0 A;  1WCQ A;  3EB7 A;  4TTG A;  5I0D A;  2Y64 A;  3I97 A;  4BXS V;  3CMG A;  3C7H A;  4XUO A;  3UNP A;  5C7G A;  2QQK A;  2BBA A;  5LA1 A;  4AAX A;  4ZZ8 A;  3MUZ 1;  2WDB A;  2Y6J A;  3T2Q A;  5JR2 A;  3WNN A;  2VME A;  3OGR A;  1W99 A;  2VOT A;  2WN2 A;  4RYD A;  2W1W A;  1UZ0 A;  4P00 B;  3ACF A;  1W9W A;  2WAO A;  2OKX A;  1UY4 A;  3NJV A;  2E26 A;  1L7Q A;  5A1A A;  1UX7 A;  4MOA A;  2YB7 A;  3VD9 A;  1XNA A;  4JX0 A;  1UYZ A;  2WUH A;  3U37 A;  1CX1 A;  2Z4F A;  2X05 A;  4A45 A;  5EJZ B;  2W47 A;  2J1U A;  3C7G A;  2C26 A;  3I2F A;  1JZ5 A;  2W9X A;  1TG7 A;  2J22 A;  5B4N A;  1J84 A;  5IHR A;  3ECQ A;  3P1I A;  1JI6 A;  1UMH A;  3HN3 A;  4XZU G;  3CDZ B;  5DQ0 A;  2DCK A;  2ZEW A;  3GM8 A;  2VZU A;  3K4Z A;  2VCC A;  3MO4 A;  4ZY9 A;  3CQO A;  1HN1 A;  2V4V A;  2EIE A;  5F7U A;  2WZ8 A;  3FHQ A;  1O59 A;  3GXU A;  1US2 A;  1NKG A;  1YQ2 A; 
#chains in the Genus database with same CATH topology
 1ZA7 A;  3ZKY A;  4EN9 B;  2PAM A;  2VW1 A;  1RUC 2;  4MX3 A;  4OHX A;  1DGR A;  2QKD A;  1Z7S 1;  3AKQ A;  3IKW A;  2SBA A;  1WBL A;  3DL3 A;  4K7J A;  3K48 A;  2R06 1;  1CVN A;  3SIS A;  3H7J A;  4V2V A;  1Y9Q A;  3KSC A;  4QHB A;  1HV1 A;  2XWJ B;  1FNZ A;  1LHV A;  4ARX A;  1AR9 3;  2ETE A;  5GAL A;  5FMD A;  1RUE 3;  1QMJ A;  1H2K A;  2BW8 A;  5LZ6 A;  3BIW E;  5LY1 A;  5F3E A;  4PDW B;  3HD8 B;  3J8F 2;  4KL1 A;  1JUH A;  1DZT A;  1JOB A;  1VBE 2;  1UNB A;  3LFI A;  2IFW A;  4QQL A;  4ES8 A;  3JD7 2;  1ZBA 1;  2R49 A;  4RSU A;  4XTP A;  3RJ2 X;  1LUL A;  4K3U A;  3I3E A;  3LA3 A;  4TN7 A;  1CGP A;  3WY6 A;  5BYN A;  1WLD A;  2JDY A;  1OI6 A;  2RDS A;  5BNO B;  3FFZ A;  4Q0S A;  3JXS A;  4RS5 C;  4J6G A;  1ZA4 A;  2C9K A;  4EV0 A;  4CDW B;  1AVB A;  3ZFG C;  5A6X A;  2OX0 A;  3AL5 A;  2FDK A;  2BFU L;  1GOF A;  1QH7 A;  4A6S A;  3AJY A;  3ENR A;  4FP3 A;  5ABJ A;  2ADE A;  1EUU A;  3POY A;  1XE8 A;  1LOA A;  1HJG A;  1XYN A;  1KJL A;  1WLT A;  1GBG A;  1ZM1 A;  2PN5 A;  5IWF A;  3GBW A;  3O0X A;  2DUO A;  3PDQ A;  3W9A A;  2VW2 A;  3VDA A;  1W0N A;  4HLT A;  2D6K A;  4F8A A;  3N7M A;  4RQP B;  3ZXL A;  3LEM A;  3O1P A;  5DPN A;  5KC6 A;  5A1L A;  1ST8 A;  1J3Q A;  1AL2 1;  1JS9 A;  2JX9 A;  3HIF A;  2B9U A;  4HBN A;  4WVM B;  5FR3 A;  1NXD 1;  2W94 A;  3ILR A;  5T55 A;  2BVB A;  3UL2 A;  3T4V A;  4A6O A;  3DUI A;  5D2A A;  4ZU4 A;  5BY5 A;  1ZRI A;  4Y3O A;  3LQC A;  4OLL A;  4ONU A;  3ZR6 A;  4IND A;  5LA1 A;  4ERO A;  4FQ4 A;  4A44 A;  4TXW A;  3EYP A;  1V6I A;  1DBN A;  1Z7S 2;  3VKL A;  2QQO A;  5F5I A;  5G05 L;  1PGW 2;  1ND2 A;  2R04 3;  3SXW A;  3VBH B;  3IDB B;  3CJI A;  2WNO A;  4XUQ A;  2WNU C;  4CE8 A;  1QOO A;  5ANQ A;  5AC9 1;  4EJR A;  4Y1Y A;  5FZ8 A;  2WZP P;  2BNO A;  3KT7 A;  3KD4 A;  4PIZ A;  1UWW A;  2VO5 A;  2E31 A;  1ULG A;  2YBK A;  2XOM A;  4BWO A;  2YBS A;  2WZR 2;  1IPK A;  1H8V A;  5IJR A;  1QEX A;  4CU6 A;  2CV6 A;  1MS0 A;  1YQC A;  3ZSE A;  1SLT A;  4KH9 A;  4LNV A;  5B4X A;  4LA2 A;  1OLR A;  3QBQ A;  3NKT A;  2VBB A;  2VMI A;  3LFM A;  4LPL A;  5GLU A;  4BIS A;  3USU A;  3W58 A;  2NLR A;  4IEV A;  3RG0 A;  1OQD A;  1LHU A;  3R05 A;  1Y4W A;  1O91 A;  1UZV A;  3POG A;  4LE4 A;  4MGK E;  3MYX A;  2BBV A;  1G86 A;  1HX6 A;  4YZ3 A;  4NAO A;  1O8S A;  3UK9 A;  1YEW A;  4A42 A;  2E7Q A;  4N43 C;  5EQU A;  1L3J A;  3UYJ A;  2W1U A;  5F2S A;  1WLC A;  4LO8 A;  1FPN 1;  1US3 A;  3K4D A;  1W04 A;  5HCH A;  1VBA 1;  1RIR A;  1AZD A;  3LAG A;  4Q0P A;  4FT8 A;  1BKZ A;  1RUO A;  3VV1 A;  2JG9 C;  2VL4 A;  5IAX A;  1OT5 A;  5FYI A;  2WQ8 A;  4FOY A;  2YFU A;  3VDD A;  4FTB A;  2VUJ A;  1ASJ 2;  5KXC A;  4Q0V A;  3VHR A;  2CNA A;  3PMS A;  1POV 0;  3BTA A;  2UWB A;  3SCH A;  3FE5 A;  1RUD 1;  1CPN A;  4Q4Y 2;  3QH6 A;  4LBL A;  5BV6 A;  1AL2 2;  2D7F A;  3AMH A;  4JAA A;  2CAV A;  1UQX A;  1REF A;  5FY8 A;  3AJZ A;  1W06 A;  1TZO A;  3PVB B;  3THT A;  3WDV A;  4LHK A;  1VBE 3;  3B3Q E;  2AYH A;  3FHI B;  5C5T A;  3ZYB A;  1C4R A;  3NL1 A;  2ZPX A;  2GAU A;  3POI A;  2H0B A;  3CO2 A;  2A6Y A;  4LEJ A;  2JDM A;  1LGB A;  4Q0U A;  3USS A;  1GQH A;  5DAW A;  1YIF A;  2HWD 1;  1OD3 A;  2VZT A;  4XDQ A;  3RMY A;  4BIO A;  5A3M A;  3PIG A;  3I49 A;  4RQP A;  4XZP A;  4AWD A;  3KCY A;  4B4Q A;  3GZA A;  4JKK A;  5JMC A;  2V5D A;  4CVU A;  4DRV A;  4Q2F A;  1GR3 A;  4JGZ B;  4DEV A;  4XW3 A;  3L2H A;  4UBH A;  2VEC A;  5BNP A;  5IT6 A;  4ZZ5 A;  2XLF A;  5HPO A;  3AL6 A;  2NZ9 A;  3LDB A;  1J3R A;  5DZF A;  4UFM A;  3LF7 A;  2Q30 A;  5KXD A;  4QGM A;  4OMD A;  4DOU A;  3T0D A;  3NNJ A;  4YZ4 A;  1PGW 1;  3GAL A;  5D21 A;  1DLL A;  3ACI A;  5FKB A;  1MEC 1;  3OGG A;  3FJS A;  3VZL A;  4AFA A;  3J26 N;  2X8K A;  4KWJ A;  3N7K A;  4HVQ A;  3FLT A;  3M3I A;  4YG0 A;  1QOT A;  1UZW A;  3TNQ A;  4ASK A;  1OA3 A;  2TNF A;  2W1S A;  5FZL A;  1BBT 3;  4XJZ A;  4C90 A;  4S2D A;  4A4A A;  5BPX A;  1ULO A;  4AFD A;  4AHZ A;  4Y1Z A;  3KV9 A;  2XBO 2;  5JVV A;  1JZ7 A;  3HNM A;  1UKG A;  4L8Q A;  4W6X A;  3THD A;  4A3Z A;  5DDJ 2;  5AFB A;  4H14 A;  1F15 A;  5IVV A;  3OBZ A;  4UFH A;  4AVV A;  2UYB A;  2VUL A;  2WNU B;  4CTE A;  2Y8K A;  5BNN A;  5FY5 A;  4L92 A;  3NV3 A;  2H6B A;  1GYK A;  3MIF A;  1DGR N;  4SLI A;  4WVW A;  4YPJ A;  3NNG A;  3N9M A;  1OF3 A;  4QQP A;  3OD4 A;  1EAH 3;  1PO2 1;  1SLL A;  3AYC A;  3C7E A;  4OI1 A;  2ZCW A;  3N7J A;  5EPA A;  4D3W A;  4ZU7 A;  2GH8 A;  3UGH A;  5JXG A;  1JU4 A;  5FWE A;  5CFD A;  1BK0 A;  4MUV A;  4E8C A;  3UET A;  1OOP C;  1DGL A;  3OEB A;  4IEP A;  2ZAB A;  1W8N A;  5CFC A;  4CEY B;  2V09 A;  4IV3 B;  4AED A;  2WL1 A;  1S55 A;  2XDV A;  2DU1 A;  3SEE A;  4ITC A;  2DFB A;  4CDU B;  3ZPO A;  3LPG A;  1XSR A;  5LEK A;  1K12 A;  1POV 1;  2PHU A;  3H1W A;  3VBH C;  1PIV 2;  2VQA A;  4O65 A;  4Y5Z 0;  1OHF A;  5FY1 A;  1PZ9 A;  2CWM A;  2G9F A;  5DAQ A;  4YFZ A;  5KHH A;  1WCS A;  2Y6K A;  1UPI A;  3DGT A;  1EY2 A;  1W6Q B;  2WJS A;  2DF7 A;  4WVV A;  4UW5 A;  1TNR A;  2DCJ A;  3WDU A;  3M3E A;  4L9B A;  2BER A;  3H3Z A;  2G9G A;  2HKX A;  3HPN A;  4WV8 A;  1BEV 3;  3I54 A;  4RA0 A;  4QX1 A;  2J1T A;  3AFG A;  1GKB A;  3AMQ A;  1BVP 1;  5T3N A;  3ZFG B;  4CCE A;  2OQ7 A;  4P9Y A;  5T5P A;  4DRR A;  2C6S A;  1H1I A;  2JDH A;  3OG2 A;  3RZZ A;  3O1V A;  2BWC A;  4O9G A;  1VMJ A;  4XQW A;  1MEC 2;  4UXA A;  4NPL A;  5I0U A;  3IAP A;  3MW2 A;  5JZG C;  2A6Z A;  2WSV A;  4HSJ A;  5JMO A;  1QJU 3;  2VW0 A;  3P5B A;  2GC1 A;  5A3W A;  1YYN A;  3IAQ A;  1EPW A;  1QOS A;  3SQO A;  5KR7 A;  1NUK A;  5J3U A;  1VBC 1;  3LA2 A;  5F3I A;  4N53 C;  4M3C B;  3WCS A;  4QB2 A;  4PDW C;  1GWK A;  3LZZ A;  3WQ7 A;  2WS9 1;  3LDK A;  3ON7 A;  2Z79 A;  3THC A;  4IUG A;  4OZX A;  2GU9 A;  3ZDS A;  5FIX A;  3III A;  4YSF A;  1NLS A;  1POQ A;  2WN3 A;  2NMO A;  4QDS A;  2BNN A;  2ERF A;  1GQP A;  1CAV A;  1VBD 1;  2YC2 A;  1U12 A;  2GNB A;  2Y38 A;  3EJK A;  4IL7 A;  4QPW A;  4EN6 B;  1O5L A;  4V2W A;  1PO2 2;  3MPB A;  4AHW A;  1LOF A;  1NCQ A;  1BEV 1;  1WUV A;  1DQ4 A;  2WR9 A;  2ZGP A;  3Q9O A;  3VD7 A;  4BQ4 A;  4I02 A;  4NPR A;  2RG4 A;  1D4M 1;  1NQJ A;  4B1L A;  4M3C A;  4MZU A;  5GZF A;  3RRD A;  3OY8 B;  2BJS A;  2XBO 1;  4FPY A;  5FTT C;  3TBD A;  2IXK A;  4HPK A;  1DGW A;  4QD2 A;  4E27 A;  4FTS A;  1O3R A;  2HYK A;  2IXI A;  3ILN A;  3T0B A;  2YPJ A;  3JUU A;  1AF9 A;  5FXW A;  2D40 A;  1F4H A;  4KI5 M;  3WG4 A;  1IG3 A;  2W87 A;  5JWP A;  3ZMN A;  3ZYJ B;  3BVC A;  1KIT A;  1W9S A;  2RR1 1;  3G6J B;  1QJE A;  4MV2 A;  2IXH A;  5FY0 A;  3WLU A;  3VBU C;  4BCU A;  2VOX A;  5FAX A;  3K46 A;  1APN A;  4MGZ E;  4QXC A;  3IPV A;  1JTZ X;  3VDD C;  5CEH A;  1IS4 A;  5FXV A;  1BLZ A;  1D4V B;  4CDQ C;  1MZE A;  4RR3 B;  5A7S A;  1CJD A;  2J1R A;  2V73 A;  2XML A;  2YGL A;  1RUJ 1;  4F7Z A;  3QD6 A;  2W46 A;  5FP4 A;  1ZRD A;  4LIV A;  5FZ6 A;  3RI8 A;  1PO2 3;  1AR7 3;  1C5H A;  3ZO0 B;  3QLQ A;  1N1T A;  2ZHK A;  1KGY A;  3ZLI A;  1JYT A;  2OT7 A;  3MLJ A;  2BEO A;  4LBQ A;  1NY7 2;  1VMH A;  4MXW A;  2VMG A;  1QJX 3;  5D8A A;  2J7M A;  3BAL A;  1ODM A;  4ATE A;  1NCR A;  3ELN A;  1LRH A;  4B4P A;  4Z82 A;  2ARB A;  4HVO A;  5A33 B;  2CHH A;  3MDP A;  2UY8 A;  4EN7 B;  3AZY A;  4AE2 A;  4R52 A;  4H55 A;  2AUY A;  4IE6 A;  4XFG A;  3OGS A;  1F31 A;  3OBA A;  3VN4 A;  3ZFE B;  4DUV A;  1LAJ A;  2PQS A;  5F39 A;  2ZKN A;  4QPI B;  2GAL A;  1AR6 2;  4LLF A;  1UU6 A;  2WS9 2;  2QBX A;  4Q4V 1;  1RUG 2;  1WKY A;  4JHT A;  1DGW X;  5FPX A;  4XDP A;  1R09 1;  1ULC A;  4UF0 B;  1LCL A;  4WM7 A;  3POE A;  4GWM A;  4QDR A;  2E7T A;  2WNU A;  4YW5 A;  4FOV A;  1LOC A;  2A7A A;  4Y33 A;  4NWW A;  1AYN 1;  1CON A;  2VJX A;  4HXC A;  2FDG A;  4XHB A;  1D7P M;  2EAK A;  5FMO L;  2QQP A;  4I3G A;  2P3K A;  4AG4 A;  1EPZ A;  1UKR A;  2JEN A;  2QQW A;  4D69 A;  3URF A;  3KCC A;  1XOY A;  1MZ5 A;  4E4H A;  3B93 A;  3N9O A;  4D7T A;  2E7A A;  2RS3 1;  4WVZ A;  1UOJ A;  3RWK X;  4XAA A;  1ULE A;  2E9Q A;  3NAP A;  2BRT A;  3KWV A;  4EWD A;  1U5Y A;  4HN1 A;  1YI7 A;  4AR2 A;  3PJY A;  2GNM A;  4MXV A;  3S7I A;  1FMD 2;  5FY4 A;  2W08 A;  1OFS A;  2DUQ A;  2WYF A;  2ZX1 A;  1UO9 A;  1AYM 1;  1WMD A;  1HRI 1;  4CUG A;  5CVR A;  1RUG 3;  1H1A A;  2ZZJ A;  2Y6F A;  3WW1 A;  1IHM A;  1LKN A;  4ZZ8 A;  4IQP A;  3MUZ 1;  3VBS A;  5A70 A;  1UYP A;  4BH9 A;  1PNG A;  1DZR A;  2W39 A;  5JR2 A;  3Q8E A;  5FJK A;  1CD3 G;  4LOR A;  1W99 A;  4FCA A;  1ND2 C;  2B5H A;  5K0U C;  2WN2 A;  4DZG A;  3KV6 A;  1OLM E;  3B9I A;  4P00 B;  4GKY A;  3DN7 A;  1XRU A;  2D43 A;  1TME 3;  2XVL A;  3ACF A;  4OCT A;  5FZ9 A;  4YG3 A;  3RZM A;  4J1X A;  4NWV A;  3NJV A;  3PIJ A;  2E26 A;  1HIX A;  1FT9 A;  4LO4 B;  3GJB A;  5L9R A;  3SCF A;  3BIE A;  4BU2 A;  2WNV C;  3TN9 1;  3DPR A;  5CG8 A;  4RR3 C;  1TEI A;  2F17 A;  4RR3 A;  4XHX A;  1RUJ 2;  5GLZ A;  2GMP A;  1C1F A;  1QDO A;  3CJX A;  4ASL A;  4JX0 A;  1NXM A;  5GLT A;  4G9S B;  2WIN B;  5KHI A;  3U37 A;  4QT6 A;  1OUR A;  2QDR A;  1XSQ A;  1NY7 1;  1W8F A;  1LGC A;  1KD7 A;  1U5Z A;  1RUG 1;  1FOD 2;  1GZ9 A;  4LHN A;  4P9L A;  3KVB A;  4A45 A;  4YZ2 A;  1R08 1;  2W47 A;  4MET A;  3CNA A;  1COV 1;  4FFH A;  3H7Y A;  5FZ3 A;  2J22 A;  1QXR A;  3NV1 A;  4GH4 A;  1Y9M A;  4E4Z A;  3LIH A;  2HWC 2;  3B7M A;  4XZU G;  1A34 A;  2AEN A;  2CAU A;  2MPF A;  2OS2 A;  1YRZ A;  3CDZ B;  4YYO A;  1T6B X;  4LBM A;  3WHU A;  3BTX A;  2ZEW A;  2RMU 2;  4XFF A;  4QPI A;  4WBB A;  5FBJ A;  1H1M A;  1NA1 B;  2O8Q A;  3GM8 A;  4Q4V 2;  3NV4 A;  2HWE 1;  5FBZ A;  4A7Z A;  4Q4X 3;  3WW4 A;  2D44 A;  4LBQ D;  3LCP A;  1SMV A;  1R09 2;  3E5Q A;  5EXO A;  2WZ8 A;  4JGZ A;  4I09 A;  1F35 A;  2P17 A;  2WFP A;  1MQT B;  2ZMN A;  3LKJ A;  4K40 A;  1PK6 A;  3AFK A;  5FPL A;  3ZSJ A;  3AZW A;  3J7M A;  2EA7 A;  3ZFF C;  1SCR A;  4AF9 A;  2P3J A;  2ZXQ A;  3AYE A;  1ZZ8 A;  4LIU A;  3MBW A;  3NRU A;  4Y22 A;  4GAZ A;  3HN1 A;  1Y7B A;  2KA3 A;  1W6N A;  1RUH 3;  4YW4 A;  2HWB 3;  1QH6 A;  1HB3 A;  1KEX A;  4QX2 A;  5C71 A;  4GWJ A;  1XND A;  2F4P A;  1UMZ A;  4A3X A;  2P3I A;  4XE9 A;  1YFW A;  5HCB A;  5FYH A;  4FQZ A;  1LR5 A;  1DF0 A;  4MGQ A;  5FZ1 A;  4QB6 A;  4KGG A;  2GN7 A;  2VZP A;  1FMD 1;  4LE3 A;  3B9C A;  1S4C A;  2FMY A;  1MS4 A;  1G9C A;  3SH4 A;  3GCW A;  2WO2 A;  1XNC A;  1KFU L;  4ZXE A;  1DCS A;  3SC7 X;  4M0N A;  5FZD A;  5H9R A;  4MSV A;  1RIT A;  2VTX J;  3OPZ A;  3DV8 A;  1H4H A;  1UF2 C;  3ZYR A;  4YW1 A;  2QJV A;  4IEW A;  2VQT A;  3O1M A;  3TN9 2;  2VVD A;  4RGK A;  4BQW A;  3PVN A;  1W8W A;  2HJI A;  3KGZ A;  2FBE A;  4JRA A;  4DUW A;  1QJF A;  4LOT A;  1RUJ 3;  4XEZ A;  3T0A A;  4CCJ A;  3RZG A;  1ZZ9 A;  2JB8 A;  1IS6 A;  4K20 A;  4AGR A;  1JYW A;  4ZS2 A;  4XFC A;  3E1F 1;  1FOD 1;  1V6N A;  4NR1 A;  2VMC A;  5IAT A;  3TEW A;  1JOJ A;  4CA9 A;  4XIL A;  5GM0 A;  4Z2A A;  2JB4 A;  4QHO A;  2QVS B;  2WAB A;  4K21 A;  2QZ3 A;  4YW6 A;  4AYU A;  4IV3 C;  2XHN A;  4FFF A;  3HVD A;  1VR3 A;  2HBU A;  4CEY A;  5C5U A;  4OI4 A;  2TEP A;  5A7O A;  5C4W A;  4DUX A;  2Y26 A;  1V00 A;  2Q8E A;  4FPE A;  4XJU A;  1IQD C;  1RC6 A;  3GBF A;  2QQU A;  2ARC A;  1W2N A;  4IW3 A;  3AM2 A;  3V56 A;  4AQ2 A;  3O0V A;  3I2K A;  2A5Z A;  2ZA9 A;  4CP0 A;  1C8M 2;  1HQL A;  1LOE A;  2JE7 A;  1OPM A;  2UYA A;  4XFB A;  3FC0 A;  1UYY A;  4DO0 A;  2YBP A;  1NAE A;  3BN6 A;  1YNA A;  5FXZ A;  1MS1 A;  1OH4 A;  2WNV A;  3BGA A;  3LA7 A;  4SBV A;  4UFJ A;  2HH9 A;  3J9S A;  2CGP A;  1HXS 3;  1QNY A;  1HW5 A;  2VPV A;  2W0X A;  5ANN A;  1EV1 2;  1G9D A;  5FYU A;  1ND3 C;  1VIW B;  3SIT A;  1ZRE A;  1UY2 A;  4XFH A;  1G9B A;  1AX1 A;  4MGS A;  3D8C A;  5KXB A;  2IWG B;  5GLV A;  2ZAH A;  3E6C C;  2RJL A;  3OGV A;  1W2A X;  3HWJ A;  4LO7 A;  3KM5 A;  2GN3 A;  3AB0 A;  2D5F A;  1LHN A;  4CXX A;  1DQ2 A;  1K5M A;  3KVA A;  4KWL A;  2CYF A;  2XVG A;  4XUN A;  2JE9 A;  3A0K A;  1XPW A;  4GWI A;  4RHV 3;  4XMA A;  1PO1 1;  4AI0 A;  1GV9 A;  4CCO A;  5JUV A;  3LE0 A;  4FOQ A;  1H6Y A;  4WM7 B;  3ETP A;  3RZL A;  1ASJ 3;  5FPZ A;  3T3Y A;  4QWN A;  5IVC A;  2RDQ A;  5FLJ A;  2VR4 A;  2LUW A;  5ABJ B;  3IBM A;  4UF0 A;  3IDC B;  2UU8 A;  4LKE A;  4D6R A;  5HBA A;  4AGV A;  1JYN A;  4HET A;  2WFF 1;  5JSO A;  3VBU B;  5A7W A;  1I1E A;  1W05 A;  4IGQ A;  2XL7 A;  4ASM B;  1B09 A;  1FV2 A;  4R9D A;  4TZD A;  1EP0 A;  1Z78 A;  5F37 A;  4AVS A;  1QU0 A;  2YU1 A;  4NMI A;  5LB6 A;  3AP4 A;  2VZO A;  1D0H A;  3CZJ A;  1PGS A;  3VBF C;  4AEJ A;  2XJQ A;  2YRO A;  2X5I A;  4DPN A;  1LGN A;  1IOA A;  4XVH A;  3W59 A;  4P5H A;  4PT6 A;  1POV 3;  2ET1 A;  3UT0 A;  2Q1Z B;  5BNN B;  1K42 A;  3ACG A;  5CBL A;  1MS5 A;  2CTV A;  3TNP B;  4URA A;  2BZD A;  1R1A 3;  1ULP A;  1Q8S A;  3LEK A;  1CAW A;  2ZJC A;  2YG0 A;  3U11 A;  4OI0 A;  2IXL A;  1QJY 2;  2R32 A;  2FD8 A;  2W52 A;  3FUO A;  4TLG A;  3HR9 A;  4WM8 A;  1SEF A;  3E6B A;  1KDK A;  3LOB A;  3KZ4 C;  3I2I A;  4A7Y A;  5F32 A;  5FQ0 A;  1XU2 A;  3V0A A;  1BMV 1;  1O8P A;  1KXG A;  2MEV 1;  3C7F A;  2WII B;  2K0G A;  4NVP A;  1A78 A;  4LHL A;  2OW4 A;  5FYZ A;  2OXB A;  3MV1 1;  5CKM A;  2XON A;  3ACL A;  1H2L A;  2JD9 A;  3UKN A;  1PMJ X;  1STM A;  1MVE A;  3OY8 A;  1RUC 1;  5LAS A;  2YV8 A;  4NUB A;  1PNF A;  2I2S A;  2OQ6 A;  3AKT A;  2R7E B;  3GJA A;  1E5S A;  1K45 A;  1UOG A;  5FZF A;  1FMD 3;  3O1R A;  5JAX A;  4XTM A;  2PHL A;  1ZRR A;  1SBF A;  2ZGK A;  3MEP A;  3PVE A;  3WDW A;  1YCI A;  3AYA A;  4GA9 A;  2AZ5 A;  4BIF A;  2TUN A;  2QDN A;  4CYD A;  1W2T A;  4IV1 A;  1WZX A;  1X82 A;  2HWB 1;  5FZO A;  1RUH 1;  1V6L A;  5IVJ A;  2VC9 A;  5SV8 A;  1MEC 3;  1HKD A;  4R8H A;  1VB4 A;  4ZU5 A;  4R9C A;  1E5H A;  3JD7 1;  1XNT A;  1OVP A;  5FDB A;  4MAD A;  3GHN A;  2RV9 A;  3SH3 A;  4PQ9 A;  1J1T A;  3ZXE A;  4QX8 A;  4FXG B;  2VH9 A;  3M1H A;  1WGP A;  1KS4 A;  5KC5 A;  1GLH A;  1TNF A;  2E51 A;  3JQW A;  4GKX A;  1SFN A;  2HWE 3;  4DEQ A;  1Y3T A;  4YM0 A;  2ENR A;  3VKM A;  3WNL A;  4GWN A;  5FPV A;  2RJK A;  1J3P A;  2EXH A;  2VCB A;  2CGO A;  3ZN6 B;  1GIC A;  3N9N A;  3GZU C;  1AXY A;  1GSL A;  2XQX A;  4OHW A;  1JZ2 A;  5AFE A;  2JIG A;  4JQR A;  2JKB A;  4H7L A;  5DZG A;  3U75 A;  1LU2 A;  5I0R A;  1LED A;  4KG0 A;  1JZ3 A;  1YFU A;  1MS9 A;  2QQN A;  2EF6 A;  4GB3 1;  1W6N B;  5F2W A;  2AC1 A;  4NO4 A;  3LD8 A;  3PUR A;  4GB3 3;  2UWA A;  4QXK A;  1W8O A;  5EJ1 B;  2J1A A;  4IEZ A;  2Y0I A;  1E5R A;  1A6C A;  1CQ9 A;  4DY5 A;  1UAI A;  1RMU 3;  1RUD 3;  2W5F A;  3C2U A;  4M01 A;  5CKQ A;  2XVK A;  3SCG A;  1EYB A;  5I91 A;  3ORJ A;  4QU1 A;  2AR6 A;  3U07 A;  4CP9 A;  4YM3 A;  2FDH A;  2E63 A;  3TN9 3;  5BNQ A;  3O1U A;  5LBF A;  4OUS A;  4X6Q B;  1KRI A;  2P34 A;  2WQZ C;  2VZV A;  3WHT A;  3KLS A;  1UL9 A;  1YI9 A;  4IXL A;  5CIS A;  1O7F A;  3NJX A;  3VDC A;  3ZFF B;  4MH0 E;  4RFT 0;  2PHR A;  2NP0 A;  2B4K A;  4QPY A;  5E88 A;  3WNP A;  2D3R A;  4DS0 A;  2D6O X;  2D3S A;  4JZR A;  2P1B A;  1GNH A;  3KQ4 B;  5J09 A;  2P37 A;  1IKQ A;  2CWS A;  2JG8 A;  4MO3 M;  5FYS A;  4QGL A;  5AC9 2;  1W03 A;  2GNT A;  1AYN 3;  2XKO A;  3KCX A;  4UW4 A;  2HWB 2;  3MF6 A;  3DYM A;  1GAN A;  3JD7 3;  4QKN A;  1QNW A;  4RL7 A;  3ZXF A;  1JYI A;  3CJI B;  4B8E A;  4TWT A;  1QKQ A;  4JKL A;  2R16 A;  1UYX A;  2VBD A;  4QHZ A;  5ERL A;  3P3N A;  2CU5 A;  5CZK A;  5JXH A;  5K8S A;  5C9A A;  3S7E A;  3UJO A;  1QXJ A;  4IEX A;  4HT1 T;  1X9P A;  3HJR A;  5JPM B;  1OOP A;  4RD7 A;  1VBB 1;  1YLL A;  3M3O A;  4XJA A;  1BXH A;  1SG3 A;  2JXA A;  1W39 A;  5C33 A;  4DY3 A;  2RS3 3;  4MHR A;  5T5O A;  5FP7 A;  3SEP A;  1GNZ A;  1RUH 2;  4BLI A;  4CXY A;  3QCW A;  3BB6 A;  4Y1V A;  5JDB A;  3JB4 C;  2WNV B;  2J1E A;  4AVA A;  3E5U A;  3AC0 A;  3D0J A;  1PMI A;  1AX2 A;  1VRH 2;  4NRM A;  4XXP A;  4A2U A;  3W5M A;  3T2T A;  1X8E A;  2XG3 A;  2UWC A;  2VVF A;  2VCA A;  5LW9 A;  2WO7 A;  2EVX A;  5D8A C;  3ATG A;  1ACC A;  3ROU A;  3VD4 A;  4KU8 A;  4QKF A;  2VD7 A;  3FLP A;  3GCX A;  4JVA A;  4CRQ A;  4IE4 A;  3RQ0 A;  5FZA A;  4BK4 A;  2VQU A;  3A7Q A;  3ZKU A;  2DDU A;  2RVA A;  3ZX7 A;  1J83 A;  3RDI A;  4E2Q A;  3CBN A;  5FWJ A;  1BYH A;  1MS8 A;  2DWR A;  3FX3 A;  2QUO A;  4BB3 A;  2YY1 A;  5FYM A;  1N3O A;  4FXK B;  3OD0 A;  3VD3 A;  2H6C A;  2UY9 A;  4IGP A;  2WA3 A;  4PI2 A;  1DFQ A;  5FZH A;  4FOW A;  5LBE A;  2ZAC A;  2YXS A;  2QTW B;  4LHS A;  3K4A A;  3R4S A;  3THP A;  4HOO A;  4P9J A;  3ST7 A;  1BBT 2;  1GU3 A;  1M4W A;  4GIQ A;  1MPX A;  1S0F A;  2D6L X;  2GP5 A;  2WRA A;  4YLZ A;  4YGD A;  3A23 A;  5I8S A;  2A3X A;  3N9L A;  1TVG A;  2JKX A;  2JDA A;  3I2J A;  1C8N A;  4JC1 A;  2PHD A;  3EMR A;  3ACH A;  2IXJ A;  3B02 A;  3KGL A;  4K6B A;  3T09 A;  5FYV A;  3BPZ A;  3K75 B;  4XET A;  1GWM A;  4UBG A;  5GZD A;  4OQ9 A;  1R1A 1;  1E5I A;  1W6P A;  1OUS A;  2O0O A;  4KQ7 A;  4CSW A;  5C9A C;  4IER A;  1HB1 A;  4ATF A;  3Q8C A;  4BDV B;  2EXI A;  2VG9 A;  3D4K A;  4FTE A;  2YU2 A;  3D3A A;  3ME2 A;  5FMO S;  4AHX A;  1PO1 3;  4R4X A;  4EYU A;  1VAL A;  2XWB B;  3EBR A;  4YGB A;  3E6D A;  1F8V A;  1RUE 1;  2OUJ A;  1C8M 3;  5JCT A;  2VXJ A;  3WW3 A;  4D7S A;  3L9J T;  2Q8D A;  1JW6 A;  1QJU 1;  3JQX A;  3K51 A;  2FCV A;  2GC2 A;  2XGX A;  3PL0 A;  5A6Q A;  1N47 A;  1JU3 A;  1GZC A;  1H9W A;  1I6X A;  3GDB A;  4XAE A;  4QXH A;  4D6Q A;  1DYK A;  1IG0 A;  3H8X A;  4UFK A;  3DXU A;  2PAE A;  3ZN5 A;  2ZHN A;  4MYE A;  2ZX0 A;  1QXP A;  2WZR 3;  1FNY A;  3HNY M;  4P9W A;  5IK5 A;  3DKQ A;  1P8J A;  3AXE A;  2JIC A;  4AFB A;  4Y26 A;  5JIU A;  3MI8 A;  4YM1 A;  3SHR A;  3GNE A;  4AOC A;  1V9U 1;  3I59 B;  1WBF A;  5FRA A;  4B4R A;  2ES3 A;  1J59 A;  2DYC A;  4KG8 A;  4Y4Y A;  4YGE A;  4F3J A;  4JDO A;  4CDQ B;  4Z8B A;  3VDD B;  5GZG A;  5JOW A;  1HJF A;  2XUE A;  3ZVX A;  3I97 A;  2NQY A;  3PU8 A;  3WUD A;  2BP6 A;  3PHM A;  5IVF A;  4XUO A;  3F95 A;  1H4G A;  4Y1U A;  4MHU A;  2ZMK A;  5A3O A;  4NHY A;  5GJ6 A;  1HQW A;  3NJZ A;  3ZSM A;  2QQK A;  2D6M A;  4QXB A;  1K5M C;  1NA1 C;  3FBM A;  1PK6 B;  1MZF A;  3LGR A;  4MGI E;  2J42 A;  4AAX A;  4H3W A;  1XJA A;  4JCK A;  3U14 A;  2X5I C;  3M7A A;  1HB2 A;  3WQ1 A;  4CP2 A;  3WNN A;  4HK8 A;  5JPN B;  5C4W C;  4AVC A;  2VME A;  3VL9 A;  3KV4 A;  4A7K A;  5FY7 A;  4Q0Q A;  5JSP A;  3AMN A;  4MVT A;  1VRH 3;  4OVE A;  2VNO A;  3ZDV A;  2VAU A;  1QGL A;  1W9W A;  1W0P A;  3ZN6 A;  1GWL A;  2OKX A;  5H9P A;  3PJQ A;  2KM2 A;  4GH4 B;  1BBT 1;  1L7Q A;  4MOA A;  1AX0 A;  5HCA A;  1DQ6 A;  1SBE A;  4LBN A;  3VD9 A;  2ZGQ A;  3BPS A;  1W3X A;  1XNA A;  1X7N A;  4RFR B;  5A7P A;  3H0O A;  4XJ9 A;  3FMG A;  4N53 B;  3VBH A;  4N9H A;  3W21 A;  4XF4 A;  1CX1 A;  2BTV C;  1CPM A;  3HQX A;  5FKC A;  1R1A 2;  3VZO A;  2HEY F;  2Z4F A;  3AVS A;  1C5I A;  1LOB A;  5EJZ B;  1AXZ A;  5JZG B;  3S0M A;  3C7G A;  2C26 A;  3V0A B;  4QM8 A;  1H9P A;  1JZ5 A;  4COZ A;  3VZN A;  5EZW A;  5H9S A;  4EN8 B;  3ZYG A;  4GJZ A;  3KB5 A;  3ASI A;  1RUE 2;  3H50 A;  5JI7 A;  5F9T A;  2A6V A;  1G6N A;  1BEV 2;  2V4A A;  5DAX A;  5A3U A;  2PHW A;  1V9U 2;  5FO9 B;  1ZVF A;  2VZU A;  2ZZQ A;  3UJQ A;  1FPN 2;  1K5J A;  4I3P A;  3VHO A;  1GQG A;  1HN1 A;  4UW3 A;  3IM0 A;  2EIE A;  4OHY A;  5LRS A;  3GXU A;  2FCT A;  1PIV 3;  1TE1 B;  3E5X A;  4CDW A;  5JOX A;  2ZKL A;  2GND A;  1VLN A;  1CAU A;  2HYX A;  4CEW A;  3WSO A;  2C24 A;  2L9L A;  3AMP A;  1O3S A;  4FPJ A;  4CDU C;  1GUI A;  2LRP A;  3VBF A;  5FPB A;  4BK5 A;  3I2O A;  4K9S A;  1C28 A;  4CEY C;  3MLL A;  2WWJ A;  1VB2 A;  4COY A;  2KR2 A;  4Q4X 1;  1GMM A;  3S6P A;  3RZJ A;  3VDB A;  5DAV A;  2VMD A;  3B5L B;  2OZ6 A;  1NCQ C;  2C5D A;  3DYP A;  3ZYP A;  2WAA A;  2JEC A;  2OPK A;  4L99 A;  1TMF 3;  2XJT A;  2VZR A;  4XF1 A;  1WD4 A;  3S5Q A;  4ORF A;  5CAD A;  5FUP A;  1JYC A;  1Y43 B;  2QFE A;  1VP6 A;  4QPI C;  3HBZ A;  2RDN A;  1DQ0 A;  1R08 3;  2JG8 B;  2Z42 A;  3R0R A;  5E6H A;  4YZ1 A;  3ZFE C;  5J48 A;  1H6X A;  2ET7 A;  2AEY A;  1OF4 A;  1O5U A;  1SZB A;  4YFW A;  5FRE A;  4XBL A;  5A32 A;  3OYW B;  2V72 A;  4QM9 A;  1Q8Q A;  3I3D A;  4QKD A;  3WNM A;  1UPS A;  3PUH A;  3U1X A;  1ZBE 1;  1AYM 3;  3N4M A;  1CAU B;  1OMI A;  2DTW A;  5EYY A;  2GP3 A;  4LT5 A;  1NE4 A;  5D8A B;  3MLK A;  2Y6G A;  5J36 A;  3J4U H;  3RMX A;  1TMF 1;  1Y9G A;  3H42 B;  1S2K A;  1YQ6 A;  1QQP 2;  2A1X A;  2ZS6 B;  4IGO A;  2X53 S;  1NZC A;  2OUH A;  2Y0O A;  1N1Y A;  4QQH A;  5DG1 A;  5GZE A;  1CZV A;  1TME 1;  1WMX A;  2WT1 A;  4FPF A;  4XXA A;  1RIN A;  3ES4 A;  4A41 A;  2D6P A;  4PCR A;  4M4P A;  3WT3 A;  4HFS A;  1M06 G;  3KF3 A;  1OH3 A;  1ZZB A;  1SCS A;  4YNI A;  5C8C B;  4NHK A;  3IPV B;  2R04 1;  4UI9 L;  5F3G A;  4BQX A;  4JGZ C;  3HOB A;  2FHR A;  2K2S A;  3EQE A;  3AVR A;  2ARA A;  1RXF A;  5ACA 2;  4I0B A;  3TAY A;  4QKB A;  1XQN A;  4MGT A;  2IVI B;  1R09 3;  1NCR C;  3BCW A;  4EWA A;  1Q8V A;  1AYM 2;  1Q56 A;  2QNK A;  4QPG B;  4CPB A;  4NIH A;  4L11 A;  1LHW A;  2NM1 A;  4FPL A;  1PGL 2;  4AK3 A;  4UFL A;  4NII A;  3HT1 A;  3W5N A;  3T30 A;  5LCW L;  3APB A;  3VBS C;  3HT2 A;  1UD1 A;  4EQV A;  3N9Q A;  5FJH A;  1HV0 A;  1LEC A;  2OVU A;  1CZT A;  1X33 A;  3K2O A;  4AQS A;  3MGU A;  4EN0 A;  3AKP A;  3WF0 A;  4MLO A;  5JOZ A;  1UZZ A;  4YAR A;  4Y22 B;  4FP2 A;  5CAZ A;  1JYV A;  5FZK A;  1VAK A;  2IFR A;  5JI9 A;  1WCU A;  1AR7 1;  3WF4 A;  3JB8 A;  3MFA A;  4I2O A;  2A71 A;  2F6B A;  2J1S A;  1UZY A;  4QGN A;  1W9T A;  4XYX A;  5I93 A;  3OTF A;  5JSR A;  2VTX A;  1ND3 B;  4Q4V 3;  4YG6 A;  5DUV A;  3T4H B;  4H2A A;  3UGF A;  3BKZ A;  5C3O A;  1RVF 2;  5L7O B;  4GXL A;  1ZYB A;  4XIO A;  4QX3 A;  2LW8 A;  1ZRF A;  4N43 A;  3K3N A;  1ND3 A;  2ID4 A;  2RR1 3;  4LBO A;  2D6N A;  1OQE A;  4ARY A;  5LEJ A;  4J1W A;  3IB3 A;  4W50 A;  2GMM A;  3TRS B;  3GYD A;  2X09 A;  2VM9 A;  4IE5 A;  1QQP 1;  3MF9 A;  4IV1 C;  2Q0A A;  4C91 A;  5TSW A;  2P5B A;  1QJX 1;  1JZ4 A;  3I2G A;  1W8T A;  2HWC 1;  4PBO A;  3RVH A;  4I0A A;  4BM8 A;  4QQ2 A;  4N90 A;  4JHZ A;  3RZK A;  2R06 2;  3ZN4 A;  2P3Y A;  1KDM A;  2WFF 3;  4NAM A;  4CCM A;  1WD3 A;  5FZB A;  3M4F A;  4XQD A;  3NST A;  3R6S A;  1TMF 2;  1LTE A;  2CSG A;  2BNM A;  2BQP A;  3I2D A;  1DU3 D;  2ZHM A;  3ABZ A;  2ZGS A;  5JXI A;  2HLE A;  3AKS A;  4K8F A;  4KWK A;  1ZBA 3;  3UES A;  5DAP A;  2WS9 3;  4LJH A;  4B29 A;  2G19 A;  2VY0 A;  3A21 A;  3WEZ A;  4M0H A;  3VZM A;  4OUE A;  1JYX A;  1D4M 2;  4RHV 1;  3UKV A;  2GSY A;  1S0E A;  1VBC 3;  2IXC A;  5CFD B;  1MQT A;  3WV6 A;  4DXS A;  1V9U 3;  5DN2 A;  4IV1 B;  4JGY B;  1HDK A;  4U36 A;  5ACA 1;  1AR9 1;  3HBK A;  1JMU B;  2PMW B;  3F2Z A;  4LKS A;  5LY2 A;  3WNX A;  4ZKT B;  5J1X A;  3MUY 1;  3OBR A;  4M4R A;  2MNG A;  2WLQ A;  4NRO A;  1UOF A;  1XU1 A;  5BUV A;  1OXC A;  3WF3 A;  3NW4 A;  1MS3 A;  1S0G A;  1DG6 A;  3JBG 2;  2ZEZ A;  5CYY A;  4LKD A;  3OYW A;  3OB8 A;  1SLC A;  3MIE A;  1PGL 1;  3NKG A;  3WF2 A;  5SV5 A;  3T1L A;  1KJR A;  1RXG A;  3DEC A;  4BYY A;  3H8U A;  1WA4 A;  2K46 A;  5LBB A;  4EZH A;  4ZPI A;  2EIC A;  4XUP A;  1W2O A;  3KQR A;  1RVF 1;  3WZ1 A;  5JOY A;  3NQH A;  5K4L A;  5A32 B;  5KHJ A;  2PFW A;  4X6R B;  4UOJ A;  3T08 A;  2NN8 A;  3GHM A;  4DNY A;  4QB1 A;  2BGP A;  3ZXG A;  1L7L A;  4UYB A;  3KT4 A;  2W1Q A;  1OA2 A;  1T6G C;  2XUM A;  2YYO A;  1LB2 A;  5L7O C;  1AR7 2;  4XUT A;  1JH5 A;  1WW4 A;  1ENX A;  3KHC A;  3A4U A;  2WO1 A;  1FOD 3;  1QJX 2;  1X9T A;  3OSD A;  4FI9 A;  5BNN C;  3AP9 A;  4XF9 A;  3GZE A;  3ZYH A;  3OF1 A;  1C3H A;  2RM2 1;  5L9B A;  3VBF B;  2R1D A;  4FO9 A;  4OHZ A;  3VBO C;  4CCC A;  5LWB A;  1BCX A;  2CDP A;  4LO5 B;  3SNM A;  4AW7 A;  1JOD A;  5FP8 A;  4GMP 3;  2HBT A;  2LAL A;  3LEG A;  5C3S A;  3CIH A;  1CWP A;  4LOS A;  2RMU 3;  5IFP A;  2BGO A;  2QCS B;  3ETQ A;  2AH2 A;  2AAC A;  2XJP A;  5C3P A;  3VBS B;  1F2N A;  1DZQ A;  1EV1 1;  2R1B A;  3V0B B;  3AZV A;  4HMZ A;  2VTF A;  3FBY A;  1W90 A;  1QWR A;  1CIY A;  5HV4 A;  4LKF A;  5E8A A;  1X36 A;  2JD4 A;  3ZR5 A;  3RSJ A;  2O14 A;  5L19 A;  4HON A;  3VKF C;  4BZ4 A;  3HQR A;  5FUI A;  3SMH A;  5A3P A;  3CHX A;  3G7D A;  2WBK A;  3WG1 A;  3ZXD A;  2VOV A;  2DBI A;  4DXT A;  2Z5W A;  3T2P A;  2WNE A;  4NID A;  3WG3 A;  1EAH 1;  2ZGR A;  3RNS A;  2FDF A;  3D5O A;  3RYP A;  4IES A;  4UT5 A;  5I0T A;  5C8C C;  4WZF A;  2D98 A;  4RHV 2;  3O14 A;  4JDN A;  1SAC A;  2XQR A;  4S2G A;  1TQ5 A;  5JZG A;  4OQ8 A;  4CEW B;  2EXK A;  2F4L A;  2VCM A;  2NMN A;  4ISR A;  4B3N A;  5T52 A;  3PTY A;  4QX0 A;  3ZFE A;  5HV0 A;  3FFQ A;  1HB4 A;  3J7L A;  4KMQ A;  1CX4 A;  5FP9 A;  1U5X A;  2EID A;  3T2O A;  2DVG A;  3WP3 A;  3A0N A;  2DTY A;  2BWA A;  5IUQ A;  3ZM8 A;  4Q4Y 1;  1YC6 1;  4ES9 A;  2WC2 A;  3ZFF A;  3D6E A;  2JDU A;  4G3Y C;  5LK5 A;  3I3B A;  3JBG 1;  1NCQ B;  4E4S A;  2VUC A;  1UY1 A;  5J37 A;  2WT2 A;  1XNK A;  4OFG A;  1LHO A;  2EAA A;  2O1Q A;  1CAV B;  4P02 B;  1N1S A;  4LBJ A;  1WCK A;  4MG2 A;  3HEI A;  4LK7 A;  4XPV A;  2PLV 1;  4M3C F;  3VGI A;  5T50 A;  2WT0 A;  4XJ8 A;  2HWD 2;  5IVB A;  4E4D X;  2PAK A;  3MPP G;  2BOI A;  2A3W A;  1W6O B;  5JXJ A;  2X29 A;  1SBD A;  1Q3E A;  3H1Y A;  5EHD A;  5FZM A;  1RYY A;  4M00 A;  3WQ0 A;  1H0B A;  1R08 2;  1F5F A;  4AFC A;  4Z1V A;  2C1F A;  4CP1 A;  5CFC C;  4R4Z A;  4BQY A;  3BU7 A;  4QU2 A;  2R30 A;  1VBA 3;  3WP4 A;  3WG2 A;  2V5Y A;  1XNB A;  1YJL A;  4B7K A;  4AZZ A;  4XC9 A;  2YFZ A;  4Q1R A;  4HPK B;  2RM2 2;  3RWN A;  1S0C A;  2A73 B;  2E33 A;  1RMU 1;  2RMU 1;  2WWU A;  2CGN A;  3IDA A;  3NVC A;  1CAW B;  3ZXK A;  2AGS A;  2HWE 2;  4GMP 1;  5LA2 A;  4IEY A;  4MGY E;  4RQP C;  2DBN A;  2XJU A;  5E16 A;  5FQ0 B;  1V70 A;  1U5I A;  3VD5 A;  1W6M A;  4GZ9 A;  1UX6 A;  2VZ3 A;  1HRI 3;  1WLW A;  3AMM A;  3MIH A;  3TB0 A;  2RS5 3;  3UV9 A;  3J8F 1;  3AZX A;  1UOB A;  4B7E A;  5FZ4 A;  3VB9 A;  4CCK A;  1ZBA 2;  2XJS A;  2B7Y A;  2FMD A;  3N36 A;  5LA9 A;  5DDJ 1;  1C1L A;  2IZW A;  1Q5O A;  2FZ1 A;  5FXX A;  3POF A;  4CXW A;  5FZ0 A;  4BA6 A;  4FAH A;  1PHM A;  4Q26 A;  2YHJ A;  3MW4 A;  3OPW A;  4AED B;  4CDW C;  3RZH A;  1JHJ A;  5F8P A;  3O1T A;  2HEW F;  1LEM A;  3MIG A;  5FK8 A;  3S30 A;  3WDT A;  4HG6 B;  4BE3 A;  2Z69 A;  5C8W A;  1OPO A;  2BDR A;  3B00 A;  5FYT A;  4XF3 A;  3U10 A;  3DF0 A;  1DYP A;  2G1M A;  3CKH A;  4KWU A;  4Y20 B;  1IGO A;  1S1A A;  2PHF A;  4YVS A;  4CDX C;  2A75 A;  4YZ5 A;  4C8D A;  1RED A;  4J25 A;  4V1P A;  4FBF A;  1FYU A;  1ENQ A;  1OBN A;  2E6V A;  3CZU A;  1DHK B;  5F3C A;  1OUX A;  5FLH A;  3SKV A;  4DXZ A;  1LOG A;  1W6P B;  2PXJ A;  2XL9 A;  4XQ4 A;  1K5M B;  1AL2 3;  1JZ6 A;  2PLV 2;  5FMB A;  4GH4 C;  1HXS 2;  1I5P A;  2PQQ A;  2JEM A;  4NRP A;  1FV3 A;  1ONA A;  2YC4 A;  4GB3 2;  4PIY A;  4AAP A;  5DMY A;  4OYU A;  2XKP A;  4QDQ A;  4DIQ A;  5F1R A;  5GZC A;  3J7N A;  5CU1 A;  1HRV 3;  1O4Y A;  3POJ A;  4BQ1 A;  1N1V A;  3OBT A;  1WCQ A;  2Q5T A;  3EB7 A;  3GF6 A;  4EZ4 A;  5FPA A;  3ZXJ A;  4EE2 A;  2Y64 A;  1H2N A;  4Y5S A;  4HKO A;  4RS5 A;  2ZGO A;  2X5I B;  3C7H A;  4CDX B;  4UWD A;  1ZRC A;  4LA3 A;  1W9F A;  2VUD A;  4N53 A;  5J98 B;  3VBU A;  4PLM A;  3VBR A;  3VBR C;  3BOP A;  3P3P A;  3PUA A;  3CLP A;  1RMU 2;  3ZYF A;  4Y5T A;  1ZZ7 A;  2ZX2 A;  2BBA A;  1F5J A;  3FUQ A;  4LUM A;  2BU9 A;  2WDB A;  2IVJ A;  1IZ3 A;  4KBB A;  3TEY A;  1YQ8 A;  1ZZC A;  3N3H A;  4IV3 A;  5K0U B;  4IEO A;  3VZJ A;  4P14 A;  5CIR A;  1VBC 2;  1DQ5 A;  2WA4 A;  3AKR A;  1NG0 A;  1JXN A;  1UZ0 A;  2HWC 3;  4O61 A;  1SQ4 A;  3JU9 A;  3PVO A;  4Q29 A;  5HXV A;  5LK7 B;  4IDZ A;  2VE1 A;  3SLI A;  2XB6 C;  1Q8O A;  2DVB A;  4LBQ B;  5BNP B;  1A3K A;  1NOV A;  1S2E A;  4YM2 A;  5KWR A;  4AQ6 A;  4AI8 A;  1AR8 1;  4LK6 A;  1U0A A;  1VAV A;  1UX7 A;  3ZSL A;  3PU3 A;  1S2B A;  2D5H A;  2YB7 A;  1PO1 2;  3U4S A;  4FSJ A;  1CR7 A;  2DVD A;  1XE7 A;  4FPH A;  3OUH A;  3C3V A;  1H2M A;  2R06 3;  1OLQ A;  3NO8 A;  1YHF A;  2WUH A;  4K1Z A;  5C9A B;  2W2I A;  1MAC A;  4DIN B;  5A6Z A;  3IT8 A;  1VJ2 A;  2DCT A;  4PJY A;  5FP3 A;  1OOP B;  1I5Z A;  3W20 A;  5I8Y A;  1VBA 2;  3IDE A;  4X8N A;  4BQ2 A;  4NRQ A;  2P6H A;  3I2F A;  1JOP A;  2W9X A;  2WFF 2;  2DVA A;  5IHR A;  5JLV A;  3ECQ A;  1ASJ 1;  4M3C E;  3VZK A;  1AJK A;  1UCX A;  3HN3 A;  1ODN A;  1GZW B;  1RUD 2;  2DCK A;  4OUL A;  2ZGU A;  2ZX3 A;  2B39 A;  3I3M A;  2ATF A;  2BYV E;  5F5A A;  4LO6 B;  3B94 A;  1S0J A;  3HMY A;  5FK7 A;  4CCL A;  1QF3 A;  4XF0 A;  3BTZ A;  2VCC A;  2YDE A;  3MO4 A;  4GAL A;  4ZY9 A;  1RUF 1;  3WXP A;  1D0G A;  3FHQ A;  1ULD A;  4Z92 B;  2JWP A;  5A80 A;  1D2S A;  2DUP A;  2FQP A;  1O59 A;  4O7X A;  5EJ3 A;  4GQ7 A;  3USU B;  2VU9 A;  4N7I A;  1Z7S 3;  1XB9 A;  3GGL A;  4P08 A;  3RS6 A;  4BOW A;  3LB9 A;  5L7O A;  1OA4 A;  1HXS 1;  1VAM A;  3DCQ A;  5HI0 A;  4HAN A;  1PMH X;  1I9R A;  4W6W A;  4Y4R A;  3M3C A;  1QJY 1;  3FL7 A;  2TBV A;  4XOG A;  1CJP A;  3R4U A;  5FMC A;  1BMV 2;  1WME A;  3H9A A;  2MEV 2;  2Y33 A;  1WCD J;  5IK7 A;  3RI9 A;  1RTV A;  3IZO A;  3QAC A;  3ZXA C;  3P6B A;  1BHG A;  1PX3 A;  2VVE A;  2QQV A;  2VZ1 A;  5E1R A;  4NIA A;  3WCR A;  5FYY A;  4XFI A;  3I59 A;  1IKP A;  3OEA A;  1UU5 A;  2ZEX A;  4LMF A;  3EXU A;  5E89 A;  5DDJ 3;  1MVQ A;  2DV9 A;  2YPD A;  4WM8 C;  4HKL A;  1WWY A;  3VHP A;  4COV A;  2W68 A;  2RHP A;  5AVA A;  4I01 A;  2YUE A;  4CU7 A;  5A7N A;  4YW7 A;  3NAP C;  3FHA A;  4Q5O A;  2RS5 1;  3I7D A;  1W6Q A;  1ZBE 3;  5DAB A;  4OUM A;  4ZS3 A;  3DPR B;  5K9Y A;  3NWK A;  1JBC A;  4JKM A;  5LA0 A;  1OD5 A;  2FDJ A;  4NHM A;  3LIG A;  1QJU 2;  3WP6 A;  1W6O A;  3FN9 A;  4GMP 0;  4QX5 A;  4W6Y A;  3CJI C;  5IW0 A;  5FO8 B;  1CAX B;  3EO6 A;  1T2X A;  2HWF 1;  3D0S A;  4Q4W 3;  4PLN A;  4COU A;  1AJO A;  1HN0 A;  2RS3 2;  4YVW C;  4Z2W A;  1B35 B;  2FDI A;  1JN2 P;  4KNC A;  2RJ2 A;  4AL9 A;  4CDU A;  1AR8 2;  4HZF A;  2NPI A;  2WZE A;  1A8D A;  3HNB M;  4AI2 A;  3V65 A;  1YFX A;  1UIK A;  3POB A;  1IPS A;  4CCD A;  5K7P A;  4C1W A;  1F4A A;  1E57 A;  3GZT B;  1OC1 A;  1Z0H A;  3INA A;  5DUW A;  1HRI 2;  2EAL A;  5FZE A;  4NHL A;  3DEM A;  2ZML A;  3POW A;  4DB5 A;  1FXZ A;  5EIY B;  4NJ4 A;  2QQL A;  3LSD A;  1RUF 2;  4FFG A;  3R4D B;  2ZGT A;  4KU7 A;  3T1M A;  4N7U A;  4QPG A;  2JJ6 A;  1DLC A;  3FLR A;  5IFT A;  2PLV 3;  3WX5 A;  1RHI 1;  1UW8 A;  4L97 A;  3DYO A;  1WW6 A;  2BFU S;  2DVF A;  4YWA A;  4DFS A;  4FFI A;  4OI2 A;  2PHT A;  3NNF A;  5IK4 A;  3A22 A;  2P4E A;  3OUI A;  2CY6 A;  2ORZ A;  5KXE A;  3FWE A;  5GKA C;  3MW3 A;  2ZOE B;  1PIV 1;  2I45 A;  4AED C;  1EUT A;  2DUR A;  4GJY A;  2IUW A;  4UFI A;  5CB7 A;  4L0P A;  2A70 A;  3I8T A;  3AP5 A;  5A3L A;  4C1X A;  4U2A A;  3RYR A;  5FYB A;  2R0H A;  2E32 A;  2D97 A;  1RUI 1;  1RJ7 A;  2RS1 1;  3EHK A;  4FPC A;  4JRL A;  5FCC A;  4DXR A;  3WW2 A;  1LEN A;  5EYX A;  5IYY A;  2R6Q A;  3CEW A;  1RUN A;  1CN1 A;  2HWD 3;  4CU8 A;  2ARX A;  2B8M A;  5FLI A;  1Q43 A;  1J58 A;  2KXL A;  5G04 L;  2DFC A;  1NZI A;  1VE0 A;  3IN9 A;  4BHP A;  3VUO A;  1COV 3;  3ZOI A;  4LLO A;  2P2K A;  3ZIW A;  3C7O A;  4D8M A;  3BI3 A;  5T5J A;  2EXJ A;  2J1V A;  2BOJ A;  1X50 A;  3I4I A;  3VHN A;  1HLC A;  2WLP A;  1RL3 A;  1V6O A;  1RHI 3;  5A7W B;  4XDO A;  1WW7 A;  5IVY A;  1CIW A;  3ZSK A;  1D2Q A;  5KHK A;  2BV4 A;  4JTN A;  1JZ8 A;  1BVV A;  3KHB A;  4Y1X A;  5BNO A;  1XYP A;  4GUL A;  4XIK A;  2X10 A;  2BGC A;  2XHK A;  3IIA A;  4QX7 A;  4PHZ A;  2HWF 2;  5C3R A;  1DYO A;  5CG9 A;  4AI3 A;  3AZZ A;  1PZ8 A;  1UIJ A;  3NNM A;  4LQR A;  2PA7 A;  2XJR A;  3HQU A;  3WP5 A;  3I2H A;  2XXZ A;  3WNO A;  3BOD A;  4XUR A;  1GOG A;  1VBD 2;  4LIT A;  3MIB A;  3KF5 A;  4HL0 A;  4E2G A;  4IE0 A;  1RB8 G;  1SDW A;  2Q8O A;  2RS5 2;  3S57 A;  1LOD A;  3Q8A A;  5L73 A;  1SLA A;  1R64 A;  2G9Z A;  4W8J A;  3AP6 A;  2A6W A;  5L9V A;  1YWK A;  2ORX A;  2C0Z A;  4B1M A;  1SLI A;  2VZQ A;  2ZX4 A;  1W6M B;  3PUQ A;  3WVJ A;  4AQT A;  3WD5 A;  1W8U A;  3U4X A;  4YVS B;  1QJZ A;  3Q8F A;  4W65 A;  1SHW B;  2CDO A;  5IAV A;  2B42 B;  2RM2 3;  4RGG A;  4D6S A;  5FZC A;  3O1O A;  1DIW A;  1RHI 2;  4E2S A;  1SDD B;  3CU7 A;  1G7Y A;  1YQ5 A;  5APA A;  5D1I A;  4C0B A;  4DMI A;  3QH7 A;  2MHF A;  5EWS A;  2YC0 A;  1ENS A;  2R07 2;  4O9E A;  2RR1 2;  1YFY A;  4HKW A;  3TEZ A;  1O3T A;  4OMC A;  2VNG A;  1GNY A;  4BMB A;  3CL1 A;  4CEW C;  1J1L A;  4F83 A;  1G9A A;  2ZGN A;  3O7O A;  2D93 A;  4FPO B;  5AC9 3;  1I3H A;  2Q1F A;  4BQ3 A;  4XFA A;  4MXW B;  2AEZ A;  2QQI A;  2ZGM A;  2VNR A;  1HQN A;  5CNA A;  2QZ2 A;  4W4Z A;  3N7L A;  1FI2 A;  3MIC A;  4Q4X 2;  4RGA A;  2ZEY A;  1JHN A;  1UU4 A;  1PZ7 A;  2JG9 A;  4WZC A;  1N3Q A;  5DZE A;  4IEU A;  5FZO B;  4XAB A;  2VMF A;  4E8D A;  2YMZ A;  5DUX A;  1IS3 A;  1F9K A;  1QJY 3;  3D82 A;  3J7H A;  4JDM A;  2B9V A;  4NE9 A;  3WF1 A;  1K3I A;  1S0D A;  3LWC A;  1W3V A;  3AP7 A;  3LDR A;  3N35 A;  3QOP A;  3WR0 A;  1G9F A;  3TWI A;  1QDC A;  2ZTN A;  1YIP A;  4BME A;  2N7G A;  2Y6L A;  4AI1 A;  1N3P A;  1B35 C;  1UXZ A;  1V6M A;  1YJK A;  2QQM A;  4RN5 A;  4TYS A;  1OKQ A;  4YVW B;  5LRR A;  5L36 A;  1RUI 2;  2H0V A;  2RS1 2;  2HEV F;  4QAW A;  4YW3 A;  5A7Q A;  1W8Z A;  5KBF A;  1RUF 3;  5ABJ C;  5CKN A;  5J96 B;  3OPT A;  3SKJ E;  5ACA 3;  1HRV 2;  5FZG A;  1C8M 1;  1AR6 1;  4P5Y A;  1H30 A;  1V6J A;  2RE9 A;  1UN1 A;  3RYK A;  2XJV A;  3ZFG A;  2KD7 A;  4N8M A;  2K9Z A;  3POS A;  2GME A;  3NNL A;  4XBQ A;  4WM7 C;  3NJY A;  2GH2 A;  3V64 A;  2D3P A;  2Q1M A;  4CDQ A;  1WMF A;  1O4Z A;  2DCZ A;  4JTO A;  5FY9 A;  2ZBJ A;  4DQA A;  3E97 A;  3OGJ A;  3VKN A;  1ALY A;  1DP0 A;  3LOI A;  4WM8 B;  2Q8C A;  3VBO B;  1AYN 2;  2JG9 B;  1REE A;  1MZ6 A;  1GOH A;  4WVM A;  2A6X A;  2VMH A;  3RPQ A;  2VQ0 A;  1TME 2;  2BVV A;  2WKK A;  1R1Z A;  4CCN A;  4AVT A;  1BJQ A;  2ARE A;  2WYS A;  3JZV A;  2ZHL A;  4R9A A;  1FX5 A;  1W2U A;  1YXW A;  4AHY A;  1WW5 A;  5B2G B;  4N43 B;  1NE6 A;  4HVR A;  3JCI A;  5FOJ B;  2PHX A;  3H3U A;  5JR7 B;  4HK9 A;  2IC1 A;  2YGM A;  4L2N A;  2W95 A;  1NQD A;  4P9G A;  1CZS A;  2XH6 A;  2JDZ A;  4Z07 A;  1ZX5 A;  3M3Q A;  4IEQ A;  4UAP A;  5FO7 B;  3WDX A;  3L2Y A;  1AR8 3;  1KFX L;  1RGS A;  2R07 1;  3O12 A;  1QQP 3;  3PUI A;  2FZ2 A;  2UUR A;  1JUI A;  1NA1 A;  4I0W B;  5FFO C;  1QIQ A;  1AXK A;  2R07 3;  4FPK A;  4YVS C;  2XBO 3;  4AEM A;  2B46 X;  4BQ5 A;  4CPB D;  3O0W A;  3O5S A;  3TEX A;  4HSL A;  4LXL A;  1UMI A;  1D4M 3;  4PI0 A;  2PTM A;  2JG8 C;  1NX9 A;  1IS5 A;  4ZHN A;  1LU1 A;  4KGQ A;  5GLW A;  5LBC A;  4XBN A;  2JE8 A;  3I3Q A;  5I8T A;  2C4X A;  3K77 A;  1XBF A;  5F5C A;  2LM3 A;  5LAT A;  1AHS A;  1VBD 3;  2JDN A;  4EWE A;  5T54 A;  3U78 A;  5C6C A;  1XYO A;  4R9B A;  2ZAA A;  3M8L A;  3MID A;  4Q8L A;  1IPJ A;  3ZIX A;  2I74 A;  4D0Q A;  4JGY C;  1S0B A;  2W3J A;  3HAG A;  5CFD C;  3LEI A;  2VBP A;  1OFN A;  3PLQ A;  1L7R A;  1UY3 A;  4NPM A;  2W92 A;  2VGD A;  2XLA A;  2EIB A;  4GD4 A;  3ZMO A;  1LES A;  1C57 A;  1PVC 3;  1NLR A;  3ILF A;  4CUC A;  1AR6 3;  1HRV 1;  3AXD A;  4CUA A;  1OVS A;  4IET A;  4H7M A;  3C8X A;  1GP5 A;  4JQT A;  4KBZ A;  3TYJ A;  1VBB 3;  3BUC A;  1BK1 A;  3KMH A;  2EIG A;  5M0T A;  3RFR A;  1COV 2;  4S2F A;  4PQQ A;  4Q27 A;  2Y6H A;  2ILM A;  1YO8 A;  4YRD A;  3BTY A;  5BNP C;  1H8T C;  3DKW A;  3NV2 A;  3ZYI B;  3H1M A;  5BXX A;  2R0F A;  4QQO A;  2BUK A;  1AUY A;  4G4F A;  3LPF A;  5FV3 A;  2LS6 A;  5F6K A;  4BPZ A;  2JDP A;  1URX A;  2PYT A;  2Z2S B;  2LRO A;  2ZGL A;  5C70 A;  4ISQ A;  2A3Y A;  4OZO A;  5EV7 A;  5J7M A;  5IVE A;  2G4I A;  3MV0 1;  1KQR A;  1SPP B;  1B35 A;  1GZT A;  2B45 X;  2Y60 A;  4LR4 A;  4LUK A;  4RS5 B;  1OLM A;  5BNO C;  3WOG A;  4NOT A;  1RJ8 A;  3U0Z A;  1CAX A;  2WO3 A;  4BXF A;  3Q8B A;  1UY0 A;  1DDL A;  1XXN A;  3VBR B;  4AXO A;  3BOW A;  1GP6 A;  1W8H A;  4XCB A;  4CDX A;  5FOB B;  1OKO A;  4Q4W 2;  4AVB A;  1LNS A;  1QHD A;  5F5Q A;  3MZH A;  3DXT A;  3J8F 3;  4PDW A;  1VMF A;  3BU0 A;  3OJB A;  1XC6 A;  1YUD A;  2QQJ A;  4ZXK A;  2W91 A;  1MQT C;  1VPH A;  2GDF A;  2XR4 A;  1AR9 2;  1PX4 A;  1SPP A;  2Y34 A;  3AYD A;  2VUA A;  3UKT A;  2PEL A;  2E53 A;  3ZPY A;  1V0A A;  5ISL A;  2XPJ A;  2I07 B;  5K0U A;  3GBG A;  3AK0 A;  4JGY A;  1LJ7 A;  2VOW A;  3JBG 3;  3VKO A;  2BPA 2;  1UXX X;  2OPW A;  3FZ3 A;  4C0H A;  2XLG A;  4Q4Y 3;  1PM4 A;  3LSE A;  3WQB A;  2VNV A;  5C4W B;  3IWZ A;  4LTA A;  4Y24 A;  2DCY A;  1RUI 3;  2RS1 3;  4PIX A;  4Y20 A;  2OYZ A;  5HXM A;  4QPG C;  1SFY A;  4CP9 B;  2JDK A;  1PK6 C;  4FPG A;  5AVP A;  5A33 A;  3DPR C;  3VL8 A;  3WIN E;  3IMM A;  4TLF A;  1NCR B;  2VZS A;  3B01 A;  3MFC A;  3NAP B;  4HN0 A;  1PVC 2;  4AGG A;  4ET7 A;  2GZW A;  4D7Y A;  5EP9 A;  1KS5 A;  1NLQ A;  3H8O A;  1Q8P A;  4PF1 A;  3WNK A;  1DQ1 A;  1ZNP A;  1VRB A;  1GP4 A;  4CU9 A;  2WSU A;  1W9Y A;  2Q4S A;  3PUS A;  2SLI A;  2NYY A;  1OQ1 A;  1GZW A;  3K3O A;  5IK8 A;  1H8T B;  4OHV A;  2ADD A;  3WDY A;  1FAT A;  4FAG A;  1OSG A;  1ZBE 2;  1QY4 A;  1H8T A;  4CUB A;  1IQA A;  4K8R B;  4QMA A;  3PNA A;  2LTN A;  4Q8K A;  2CL2 A;  4N9I A;  3TOJ A;  4NIG A;  4BJ0 A;  1ZZ6 A;  4TTG A;  4BLJ A;  5DXD A;  1ND2 B;  5I0D A;  5FUN A;  4NHX A;  4BXS V;  3RGB A;  1RUC 3;  3CMG A;  4AI9 A;  1BZW A;  4COW A;  5A3T A;  3OOX A;  3S5A A;  2HWF 3;  4Q4W 1;  4CZS A;  2C9A A;  3UNP A;  1VBE 1;  4PBP A;  5C7G A;  3KS7 A;  2FCU A;  5HCF A;  2DU0 A;  1G8W A;  1NT0 A;  2R04 2;  4P9I A;  5DG2 A;  2MEV 3;  4FVV A;  4E9K A;  5F6L B;  5CFC B;  3N9P A;  1O4T A;  5CA6 A;  5FYC A;  4P9X A;  1W28 A;  4ZON A;  2QE3 A;  3PTR B;  2Y6J A;  3ES1 A;  3NMB A;  1VBB 2;  5H9Q A;  3T2Q A;  1BQP A;  1O3Q A;  5A6Y A;  1A8M A;  3OGR A;  5C8C A;  3PME A;  3OUJ A;  1GFF 2;  2VOT A;  2YZ4 A;  4RYD A;  1PM7 A;  5A3N A;  2W1W A;  3VBO A;  4AFM A;  4XCA A;  2OII A;  4AEK A;  3BYW A;  3VLB B;  1EAH 2;  1ULF A;  3CF6 E;  4X8P A;  2JIJ A;  2WAO A;  1UY4 A;  4YGC A;  5FPU A;  3ALQ A;  4IE7 A;  1EV1 3;  1FPN 3;  4NN0 A;  1NYW A;  3H8R A;  4XMI A;  2GC3 A;  1VRH 1;  5A1A A;  3OCP A;  2P6C A;  5T5L A;  3X29 B;  3RJR A;  2WWS A;  3MHZ A;  4URT A;  5JIA A;  5KHG A;  4XAC A;  3IMN A;  1SFP A;  4UW6 A;  1UYZ A;  3SH5 A;  4LBK A;  4I30 A;  4TSV A;  3KV5 A;  4D94 A;  2VXR A;  3KT1 A;  3M2M A;  1AL0 G;  4LUL A;  2X05 A;  2RDR A;  5DUU A;  2GC0 A;  3WUC A;  5FZI A;  1PVX A;  1V6K A;  2J1U A;  3O1S A;  1CES A;  4K1Y A;  5I0S A;  1TG7 A;  4YVW A;  5FZ7 A;  1J84 A;  4S2H A;  2WQ4 A;  5B4N A;  4Q1P A;  3P1I A;  1FAY A;  1XE0 A;  2OZJ A;  1JI6 A;  1UMH A;  3AX4 A;  5C3Q A;  2VOK A;  4PLO A;  5DQ0 A;  1PVC 1;  1X8M A;  1LOF C;  1S0I A;  2OA2 A;  1MR5 A;  3ITQ A;  1SLB A;  2O8O A;  3M70 A;  3K4Z A;  3V0B A;  4JV4 A;  1RVF 3;  3CQO A;  1O6U A;  2V4V A;  5F7U A;  1ENR A;  4PF5 A;  3H3L A;  1WA6 X;  4YW2 A;  4XJW A;  1US2 A;  1NKG A;  1W0O A;  1YQ2 A;  3B69 A;  5A1F A;  3UGG A;  5EFU A;  2WZR 1; 
#chains in the Genus database with same CATH homology
 3GGL A;  4P08 A;  2ZXQ A;  2HYX A;  3MBW A;  1PMH X;  2L9L A;  3NRU A;  3WSO A;  1GUI A;  3FL7 A;  4BK5 A;  4QX2 A;  1KEX A;  5C71 A;  4GWJ A;  4ARX A;  1GMM A;  3VDB A;  2VMD A;  3P6B A;  4MGQ A;  1BHG A;  1PX3 A;  2VZ1 A;  3DYP A;  4QB6 A;  2WAA A;  2VZP A;  3OEA A;  2ZEX A;  2WO2 A;  4ZXE A;  2VZR A;  2VQT A;  3I3E A;  4CU7 A;  3FHA A;  1H6X A;  3JXS A;  4DUW A;  1OF4 A;  2C9K A;  4JKM A;  5LA0 A;  3T0A A;  2V72 A;  3WNM A;  3I3D A;  1JYW A;  3FN9 A;  3PUH A;  3E1F 1;  1GOF A;  1T2X A;  2VMC A;  1EUU A;  4Z2A A;  2Y6G A;  2RJ2 A;  2WAB A;  2XHN A;  2WZE A;  3HNB M;  4DUX A;  1F4A A;  1CZV A;  3VDA A;  1IQD C;  4A41 A;  1W0N A;  4M4P A;  3I2K A;  5DPN A;  4UI9 L;  1UYY A;  5EIY B;  3HOB A;  2QQL A;  1NAE A;  3BN6 A;  2W94 A;  1OH4 A;  3BGA A;  1DLC A;  5IFT A;  4A6O A;  3DYO A;  3LQC A;  3A22 A;  1UY2 A;  2ORZ A;  4A44 A;  4TXW A;  3EYP A;  4MGS A;  2QQO A;  1EUT A;  5G05 L;  4L0P A;  3OGV A;  4XUQ A;  3W5N A;  2E32 A;  4XUN A;  5LCW L;  1XPW A;  4GWI A;  4DXR A;  5JUV A;  3LE0 A;  1UWW A;  2VO5 A;  2E31 A;  1H6Y A;  5IYY A;  1CZT A;  2XOM A;  3ETP A;  4CU8 A;  5IJR A;  4CU6 A;  5G04 L;  3WF0 A;  2VR4 A;  5B4X A;  4D8M A;  3C7O A;  1JYV A;  3WF4 A;  4LPL A;  2J1V A;  2J1S A;  1W9T A;  1JZ8 A;  2X10 A;  1O8S A;  4QX3 A;  2LW8 A;  4A42 A;  2ID4 A;  4ARY A;  1DYO A;  2W1U A;  2VZO A;  3CZJ A;  4LQR A;  1US3 A;  3K4D A;  3IB3 A;  3I2H A;  4W50 A;  4XVH A;  4PT6 A;  3WNO A;  2X09 A;  2VM9 A;  1GOG A;  4XUR A;  2VL4 A;  1K42 A;  1OT5 A;  3ACG A;  2WQ8 A;  2YFU A;  1JZ4 A;  4W8J A;  1R64 A;  2BZD A;  1ULP A;  3I2G A;  2ORX A;  3LEK A;  2VZQ A;  2YG0 A;  4JHZ A;  3I2I A;  1SHW B;  2CDO A;  1O8P A;  1SDD B;  3C7F A;  3ABZ A;  3MV1 1;  2XON A;  5JXI A;  2JD9 A;  2HLE A;  3UES A;  1PMJ X;  3A21 A;  3WEZ A;  1OD3 A;  2VZT A;  2R7E B;  4OMC A;  4OUE A;  1JYX A;  1GNY A;  1K45 A;  4JKK A;  4DXS A;  2V5D A;  4CVU A;  5DN2 A;  2QQI A;  4DEV A;  4W4Z A;  2ZEY A;  3F2Z A;  4LKS A;  4ZZ5 A;  5J1X A;  3MUY 1;  5HPO A;  4M4R A;  2VMF A;  4E8D A;  3WF3 A;  3J7H A;  2VC9 A;  2B9V A;  4OMD A;  3WF1 A;  3T0D A;  1K3I A;  2ZEZ A;  5CYY A;  3ACI A;  3OB8 A;  1XNT A;  4MAD A;  2RV9 A;  2Y6L A;  2QQM A;  3WF2 A;  1UXZ A;  3DEC A;  4RN5 A;  4QAW A;  2EIC A;  4XUP A;  3NQH A;  3SKJ E;  2W1S A;  4DEQ A;  4UOJ A;  3T08 A;  3WNL A;  4P5Y A;  4QB1 A;  2BGP A;  4A4A A;  1ULO A;  2KD7 A;  2W1Q A;  2VCB A;  1JZ7 A;  3HNM A;  3THD A;  4A3Z A;  4XUT A;  2XQX A;  1JZ2 A;  1DP0 A;  2Y8K A;  2WO1 A;  4FI9 A;  4YPJ A;  1GOH A;  3NNG A;  1OF3 A;  1JZ3 A;  2QQN A;  3C7E A;  2WYS A;  2CDP A;  5JXG A;  1JU4 A;  1W8O A;  5EJ1 B;  2J1A A;  4E8C A;  3UET A;  3OEB A;  2W5F A;  3LEG A;  2W95 A;  1W8N A;  3CIH A;  1CZS A;  5IFP A;  2BGO A;  4UAP A;  3SEE A;  3LPG A;  2VZV A;  1K12 A;  3PUI A;  3NJX A;  3VDC A;  2VTF A;  1CIY A;  2B4K A;  3WNP A;  1UMI A;  2Y6K A;  1NX9 A;  4MO3 M;  5FUI A;  2DCJ A;  2JE8 A;  2BER A;  2WBK A;  3HPN A;  2C4X A;  3DYM A;  3K77 A;  4QX1 A;  2J1T A;  4DXT A;  3T2P A;  4JKL A;  1UYX A;  3OG2 A;  5CZK A;  5JXH A;  4D0Q A;  2W3J A;  3IAP A;  3LEI A;  5JMO A;  3HJR A;  1L7R A;  1UY3 A;  2W92 A;  3IAQ A;  4QX0 A;  1SG3 A;  2EIB A;  1NUK A;  4CUC A;  4KMQ A;  4CUA A;  2EID A;  3SEP A;  3T2O A;  3C8X A;  4QB2 A;  3ZM8 A;  3THC A;  3I3B A;  2J1E A;  4IUG A;  3III A;  1UY1 A;  3AC0 A;  2WN3 A;  4PQQ A;  4QDS A;  2Y6H A;  3W5M A;  1GQP A;  2YC2 A;  4P02 B;  2VCA A;  4QPW A;  3HEI A;  3LPF A;  3VD7 A;  2LS6 A;  3VD4 A;  5C70 A;  4BK4 A;  4OZO A;  2VQU A;  3A7Q A;  5JXJ A;  2DDU A;  2RVA A;  1J83 A;  1RYY A;  3MV0 1;  3T0B A;  2WO3 A;  1UY0 A;  3VD3 A;  1F4H A;  4KI5 M;  2W87 A;  1LNS A;  1W9S A;  2YFZ A;  4LHS A;  2E33 A;  3K4A A;  3IDA A;  1JYN A;  3K46 A;  1XC6 A;  2QQJ A;  5LA2 A;  1GU3 A;  1MPX A;  2W91 A;  3A23 A;  2J1R A;  1TVG A;  2JKX A;  3I2J A;  2JDA A;  1PX4 A;  2W46 A;  3VD5 A;  4GZ9 A;  3ACH A;  2VZ3 A;  3T09 A;  1KGY A;  3K75 B;  2J7M A;  1UXX X;  4BDV B;  3D3A A;  3WQB A;  5HXM A;  3OGS A;  1JHJ A;  3OBA A;  4DUV A;  2VZS A;  2PQS A;  4HG6 B;  1JU3 A;  2QBX A;  4KWU A;  3CKH A;  4ET7 A;  3GDB A;  1WKY A;  4PF1 A;  3WNK A;  3CZU A;  4QDR A;  4CU9 A;  3SKV A;  3HNY M;  2VJX A;  1JZ6 A;  1D7P M;  1P8J A;  1I5P A;  2YC4 A;  4AG4 A;  5DMY A;  4OYU A;  4QDQ A;  4CUB A;  4BJ0 A;  1WCQ A;  3EB7 A;  4TTG A;  5I0D A;  2Y64 A;  3I97 A;  4BXS V;  3CMG A;  3C7H A;  4XUO A;  3UNP A;  5C7G A;  2QQK A;  2BBA A;  5LA1 A;  4AAX A;  4ZZ8 A;  3MUZ 1;  2WDB A;  2Y6J A;  3T2Q A;  5JR2 A;  3WNN A;  2VME A;  3OGR A;  1W99 A;  2VOT A;  2WN2 A;  4RYD A;  2W1W A;  1UZ0 A;  4P00 B;  3ACF A;  1W9W A;  2WAO A;  2OKX A;  1UY4 A;  3NJV A;  2E26 A;  1L7Q A;  5A1A A;  1UX7 A;  4MOA A;  2YB7 A;  3VD9 A;  1XNA A;  4JX0 A;  1UYZ A;  2WUH A;  3U37 A;  1CX1 A;  2Z4F A;  2X05 A;  4A45 A;  5EJZ B;  2W47 A;  2J1U A;  3C7G A;  2C26 A;  3I2F A;  1JZ5 A;  2W9X A;  1TG7 A;  2J22 A;  5B4N A;  1J84 A;  5IHR A;  3ECQ A;  3P1I A;  1JI6 A;  1UMH A;  3HN3 A;  4XZU G;  3CDZ B;  5DQ0 A;  2DCK A;  2ZEW A;  3GM8 A;  2VZU A;  3K4Z A;  2VCC A;  3MO4 A;  4ZY9 A;  3CQO A;  1HN1 A;  2V4V A;  2EIE A;  5F7U A;  2WZ8 A;  3FHQ A;  1O59 A;  3GXU A;  1US2 A;  1NKG A;  1YQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...