4QQ6A

Crystal structure of tudor domain of smn1 in complex with a small organic molecule
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
b'QQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Survival motor neuron protein
publication title Crystal Structure of tudor domain of SMN1 in complex with a small organic molecule
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 10
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2014-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4qq6A00
3FLGA 3EAEA 4E7LA 2RJEA 4QQDA 2E6NA 2DAQA 2LCCA 2RHIA 4PL6A 3OS0A 3M9QA 3LH0A 2X35A 3OY9A 3S6WA 3DB4A 5CIUA 5IAYA 4B9WA 3OYIA 3Q1JA 4BACA 2E5QA 2MWPA 2EQJA 2VYTA 1SSFA 5KCOA 4CRIA 3OYBA 3OYCA 3L2VA 3S3MA 2R58A 3MP8A 2BUDA 2O4XB 3PMTA 4IKFA 2EQUA 2JTFA 2BKDN 4IUPA 4N4HA 3LGLA 5D6XA 4E7HA 3BDLA 3OYFA 2FHDA 3OA6A 2NLUA 3F70A 2L89A 2D9TA 2RJCA 4IURA 3OYMA 2LVMA 2MWOA 2WACA 4LD6A 2B8AA 3OMGA 1H3ZA 2M16A 4QQGA 3MEWA 3CEYA 3P8HA 3MEAA 5KCHA 4BDYA 2P0KA 3P8DA 3QJ6A 2EKOA 4PLIA 3MEUA 1OI1A 3OS1A 2RHXA 4HCZA 3OYKA 3L2WA 4C5HA 2K3XA 2X4WA 3NTIA 3PFSA 2LTOA 4N4GA 4X34A 2R57A 4ZTFA 1OZ3A 3DB3A 4QVZA 2RHYA 4BD3A 3LX7A 2HQEA 4L59A 4GY5A 3OYLA 3OB9A 5KE2A 2RHUA 4N4IA 4IUVA 2M0OA 5D6YA 5J26A 4C5IA 3OYGA 2QQRA 3FC3A 3L2RA 3PMIA 2EFIA 4ZTJA 2QQSA 2R5AA 3OYDA 4FL6A 4QQ6A 3MP1A 3LYIA 3QIIA 2G3RA 4E7JA 4E7KA 3PNWC 2M1HA 1WJSA 2DIGA 1WJRA 1OYXA 3E9GA 3NTKA 5M9OA 2LDMA 1RI0A 3OMCA 4OVAA 3S3OA 1KHCA 2X4YA 3OQ5A 2RO0A 4C5GA 2EQMA 4B9XA 3NTHA 3ME9A 3GOXA 3L2UA 3L2QA 3DLMA 3ASKA 3MP6A 4NS5A 2DIQA 3OS2A 2RJDA 3MEVA 3OYNA 4Q5WA 2EQKA 2JZ2A 3H6ZA 3KUFA 3S3NA 1OZ2A 3E9FA 2XK0A 5J39A 4BE0A 5IN1A 2CKKA 3LLRA 3LGFA 3OYHA 4A4EA 2GFAA 3OYJA 1WGSA 4PLLA 2K3YA 4E7IA 2HQXA 5KE3A 4A4FA 3MO8A 4IUTA 1XNIA 4Z02A 2RJFA 4EDUA 3C4SA 2RI5A 4BE2A 3FEOA 2O4XA 5FROA 3H8ZA 4II1A 5D6WA 2GF7A 2X4XA 2L8DA 2YRVA 3QKJA 5C6SA 5KH6A 5FRMA 3META 2IG0A 3FDRA 3L42A 2XDPA 1G5VA 1MHNA 4IUUA 2RHZA 2BIVA 3QBYA 4FU6A 3SD4A 3O8VA 3OYEA 2GFUA 4BDZA 2RI2A 4C5EA 4IUQA 2R5MA 2F5KA 4RG2A 4BE1A 4QW2A 2RI3A 1N27A 2PQWA 5C0MA 3UT1A 2LRQA 3ZEHA 4A4GA 4UC4A 3OYAA 5FRNA 1WJQA 2L3RA 3UWNA 4A4HA
chains in the Genus database with same CATH superfamily
2MCNA 3JRZA 2A37A 2P84A 3CCQA 4ESRA 4KULA 2CP3A 2QA4A 4PJMA 2KK4A 1NPPA 2LT4A 4N4HA 1R0BG 4KH0B 4WF2A 2B8AA 1QP3A 4RMOA 5KYWA 3MEAA 3QXEB 2P0KA 4N4GA 2Y90A 5HY6A 2SRCA 1KHIA 2EAYA 4RG8A 3CCSA 2C06A 3LX7A 1N9SA 2V1RA 2DXBA 3CC4A 2DILA 2L3PA 1AEYA 3H0IA 4Z88A 4C5IA 3JCMV 4M7AA 2KMTA 3SDZA 4ZTJA 3CBPA 2DXTA 3MHXA 2K5IA 3NTKA 3VS6A 1AOJA 1VQ8Q 2LZ6B 3OQ5A 1K73R 4HKEA 4A53A 1FMKA 4N0AC 1YIJA 2F2VA 4M75A 1U1SA 4XU0A 3MEVA 1ZBXA 3UPUA 1YJWQ 2KROA 4XTVA 2CKKA 1EX4A 5CAIA 1JXOA 1WGSA 1VQ8T 2HL3A 1K9MR 1SKUB 1XNIA 1GCQC 4ZNXA 1K8AU 2FO0A 3WVDB 3I55Q 1OEBA 1X43A 1YITQ 1SEMA 4KRTA 2KGTA 2F5TX 2XDPA 2RHZA 4KBMB 3QG1A 2CZ0B 4QW2A 4MDXA 1VQ9A 5EG2A 1YITT 1PKSA 2ESWA 2ZPHB 1VQ4A 2WSCE 1WYXA 2NUPB 1IB8A 2DBKA 4OMQA 1WA7A 4FT2A 3JCMX 4PL6A 4F7UA 1K9MU 1X6GA 4ZGDB 2DL7A 4DEYA 1M4ZA 2VYTA 2DL4A 2QTVA 4CRIA 2CSQA 3VRYA 3LWHA 1ABQA 1BI1A 2KR3A 3RIRA 1WFWA 2BZXA 3V7CA 1PWTA 1IGUA 4M7AC 1JU5C 2EGCA 2ZPFB 1IHWA 4LDUA 3P8HA 1YCYA 4PLIA 1SHFA 1PSEA 4PJOA 1K0SA 2LQKA 1UECA 4X34A 5LJ3f 4J6WA 2FPDA 2LMJA 3ULRB 3OB9A 2WSFE 1I07A 2DLPA 1MNEA 1AWOA 3L2RA 1D1AA 2R5AA 2ROLA 1D0YA 1K9AA 2MMPA 4M78D 1OYXA 5GMKm 1X27A 2EWNA 1KHCA 1MMAA 4J9EA 4BI4A 4FYXB 1I8FA 2V8IA 2RM4A 3NMZC 1YJNQ 4DEXA 1YI2A 3RERA 4LDXA 1I5LA 3EHQA 3ZBDA 2KI7A 3JSCA 1KC8R 4C0DC 3CCLA 1GFDA 3U23A 4CC7A 4JJNK 1K76A 5D6WA 2YRDA 4OGCA 4M77G 3JV3A 1MHNA 4JRKA 4IUQA 2FRYA 3WXMB 2RI3A 2O88A 1PRLC 3JCMJ 2V26A 4RTWA 1VQ6A 1UTIA 2E70A 3PVQA 4M77E 1D1CA 1QWFA 4CI0C 4PFOA 3JB9D 5A0GA 3PIPA 4E2FB 4L5GA 3R6NA 4M78B 3CCEA 3QWYA 3JCMQ 2RNAA 1AWWA 1JEGA 1PM3A 1AD5A 2PUKB 3RKXA 3BFMA 3OBYA 2QQBA 4IUPA 3VRZA 1TOVA 1E6GA 2PNIA 3E2UA 1N8RC 2DTHA 4C8QA 1KQ1A 1MMNA 3SB2A 2DJQA 2A36A 3M0PA 5CCAA 5LJ3h 2KRMA 4BD3A 3OYLA 1UE9A 2JS0A 3G6EA 4OB1B 2LQWA 3EH2A 2QQRA 3NPFA 1IZ6A 2HAXA 4J6XA 1YP5A 3PVLA 1WQWA 4M7AD 4E7KA 5KYUA 1H8KA 2GTJA 4ZGEB 1D3BA 4FYWB 1KD1U 3S3OA 3CD6A 1AHJB 2EQMA 1QVGP 1RABB 3I56T 4OB3B 3X26B 4E7SA 3C94A 2DYBA 1TUDA 1UG1A 2JZ2A 1MV3A 3S3NA 4F04B 4BE0A 1AZGB 4M75D 2D8HA 2J06A 1AT1B 3VJPA 3OW2A 1FX7A 4IUTA 3A5ZB 3TVTA 4LE9A 3EH1A 1VQLT 2CP5A 3V8KA 4II1A 3A1PA 1H641 3WVEB 3M0SA 1M8VA 1G5VA 5CKDA 5KYWB 1YNZA 2KT8A 1A0NB 3OSSC 1ARKA 2RK2A 2NUZA 5C0MA 1GL5A 1X2KA 4QKUA 3OYAA 2K7AA 2ECZA 1U06A 1GXIE 1KD1C 2BTTA 2RN8A 2RHIA 3NGPA 2P0PA 4M7AB 1T3LA 3OYIA 4K11A 5IHIA 1S72A 5KCOA 1KQSA 3PMTA 4FSSA 2NWMA 2KQWA 2YHTA 4F7UF 1X69A 1TXQA 3VUBA 2LVMA 2AKLA 4M75B 2OTJA 4JJCA 3A8GB 2CP7A 1MGQA 4XTYA 4B6MA 3HL8A 2JOYA 2EKOA 5IH2A 2PVOB 1YJ9A 3BE3A 1M3BA 1I4K1 1TS9A 4PJOD 2EVRA 4EMKA 3EGXB 5KE2A 3A8HB 1Q81U 5D6YA 5A0LA 2QEXT 2RQUA 5GANf 4ME7A 2D1XA 2DBMA 2LDMA 3NFCA 4WTOB 1T3SA 4PNOA 1BI3A 1F1BB 3EGDA 4J7FA 3JCMe 1VOMA 4RTZA 2LNVA 3OYNA 3A8MB 1QWEA 4C92G 4XTWA 1S1NA 2W0ZA 1QW1A 4PLLA 2GNCA 3VU3C 3EFRA 3HRSA 4A4FA 2JS2A 1W2BA 4YTLA 2RK1A 2V1QA 1LPLA 3HRTA 3C4SA 3RKYA 1OX9A 2W10A 1Q82R 4C92E 2RMOA 2X4XA 1YHQT 2PU9B 3FDRA 4MMKA 4PFPA 4BDZA 4PJOB 4E47A 1QVFP 5GAMf 3ZL7C 3EG2A 2XMFA 3ZFJA 3M55A 3AHUA 3EAEA 5GAN6 2PVDB 1JJ2P 1QVGS 4FYVB 3CMEA 2RQVA 2D0QB 3CC7A 4JJDA 2E5KA 4EMKC 2R58A 2BUDA 3I5SA 2DZCA 2ED1A 3M5AA 4E7HA 4HXJA 4PFZA 1U8RA 3PGGA 1SRLA 2YXYA 1VIEA 2EJFA 4Y92A 1H92A 4Z8AA 3GPLA 1G3WA 1VQ9Q 4HCBA 3JCMd 3I35A 3CCJA 1VQ4Q 1Y96B 4C8QD 2HBPA 5AYFA 1O75A 1QLYA 1I81A 2ZZDA 4GY5A 1AVZC 3X24B 1M2OA 2IPOB 4M4ZA 4ANJA 4IUVA 2M0OA 5LJ5f 2GTOA 5IXBA 1VQ4T 2QTXA 2QQSA 1M2VB 3JCMP 5GANh 3OYDA 4QQ6A 2VGMA 1RACB 2HKNA 4JRIA 1M1KC 1VQKT 4LN2A 5CQXA 2X4YA 2RO0A 2CH4A 1OU9A 1K1ZA 3CPFA 2V8KA 3OSVA 1RLQC 1RLPC 1TTHB 1X6BA 4HA8A 2P4RA 5IN1A 1TSFA 1WHMA 1PSFA 5GAN2 5CQYA 2L5QA 1UGRB 4BI8B 4E7IA 3CPWP 2M51A 1XOVA 2KAFA 4BE2A 3PTAA 2AIRB 1M90R 2F2XA 2QGGA 4HCCA 1AZEA 2DRMA 4FYYB 2CP6A 4C8QB 4M7DG 1BI0A 2HSEB 2QASA 2COWA 3HSBA 2DD4A 3O5ZA 2K57A 3CCVQ 3UATA 1D09B 5GAN8 2ROTA 2A0FB 5GAMh 2JM8A 5FRNA 1UHFA 1SF9A 2WSEE 4M77A 1VQ7Q 1YCSB 4M7DE 3OS0A 4CC3A 1YI2Q 1KFZA 2KE9A 2L2PA 3G71A 3CCVT 3DB4A 1WNLA 1WDXA 1WHLA 2IVWA 1OX8A 3G4SA 1UB4A 3JB9I 3MKDA 1TU0B 4IIOA 1VQ7T 2EQUA 4OMLA 1FYNA 2E6ZA 1Q95G 3M58A 2VXFA 4F16A 4DOVA 3M0QA 9ATCB 4XTXA 3VS0A 2E10A 4AG1C 3CEYA 4LDVA 4OMPA 4JDSA 1NZ9A 3KXTA 3RUXA 3GIBA 1VQPA 3RNJA 1QVFS 1VQMQ 2RF0A 1R0CB 2HZYA 2JVVA 2BZYA 3CCRA 2RHUA 4RTTA 4N4IA 5LJ5h 3CCMA 2DXUA 1JJ2S 4M78C 2FZKB 2HBWA 3LYIA 4D8DA 2X3XD 1VQMT 2EJGA 4C5GA 2OI3A 1RAEB 2KXDA 4XK8E 5CKHA 1SPKA 5DM7R 1DJ7B 5FU7C 2IIMA 5L8RE 3REAB 3LGFA 4Y91A 2EYWA 3V7RA 1B7TA 5HCKA 5GAOl 2RQWA 1K8AR 4CC2A 2X9HA 5CK9A 2I2LA 1IXDA 1K4US 1RL2A 3V7SA 4J9GA 3CMAA 2DVEA 2HL5C 3X28B 2AT1B 3H0HA 5HKCA 4C5EA 3VS4A 2CDTA 1N27A 3THKA 1VYUA 3JCMb 4EMKB 5HK0A 1T0JA 3OS5A 2RJEA 1K0XA 1VQ5A 1TUCA 2COZA 2LX7A 3M9QA 2ZCFB 1SSHA 3QYHB 2E3IA 3EGXA 5CIUA 1FWZA 2ZPEB 1YJWT 1MUZA 2XHCA 4MMLA 1Q86C 5GMKi 3MP8A 2KSSA 4MZPA 4L6V5 4NOYA 2NLUA 3I55T 4HVWA 3CPWS 2L89A 5DY9A 3EGDB 5LJ3g 1N6AA 1QCFA 1ABOA 3BY7A 2DJZA 4LDWA 3CCUQ 4J9HA 4HCZA 4OMFB 5I21A 2DEQA 4AFQC 3H0FA 5GJVB 3OYYA 3OYGA 2DA9A 4RCBA 3CCUT 1WPYA 2GGRA 2K3BA 1KG1A 2QDYB 3HFOA 3J81E 1KIKA 2FZGB 2M1HA 2DIGA 4KGVB 3UF4A 2JUFA 4KUDK 2MAMA 4LXCA 3X20B 1VQOA 1Z9ZA 2KY9A 1LCKA 3TSZA 5LL6S 2PTKA 3GOXA 3L2UA 1EFNA 2M9UA 4M75C 5EC7A 1YJ9Q 1RUWA 2QAZA 1UGPB 1OV3A 1HJDA 1N8RR 5KE3A 2KRSA 1NEBA 1UEBA 2XIDA 2K9GA 2ZGWA 1YJ9T 1ZUUA 4C92A 1K73C 3VS3A 4M78F 4J6YA 2ZPIB 3EHRA 3UA6A 4ELYC 4D8KA 4R56A 2VVKA 2C0TA 4LD9K 2NUTB 2LRQA 4A4GA 2OX7A 5J39A 1Y96A 5DLOA 3MPUB 3JCMc 5GANj 1N8RU 4QQDA 2RA2A 4HT8A 4M77D 1VUBA 3A98A 4JLGA 1WXBA 4BACA 1M8MA 1YJNT 3H9NA 4DQ2A 1SSFA 2KEAA 1JO8A 1M2VA 3KBGA 4ZN3A 2HDAA 1GBQA 2DXCA 2DK3A 3VS7A 1OI1A 2CP0A 3PE0A 4XTZA 4PJOC 1BK2A 2O01E 2LTOA 3PFSA 5GMKe 2LC4A 4JRQA 3JB9F 3HTRA 3CMEQ 2OTLQ 5GMKj 7AT1B 3T9NA 2EYZA 1V29B 1P92A 5GAMj 1PNJA 1ZBJA 5FU7B 1KD1R 1BCMA 2CS7A 3PNWC 2XI9A 4IIMA 5M9OA 2OTLT 2DNUA 2KYBA 1LOJA 5GANd 2YUOA 1R77A 4M77B 1W70A 1JRIA 1QVGA 4J83A 2DFUA 4J9IA 4A63B 2MF2A 6AT1B 2LT1A 2YLCA 2JMCA 3MO8A 4Z02A 2QQAA 1MMDA 2JTEA 5GAOq 2YSQA 4M7AF 4JZ4A 3DKMA 2IG0A 3L42A 2H8HA 1YN8A 2MYSA 3VV0A 3QBYA 2YUNA 5IT9E 5LJ5j 5KYXA 3UT1A 4O5VA 2QYZA 1VQ8A 3TREA 3EG1A 4M75F 3M59A 1UUEA 4M7DA 3SWNB 3CQTA 5GMKl 1KC8C 1QCNA 5GAMd 1NYFA 4ZGJB 4RKUE 2ED0A 2D6FA 3MJXA 1GFCA 1NPRA 3DLLA 2YUQA 4KT0E 1X6OA 2FVUA 2A3LA 5D6XA 1CSKA 3OA6A 4XU3A 2D9TA 2MWOA 1YITA 2QQ9A 3VS2A 2KBTA 3RESA 1WLPB 3C12A 3CXCA 3P8DA 4C8QC 1IO6A 4X9CA 4J9FA 5GANg 1OZ3A 1Q81R 4OB0B 1ZUYA 2HQEA 2YRCA 1SRMA 3CBOA 3TQ7P 3OW2P 1NJIU 1WJSA 5LJ5d 4WCIA 3EGUA 1M27C 3GF5A 4AG2C 4B9XA 2LX9A 3DLMA 3INZA 4NS5A 3CCQQ 3FJ5A 1J3TA 4LNPA 4MZTA 4F7UG 2EQKA 2OAWA 4GLKA 4PJOF 2QA4Q 1BB9A 2HQXA 3HRUA 2E3HA 3CCQT 2LJ1A 4M7DC 1BYMA 5GAMg 5KYNA 1YFNA 2QA4T 4F17A 1NG2A 4C92D 5D7UA 2BIVA 1NLOC 1ZUKA 5A0DA 2GFUA 5ECAA 3CCSQ 1YWOA 1NJIC 2QGFB 2VWFA 1PRMC 4AFZC 4EPCA 3M4YA 2CSIA 3FLGA 3CC4Q 1M1KR 2DAQA 1JJ2A 5IHNA 4HCKA 3Q1JA 2O9VA 3CCST 2EQJA 1WXTA 2K2MA 3JB9H 2E1HA 2EKHA 2YT6A 3CC4T 4IKFA 1NYGA 3QHSA 3BDUA 3CMAQ 2JTMA 3OYFA 1Q7YC 3F70A 1YIJQ 2AK5A 2J6KA 2QK0A 4A4KA 5CKEA 4DBHA 5GAN3 3A8OB 2KXCA 2DERA 3IQLA 2J05A 3EFOB 2YUPA 5LJ5g 3CMAT 2QG9B 5AT1B 3M57A 2K3XA 1M1KU 1YIJT 1OULA 4ZTFA 1B3QA 1VQ5Q 3LW5E 4C92B 4JS4A 1M3CA 5FWBA 2F1LA 1AWXA 1W2BP 2FRWA 1IHVA 2XD0A 2BZ8A 5GAOr 4X9DA 1T0HA 3QIIA 4J9DA 3E9GA 4PK4A 4XU2A 1RADB 5CKBA 2NUTA 2OJ2A 4GBQA 4C8QF 1JB0E 5GJWB 1RAIB 3E9FA 1VQ9T 3OYHA 2X51A 1OU8A 3CC2A 2RJFA 2JMAA 3CPWA 3J7AF 5FROA 2DEUA 4OMOA 1VYVA 3FB9A 4KGZB 5KH6A 2DX1A 2C0IA 5CR2A 3I56A 4DOWA 3GNFB 1VQOQ 5J3BA 1LVKA 3OW2S 1XQHA 2K5LA 1VQNA 5FW9A 2L3RA 3M4GA 1QKXA 4J9CA 1VA7A 3CBMA 3M0RA 2HEQA 1MNDA 1VQOT 4Y28E 1VQLA 2QI2A 3FRNA 1Q82C 4M7DD 5IAYA 1UGSB 4C0FA 4A54A 5LJ3j 2O4XB 1H3HA 2KVQG 3QPHA 3LGLA 2YWWA 3URGA 4IURA 4OB2B 5DLQE 2X4JA 4PJLA 4PJJA 1PG5B 4J8OA 2Z0WA 2EPDA 2EYYA 1XTDA 3QJ6A 2A7YA 4C0ZA 3TCJA 3OYKA 3LWIA 2VKNA 1NEGA 2R57A 3DB3A 3HP9A 5GAOn 2ABLA 3CCLQ 1Y71A 2DE0X 2DVJA 3QJYA 4KUIA 4XQ3A 1GBRA 3PMIA 1YI2T 4AMCA 4JS5A 2E12A 3MP1A 2LNHB 1R8OB 2ENMA 2RQTA 2VC8A 3CCLT 4BY6B 1RI0A 2HQHA 5KYXB 3OMCA 2EQIA 1AWJA 1VQ6Q 1B34B 2CREA 2JW4A 3L2QA 4M7DB 3MP6A 3QUIA 4O6JA 1ACMB 3JCMW 2RB6A 3PIOA 3SWNA 1X2QA 3CCEQ 2KYMA 3OYJA 1Y7XA 1VQ6T 2CT3A 5LJ3d 2DL5A 1EIFA 2K3YA 2QEXA 1GCQA 2JJ9A 4PKCC 3FEOA 2E4HA 2GCXA 3H8ZA 3E19A 3VS1A 3CCET 2YRVA 2SEMA 3RBBB 4RTYA 1UHCA 4FU6A 4EMGA 1M5Q1 1VIFA 3R6OA 3JCMf 1W2BS 4CC4B 1Q86U 1WX6A 2LJ3A 2D8JA 1PCXA 1TUGB 1WJQA 2HKQB 3EG9B 4A4HA 3G6EQ 2HMAA 3QSUA 2CH4W 4HVVA 2EW3A 2FB7A 2CT4A 2K79A 3UDCA 1OPLA 2YDLA 4M77C 1IGQA 2DYIA 2K5FA 4JUVA 2J6OA 1D0ZA 1M90C 1YHQA 4BB7A 2EYXA 3L2VA 3G6ET 1WHKA 2AZSA 2CUDA 3QDRB 3CD6Q 2JM9A 2O2OA 2RJCA 2FPEA 3OYMA 4LD6A 3OMGA 1UDLA 1GCPA 2M16A 4QQGA 4JPBW 5KCHA 1UJ0A 3OS1A 1QCOA 3CD6T 4XTUA 1NLPC 3NTIA 2HCKA 3X25B 4C5HA 4AFUC 4QVZA 1FXXA 2K6DA 2CGHA 5J26A 2KRNA 1O9SA 1ZSZA 3SWNC 3FC3A 2AHJB 3VS5A 1WQ7A 1WJRA 4MDWA 4OVAA 1Y57A 1QKWA 3M56A 1M3AA 1WZOA 2CYZB 3NTHA 4D6WA 1K73U 3OS2A 2RJDA 2XK0A 1G3SA 1S72Q 2ZPGB 3SHWA 2L3QA 1NBEB 1I5OB 1WHJA 2JT4A 2EGAA 3TU4K 2RI5A 1I1JA 2L3SA 3G7ZA 1VQKA 3EG0A 2L8DA 1S72T 3J80E 2OTJQ 1YWPA 4OGEA 1JQQA 2PUOB 3SD4A 2DM1A 3JCMh 3D7SB 4RG2A 1PC0A 3EFOA 1OPKA 3RMSA 2F69A 3HKSA 2P4TA 2XU8A 2QXFA 1K8AC 3UWNA 4J7IA 2OTJT 3EG3A 3C0CA 4E7LA 3QZ5B 3SEMA 2LCCA 4AFSC 1WIEA 2L0AA 3OYBA 3LH5A 3OYCA 5FWCA 3TEEA 5CVIA 2DF6A 1Y0MA 3REBB 1E6HA 3BDLA 5GANe 5FLXE 1ZSZC 4FM4B 2WACA 2C0OA 4FT4A 2DZ9A 1K9MC 5KYYB 3FJPA 2COYA 4M78G 3CCVA 2AKKA 2RHYA 1ZA2B 4M77F 1VYTA 4LDYA 2BE7D 1TWBA 1BIBA 3QYGB 1VQ7A 2EFIA 1QP2A 4M78E 5FU6B 2VXEA 3SFMA 2XKOC 1YBYA 4DA4A 2DETA 1PKTA 4DBFA 3ASKA 3RDVA 4J9BA 1N5ZA 2MI6A 5GAMe 3L2ZA 3MCAB 4RTXA 4FW1A 3LLRA 1PHTA 3CC7Q 1ZHIA 1JBMA 1VQMA 2VV5A 1M30A 2O4XA 1E7OA 3CMET 4NL2A 1KC8U 3QKJA 2ZPBB 4C92C 3C95A 5C6SA 3JB9G 3CC7T 1BKBA 2Y4YA 1TG0A 1UGVA 3NHNA 4IUUA 3CCJQ 3OYEA 2FYKA 2R5MA 2K4YA 2O31A 3L1AA 2V8JA 1SG5A 5GAOp 5I11A 2F2WA 2P0QA 4GLMA 4RTVA 2GBQA 1G3TA 2DD5A 4LUEA 3EFSA 2M02A 1ZLMA 2E6NA 2FZCB 3HFNA 3CCJT 2OAUA 2J7IA 3LH0A 2X35A 4X1VA 2XDDA 1RI9A 4B9WA 3CC2Q 2MPXC 2GQIA 3S3MA 3P8BB 5LJ5e 5CKFA 2I0NA 1U5SA 1HYOA 4EMHA 1MMGA 2ATCB 2LCLA 1XJWB 2FG0A 3I56Q 1RAFB 4RCCA 3E1SA 3CC2T 1B34A 1HD3A 1HXDA 2H3JA 1M1FA 4DBRA 1WHHA 3MEWA 1VQNQ 1X75C 4BDYA 4M7AG 3GNGA 2DTIA 4E7ZA 2RHXA 1UJYA 3L2WA 1YJWA 1BU1A 1C0MA 4HT9A 1VQLQ 2E41A 1U1TA 2KT1A 4ELZC 3GBQA 4V2SA 2VGNA 3M53A 1VQNT 3KFVA 1NJIR 4M7AE 3I55A 1IREB 2B86A 2NYSA 1B07A 4M75G 1Z9QA 1Y07A 4FL6A 2DRKA 2PZ1A 2XG8D 1HK9A 2CZ6B 1V76A 1BI2A 1BBZA 4R55A 2JXBA 4J5YA 1CKAA 4M75E 2DIQA 3EG9A 1MV0B 3ER0A 3G71Q 1BIAA 1Q7YR 2DL8A 4A4EA 3GLXA 3G4SQ 2GFAA 3JB9J 3CCUA 4JLIA 1KSWA 3AT1B 3VYGA 2H3EB 2MOXA 3I9QA 2A28A 4EDUA 4XAXB 1UFFA 3G71T 1C6VX 4TVRA 2GF7A 2X3WD 2JN0A 3G4ST 4DBQA 1PD1A 2DMOA 2FPFA 2HSPA 5GAN7 2RI2A 1ZSGA 3M0TA 4PJNA 1VQPQ 2ZAEA 4BY6C 3ZEHA 4UC4A 1ZX6A 1Q7YU 3CXCP 3VKIA 3CCRQ 3QZ9B 4QVDA 3V8LA 5GAN4 1SHGA 1WHGA 1G8XA 1ZSZB 2VUBA 4JJBA 4F7UE 3CCMQ 3OY9A 2QEXQ 1VQPT 1LJOA 2E5QA 2MWPA 1U3OA 1KQSP 1G83A 1X01A 3CCRT 1D0XA 4PJOG 1WI7A 1RAHB 4C92F 2FHDA 3CCMT 1QVFA 2PVGB 1H3ZA 1M9SA 3QO3A 4FCYA 1KQ2A 4NL3A 1RAAB 3QDFA 4OMNA 3HPWA 4PJOE 1EZZB 3I5RA 1QQJA 2DTOA 1W6XA 4OP0A 4C0DB 3H41A 1YJNA 3HHTB 4F7UB 1RAGB 1WXUA 2NUPA 8AT1B 2VB6A 2CUBA 4XU1A 1YHQQ 2DO3A 2A08A 4EIKA 4BI3A 3FIFA 4RUGA 1NE8A 3OBWA 4JZ3A 1W1FA 5IHKA 5L23A 4OF1A 4E6RA 5I2SA 1W4SA 2YLBA 2MIOA 4KH1B 3RMQA 3BW1A 3ME9A 2EJ9A 3VUZA 2HNIA 1Q81C 1I0CA 2LP5A 2J6FA 1OOTA 4LUDA 3H6ZA 1KK7A 4JRPA 2Y4XA 1HSQA 1VQ5T 2M0YA 8ATCB 2LQNA 3M0UA 2OTLA 4FIBA 2RQRA 4FSXA 3META 1Q82U 4Z89A 4QVCA 2LQ8A 3O8VA 3RKWA 2FEIA 1FMWA 3RR6A 5I2MA 2PQWA 5KYYA 5I22A 2JNGA 1ZQ1A 4BUGA 2MK5A 1GRIA 3S6WA 1PD0A 1QVPA 1QMCA 2FL7A 2RPNA 2LCSA 3TSWA 1JXMA 4C8QG 4QT7A 1G2BA 1VQKQ 2JTFA 2BKDN 4C0GA 4F14A 4ORZA 2DKGA 3QWXX 2CP2A 1TH7A 5GAOm 1FMVA 3M54A 2CZ1B 4C8QE 4AT1B 2O9SA 1N9RA 4MZMA 4FW2A 2XDBA 1OQKA 4ATOA 1ZA1B 3MEUA 2D0NA 2VASA 5LJ3e 2X4WA 3G1JA 4ZN1A 1LNXA 1UGQB 4P5NA 2EGEA 2DL3A 4L59A 4M7DF 4VUBA 4R0KA 3V8JA 2AZVA 2BE9B 2E65A 2K2VA 2KDSA 4KGXB 1D1BA 5A2QE 3CXCS 2QDLA 3A8LB 4M78A 3JAME 2RH2A 4RTUA 4E7JA 2G3RA 1NM7A 2CZ7B 1KQSS 5IXFA 1M1GA 2HD0A 2LJ0A 1IRXA 2E64A 3N5BB 5HK3A 3PT9A 5GMKh 4Q5WA 3KUFA 1OZ2A 4HVUA 3GP8A 2EIFA 1BCOA 3UA7A 4OMMA 5CO7A 2EBPA 3VYHB 1C1AA 3JCMg 1G3YA 2DPPB 2KNBB 2RD1A 5GAN5 4N0AA 5FRMA 1CKBA 2EYQA 5KYUB 1Q86R 1M90U 1D3BB 1V1CA 5FU6C 2F5KA 4BE1A 2XICA 2G6FX 2GQVA 1KJWA
chains in the Genus database with same CATH topology
3TREA 4J7IA 3M55A 2OTJT 3AHUA 4M75F 3M59A 3EAEA 4E7LA 5GAN6 3QZ5B 4M7DA 3SWNB 2PVDB 3JRZA 5GMKl 3CCQA 1KC8C 2LCCA 5GAMd 1QVGS 4ZGJB 4RKUE 2D6FA 4KULA 3CMEA 2D0QB 2QA4A 1NPRA 3DLLA 4KT0E 3CC7A 2KK4A 1X6OA 3OYBA 1NPPA 2FVUA 2LT4A 2R58A 4EMKC 3TEEA 2BUDA 5CVIA 3OYCA 2A3LA 2DZCA 4N4HA 3M5AA 5D6XA 4E7HA 3BDLA 3OA6A 5GANe 1U8RA 3PGGA 4XU3A 5FLXE 4WF2A 4FM4B 2D9TA 2MWOA 2WACA 2B8AA 2QQ9A 1VIEA 1QP3A 2EJFA 4FT4A 3RESA 1YITA 2DZ9A 4RMOA 3GPLA 1G3WA 1K9MC 4HCBA 3MEAA 3CXCA 3C12A 3QXEB 3JCMd 2P0KA 3P8DA 4C8QC 3CCJA 3FJPA 4X9CA 1Y96B 4C8QD 4M78G 4N4GA 2HBPA 2Y90A 3CCVA 5HY6A 5GANg 5AYFA 1O75A 1KHIA 1OZ3A 2EAYA 4RG8A 3CCSA 2RHYA 4OB0B 2C06A 1I81A 2ZZDA 2HQEA 3LX7A 4GY5A 4M77F 3X24B 4LDYA 1N9SA 1BIBA 2DXBA 3CC4A 3QYGB 1VQ7A 3CBOA 4IUVA 2M0OA 4C5IA 5LJ5f 3JCMV 4M7AA 2KMTA 3SDZA 2EFIA 4ZTJA 2QTXA 1VQ4T 2QQSA 1QP2A 4M78E 3JCMP 5FU6B 5GANh 3CBPA 1NJIU 2VXEA 3OYDA 4QQ6A 2DXTA 3MHXA 1WJSA 2VGMA 3SFMA 2K5IA 2XKOC 3NTKA 5LJ5d 1YBYA 4JRIA 1M1KC 1VQKT 4DA4A 5CQXA 2X4YA 3OQ5A 2RO0A 3GF5A 4HKEA 4A53A 4B9XA 2LX9A 2V8KA 3CPFA 3OSVA 1YIJA 4N0AC 3DLMA 3ASKA 3INZA 4NS5A 4M75A 1U1SA 4XU0A 3MEVA 2MI6A 4MZTA 4F7UG 5GAMe 2EQKA 1ZBXA 3L2ZA 3MCAB 4HA8A 3UPUA 4GLKA 5IN1A 4PJOF 4XTVA 2CKKA 3LLRA 5CAIA 1PSFA 5GAN2 1WGSA 1VQ8T 1ZHIA 2L5QA 5CQYA 1UGRB 4BI8B 2HQXA 4E7IA 1JBMA 3HRUA 1XNIA 3CCQT 1VQMA 1K8AU 4M7DC 2VV5A 1XOVA 3WVDB 2KAFA 4BE2A 2O4XA 1BYMA 5GAMg 3CMET 3PTAA 4NL2A 1KC8U 3QKJA 2QA4T 2ZPBB 4C92C 3C95A 5C6SA 2F5TX 3JB9G 4HCCA 3CC7T 1BKBA 2Y4YA 2XDPA 4C8QB 4C92D 1BI0A 4M7DG 4IUUA 2RHZA 4KBMB 3HSBA 2BIVA 5A0DA 2DD4A 3OYEA 2GFUA 3QG1A 2FYKA 2R5MA 2K4YA 2K57A 3L1AA 5GAN8 2V8JA 2CZ0B 4QW2A 5GAMh 4MDXA 5GAOp 1VQ9A 1NJIC 5EG2A 1YITT 5FRNA 2P0QA 2WSEE 2ZPHB 1VQ4A 1G3TA 2DD5A 2WSCE 3FLGA 3M4YA 4EPCA 4M77A 4M7DE 3EFSA 4FT2A 2E6NA 2DAQA 3HFNA 3JCMX 4PL6A 3OS0A 3CCJT 4F7UA 1JJ2A 2OAUA 3LH0A 2X35A 1K9MU 3G71A 4ZGDB 3CCVT 3DB4A 1WNLA 2XDDA 4B9WA 3Q1JA 1M4ZA 3CCST 2EQJA 2IVWA 2VYTA 3JB9H 3G4SA 1UB4A 3JB9I 2E1HA 3P8BB 4CRIA 3S3MA 5LJ5e 5CKFA 3CC4T 3LWHA 1VQ7T 2EQUA 4EMHA 3QHSA 4IKFA 3BDUA 2E6ZA 2JTMA 2LCLA 1BI1A 3RIRA 3OYFA 3M58A 2VXFA 3V7CA 3F70A 1Q7YC 4DOVA 4M7AC 4RCCA 3E1SA 2ZPFB 4XTXA 4A4KA 5CKEA 3CC2T 1B34A 5GAN3 1HXDA 2H3JA 2E10A 1M1FA 4LDUA 3A8OB 3MEWA 3CEYA 3P8HA 4LDVA 1X75C 1YCYA 4BDYA 4JDSA 5LJ5g 4PLIA 1NZ9A 1PSEA 3GNGA 2DTIA 3KXTA 3CMAT 4M7AG 3RUXA 2RHXA 3GIBA 3L2WA 3M57A 2K3XA 1VQPA 1YJWA 2LQKA 1M1KU 1YIJT 4X34A 5LJ3f 4J6WA 4ZTFA 1QVFS 4HT9A 2E41A 1U1TA 4ELZC 4V2SA 2VGNA 2JVVA 3M53A 3LW5E 3OB9A 2WSFE 1VQNT 4C92B 3CCRA 2RHUA 4JS4A 4N4IA 5LJ5h 3L2RA 4M7AE 3CCMA 2DXUA 3I55A 1IREB 2R5AA 1JJ2S 4M75G 2XD0A 1Y07A 4FL6A 4M78C 5GAOr 3LYIA 2XG8D 3QIIA 4X9DA 1VQMT 2MMPA 1HK9A 2CZ6B 4M78D 1OYXA 1BI2A 3E9GA 5GMKm 4R55A 4J5YA 2EWNA 1KHCA 4XU2A 2EJGA 4C5GA 5CKBA 5CKHA 4XK8E 5DM7R 1DJ7B 4M75E 2DIQA 4BI4A 4C8QF 5FU7C 3ER0A 1I8FA 2V8IA 1JB0E 5L8RE 1BIAA 2RM4A 3E9FA 1VQ9T 3OYHA 4Y91A 3LGFA 4A4EA 3GLXA 2GFAA 3V7RA 3JB9J 5GAOl 1YI2A 3CCUA 3RERA 4LDXA 4JLIA 1I5LA 3ZBDA 3VYGA 3CC2A 3JSCA 5CK9A 2I2LA 2RJFA 4EDUA 4C0DC 3CPWA 3CCLA 4XAXB 3G71T 5FROA 3J7AF 4JJNK 4TVRA 3FB9A 5D6WA 1RL2A 2GF7A 3V7SA 5KH6A 3CMAA 2DVEA 2JN0A 3G4ST 4OGCA 4M77G 5CR2A 1MHNA 3I56A 4DOWA 3X28B 3GNFB 5J3BA 4JRKA 5GAN7 3OW2S 5HKCA 1XQHA 2K5LA 2RI2A 4IUQA 4C5EA 3WXMB 1VQNA 2RI3A 1N27A 4BY6C 3ZEHA 3JCMb 4UC4A 3JCMJ 4EMKB 2L3RA 1VQ6A 3M4GA 1Q7YU 2E70A 3CBMA 5HK0A 3VKIA 4M77E 3QZ9B 4QVDA 3OS5A 3V8LA 2RJEA 5GAN4 4CI0C 1VQOT 4Y28E 1VQLA 2VUBA 1VQ5A 3JB9D 2QI2A 4F7UE 3M9QA 2ZCFB 3FRNA 3QYHB 5A0GA 3OY9A 3PIPA 1Q82C 4L5GA 4M7DD 5CIUA 1FWZA 2ZPEB 4M78B 5IAYA 1LJOA 3CCEA 2E5QA 1YJWT 3JCMQ 1UGSB 2MWPA 2XHCA 4C0FA 4A54A 4MMLA 2PUKB 5GMKi 3MP8A 2KSSA 3RKXA 2O4XB 3BFMA 1X01A 4MZPA 3OBYA 3CCRT 2QQBA 2KVQG 3QPHA 4IUPA 4PJOG 3LGLA 4L6V5 4NOYA 4C92F 2FHDA 3URGA 2NLUA 3CCMT 3I55T 1QVFA 3CPWS 2L89A 4IURA 4OB2B 5DLQE 5DY9A 5LJ3g 1N8RC 2PVGB 2X4JA 1H3ZA 1M9SA 1N6AA 3QO3A 1KQ2A 2DTHA 4NL3A 4C8QA 4J8OA 1KQ1A 3BY7A 1XTDA 2DJZA 3HPWA 3QJ6A 4LDWA 2A7YA 3SB2A 4C0ZA 4PJOE 3TCJA 3OYKA 4HCZA 3LWIA 4OMFB 5I21A 2DEQA 2DTOA 5CCAA 2R57A 4OP0A 5LJ3h 3DB3A 3HP9A 4C0DB 5GAOn 1YJNA 4BD3A 3OYLA 1Y71A 3HHTB 4F7UB 3G6EA 3OYYA 1Q86C 3QJYA 4KUIA 4XQ3A 4OB1B 4XU1A 3OYGA 2QQRA 2DO3A 4RCBA 3PMIA 1YI2T 4BI3A 3CCUT 1WPYA 4JS5A 3FIFA 2E12A 1IZ6A 1KG1A 2HAXA 2QDYB 1NE8A 3OBWA 4J6XA 1WQWA 3HFOA 3MP1A 1R8OB 3J81E 4E7KA 4M7AD 4OF1A 2VC8A 2M1HA 2DIGA 4BY6B 3CCLT 2JUFA 4ZGEB 4KUDK 1D3BA 5I2SA 1KD1U 1RI0A 1W4SA 2MAMA 3OMCA 3X20B 3S3OA 1VQOA 2YLBA 3CD6A 3RMQA 3BW1A 1B34B 2KY9A 1AHJB 2EQMA 5LL6S 3ME9A 2EJ9A 3VUZA 2HNIA 3GOXA 3I56T 4OB3B 3X26B 3L2QA 3C94A 3MP6A 3QUIA 3L2UA 4O6JA 1Q81C 4M7DB 2M9UA 4M75C 2JZ2A 3H6ZA 3JCMW 3S3NA 2RB6A 4BE0A 3PIOA 1UGPB 3SWNA 4M75D 4JRPA 3OYJA 1Y7XA 1VQ6T 5LJ3d 1EIFA 2K3YA 3VJPA 2Y4XA 2QEXA 5KE3A 3OW2A 1FX7A 4IUTA 4PKCC 3A5ZB 1VQLT 1VQ5T 1UEBA 2XIDA 2ZGWA 3FEOA 2GCXA 3H8ZA 3V8KA 1YJ9T 3E19A 4II1A 4C92A 2OTLA 3CCET 4FIBA 4FSXA 2YRVA 1K73C 1H641 4M78F 4J6YA 3META 3WVEB 1Q82U 1M8VA 4QVCA 1G5VA 5CKDA 2ZPIB 4FU6A 4ELYC 2LQ8A 3O8VA 4EMGA 3RKWA 4R56A 1M5Q1 1VIFA 3OSSC 3R6OA 3JCMf 1W2BS 2RK2A 1Q86U 4LD9K 5I2MA 5C0MA 2PQWA 4PJOA 2LRQA 4A4GA 3OYAA 1WJQA 5J39A 1Y96A 4A4HA 5DLOA 2JNGA 5GANj 3JCMc 3QSUA 1ZQ1A 4BUGA 2FB7A 1GXIE 1KD1C 1N8RU 4QQDA 3UDCA 4M77C 2RHIA 2RA2A 4HT8A 2P0PA 4M7AB 2K5FA 4JUVA 3S6WA 1QVPA 1VUBA 4M77D 3OYIA 4JLGA 2FL7A 3ZFJA 1M90C 4BACA 1YHQA 1S72A 4BB7A 1YJNT 4DQ2A 1SSFA 5KCOA 4C8QG 3L2VA 1KQSA 3KBGA 3G6ET 3PMTA 4ZN3A 2JTFA 2BKDN 2KQWA 2YHTA 3QDRB 4C0GA 4F7UF 2DKGA 2DXCA 1TH7A 2RJCA 3OYMA 3VUBA 2LVMA 4LD6A 3OMGA 4M75B 5GAOm 2M16A 2DK3A 3M54A 2OTJA 4QQGA 2CZ1B 3A8GB 4C8QE 1MGQA 4XTYA 1N9RA 4MZMA 5KCHA 2XDBA 3HL8A 2JOYA 4ATOA 2EKOA 3MEUA 1OI1A 3OS1A 3CD6T 4XTUA 2PVOB 4XTZA 5LJ3e 1YJ9A 4PJOC 4C5HA 2X4WA 3NTIA 3X25B 1I4K1 2LTOA 2O01E 3PFSA 2LC4A 5GMKe 4JRQA 4ZN1A 1LNXA 4QVZA 1UGQB 3JB9F 4PJOD 1FXXA 4P5NA 4EMKA 1VQPT 4L59A 4M7DF 4VUBA 5KE2A 5GMKj 2CGHA 3A8HB 3T9NA 1Q81U 5J26A 5D6YA 1V29B 3V8JA 1O9SA 2E65A 1P92A 2K2VA 2KDSA 3SWNC 2AHJB 5GAMj 5A2QE 3FC3A 5A0LA 3CXCS 3A8LB 4M78A 3JAME 2QEXT 5GANf 2RH2A 5FU7B 4ME7A 4E7JA 2CS7A 2G3RA 2CZ7B 5LJ3j 3PNWC 1WQ7A 2XI9A 1WJRA 5M9OA 2LDMA 1KQSS 2OTLT 4MDWA 4OVAA 1M1GA 3NFCA 2HD0A 4PNOA 1LOJA 3M56A 1BI3A 2E64A 3N5BB 5GANd 2CYZB 3NTHA 4M77B 5HK3A 4D6WA 3PT9A 1JRIA 4J7FA 3JCMe 1QVGA 1K73U 4J83A 3OS2A 2RJDA 2LNVA 3OYNA 5GMKh 4Q5WA 3A8MB 3KUFA 1OZ2A 4C92G 4XTWA 2XK0A 1G3SA 3GP8A 2ZPGB 1QW1A 2EIFA 4PLLA 2MF2A 3VU3C 3EFRA 2LT1A 3HRSA 5CO7A 4A4FA 2YLCA 3MO8A 3TU4K 4Z02A 2QQAA 1W2BA 4YTLA 2RK1A 3VYHB 3HRTA 3JCMg 3C4SA 1G3YA 2DPPB 2RI5A 3RKYA 5GAOq 2RD1A 4C92E 3G7ZA 5GAN5 1VQKA 4M7AF 2X4XA 1YHQT 2L8DA 2PU9B 3DKMA 3J80E 1S72T 4N0AA 5FRMA 2EYQA 2IG0A 3FDRA 3L42A 4MMKA 1M90U 1D3BB 4OGEA 3VV0A 3QBYA 2PUOB 3SD4A 5FU6C 5IT9E 4BDZA 4PJOB 4E47A 3JCMh 2F5KA 4RG2A 4BE1A 5GAMf 2XICA 5LJ5j 3UT1A 4O5VA 3RMSA 2F69A 3HKSA 2P4TA 2XU8A 2QXFA 2GQVA 1K8AC 3UWNA 1VQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FLG A;  3EAE A;  4E7L A;  2RJE A;  4QQD A;  2E6N A;  2DAQ A;  2LCC A;  2RHI A;  4PL6 A;  3OS0 A;  3M9Q A;  3LH0 A;  2X35 A;  3OY9 A;  3S6W A;  3DB4 A;  5CIU A;  5IAY A;  4B9W A;  3OYI A;  3Q1J A;  4BAC A;  2E5Q A;  2MWP A;  2EQJ A;  2VYT A;  1SSF A;  5KCO A;  4CRI A;  3OYB A;  3OYC A;  3L2V A;  3S3M A;  2R58 A;  3MP8 A;  2BUD A;  2O4X B;  3PMT A;  4IKF A;  2EQU A;  2JTF A;  2BKD N;  4IUP A;  4N4H A;  3LGL A;  5D6X A;  4E7H A;  3BDL A;  3OYF A;  2FHD A;  3OA6 A;  2NLU A;  3F70 A;  2L89 A;  2D9T A;  2RJC A;  4IUR A;  3OYM A;  2LVM A;  2MWO A;  2WAC A;  4LD6 A;  2B8A A;  3OMG A;  1H3Z A;  2M16 A;  4QQG A;  3MEW A;  3CEY A;  3P8H A;  3MEA A;  5KCH A;  4BDY A;  2P0K A;  3P8D A;  3QJ6 A;  2EKO A;  4PLI A;  3MEU A;  1OI1 A;  3OS1 A;  2RHX A;  4HCZ A;  3OYK A;  3L2W A;  4C5H A;  2K3X A;  2X4W A;  3NTI A;  3PFS A;  2LTO A;  4N4G A;  4X34 A;  2R57 A;  4ZTF A;  1OZ3 A;  3DB3 A;  4QVZ A;  2RHY A;  4BD3 A;  3LX7 A;  2HQE A;  4L59 A;  4GY5 A;  3OYL A;  3OB9 A;  5KE2 A;  2RHU A;  4N4I A;  4IUV A;  2M0O A;  5D6Y A;  5J26 A;  4C5I A;  3OYG A;  2QQR A;  3FC3 A;  3L2R A;  3PMI A;  2EFI A;  4ZTJ A;  2QQS A;  2R5A A;  3OYD A;  4FL6 A;  4QQ6 A;  3MP1 A;  3LYI A;  3QII A;  2G3R A;  4E7J A;  4E7K A;  3PNW C;  2M1H A;  1WJS A;  2DIG A;  1WJR A;  1OYX A;  3E9G A;  3NTK A;  5M9O A;  2LDM A;  1RI0 A;  3OMC A;  4OVA A;  3S3O A;  1KHC A;  2X4Y A;  3OQ5 A;  2RO0 A;  4C5G A;  2EQM A;  4B9X A;  3NTH A;  3ME9 A;  3GOX A;  3L2U A;  3L2Q A;  3DLM A;  3ASK A;  3MP6 A;  4NS5 A;  2DIQ A;  3OS2 A;  2RJD A;  3MEV A;  3OYN A;  4Q5W A;  2EQK A;  2JZ2 A;  3H6Z A;  3KUF A;  3S3N A;  1OZ2 A;  3E9F A;  2XK0 A;  5J39 A;  4BE0 A;  5IN1 A;  2CKK A;  3LLR A;  3LGF A;  3OYH A;  4A4E A;  2GFA A;  3OYJ A;  1WGS A;  4PLL A;  2K3Y A;  4E7I A;  2HQX A;  5KE3 A;  4A4F A;  3MO8 A;  4IUT A;  1XNI A;  4Z02 A;  2RJF A;  4EDU A;  3C4S A;  2RI5 A;  4BE2 A;  3FEO A;  2O4X A;  5FRO A;  3H8Z A;  4II1 A;  5D6W A;  2GF7 A;  2X4X A;  2L8D A;  2YRV A;  3QKJ A;  5C6S A;  5KH6 A;  5FRM A;  3MET A;  2IG0 A;  3FDR A;  3L42 A;  2XDP A;  1G5V A;  1MHN A;  4IUU A;  2RHZ A;  2BIV A;  3QBY A;  4FU6 A;  3SD4 A;  3O8V A;  3OYE A;  2GFU A;  4BDZ A;  2RI2 A;  4C5E A;  4IUQ A;  2R5M A;  2F5K A;  4RG2 A;  4BE1 A;  4QW2 A;  2RI3 A;  1N27 A;  2PQW A;  5C0M A;  3UT1 A;  2LRQ A;  3ZEH A;  4A4G A;  4UC4 A;  3OYA A;  5FRN A;  1WJQ A;  2L3R A;  3UWN A;  4A4H A; 
#chains in the Genus database with same CATH topology
 2MCN A;  3JRZ A;  2A37 A;  2P84 A;  3CCQ A;  4ESR A;  4KUL A;  2CP3 A;  2QA4 A;  4PJM A;  2KK4 A;  1NPP A;  2LT4 A;  4N4H A;  1R0B G;  4KH0 B;  4WF2 A;  2B8A A;  1QP3 A;  4RMO A;  5KYW A;  3MEA A;  3QXE B;  2P0K A;  4N4G A;  2Y90 A;  5HY6 A;  2SRC A;  1KHI A;  2EAY A;  4RG8 A;  3CCS A;  2C06 A;  3LX7 A;  1N9S A;  2V1R A;  2DXB A;  3CC4 A;  2DIL A;  2L3P A;  1AEY A;  3H0I A;  4Z88 A;  4C5I A;  3JCM V;  4M7A A;  2KMT A;  3SDZ A;  4ZTJ A;  3CBP A;  2DXT A;  3MHX A;  2K5I A;  3NTK A;  3VS6 A;  1AOJ A;  1VQ8 Q;  2LZ6 B;  3OQ5 A;  1K73 R;  4HKE A;  4A53 A;  1FMK A;  4N0A C;  1YIJ A;  2F2V A;  4M75 A;  1U1S A;  4XU0 A;  3MEV A;  1ZBX A;  3UPU A;  1YJW Q;  2KRO A;  4XTV A;  2CKK A;  1EX4 A;  5CAI A;  1JXO A;  1WGS A;  1VQ8 T;  2HL3 A;  1K9M R;  1SKU B;  1XNI A;  1GCQ C;  4ZNX A;  1K8A U;  2FO0 A;  3WVD B;  3I55 Q;  1OEB A;  1X43 A;  1YIT Q;  1SEM A;  4KRT A;  2KGT A;  2F5T X;  2XDP A;  2RHZ A;  4KBM B;  3QG1 A;  2CZ0 B;  4QW2 A;  4MDX A;  1VQ9 A;  5EG2 A;  1YIT T;  1PKS A;  2ESW A;  2ZPH B;  1VQ4 A;  2WSC E;  1WYX A;  2NUP B;  1IB8 A;  2DBK A;  4OMQ A;  1WA7 A;  4FT2 A;  3JCM X;  4PL6 A;  4F7U A;  1K9M U;  1X6G A;  4ZGD B;  2DL7 A;  4DEY A;  1M4Z A;  2VYT A;  2DL4 A;  2QTV A;  4CRI A;  2CSQ A;  3VRY A;  3LWH A;  1ABQ A;  1BI1 A;  2KR3 A;  3RIR A;  1WFW A;  2BZX A;  3V7C A;  1PWT A;  1IGU A;  4M7A C;  1JU5 C;  2EGC A;  2ZPF B;  1IHW A;  4LDU A;  3P8H A;  1YCY A;  4PLI A;  1SHF A;  1PSE A;  4PJO A;  1K0S A;  2LQK A;  1UEC A;  4X34 A;  5LJ3 f;  4J6W A;  2FPD A;  2LMJ A;  3ULR B;  3OB9 A;  2WSF E;  1I07 A;  2DLP A;  1MNE A;  1AWO A;  3L2R A;  1D1A A;  2R5A A;  2ROL A;  1D0Y A;  1K9A A;  2MMP A;  4M78 D;  1OYX A;  5GMK m;  1X27 A;  2EWN A;  1KHC A;  1MMA A;  4J9E A;  4BI4 A;  4FYX B;  1I8F A;  2V8I A;  2RM4 A;  3NMZ C;  1YJN Q;  4DEX A;  1YI2 A;  3RER A;  4LDX A;  1I5L A;  3EHQ A;  3ZBD A;  2KI7 A;  3JSC A;  1KC8 R;  4C0D C;  3CCL A;  1GFD A;  3U23 A;  4CC7 A;  4JJN K;  1K76 A;  5D6W A;  2YRD A;  4OGC A;  4M77 G;  3JV3 A;  1MHN A;  4JRK A;  4IUQ A;  2FRY A;  3WXM B;  2RI3 A;  2O88 A;  1PRL C;  3JCM J;  2V26 A;  4RTW A;  1VQ6 A;  1UTI A;  2E70 A;  3PVQ A;  4M77 E;  1D1C A;  1QWF A;  4CI0 C;  4PFO A;  3JB9 D;  5A0G A;  3PIP A;  4E2F B;  4L5G A;  3R6N A;  4M78 B;  3CCE A;  3QWY A;  3JCM Q;  2RNA A;  1AWW A;  1JEG A;  1PM3 A;  1AD5 A;  2PUK B;  3RKX A;  3BFM A;  3OBY A;  2QQB A;  4IUP A;  3VRZ A;  1TOV A;  1E6G A;  2PNI A;  3E2U A;  1N8R C;  2DTH A;  4C8Q A;  1KQ1 A;  1MMN A;  3SB2 A;  2DJQ A;  2A36 A;  3M0P A;  5CCA A;  5LJ3 h;  2KRM A;  4BD3 A;  3OYL A;  1UE9 A;  2JS0 A;  3G6E A;  4OB1 B;  2LQW A;  3EH2 A;  2QQR A;  3NPF A;  1IZ6 A;  2HAX A;  4J6X A;  1YP5 A;  3PVL A;  1WQW A;  4M7A D;  4E7K A;  5KYU A;  1H8K A;  2GTJ A;  4ZGE B;  1D3B A;  4FYW B;  1KD1 U;  3S3O A;  3CD6 A;  1AHJ B;  2EQM A;  1QVG P;  1RAB B;  3I56 T;  4OB3 B;  3X26 B;  4E7S A;  3C94 A;  2DYB A;  1TUD A;  1UG1 A;  2JZ2 A;  1MV3 A;  3S3N A;  4F04 B;  4BE0 A;  1AZG B;  4M75 D;  2D8H A;  2J06 A;  1AT1 B;  3VJP A;  3OW2 A;  1FX7 A;  4IUT A;  3A5Z B;  3TVT A;  4LE9 A;  3EH1 A;  1VQL T;  2CP5 A;  3V8K A;  4II1 A;  3A1P A;  1H64 1;  3WVE B;  3M0S A;  1M8V A;  1G5V A;  5CKD A;  5KYW B;  1YNZ A;  2KT8 A;  1A0N B;  3OSS C;  1ARK A;  2RK2 A;  2NUZ A;  5C0M A;  1GL5 A;  1X2K A;  4QKU A;  3OYA A;  2K7A A;  2ECZ A;  1U06 A;  1GXI E;  1KD1 C;  2BTT A;  2RN8 A;  2RHI A;  3NGP A;  2P0P A;  4M7A B;  1T3L A;  3OYI A;  4K11 A;  5IHI A;  1S72 A;  5KCO A;  1KQS A;  3PMT A;  4FSS A;  2NWM A;  2KQW A;  2YHT A;  4F7U F;  1X69 A;  1TXQ A;  3VUB A;  2LVM A;  2AKL A;  4M75 B;  2OTJ A;  4JJC A;  3A8G B;  2CP7 A;  1MGQ A;  4XTY A;  4B6M A;  3HL8 A;  2JOY A;  2EKO A;  5IH2 A;  2PVO B;  1YJ9 A;  3BE3 A;  1M3B A;  1I4K 1;  1TS9 A;  4PJO D;  2EVR A;  4EMK A;  3EGX B;  5KE2 A;  3A8H B;  1Q81 U;  5D6Y A;  5A0L A;  2QEX T;  2RQU A;  5GAN f;  4ME7 A;  2D1X A;  2DBM A;  2LDM A;  3NFC A;  4WTO B;  1T3S A;  4PNO A;  1BI3 A;  1F1B B;  3EGD A;  4J7F A;  3JCM e;  1VOM A;  4RTZ A;  2LNV A;  3OYN A;  3A8M B;  1QWE A;  4C92 G;  4XTW A;  1S1N A;  2W0Z A;  1QW1 A;  4PLL A;  2GNC A;  3VU3 C;  3EFR A;  3HRS A;  4A4F A;  2JS2 A;  1W2B A;  4YTL A;  2RK1 A;  2V1Q A;  1LPL A;  3HRT A;  3C4S A;  3RKY A;  1OX9 A;  2W10 A;  1Q82 R;  4C92 E;  2RMO A;  2X4X A;  1YHQ T;  2PU9 B;  3FDR A;  4MMK A;  4PFP A;  4BDZ A;  4PJO B;  4E47 A;  1QVF P;  5GAM f;  3ZL7 C;  3EG2 A;  2XMF A;  3ZFJ A;  3M55 A;  3AHU A;  3EAE A;  5GAN 6;  2PVD B;  1JJ2 P;  1QVG S;  4FYV B;  3CME A;  2RQV A;  2D0Q B;  3CC7 A;  4JJD A;  2E5K A;  4EMK C;  2R58 A;  2BUD A;  3I5S A;  2DZC A;  2ED1 A;  3M5A A;  4E7H A;  4HXJ A;  4PFZ A;  1U8R A;  3PGG A;  1SRL A;  2YXY A;  1VIE A;  2EJF A;  4Y92 A;  1H92 A;  4Z8A A;  3GPL A;  1G3W A;  1VQ9 Q;  4HCB A;  3JCM d;  3I35 A;  3CCJ A;  1VQ4 Q;  1Y96 B;  4C8Q D;  2HBP A;  5AYF A;  1O75 A;  1QLY A;  1I81 A;  2ZZD A;  4GY5 A;  1AVZ C;  3X24 B;  1M2O A;  2IPO B;  4M4Z A;  4ANJ A;  4IUV A;  2M0O A;  5LJ5 f;  2GTO A;  5IXB A;  1VQ4 T;  2QTX A;  2QQS A;  1M2V B;  3JCM P;  5GAN h;  3OYD A;  4QQ6 A;  2VGM A;  1RAC B;  2HKN A;  4JRI A;  1M1K C;  1VQK T;  4LN2 A;  5CQX A;  2X4Y A;  2RO0 A;  2CH4 A;  1OU9 A;  1K1Z A;  3CPF A;  2V8K A;  3OSV A;  1RLQ C;  1RLP C;  1TTH B;  1X6B A;  4HA8 A;  2P4R A;  5IN1 A;  1TSF A;  1WHM A;  1PSF A;  5GAN 2;  5CQY A;  2L5Q A;  1UGR B;  4BI8 B;  4E7I A;  3CPW P;  2M51 A;  1XOV A;  2KAF A;  4BE2 A;  3PTA A;  2AIR B;  1M90 R;  2F2X A;  2QGG A;  4HCC A;  1AZE A;  2DRM A;  4FYY B;  2CP6 A;  4C8Q B;  4M7D G;  1BI0 A;  2HSE B;  2QAS A;  2COW A;  3HSB A;  2DD4 A;  3O5Z A;  2K57 A;  3CCV Q;  3UAT A;  1D09 B;  5GAN 8;  2ROT A;  2A0F B;  5GAM h;  2JM8 A;  5FRN A;  1UHF A;  1SF9 A;  2WSE E;  4M77 A;  1VQ7 Q;  1YCS B;  4M7D E;  3OS0 A;  4CC3 A;  1YI2 Q;  1KFZ A;  2KE9 A;  2L2P A;  3G71 A;  3CCV T;  3DB4 A;  1WNL A;  1WDX A;  1WHL A;  2IVW A;  1OX8 A;  3G4S A;  1UB4 A;  3JB9 I;  3MKD A;  1TU0 B;  4IIO A;  1VQ7 T;  2EQU A;  4OML A;  1FYN A;  2E6Z A;  1Q95 G;  3M58 A;  2VXF A;  4F16 A;  4DOV A;  3M0Q A;  9ATC B;  4XTX A;  3VS0 A;  2E10 A;  4AG1 C;  3CEY A;  4LDV A;  4OMP A;  4JDS A;  1NZ9 A;  3KXT A;  3RUX A;  3GIB A;  1VQP A;  3RNJ A;  1QVF S;  1VQM Q;  2RF0 A;  1R0C B;  2HZY A;  2JVV A;  2BZY A;  3CCR A;  2RHU A;  4RTT A;  4N4I A;  5LJ5 h;  3CCM A;  2DXU A;  1JJ2 S;  4M78 C;  2FZK B;  2HBW A;  3LYI A;  4D8D A;  2X3X D;  1VQM T;  2EJG A;  4C5G A;  2OI3 A;  1RAE B;  2KXD A;  4XK8 E;  5CKH A;  1SPK A;  5DM7 R;  1DJ7 B;  5FU7 C;  2IIM A;  5L8R E;  3REA B;  3LGF A;  4Y91 A;  2EYW A;  3V7R A;  1B7T A;  5HCK A;  5GAO l;  2RQW A;  1K8A R;  4CC2 A;  2X9H A;  5CK9 A;  2I2L A;  1IXD A;  1K4U S;  1RL2 A;  3V7S A;  4J9G A;  3CMA A;  2DVE A;  2HL5 C;  3X28 B;  2AT1 B;  3H0H A;  5HKC A;  4C5E A;  3VS4 A;  2CDT A;  1N27 A;  3THK A;  1VYU A;  3JCM b;  4EMK B;  5HK0 A;  1T0J A;  3OS5 A;  2RJE A;  1K0X A;  1VQ5 A;  1TUC A;  2COZ A;  2LX7 A;  3M9Q A;  2ZCF B;  1SSH A;  3QYH B;  2E3I A;  3EGX A;  5CIU A;  1FWZ A;  2ZPE B;  1YJW T;  1MUZ A;  2XHC A;  4MML A;  1Q86 C;  5GMK i;  3MP8 A;  2KSS A;  4MZP A;  4L6V 5;  4NOY A;  2NLU A;  3I55 T;  4HVW A;  3CPW S;  2L89 A;  5DY9 A;  3EGD B;  5LJ3 g;  1N6A A;  1QCF A;  1ABO A;  3BY7 A;  2DJZ A;  4LDW A;  3CCU Q;  4J9H A;  4HCZ A;  4OMF B;  5I21 A;  2DEQ A;  4AFQ C;  3H0F A;  5GJV B;  3OYY A;  3OYG A;  2DA9 A;  4RCB A;  3CCU T;  1WPY A;  2GGR A;  2K3B A;  1KG1 A;  2QDY B;  3HFO A;  3J81 E;  1KIK A;  2FZG B;  2M1H A;  2DIG A;  4KGV B;  3UF4 A;  2JUF A;  4KUD K;  2MAM A;  4LXC A;  3X20 B;  1VQO A;  1Z9Z A;  2KY9 A;  1LCK A;  3TSZ A;  5LL6 S;  2PTK A;  3GOX A;  3L2U A;  1EFN A;  2M9U A;  4M75 C;  5EC7 A;  1YJ9 Q;  1RUW A;  2QAZ A;  1UGP B;  1OV3 A;  1HJD A;  1N8R R;  5KE3 A;  2KRS A;  1NEB A;  1UEB A;  2XID A;  2K9G A;  2ZGW A;  1YJ9 T;  1ZUU A;  4C92 A;  1K73 C;  3VS3 A;  4M78 F;  4J6Y A;  2ZPI B;  3EHR A;  3UA6 A;  4ELY C;  4D8K A;  4R56 A;  2VVK A;  2C0T A;  4LD9 K;  2NUT B;  2LRQ A;  4A4G A;  2OX7 A;  5J39 A;  1Y96 A;  5DLO A;  3MPU B;  3JCM c;  5GAN j;  1N8R U;  4QQD A;  2RA2 A;  4HT8 A;  4M77 D;  1VUB A;  3A98 A;  4JLG A;  1WXB A;  4BAC A;  1M8M A;  1YJN T;  3H9N A;  4DQ2 A;  1SSF A;  2KEA A;  1JO8 A;  1M2V A;  3KBG A;  4ZN3 A;  2HDA A;  1GBQ A;  2DXC A;  2DK3 A;  3VS7 A;  1OI1 A;  2CP0 A;  3PE0 A;  4XTZ A;  4PJO C;  1BK2 A;  2O01 E;  2LTO A;  3PFS A;  5GMK e;  2LC4 A;  4JRQ A;  3JB9 F;  3HTR A;  3CME Q;  2OTL Q;  5GMK j;  7AT1 B;  3T9N A;  2EYZ A;  1V29 B;  1P92 A;  5GAM j;  1PNJ A;  1ZBJ A;  5FU7 B;  1KD1 R;  1BCM A;  2CS7 A;  3PNW C;  2XI9 A;  4IIM A;  5M9O A;  2OTL T;  2DNU A;  2KYB A;  1LOJ A;  5GAN d;  2YUO A;  1R77 A;  4M77 B;  1W70 A;  1JRI A;  1QVG A;  4J83 A;  2DFU A;  4J9I A;  4A63 B;  2MF2 A;  6AT1 B;  2LT1 A;  2YLC A;  2JMC A;  3MO8 A;  4Z02 A;  2QQA A;  1MMD A;  2JTE A;  5GAO q;  2YSQ A;  4M7A F;  4JZ4 A;  3DKM A;  2IG0 A;  3L42 A;  2H8H A;  1YN8 A;  2MYS A;  3VV0 A;  3QBY A;  2YUN A;  5IT9 E;  5LJ5 j;  5KYX A;  3UT1 A;  4O5V A;  2QYZ A;  1VQ8 A;  3TRE A;  3EG1 A;  4M75 F;  3M59 A;  1UUE A;  4M7D A;  3SWN B;  3CQT A;  5GMK l;  1KC8 C;  1QCN A;  5GAM d;  1NYF A;  4ZGJ B;  4RKU E;  2ED0 A;  2D6F A;  3MJX A;  1GFC A;  1NPR A;  3DLL A;  2YUQ A;  4KT0 E;  1X6O A;  2FVU A;  2A3L A;  5D6X A;  1CSK A;  3OA6 A;  4XU3 A;  2D9T A;  2MWO A;  1YIT A;  2QQ9 A;  3VS2 A;  2KBT A;  3RES A;  1WLP B;  3C12 A;  3CXC A;  3P8D A;  4C8Q C;  1IO6 A;  4X9C A;  4J9F A;  5GAN g;  1OZ3 A;  1Q81 R;  4OB0 B;  1ZUY A;  2HQE A;  2YRC A;  1SRM A;  3CBO A;  3TQ7 P;  3OW2 P;  1NJI U;  1WJS A;  5LJ5 d;  4WCI A;  3EGU A;  1M27 C;  3GF5 A;  4AG2 C;  4B9X A;  2LX9 A;  3DLM A;  3INZ A;  4NS5 A;  3CCQ Q;  3FJ5 A;  1J3T A;  4LNP A;  4MZT A;  4F7U G;  2EQK A;  2OAW A;  4GLK A;  4PJO F;  2QA4 Q;  1BB9 A;  2HQX A;  3HRU A;  2E3H A;  3CCQ T;  2LJ1 A;  4M7D C;  1BYM A;  5GAM g;  5KYN A;  1YFN A;  2QA4 T;  4F17 A;  1NG2 A;  4C92 D;  5D7U A;  2BIV A;  1NLO C;  1ZUK A;  5A0D A;  2GFU A;  5ECA A;  3CCS Q;  1YWO A;  1NJI C;  2QGF B;  2VWF A;  1PRM C;  4AFZ C;  4EPC A;  3M4Y A;  2CSI A;  3FLG A;  3CC4 Q;  1M1K R;  2DAQ A;  1JJ2 A;  5IHN A;  4HCK A;  3Q1J A;  2O9V A;  3CCS T;  2EQJ A;  1WXT A;  2K2M A;  3JB9 H;  2E1H A;  2EKH A;  2YT6 A;  3CC4 T;  4IKF A;  1NYG A;  3QHS A;  3BDU A;  3CMA Q;  2JTM A;  3OYF A;  1Q7Y C;  3F70 A;  1YIJ Q;  2AK5 A;  2J6K A;  2QK0 A;  4A4K A;  5CKE A;  4DBH A;  5GAN 3;  3A8O B;  2KXC A;  2DER A;  3IQL A;  2J05 A;  3EFO B;  2YUP A;  5LJ5 g;  3CMA T;  2QG9 B;  5AT1 B;  3M57 A;  2K3X A;  1M1K U;  1YIJ T;  1OUL A;  4ZTF A;  1B3Q A;  1VQ5 Q;  3LW5 E;  4C92 B;  4JS4 A;  1M3C A;  5FWB A;  2F1L A;  1AWX A;  1W2B P;  2FRW A;  1IHV A;  2XD0 A;  2BZ8 A;  5GAO r;  4X9D A;  1T0H A;  3QII A;  4J9D A;  3E9G A;  4PK4 A;  4XU2 A;  1RAD B;  5CKB A;  2NUT A;  2OJ2 A;  4GBQ A;  4C8Q F;  1JB0 E;  5GJW B;  1RAI B;  3E9F A;  1VQ9 T;  3OYH A;  2X51 A;  1OU8 A;  3CC2 A;  2RJF A;  2JMA A;  3CPW A;  3J7A F;  5FRO A;  2DEU A;  4OMO A;  1VYV A;  3FB9 A;  4KGZ B;  5KH6 A;  2DX1 A;  2C0I A;  5CR2 A;  3I56 A;  4DOW A;  3GNF B;  1VQO Q;  5J3B A;  1LVK A;  3OW2 S;  1XQH A;  2K5L A;  1VQN A;  5FW9 A;  2L3R A;  3M4G A;  1QKX A;  4J9C A;  1VA7 A;  3CBM A;  3M0R A;  2HEQ A;  1MND A;  1VQO T;  4Y28 E;  1VQL A;  2QI2 A;  3FRN A;  1Q82 C;  4M7D D;  5IAY A;  1UGS B;  4C0F A;  4A54 A;  5LJ3 j;  2O4X B;  1H3H A;  2KVQ G;  3QPH A;  3LGL A;  2YWW A;  3URG A;  4IUR A;  4OB2 B;  5DLQ E;  2X4J A;  4PJL A;  4PJJ A;  1PG5 B;  4J8O A;  2Z0W A;  2EPD A;  2EYY A;  1XTD A;  3QJ6 A;  2A7Y A;  4C0Z A;  3TCJ A;  3OYK A;  3LWI A;  2VKN A;  1NEG A;  2R57 A;  3DB3 A;  3HP9 A;  5GAO n;  2ABL A;  3CCL Q;  1Y71 A;  2DE0 X;  2DVJ A;  3QJY A;  4KUI A;  4XQ3 A;  1GBR A;  3PMI A;  1YI2 T;  4AMC A;  4JS5 A;  2E12 A;  3MP1 A;  2LNH B;  1R8O B;  2ENM A;  2RQT A;  2VC8 A;  3CCL T;  4BY6 B;  1RI0 A;  2HQH A;  5KYX B;  3OMC A;  2EQI A;  1AWJ A;  1VQ6 Q;  1B34 B;  2CRE A;  2JW4 A;  3L2Q A;  4M7D B;  3MP6 A;  3QUI A;  4O6J A;  1ACM B;  3JCM W;  2RB6 A;  3PIO A;  3SWN A;  1X2Q A;  3CCE Q;  2KYM A;  3OYJ A;  1Y7X A;  1VQ6 T;  2CT3 A;  5LJ3 d;  2DL5 A;  1EIF A;  2K3Y A;  2QEX A;  1GCQ A;  2JJ9 A;  4PKC C;  3FEO A;  2E4H A;  2GCX A;  3H8Z A;  3E19 A;  3VS1 A;  3CCE T;  2YRV A;  2SEM A;  3RBB B;  4RTY A;  1UHC A;  4FU6 A;  4EMG A;  1M5Q 1;  1VIF A;  3R6O A;  3JCM f;  1W2B S;  4CC4 B;  1Q86 U;  1WX6 A;  2LJ3 A;  2D8J A;  1PCX A;  1TUG B;  1WJQ A;  2HKQ B;  3EG9 B;  4A4H A;  3G6E Q;  2HMA A;  3QSU A;  2CH4 W;  4HVV A;  2EW3 A;  2FB7 A;  2CT4 A;  2K79 A;  3UDC A;  1OPL A;  2YDL A;  4M77 C;  1IGQ A;  2DYI A;  2K5F A;  4JUV A;  2J6O A;  1D0Z A;  1M90 C;  1YHQ A;  4BB7 A;  2EYX A;  3L2V A;  3G6E T;  1WHK A;  2AZS A;  2CUD A;  3QDR B;  3CD6 Q;  2JM9 A;  2O2O A;  2RJC A;  2FPE A;  3OYM A;  4LD6 A;  3OMG A;  1UDL A;  1GCP A;  2M16 A;  4QQG A;  4JPB W;  5KCH A;  1UJ0 A;  3OS1 A;  1QCO A;  3CD6 T;  4XTU A;  1NLP C;  3NTI A;  2HCK A;  3X25 B;  4C5H A;  4AFU C;  4QVZ A;  1FXX A;  2K6D A;  2CGH A;  5J26 A;  2KRN A;  1O9S A;  1ZSZ A;  3SWN C;  3FC3 A;  2AHJ B;  3VS5 A;  1WQ7 A;  1WJR A;  4MDW A;  4OVA A;  1Y57 A;  1QKW A;  3M56 A;  1M3A A;  1WZO A;  2CYZ B;  3NTH A;  4D6W A;  1K73 U;  3OS2 A;  2RJD A;  2XK0 A;  1G3S A;  1S72 Q;  2ZPG B;  3SHW A;  2L3Q A;  1NBE B;  1I5O B;  1WHJ A;  2JT4 A;  2EGA A;  3TU4 K;  2RI5 A;  1I1J A;  2L3S A;  3G7Z A;  1VQK A;  3EG0 A;  2L8D A;  1S72 T;  3J80 E;  2OTJ Q;  1YWP A;  4OGE A;  1JQQ A;  2PUO B;  3SD4 A;  2DM1 A;  3JCM h;  3D7S B;  4RG2 A;  1PC0 A;  3EFO A;  1OPK A;  3RMS A;  2F69 A;  3HKS A;  2P4T A;  2XU8 A;  2QXF A;  1K8A C;  3UWN A;  4J7I A;  2OTJ T;  3EG3 A;  3C0C A;  4E7L A;  3QZ5 B;  3SEM A;  2LCC A;  4AFS C;  1WIE A;  2L0A A;  3OYB A;  3LH5 A;  3OYC A;  5FWC A;  3TEE A;  5CVI A;  2DF6 A;  1Y0M A;  3REB B;  1E6H A;  3BDL A;  5GAN e;  5FLX E;  1ZSZ C;  4FM4 B;  2WAC A;  2C0O A;  4FT4 A;  2DZ9 A;  1K9M C;  5KYY B;  3FJP A;  2COY A;  4M78 G;  3CCV A;  2AKK A;  2RHY A;  1ZA2 B;  4M77 F;  1VYT A;  4LDY A;  2BE7 D;  1TWB A;  1BIB A;  3QYG B;  1VQ7 A;  2EFI A;  1QP2 A;  4M78 E;  5FU6 B;  2VXE A;  3SFM A;  2XKO C;  1YBY A;  4DA4 A;  2DET A;  1PKT A;  4DBF A;  3ASK A;  3RDV A;  4J9B A;  1N5Z A;  2MI6 A;  5GAM e;  3L2Z A;  3MCA B;  4RTX A;  4FW1 A;  3LLR A;  1PHT A;  3CC7 Q;  1ZHI A;  1JBM A;  1VQM A;  2VV5 A;  1M30 A;  2O4X A;  1E7O A;  3CME T;  4NL2 A;  1KC8 U;  3QKJ A;  2ZPB B;  4C92 C;  3C95 A;  5C6S A;  3JB9 G;  3CC7 T;  1BKB A;  2Y4Y A;  1TG0 A;  1UGV A;  3NHN A;  4IUU A;  3CCJ Q;  3OYE A;  2FYK A;  2R5M A;  2K4Y A;  2O31 A;  3L1A A;  2V8J A;  1SG5 A;  5GAO p;  5I11 A;  2F2W A;  2P0Q A;  4GLM A;  4RTV A;  2GBQ A;  1G3T A;  2DD5 A;  4LUE A;  3EFS A;  2M02 A;  1ZLM A;  2E6N A;  2FZC B;  3HFN A;  3CCJ T;  2OAU A;  2J7I A;  3LH0 A;  2X35 A;  4X1V A;  2XDD A;  1RI9 A;  4B9W A;  3CC2 Q;  2MPX C;  2GQI A;  3S3M A;  3P8B B;  5LJ5 e;  5CKF A;  2I0N A;  1U5S A;  1HYO A;  4EMH A;  1MMG A;  2ATC B;  2LCL A;  1XJW B;  2FG0 A;  3I56 Q;  1RAF B;  4RCC A;  3E1S A;  3CC2 T;  1B34 A;  1HD3 A;  1HXD A;  2H3J A;  1M1F A;  4DBR A;  1WHH A;  3MEW A;  1VQN Q;  1X75 C;  4BDY A;  4M7A G;  3GNG A;  2DTI A;  4E7Z A;  2RHX A;  1UJY A;  3L2W A;  1YJW A;  1BU1 A;  1C0M A;  4HT9 A;  1VQL Q;  2E41 A;  1U1T A;  2KT1 A;  4ELZ C;  3GBQ A;  4V2S A;  2VGN A;  3M53 A;  1VQN T;  3KFV A;  1NJI R;  4M7A E;  3I55 A;  1IRE B;  2B86 A;  2NYS A;  1B07 A;  4M75 G;  1Z9Q A;  1Y07 A;  4FL6 A;  2DRK A;  2PZ1 A;  2XG8 D;  1HK9 A;  2CZ6 B;  1V76 A;  1BI2 A;  1BBZ A;  4R55 A;  2JXB A;  4J5Y A;  1CKA A;  4M75 E;  2DIQ A;  3EG9 A;  1MV0 B;  3ER0 A;  3G71 Q;  1BIA A;  1Q7Y R;  2DL8 A;  4A4E A;  3GLX A;  3G4S Q;  2GFA A;  3JB9 J;  3CCU A;  4JLI A;  1KSW A;  3AT1 B;  3VYG A;  2H3E B;  2MOX A;  3I9Q A;  2A28 A;  4EDU A;  4XAX B;  1UFF A;  3G71 T;  1C6V X;  4TVR A;  2GF7 A;  2X3W D;  2JN0 A;  3G4S T;  4DBQ A;  1PD1 A;  2DMO A;  2FPF A;  2HSP A;  5GAN 7;  2RI2 A;  1ZSG A;  3M0T A;  4PJN A;  1VQP Q;  2ZAE A;  4BY6 C;  3ZEH A;  4UC4 A;  1ZX6 A;  1Q7Y U;  3CXC P;  3VKI A;  3CCR Q;  3QZ9 B;  4QVD A;  3V8L A;  5GAN 4;  1SHG A;  1WHG A;  1G8X A;  1ZSZ B;  2VUB A;  4JJB A;  4F7U E;  3CCM Q;  3OY9 A;  2QEX Q;  1VQP T;  1LJO A;  2E5Q A;  2MWP A;  1U3O A;  1KQS P;  1G83 A;  1X01 A;  3CCR T;  1D0X A;  4PJO G;  1WI7 A;  1RAH B;  4C92 F;  2FHD A;  3CCM T;  1QVF A;  2PVG B;  1H3Z A;  1M9S A;  3QO3 A;  4FCY A;  1KQ2 A;  4NL3 A;  1RAA B;  3QDF A;  4OMN A;  3HPW A;  4PJO E;  1EZZ B;  3I5R A;  1QQJ A;  2DTO A;  1W6X A;  4OP0 A;  4C0D B;  3H41 A;  1YJN A;  3HHT B;  4F7U B;  1RAG B;  1WXU A;  2NUP A;  8AT1 B;  2VB6 A;  2CUB A;  4XU1 A;  1YHQ Q;  2DO3 A;  2A08 A;  4EIK A;  4BI3 A;  3FIF A;  4RUG A;  1NE8 A;  3OBW A;  4JZ3 A;  1W1F A;  5IHK A;  5L23 A;  4OF1 A;  4E6R A;  5I2S A;  1W4S A;  2YLB A;  2MIO A;  4KH1 B;  3RMQ A;  3BW1 A;  3ME9 A;  2EJ9 A;  3VUZ A;  2HNI A;  1Q81 C;  1I0C A;  2LP5 A;  2J6F A;  1OOT A;  4LUD A;  3H6Z A;  1KK7 A;  4JRP A;  2Y4X A;  1HSQ A;  1VQ5 T;  2M0Y A;  8ATC B;  2LQN A;  3M0U A;  2OTL A;  4FIB A;  2RQR A;  4FSX A;  3MET A;  1Q82 U;  4Z89 A;  4QVC A;  2LQ8 A;  3O8V A;  3RKW A;  2FEI A;  1FMW A;  3RR6 A;  5I2M A;  2PQW A;  5KYY A;  5I22 A;  2JNG A;  1ZQ1 A;  4BUG A;  2MK5 A;  1GRI A;  3S6W A;  1PD0 A;  1QVP A;  1QMC A;  2FL7 A;  2RPN A;  2LCS A;  3TSW A;  1JXM A;  4C8Q G;  4QT7 A;  1G2B A;  1VQK Q;  2JTF A;  2BKD N;  4C0G A;  4F14 A;  4ORZ A;  2DKG A;  3QWX X;  2CP2 A;  1TH7 A;  5GAO m;  1FMV A;  3M54 A;  2CZ1 B;  4C8Q E;  4AT1 B;  2O9S A;  1N9R A;  4MZM A;  4FW2 A;  2XDB A;  1OQK A;  4ATO A;  1ZA1 B;  3MEU A;  2D0N A;  2VAS A;  5LJ3 e;  2X4W A;  3G1J A;  4ZN1 A;  1LNX A;  1UGQ B;  4P5N A;  2EGE A;  2DL3 A;  4L59 A;  4M7D F;  4VUB A;  4R0K A;  3V8J A;  2AZV A;  2BE9 B;  2E65 A;  2K2V A;  2KDS A;  4KGX B;  1D1B A;  5A2Q E;  3CXC S;  2QDL A;  3A8L B;  4M78 A;  3JAM E;  2RH2 A;  4RTU A;  4E7J A;  2G3R A;  1NM7 A;  2CZ7 B;  1KQS S;  5IXF A;  1M1G A;  2HD0 A;  2LJ0 A;  1IRX A;  2E64 A;  3N5B B;  5HK3 A;  3PT9 A;  5GMK h;  4Q5W A;  3KUF A;  1OZ2 A;  4HVU A;  3GP8 A;  2EIF A;  1BCO A;  3UA7 A;  4OMM A;  5CO7 A;  2EBP A;  3VYH B;  1C1A A;  3JCM g;  1G3Y A;  2DPP B;  2KNB B;  2RD1 A;  5GAN 5;  4N0A A;  5FRM A;  1CKB A;  2EYQ A;  5KYU B;  1Q86 R;  1M90 U;  1D3B B;  1V1C A;  5FU6 C;  2F5K A;  4BE1 A;  2XIC A;  2G6F X;  2GQV A;  1KJW A; 
#chains in the Genus database with same CATH homology
 3TRE A;  4J7I A;  3M55 A;  2OTJ T;  3AHU A;  4M75 F;  3M59 A;  3EAE A;  4E7L A;  5GAN 6;  3QZ5 B;  4M7D A;  3SWN B;  2PVD B;  3JRZ A;  5GMK l;  3CCQ A;  1KC8 C;  2LCC A;  5GAM d;  1QVG S;  4ZGJ B;  4RKU E;  2D6F A;  4KUL A;  3CME A;  2D0Q B;  2QA4 A;  1NPR A;  3DLL A;  4KT0 E;  3CC7 A;  2KK4 A;  1X6O A;  3OYB A;  1NPP A;  2FVU A;  2LT4 A;  2R58 A;  4EMK C;  3TEE A;  2BUD A;  5CVI A;  3OYC A;  2A3L A;  2DZC A;  4N4H A;  3M5A A;  5D6X A;  4E7H A;  3BDL A;  3OA6 A;  5GAN e;  1U8R A;  3PGG A;  4XU3 A;  5FLX E;  4WF2 A;  4FM4 B;  2D9T A;  2MWO A;  2WAC A;  2B8A A;  2QQ9 A;  1VIE A;  1QP3 A;  2EJF A;  4FT4 A;  3RES A;  1YIT A;  2DZ9 A;  4RMO A;  3GPL A;  1G3W A;  1K9M C;  4HCB A;  3MEA A;  3CXC A;  3C12 A;  3QXE B;  3JCM d;  2P0K A;  3P8D A;  4C8Q C;  3CCJ A;  3FJP A;  4X9C A;  1Y96 B;  4C8Q D;  4M78 G;  4N4G A;  2HBP A;  2Y90 A;  3CCV A;  5HY6 A;  5GAN g;  5AYF A;  1O75 A;  1KHI A;  1OZ3 A;  2EAY A;  4RG8 A;  3CCS A;  2RHY A;  4OB0 B;  2C06 A;  1I81 A;  2ZZD A;  2HQE A;  3LX7 A;  4GY5 A;  4M77 F;  3X24 B;  4LDY A;  1N9S A;  1BIB A;  2DXB A;  3CC4 A;  3QYG B;  1VQ7 A;  3CBO A;  4IUV A;  2M0O A;  4C5I A;  5LJ5 f;  3JCM V;  4M7A A;  2KMT A;  3SDZ A;  2EFI A;  4ZTJ A;  2QTX A;  1VQ4 T;  2QQS A;  1QP2 A;  4M78 E;  3JCM P;  5FU6 B;  5GAN h;  3CBP A;  1NJI U;  2VXE A;  3OYD A;  4QQ6 A;  2DXT A;  3MHX A;  1WJS A;  2VGM A;  3SFM A;  2K5I A;  2XKO C;  3NTK A;  5LJ5 d;  1YBY A;  4JRI A;  1M1K C;  1VQK T;  4DA4 A;  5CQX A;  2X4Y A;  3OQ5 A;  2RO0 A;  3GF5 A;  4HKE A;  4A53 A;  4B9X A;  2LX9 A;  2V8K A;  3CPF A;  3OSV A;  1YIJ A;  4N0A C;  3DLM A;  3ASK A;  3INZ A;  4NS5 A;  4M75 A;  1U1S A;  4XU0 A;  3MEV A;  2MI6 A;  4MZT A;  4F7U G;  5GAM e;  2EQK A;  1ZBX A;  3L2Z A;  3MCA B;  4HA8 A;  3UPU A;  4GLK A;  5IN1 A;  4PJO F;  4XTV A;  2CKK A;  3LLR A;  5CAI A;  1PSF A;  5GAN 2;  1WGS A;  1VQ8 T;  1ZHI A;  2L5Q A;  5CQY A;  1UGR B;  4BI8 B;  2HQX A;  4E7I A;  1JBM A;  3HRU A;  1XNI A;  3CCQ T;  1VQM A;  1K8A U;  4M7D C;  2VV5 A;  1XOV A;  3WVD B;  2KAF A;  4BE2 A;  2O4X A;  1BYM A;  5GAM g;  3CME T;  3PTA A;  4NL2 A;  1KC8 U;  3QKJ A;  2QA4 T;  2ZPB B;  4C92 C;  3C95 A;  5C6S A;  2F5T X;  3JB9 G;  4HCC A;  3CC7 T;  1BKB A;  2Y4Y A;  2XDP A;  4C8Q B;  4C92 D;  1BI0 A;  4M7D G;  4IUU A;  2RHZ A;  4KBM B;  3HSB A;  2BIV A;  5A0D A;  2DD4 A;  3OYE A;  2GFU A;  3QG1 A;  2FYK A;  2R5M A;  2K4Y A;  2K57 A;  3L1A A;  5GAN 8;  2V8J A;  2CZ0 B;  4QW2 A;  5GAM h;  4MDX A;  5GAO p;  1VQ9 A;  1NJI C;  5EG2 A;  1YIT T;  5FRN A;  2P0Q A;  2WSE E;  2ZPH B;  1VQ4 A;  1G3T A;  2DD5 A;  2WSC E;  3FLG A;  3M4Y A;  4EPC A;  4M77 A;  4M7D E;  3EFS A;  4FT2 A;  2E6N A;  2DAQ A;  3HFN A;  3JCM X;  4PL6 A;  3OS0 A;  3CCJ T;  4F7U A;  1JJ2 A;  2OAU A;  3LH0 A;  2X35 A;  1K9M U;  3G71 A;  4ZGD B;  3CCV T;  3DB4 A;  1WNL A;  2XDD A;  4B9W A;  3Q1J A;  1M4Z A;  3CCS T;  2EQJ A;  2IVW A;  2VYT A;  3JB9 H;  3G4S A;  1UB4 A;  3JB9 I;  2E1H A;  3P8B B;  4CRI A;  3S3M A;  5LJ5 e;  5CKF A;  3CC4 T;  3LWH A;  1VQ7 T;  2EQU A;  4EMH A;  3QHS A;  4IKF A;  3BDU A;  2E6Z A;  2JTM A;  2LCL A;  1BI1 A;  3RIR A;  3OYF A;  3M58 A;  2VXF A;  3V7C A;  3F70 A;  1Q7Y C;  4DOV A;  4M7A C;  4RCC A;  3E1S A;  2ZPF B;  4XTX A;  4A4K A;  5CKE A;  3CC2 T;  1B34 A;  5GAN 3;  1HXD A;  2H3J A;  2E10 A;  1M1F A;  4LDU A;  3A8O B;  3MEW A;  3CEY A;  3P8H A;  4LDV A;  1X75 C;  1YCY A;  4BDY A;  4JDS A;  5LJ5 g;  4PLI A;  1NZ9 A;  1PSE A;  3GNG A;  2DTI A;  3KXT A;  3CMA T;  4M7A G;  3RUX A;  2RHX A;  3GIB A;  3L2W A;  3M57 A;  2K3X A;  1VQP A;  1YJW A;  2LQK A;  1M1K U;  1YIJ T;  4X34 A;  5LJ3 f;  4J6W A;  4ZTF A;  1QVF S;  4HT9 A;  2E41 A;  1U1T A;  4ELZ C;  4V2S A;  2VGN A;  2JVV A;  3M53 A;  3LW5 E;  3OB9 A;  2WSF E;  1VQN T;  4C92 B;  3CCR A;  2RHU A;  4JS4 A;  4N4I A;  5LJ5 h;  3L2R A;  4M7A E;  3CCM A;  2DXU A;  3I55 A;  1IRE B;  2R5A A;  1JJ2 S;  4M75 G;  2XD0 A;  1Y07 A;  4FL6 A;  4M78 C;  5GAO r;  3LYI A;  2XG8 D;  3QII A;  4X9D A;  1VQM T;  2MMP A;  1HK9 A;  2CZ6 B;  4M78 D;  1OYX A;  1BI2 A;  3E9G A;  5GMK m;  4R55 A;  4J5Y A;  2EWN A;  1KHC A;  4XU2 A;  2EJG A;  4C5G A;  5CKB A;  5CKH A;  4XK8 E;  5DM7 R;  1DJ7 B;  4M75 E;  2DIQ A;  4BI4 A;  4C8Q F;  5FU7 C;  3ER0 A;  1I8F A;  2V8I A;  1JB0 E;  5L8R E;  1BIA A;  2RM4 A;  3E9F A;  1VQ9 T;  3OYH A;  4Y91 A;  3LGF A;  4A4E A;  3GLX A;  2GFA A;  3V7R A;  3JB9 J;  5GAO l;  1YI2 A;  3CCU A;  3RER A;  4LDX A;  4JLI A;  1I5L A;  3ZBD A;  3VYG A;  3CC2 A;  3JSC A;  5CK9 A;  2I2L A;  2RJF A;  4EDU A;  4C0D C;  3CPW A;  3CCL A;  4XAX B;  3G71 T;  5FRO A;  3J7A F;  4JJN K;  4TVR A;  3FB9 A;  5D6W A;  1RL2 A;  2GF7 A;  3V7S A;  5KH6 A;  3CMA A;  2DVE A;  2JN0 A;  3G4S T;  4OGC A;  4M77 G;  5CR2 A;  1MHN A;  3I56 A;  4DOW A;  3X28 B;  3GNF B;  5J3B A;  4JRK A;  5GAN 7;  3OW2 S;  5HKC A;  1XQH A;  2K5L A;  2RI2 A;  4IUQ A;  4C5E A;  3WXM B;  1VQN A;  2RI3 A;  1N27 A;  4BY6 C;  3ZEH A;  3JCM b;  4UC4 A;  3JCM J;  4EMK B;  2L3R A;  1VQ6 A;  3M4G A;  1Q7Y U;  2E70 A;  3CBM A;  5HK0 A;  3VKI A;  4M77 E;  3QZ9 B;  4QVD A;  3OS5 A;  3V8L A;  2RJE A;  5GAN 4;  4CI0 C;  1VQO T;  4Y28 E;  1VQL A;  2VUB A;  1VQ5 A;  3JB9 D;  2QI2 A;  4F7U E;  3M9Q A;  2ZCF B;  3FRN A;  3QYH B;  5A0G A;  3OY9 A;  3PIP A;  1Q82 C;  4L5G A;  4M7D D;  5CIU A;  1FWZ A;  2ZPE B;  4M78 B;  5IAY A;  1LJO A;  3CCE A;  2E5Q A;  1YJW T;  3JCM Q;  1UGS B;  2MWP A;  2XHC A;  4C0F A;  4A54 A;  4MML A;  2PUK B;  5GMK i;  3MP8 A;  2KSS A;  3RKX A;  2O4X B;  3BFM A;  1X01 A;  4MZP A;  3OBY A;  3CCR T;  2QQB A;  2KVQ G;  3QPH A;  4IUP A;  4PJO G;  3LGL A;  4L6V 5;  4NOY A;  4C92 F;  2FHD A;  3URG A;  2NLU A;  3CCM T;  3I55 T;  1QVF A;  3CPW S;  2L89 A;  4IUR A;  4OB2 B;  5DLQ E;  5DY9 A;  5LJ3 g;  1N8R C;  2PVG B;  2X4J A;  1H3Z A;  1M9S A;  1N6A A;  3QO3 A;  1KQ2 A;  2DTH A;  4NL3 A;  4C8Q A;  4J8O A;  1KQ1 A;  3BY7 A;  1XTD A;  2DJZ A;  3HPW A;  3QJ6 A;  4LDW A;  2A7Y A;  3SB2 A;  4C0Z A;  4PJO E;  3TCJ A;  3OYK A;  4HCZ A;  3LWI A;  4OMF B;  5I21 A;  2DEQ A;  2DTO A;  5CCA A;  2R57 A;  4OP0 A;  5LJ3 h;  3DB3 A;  3HP9 A;  4C0D B;  5GAO n;  1YJN A;  4BD3 A;  3OYL A;  1Y71 A;  3HHT B;  4F7U B;  3G6E A;  3OYY A;  1Q86 C;  3QJY A;  4KUI A;  4XQ3 A;  4OB1 B;  4XU1 A;  3OYG A;  2QQR A;  2DO3 A;  4RCB A;  3PMI A;  1YI2 T;  4BI3 A;  3CCU T;  1WPY A;  4JS5 A;  3FIF A;  2E12 A;  1IZ6 A;  1KG1 A;  2HAX A;  2QDY B;  1NE8 A;  3OBW A;  4J6X A;  1WQW A;  3HFO A;  3MP1 A;  1R8O B;  3J81 E;  4E7K A;  4M7A D;  4OF1 A;  2VC8 A;  2M1H A;  2DIG A;  4BY6 B;  3CCL T;  2JUF A;  4ZGE B;  4KUD K;  1D3B A;  5I2S A;  1KD1 U;  1RI0 A;  1W4S A;  2MAM A;  3OMC A;  3X20 B;  3S3O A;  1VQO A;  2YLB A;  3CD6 A;  3RMQ A;  3BW1 A;  1B34 B;  2KY9 A;  1AHJ B;  2EQM A;  5LL6 S;  3ME9 A;  2EJ9 A;  3VUZ A;  2HNI A;  3GOX A;  3I56 T;  4OB3 B;  3X26 B;  3L2Q A;  3C94 A;  3MP6 A;  3QUI A;  3L2U A;  4O6J A;  1Q81 C;  4M7D B;  2M9U A;  4M75 C;  2JZ2 A;  3H6Z A;  3JCM W;  3S3N A;  2RB6 A;  4BE0 A;  3PIO A;  1UGP B;  3SWN A;  4M75 D;  4JRP A;  3OYJ A;  1Y7X A;  1VQ6 T;  5LJ3 d;  1EIF A;  2K3Y A;  3VJP A;  2Y4X A;  2QEX A;  5KE3 A;  3OW2 A;  1FX7 A;  4IUT A;  4PKC C;  3A5Z B;  1VQL T;  1VQ5 T;  1UEB A;  2XID A;  2ZGW A;  3FEO A;  2GCX A;  3H8Z A;  3V8K A;  1YJ9 T;  3E19 A;  4II1 A;  4C92 A;  2OTL A;  3CCE T;  4FIB A;  4FSX A;  2YRV A;  1K73 C;  1H64 1;  4M78 F;  4J6Y A;  3MET A;  3WVE B;  1Q82 U;  1M8V A;  4QVC A;  1G5V A;  5CKD A;  2ZPI B;  4FU6 A;  4ELY C;  2LQ8 A;  3O8V A;  4EMG A;  3RKW A;  4R56 A;  1M5Q 1;  1VIF A;  3OSS C;  3R6O A;  3JCM f;  1W2B S;  2RK2 A;  1Q86 U;  4LD9 K;  5I2M A;  5C0M A;  2PQW A;  4PJO A;  2LRQ A;  4A4G A;  3OYA A;  1WJQ A;  5J39 A;  1Y96 A;  4A4H A;  5DLO A;  2JNG A;  5GAN j;  3JCM c;  3QSU A;  1ZQ1 A;  4BUG A;  2FB7 A;  1GXI E;  1KD1 C;  1N8R U;  4QQD A;  3UDC A;  4M77 C;  2RHI A;  2RA2 A;  4HT8 A;  2P0P A;  4M7A B;  2K5F A;  4JUV A;  3S6W A;  1QVP A;  1VUB A;  4M77 D;  3OYI A;  4JLG A;  2FL7 A;  3ZFJ A;  1M90 C;  4BAC A;  1YHQ A;  1S72 A;  4BB7 A;  1YJN T;  4DQ2 A;  1SSF A;  5KCO A;  4C8Q G;  3L2V A;  1KQS A;  3KBG A;  3G6E T;  3PMT A;  4ZN3 A;  2JTF A;  2BKD N;  2KQW A;  2YHT A;  3QDR B;  4C0G A;  4F7U F;  2DKG A;  2DXC A;  1TH7 A;  2RJC A;  3OYM A;  3VUB A;  2LVM A;  4LD6 A;  3OMG A;  4M75 B;  5GAO m;  2M16 A;  2DK3 A;  3M54 A;  2OTJ A;  4QQG A;  2CZ1 B;  3A8G B;  4C8Q E;  1MGQ A;  4XTY A;  1N9R A;  4MZM A;  5KCH A;  2XDB A;  3HL8 A;  2JOY A;  4ATO A;  2EKO A;  3MEU A;  1OI1 A;  3OS1 A;  3CD6 T;  4XTU A;  2PVO B;  4XTZ A;  5LJ3 e;  1YJ9 A;  4PJO C;  4C5H A;  2X4W A;  3NTI A;  3X25 B;  1I4K 1;  2LTO A;  2O01 E;  3PFS A;  2LC4 A;  5GMK e;  4JRQ A;  4ZN1 A;  1LNX A;  4QVZ A;  1UGQ B;  3JB9 F;  4PJO D;  1FXX A;  4P5N A;  4EMK A;  1VQP T;  4L59 A;  4M7D F;  4VUB A;  5KE2 A;  5GMK j;  2CGH A;  3A8H B;  3T9N A;  1Q81 U;  5J26 A;  5D6Y A;  1V29 B;  3V8J A;  1O9S A;  2E65 A;  1P92 A;  2K2V A;  2KDS A;  3SWN C;  2AHJ B;  5GAM j;  5A2Q E;  3FC3 A;  5A0L A;  3CXC S;  3A8L B;  4M78 A;  3JAM E;  2QEX T;  5GAN f;  2RH2 A;  5FU7 B;  4ME7 A;  4E7J A;  2CS7 A;  2G3R A;  2CZ7 B;  5LJ3 j;  3PNW C;  1WQ7 A;  2XI9 A;  1WJR A;  5M9O A;  2LDM A;  1KQS S;  2OTL T;  4MDW A;  4OVA A;  1M1G A;  3NFC A;  2HD0 A;  4PNO A;  1LOJ A;  3M56 A;  1BI3 A;  2E64 A;  3N5B B;  5GAN d;  2CYZ B;  3NTH A;  4M77 B;  5HK3 A;  4D6W A;  3PT9 A;  1JRI A;  4J7F A;  3JCM e;  1QVG A;  1K73 U;  4J83 A;  3OS2 A;  2RJD A;  2LNV A;  3OYN A;  5GMK h;  4Q5W A;  3A8M B;  3KUF A;  1OZ2 A;  4C92 G;  4XTW A;  2XK0 A;  1G3S A;  3GP8 A;  2ZPG B;  1QW1 A;  2EIF A;  4PLL A;  2MF2 A;  3VU3 C;  3EFR A;  2LT1 A;  3HRS A;  5CO7 A;  4A4F A;  2YLC A;  3MO8 A;  3TU4 K;  4Z02 A;  2QQA A;  1W2B A;  4YTL A;  2RK1 A;  3VYH B;  3HRT A;  3JCM g;  3C4S A;  1G3Y A;  2DPP B;  2RI5 A;  3RKY A;  5GAO q;  2RD1 A;  4C92 E;  3G7Z A;  5GAN 5;  1VQK A;  4M7A F;  2X4X A;  1YHQ T;  2L8D A;  2PU9 B;  3DKM A;  3J80 E;  1S72 T;  4N0A A;  5FRM A;  2EYQ A;  2IG0 A;  3FDR A;  3L42 A;  4MMK A;  1M90 U;  1D3B B;  4OGE A;  3VV0 A;  3QBY A;  2PUO B;  3SD4 A;  5FU6 C;  5IT9 E;  4BDZ A;  4PJO B;  4E47 A;  3JCM h;  2F5K A;  4RG2 A;  4BE1 A;  5GAM f;  2XIC A;  5LJ5 j;  3UT1 A;  4O5V A;  3RMS A;  2F69 A;  3HKS A;  2P4T A;  2XU8 A;  2QXF A;  2GQV A;  1K8A C;  3UWN A;  1VQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...