4QQ6A

Crystal structure of tudor domain of smn1 in complex with a small organic molecule
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
QQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Survival motor neuron protein
publication title Crystal Structure of tudor domain of SMN1 in complex with a small organic molecule
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 10
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2014-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4qq6A00
5C6SA 4QQDA 2M16A 3OS1A 2BIVA 4NS5A 2WACA 3DB4A 3FLGA 3L2WA 5KCHA 2P0KA 3E9GA 2K3XA 2L8DA 2B8AA 2MWOA 4E7LA 4BD3A 3OY9A 3OYEA 2L89A 1OZ2A 4E7IA 2R58A 3OYDA 3L2RA 3FDRA 5FROA 3OMGA 3NTIA 3QKJA 3S3NA 2RO0A 3MO8A 2RI3A 4CRIA 5FRNA 2RJCA 2R57A 3NTKA 3DLMA 3OYGA 3PMIA 4C5EA 1SSFA 3OYCA 3S3OA 3O8VA 3QIIA 4BE1A 2HQXA 2MWPA 4PLLA 3L2QA 4FL6A 3CEYA 3DB3A 2EFIA 3NTHA 4LD6A 4PLIA 4B9XA 4IUTA 4E7JA 2BUDA 4IUQA 2E5QA 4ZTJA 3PMTA 3H6ZA 4RG2A 4IKFA 2D9TA 2EQMA 3UT1A 4X34A 1MHNA 5KCOA 2DIGA 5J26A 2JZ2A 3L2UA 3FEOA 3PNWC 2M1HA 2RJFA 3P8DA 4L59A 4N4IA 4N4HA 3LYIA 4QQ6A 4E7KA 4A4FA 2RHXA 4B9WA 4C5HA 2DAQA 3MP8A 3QBYA 4UC4A 4BACA 3OYAA 4BE0A 4ZTFA 2F5KA 3OS0A 3OMCA 2E6NA 3OYNA 2EKOA 2LTOA 2VYTA 5C0MA 2RJEA 5D6WA 3OS2A 2EQJA 2LCCA 3OYLA 4IUPA 2M0OA 3MP6A 1KHCA 2X4XA 2XDPA 4QVZA 3FC3A 2JTFA 2L3RA 1G5VA 2RI5A 2O4XA 4OVAA 3BDLA 3KUFA 1WJRA 2RHYA 3Q1JA 2X4YA 4C5GA 3LGLA 4A4HA 2XK0A 4BDYA 2LVMA 3F70A 3OYKA 3PFSA 2QQSA 3MEWA 2X4WA 2GF7A 2O4XB 3L42A 3OA6A 4BE2A 5IN1A 4E7HA 4A4EA 1RI0A 2FHDA 5D6YA 4A4GA 3LLRA 2GFUA 4IUUA 3MEUA 5KH6A 5M9OA 3LX7A 3QJ6A 3LH0A 3EAEA 1OI1A 3SD4A 4C5IA 2RJDA 2R5AA 1WGSA 3S3MA 4QQGA 4PL6A 3OB9A 4IURA 3UWNA 5KE3A 1OZ3A 2X35A 2RHIA 2LDMA 3MEAA 4N4GA 3OYMA 4II1A 5FRMA 1WJQA 3ME9A 2IG0A 2RHUA 3E9FA 4Z02A 2NLUA 3P8HA 3MP1A 3OYJA 3OQ5A 1WJSA 5KE2A 5CIUA 3GOXA 2GFAA 2BKDN 2RHZA 5J39A 2YRVA 1XNIA 5IAYA 2EQKA 2DIQA 3S6WA 4FU6A 3OYHA 3OYIA 4EDUA 2R5MA 2G3RA 2EQUA 4BDZA 1N27A 5D6XA 3LGFA 3C4SA 2K3YA 1OYXA 3META 2CKKA 3OYBA 3OYFA 3H8ZA 3L2VA 3M9QA 4Q5WA 4HCZA 2HQEA 4QW2A 2QQRA 2PQWA 3ASKA 2RI2A 4GY5A 3MEVA 3ZEHA 1H3ZA 4IUVA 2LRQA
chains in the Genus database with same CATH superfamily
3VS3A 4QQDA 4J6WA 1U1TA 2CSIA 3A1PA 3CCJA 5KYXB 1X2QA 3RIRA 1JXMA 3INZA 1UHCA 2FPEA 2VASA 3V7SA 1P92A 4QKUA 2JOYA 4M7DD 5FWBA 2FPDA 2XMFA 1E6GA 1SF9A 1UJYA 3NTKA 4J9CA 2CP0A 1D0ZA 5AT1B 2ZZDA 5GMKm 4RCCA 3BDUA 2PUKB 1VYVA 3EGDA 4XK8E 3G1JA 1YCSB 1VQ8A 1JEGA 2QA4Q 1BI0A 1AEYA 4A53A 3OYAA 1Q86U 2QQAA 1M90U 4KH1B 2M0YA 5D6WA 1QCOA 3VV0A 2D0NA 4M78G 3JCMb 2RI5A 1W70A 1JJ2S 5GAN6 2JM9A 5GANj 4AFUC 3HHTB 4M77A 1I4K1 2YXYA 3HSBA 1SSHA 2DL5A 2E4HA 3RDVA 2QEXT 1ACMB 4A4GA 2OI3A 3UPUA 1SHGA 1SG5A 3I56Q 2KT8A 1W6XA 1S1NA 4Z88A 2LDMA 1JO8A 2MAMA 2DILA 4PJOA 1VQOT 2RB6A 4FW2A 2AK5A 4DOVA 4M75B 3QYGB 3QHSA 2QTVA 2QQBA 2W10A 2NUTB 5LJ5h 1IZ6A 4Q5WA 1VQKA 2VB6A 5KYXA 3SEMA 4HXJA 3VU3C 2DL4A 5GMKh 1YI2Q 1X69A 2D1XA 1NZ9A 1QKWA 1HK9A 4KRTA 5LJ3d 1VQ5Q 3OYEA 2OX7A 5GAOp 3CC7Q 2OAWA 2RJCA 5CAIA 3A8GB 4J6XA 5IXBA 1Y71A 4M77D 3CPWS 1H8KA 3WVEB 1RLQC 1Q86R 2EFIA 3CC2T 3I56A 1M90R 2EVRA 1YIJT 2NUPB 3EG2A 2FL7A 4C92C 1W4SA 1QVGS 2LC4A 1EZZB 3JCMh 5ECAA 2FYKA 3X28B 1WXUA 3A8HB 3QBYA 3CPFA 2L2PA 2NYSA 2JXBA 3NGPA 4BI4A 2HSPA 1FX7A 2MIOA 2ZPGB 1KHCA 4QVZA 5I22A 1YI2A 1PRLC 1UB4A 3MEWA 1H641 2JVVA 3DLLA 1PRMC 1KQ1A 3FJPA 2ZPBB 3JB9G 2OTLQ 1X75C 1NM7A 3LLRA 1RACB 2CT4A 1TUDA 2P4TA 4RUGA 4BUGA 3S3MA 3CCVQ 3OYMA 4JRQA 2DTOA 2X35A 2RHIA 4M75A 4Z02A 4IIOA 2CP2A 3RBBB 5CIUA 2NUTA 2LX9A 1KC8U 4EDUA 1YJ9T 1M3AA 4DOWA 1YFNA 3OYBA 1YNZA 2D8HA 2LX7A 3MEVA 3CXCS 1I8FA 3QZ9B 4AT1B 1Y96B 4JJNK 1E7OA 1Q82U 1Y57A 3DKMA 2DVEA 3H0HA 5IHIA 2H8HA 2JUFA 2YLBA 4MMLA 2MI6A 4F7UG 1YCYA 1ZUUA 3O5ZA 1M4ZA 1NYFA 2GBQA 2FG0A 3SWNA 5LJ5j 2OTLA 1VQ4T 3O8VA 2NUPA 1GBRA 2KDSA 2XHCA 1BB9A 2CP5A 3M0SA 3QYHB 1V29B 1VQNT 2DVJA 2E12A 5I21A 4J9GA 2KXCA 2E64A 4C5HA 3G6ET 1D1AA 2DBMA 4M75D 4X9CA 2K57A 3EG9B 2PU9B 1BU1A 2DM1A 4FM4B 3VS7A 4KT0E 3GBQA 2A7YA 1SKUB 5KYYB 1NLPC 3L1AA 1NEGA 1OV3A 5GAMg 3M0UA 4A4HA 1U5SA 3MHXA 3OYKA 1AOJA 5EG2A 1YJNT 2LT1A 3GLXA 3CMEQ 2OTJT 2JMCA 1KC8R 1QLYA 4K11A 1UGRB 4HT8A 2F5TX 4XQ3A 4AFZC 4IURA 2KXDA 5DLOA 3E9FA 2CS7A 3QUIA 4FYYB 4A63B 4DBRA 1M1KC 1V1CA 3E1SA 3S6WA 3H0FA 1D1BA 1Q82R 3HFOA 3UATA 1W2BA 4M7AB 1OYXA 4DBFA 1I5LA 4JJDA 3FB9A 3D7SB 4PNOA 1NLOC 3HPWA 1VQOA 3E19A 2JJ9A 4BY6C 2WACA 1I81A 1WA7A 5KCHA 4IIMA 4BI3A 5A0LA 3CCSQ 4E7IA 5CQYA 1AWJA 1QCFA 3OMGA 4NL3A 3R6NA 5HK3A 1QWEA 3HRTA 1K8AR 1KSWA 4LD9K 1RADB 2QG9B 1K9MC 1AWWA 4M7DE 3GPLA 4LD6A 4M7AF 4B9XA 5GAN3 2KR3A 2Z0WA 1AT1B 4BI8B 1UHFA 1ZX6A 3EG9A 1SHFA 3FEOA 3P8DA 1KD1U 4NOYA 4BACA 3M0TA 2KK4A 4M7DC 1OOTA 2VV5A 4CC3A 3ZBDA 2RK2A 1BCMA 2CP7A 3QWYA 1TWBA 1CKBA 3HRSA 2CP3A 2LQNA 2Y90A 1QVGP 4E7HA 4EPCA 2DETA 1WDXA 3CCRQ 1VQ9Q 4XTVA 2EYQA 5GAMe 2V1RA 3MEUA 1BI1A 2MPXC 2KQWA 4ELZC 4QQGA 3UWNA 3LW5E 1ZSZB 5LJ5f 3MEAA 1N5ZA 3LH5A 1KIKA 1UJ0A 3N5BB 1Q81C 2LT4A 4M78B 1K1ZA 3HP9A 2GTJA 3HKSA 5D6XA 2K3YA 1HXDA 1SRMA 2EPDA 3L2VA 4C92G 4E47A 4QW2A 2QA4T 1B34B 3JB9I 2E70A 4PK4A 1YITQ 4HKEA 3RKXA 1GCPA 2O9VA 2MMPA 1KQSP 1QVFS 2RD1A 3CCLQ 2MWOA 2A28A 1VYUA 4AMCA 1D3BA 2RO0A 2YDLA 1K73U 2M51A 4M78F 1RAEB 2RPNA 3PTAA 3JB9J 1KD1R 3CCRA 2A3LA 2HKNA 2EGCA 5GANd 2EGEA 3VJPA 3CXCP 1IB8A 2E5QA 2B86A 4ELYC 3I56T 2CUDA 2EQMA 3UT1A 2LNHB 5IH2A 4M77E 3UA6A 3GF5A 1H3HA 2COWA 4A54A 1WXBA 1XQHA 3EFOB 1B7TA 4OF1A 4M7AD 2OJ2A 2VUBA 3BFMA 2EKHA 4M77C 1ZA1B 3CBMA 2LQWA 4PJOE 3URGA 5CK9A 1RL2A 3CCLA 1K9AA 2HSEB 1WYXA 1YI2T 3LWIA 3G6EA 2KRMA 2O4XB 1GXIE 1MMGA 4A4EA 2E5KA 3UDCA 1VQ5T 1X6OA 2ABLA 3CC7T 4PJOC 4IUUA 3LX7A 4PJLA 5CO7A 2K5LA 3RERA 1U8RA 2RJDA 2WSEE 4M78A 4PL6A 3NMZC 3T9NA 2DO3A 3ME9A 3SFMA 1AWOA 2E1HA 1AWXA 3GOXA 3VUBA 2COYA 2YRVA 4M7AG 1YJNA 3M0QA 2DX1A 4BDZA 4C0DB 2OTJA 4BB7A 1GRIA 3H8ZA 3QWXX 3M9QA 4WF2A 1TUGB 1N8RU 2RI2A 1LOJA 3CCEQ 1K73R 4RCBA 2CDTA 4E6RA 4C8QB 1SRLA 5A0DA 4NL2A 3V8LA 2VKNA 3G7ZA 3M59A 1UGPB 1M3BA 4JRKA 2CZ7B 3S3NA 1WQWA 1X6BA 4MZPA 5I11A 1JJ2A 3OYGA 4C5EA 4CC2A 2DXUA 3QIIA 5CKEA 2COZA 2OTLT 3TEEA 5GAMf 4LN2A 1YHQQ 2KRNA 5AYFA 1WQ7A 3PMTA 1WZOA 2CT3A 3CCVT 2HCKA 1YWPA 4JLGA 2DYIA 3JB9F 3IQLA 2M1HA 4N4IA 5GAN4 3CCQQ 1KHIA 1NYGA 4M78D 4E7KA 4C8QF 2JNGA 2O9SA 2M02A 3OBWA 2E6NA 3OYNA 4ATOA 2KNBB 4F7UB 2FVUA 4FYVB 4RTZA 2ZPHB 4KGXB 2LCCA 1EIFA 3CCEA 4M75E 2A08A 1MGQA 2O4XA 3BDLA 1M30A 2K2MA 3QDFA 1NJIR 1I0CA 2KAFA 3PFSA 1JQQA 2QQSA 3I55Q 2JTMA 4JLIA 2F69A 1T0HA 1DJ7B 4M75C 2XICA 2KBTA 2AZVA 2WSCE 4C5IA 4ESRA 1S72Q 1YHQA 1B3QA 1NPPA 4PJMA 1N8RR 2DA9A 4M4ZA 3MP1A 1W2BP 4F7UF 3QXEB 4C0GA 1LCKA 5LJ5d 4JS5A 3CPWA 1K0XA 5FU7C 3CCQA 1M90C 4GLKA 4E7SA 3KFVA 4FT4A 2PQWA 4GBQA 1G3TA 1HD3A 4LDWA 4ZN1A 2EJGA 1QVGA 5C6SA 3OS1A 1ZBJA 1M2VB 2DZ9A 4NS5A 2A37A 1GL5A 1Q7YR 3M4GA 4FIBA 4EIKA 3I35A 3SWNC 1BIBA 9ATCB 3J81E 1AZGB 3GNGA 3I55A 4FSSA 2ED0A 4DQ2A 1RAGB 2QA4A 2V26A 3JRZA 2FB7A 2CREA 3S3OA 1FWZA 1TTHB 3CMET 2PZ1A 3L2QA 1QP3A 1N9SA 2ATCB 2KYBA 4PLIA 4QVCA 1S72A 3CQTA 3JCMd 2F2VA 2KEAA 5J26A 2RJFA 3UF4A 4F7UA 2KSSA 2BTTA 1UG1A 4RKUE 1KQSA 4BE0A 2FZGB 3TSZA 3X24B 2V8KA 4N0AC 2LTOA 4WTOB 2AZSA 2W0ZA 5CKHA 1KJWA 3JB9D 2HL5C 2FRYA 4C0ZA 2DNUA 4C5GA 1MMNA 2LVMA 1BI3A 3F70A 3VS4A 4JS4A 2ECZA 4JJBA 4LDVA 3CXCA 2ENMA 4BE2A 3VKIA 2LZ6B 1IHWA 2K79A 1VQ6Q 3CCST 4Y91A 3EGXB 1Q95G 1BCOA 3HFNA 1C1AA 1GBQA 2J6KA 1TUCA 2RQTA 4II1A 4EMHA 1WJQA 2RK1A 3P8HA 4JDSA 3JCMc 1LPLA 3OSVA 6AT1B 2RHZA 1FMWA 5J39A 5GMKi 3TCJA 1TOVA 1UFFA 2VWFA 3OYHA 1VQ5A 2X4JA 1U06A 2DJQA 1H92A 3HTRA 3CC7A 4HT9A 1UGSB 5GAN5 1WHJA 4C8QG 1IGQA 4OB0B 4KULA 1RAAB 1C6VX 3QPHA 4KH0B 1V76A 4OMFB 1QVPA 3E9GA 5LJ3g 1ARKA 3CBPA 3U23A 8ATCB 1VQ7Q 2LQ8A 2YHTA 2FO0A 2RF0A 4OP0A 5FROA 2A36A 1UGQB 4KGVB 1SEMA 2O31A 4EMKB 2DEUA 3M54A 2EIFA 1FXXA 1T3SA 4LXCA 1M2OA 1VQ9T 3CCRT 2K2VA 2J6FA 4C92B 4DEYA 2RMOA 2RN8A 3HRUA 3FRNA 2D9TA 2FZKB 1KC8C 3GNFB 5DLQE 1VQPQ 1UE9A 1RI9A 4PJJA 3OMCA 1RAHB 3JSCA 3CMAQ 4OMNA 3MPUB 2XDPA 2MF2A 2JN0A 2KVQG 1Q82C 3QSUA 4F16A 1ZBXA 5GMKj 3CCVA 2GTOA 1YITT 5GAN7 1WHLA 2F1LA 1G3WA 5CQXA 2VGMA 3EGXA 4C92F 2HQHA 5EC7A 3OA6A 1K8AU 3CCLT 1ZA2B 1PKTA 3AT1B 1YWOA 4V2SA 5GAMh 1BYMA 4HA8A 2PTKA 4XTXA 4J7FA 4ANJA 3OB9A 3CBOA 4N4GA 3JB9H 5KE2A 2RM4A 2RNAA 5IAYA 3H0IA 1VIEA 4J8OA 2EQUA 3M57A 4F17A 2CZ1B 1VQPA 1VQMQ 4KUDK 4HCZA 1D0YA 1Y7XA 2EWNA 3CMAA 2HD0A 3VRZA 2BIVA 5I2SA 2QK0A 2KY9A 2L8DA 4X9DA 1JJ2P 4EMKA 4RTXA 2XDDA 4FCYA 2IVWA 3QKJA 2E65A 3CCUQ 4C92A 5LJ3e 2DYBA 1Y96A 3TQ7P 4OMPA 3C0CA 4MZMA 4PLLA 1WXTA 3DB3A 2DMOA 1QWFA 4J7IA 3RESA 5DY9A 1ZHIA 2BUDA 1R0BG 5L8RE 3H6ZA 4RG2A 2QXFA 2VXEA 1EX4A 2F2WA 2HAXA 1HJDA 4L59A 2JM8A 4QQ6A 1FMKA 3X26B 2CGHA 3MP8A 2C0OA 3ER0A 1IGUA 3CMEA 4KGZB 1VQMA 2LJ1A 5CCAA 4M78E 5IT9E 4IUPA 2X4XA 2CSQA 3CCET 3KUFA 4Y28E 2HL3A 4RMOA 4JRPA 2RQRA 3NPFA 3E2UA 1RAFB 1YN8A 2GQIA 2J6OA 1G8XA 1PSEA 3EG0A 5KYYA 3EH2A 2EJFA 3PVQA 1VOMA 3EHRA 1NG2A 3CPWP 5KE3A 2YT6A 2X51A 2ZCFB 3J80E 1M27C 4C92D 4XU2A 1YHQT 1KD1C 1MNDA 3OYIA 4A4KA 2DRMA 4E7ZA 2DRKA 1Z9QA 2G3RA 3RMQA 3CCSA 5CKDA 5KYWB 1M1KR 2IIMA 3CCQT 5GAMj 2KRSA 3FIFA 4BY6B 2KROA 2XIDA 4PJNA 5FU6C 2QQ9A 1GCQC 3RNJA 2D6FA 4M7AA 3I9QA 1OZ2A 1BIAA 4WCIA 2C0TA 4OMQA 2RI3A 4AG1C 1M5Q1 3PIPA 1XTDA 3I55T 3CCMQ 1X43A 2XU8A 1E6HA 2HQXA 3X20B 3M0RA 1MUZA 1BKBA 3QG1A 1WHHA 3JCMW 1QW1A 1RLPC 3OW2S 1S72T 2JZ2A 1PD1A 1AD5A 2YSQA 4A4FA 2RHXA 3ZFJA 2FZCB 1RABB 2AIRB 4UC4A 4ZTFA 4J9FA 2O01E 1G2BA 2EKOA 1VQ9A 2RQWA 4LDUA 1G3YA 1ABOA 2PVOB 3OS2A 4L6V5 4OMOA 3V7CA 3EHQA 3THKA 2DERA 4QT7A 3EG3A 3M5AA 2YUNA 3REBB 5L23A 3L42A 2C06A 2DTIA 1K73C 2JTEA 1PHTA 2MOXA 2GFUA 1Z9ZA 4LDYA 1NEBA 2K6DA 3EAEA 5LJ3f 2QGFB 2XKOC 1YITA 1AHJB 2LNVA 4MMKA 5FRMA 2VC8A 2EYYA 3PIOA 5KYWA 3GP8A 4J83A 2ED1A 4RG8A 2I0NA 5GAN2 3GIBA 4JZ4A 3JCMJ 2K7AA 4D6WA 5GAOq 1U3OA 1ZSZA 2DE0X 3ZEHA 2HBPA 1BK2A 4OB2B 1UEBA 5CKBA 1TH7A 1NJIU 2ZAEA 2KT1A 2X3WD 4F7UE 1N9RA 1B34A 3EGDB 5GAOn 1VYTA 2R57A 3M4YA 5GANg 1PSFA 2P4RA 4P5NA 1ZUYA 1VQ6T 3CCJQ 3TU4K 2DTHA 2DK3A 1M9SA 4X34A 3PNWC 3RKWA 5A0GA 2V8IA 2SRCA 2P84A 2MCNA 2DKGA 4M77B 1N8RC 1AVZC 1OPLA 2YWWA 2BZXA 2EQIA 1WX6A 1OX8A 1Q7YU 3FC3A 2KE9A 1FYNA 2O88A 3LWHA 1VQ8Q 2X4YA 2Y4YA 1Y07A 2OAUA 4BDYA 2HNIA 3EFOA 3VS5A 4JZ3A 4PJOB 3EG1A 1JU5C 2K4YA 1VQ7T 5D6YA 2QGGA 4B6MA 3JCMV 3QJ6A 1R8OB 4HCBA 3UA7A 1EFNA 2R5AA 1KG1A 4M77F 3VRYA 4LUDA 2XD0A 3H9NA 1O9SA 2J06A 2KGTA 2ESWA 3RUXA 2DEQA 2QYZA 3LGFA 2K3BA 2GNCA 5A2QE 2E3HA 3BY7A 4EMGA 4PJOF 2KI7A 1VQLQ 1XJWB 1VQPT 1UTIA 4LDXA 4RTTA 1AZEA 2YUPA 1QQJA 1R77A 3CMAT 1TU0B 3DB4A 3FLGA 2GGRA 1PWTA 2P0KA 3PE0A 2K3XA 4CC7A 4BD3A 3JCMQ 2HMAA 1PM3A 1R0CB 3VUZA 4O5VA 3G71Q 1Q86C 1VQKQ 5FRNA 2SEMA 3ZL7C 2CUBA 2XI9A 2ZPEB 3PMIA 4GLMA 2YLCA 3C95A 8AT1B 4C8QA 2ROLA 4HCKA 3CEYA 5J3BA 5GJWB 4M7DG 2L0AA 4ZTJA 5GAOl 3VS2A 1LNXA 1PNJA 2LP5A 5GANe 3G4SQ 4Z89A 5FW9A 3REAB 2EYZA 2L3PA 1D1CA 1VIFA 2DAQA 1MV0B 4RTWA 5D7UA 4Z8AA 4AG2C 1T0JA 5LL6S 2JS2A 4HVVA 1B07A 5C0MA 1NBEB 1VQLA 2HDAA 3OYLA 1KQ2A 1VQMT 4DEXA 2DJZA 2M9UA 1WJRA 2JMAA 2RHYA 4JJCA 3OW2P 1QVFP 2LCSA 4CI0C 4FYWB 2CH4W 4HCCA 4JUVA 4OB3B 3KBGA 3G71A 5KH6A 1I1JA 2KYMA 1HSQA 4ZNXA 2PNIA 3V8KA 2DXBA 3CCUT 2DPPB 3CD6Q 1WGSA 1M1FA 3QZ5B 2LJ3A 2QAZA 5GAOm 2DZCA 2IG0A 2L3SA 4R55A 5FU7B 5LJ5g 4ME7A 4C8QD 2EQKA 2V1QA 5KYNA 3G4SA 3VYGA 1IO6A 4C92E 3OYFA 4M75F 2MK5A 3QO3A 3TSWA 1H3ZA 4LNPA 2K9GA 4IUVA 4EMKC 1WPYA 4J6YA 3SWNB 1RUWA 5HKCA 2D0QB 1MNEA 2BE9B 2PVGB 4MDWA 2GQVA 4E7LA 2VGNA 2HKQB 1KFZA 1D09B 3MKDA 3QJYA 1TSFA 3TVTA 1GFDA 3FDRA 3OBYA 1VA7A 3NTIA 2AT1B 4PJOD 3QDRB 4DBQA 3CC4Q 4XU1A 5LJ3h 2J05A 1X27A 4KBMB 1JB0E 1M2VA 1OU8A 2HZYA 2O2OA 3CD6A 1TG0A 2P0PA 3JCMg 4IUTA 4E7JA 4AFSC 4IKFA 2YRCA 2DL7A 3BW1A 5IXFA 3JV3A 3M53A 4M77G 1WHMA 4J5YA 1X2KA 2RH2A 4ZGJB 4R56A 1YJWQ 1ZSGA 1JXOA 1K76A 1G83A 2F5KA 4R0KA 1O75A 3OS0A 1VQ6A 3X25B 4XTUA 2VYTA 3ULRB 4MDXA 2EQJA 2VVKA 2AHJB 1KQSS 3MP6A 2CZ0B 2JTFA 1G5VA 2DF6A 2Y4XA 1W1FA 4PJOG 3A5ZB 4OB1B 4F14A 3Q1JA 4OMLA 1ZLMA 5GAMd 4DA4A 3M58A 5HCKA 4J9BA 3L2ZA 5IN1A 2LMJA 3CC4A 2RQUA 3H41A 3WXMB 5M9OA 4XTWA 2DD4A 3LH0A 5CVIA 3BE3A 1YP5A 2CYZB 3CCMT 4PFOA 1QCNA 4RTUA 3OYJA 1PD0A 1WJSA 4M7AE 1C0MA 2E41A 2FEIA 4FU6A 2LJ0A 2YUQA 1QP2A 1YJWA 5GANf 1VQ7A 2QI2A 3META 2DXCA 5LJ5e 2HQEA 2QQRA 4M7AC 3AHUA 1NE8A 2K5FA 1CKAA 3V8JA 4OGEA 2M16A 5HY6A 5GMKe 3L2WA 4O6JA 1T3LA 5FWCA 3RMSA 2QEXQ 3OY9A 4XU0A 1K8AC 4RTVA 2LCLA 2RA2A 3L2RA 3EFSA 4X1VA 2FPFA 4FW1A 3A8MB 2G6FX 3OYCA 2A0FB 3RKYA 3PT9A 4BE1A 2MWPA 1VQOQ 1JRIA 3C94A 4N0AA 1RAIB 2JS0A 1NPRA 1UGVA 1WLPB 1M1KU 3JCMX 1JBMA 4ZGEB 3JCMe 3EFRA 1OQKA 4CC4B 1KK7A 5LJ3j 3OSSC 2EJ9A 2X9HA 2LQKA 2M0OA 1IREB 1U1SA 1BI2A 2L3RA 4M75G 3A8OB 3TREA 1OEBA 3M55A 2X3XD 3PGGA 3JAME 2QEXA 2X4WA 2GF7A 5KYUB 1UECA 4Y92A 1ABQA 1PKSA 1RI0A 1N6AA 2H3JA 1OPKA 2KMTA 2ROTA 3CC2Q 4QVDA 1YIJQ 2JT4A 4XTZA 3SD4A 2YUOA 1K9MU 1OULA 1Y0MA 2J7IA 2BKDN 1ZSZC 3CCJT 3NFCA 3I5SA 1N27A 4OGCA 2BZYA 3C4SA 4M78C 3NHNA 1CSKA 3CCUA 3OW2A 1QVFA 2E3IA 1D3BB 4GY5A 2CH4A 5CKFA 1WIEA 4XAXB 2L5QA 2AKKA 1IHVA 4AFQC 2HBWA 2B8AA 1K0SA 2DL8A 1MMDA 2RQVA 2L89A 1IXDA 4ZN3A 1VQ8T 3EGUA 5GAOr 3MO8A 4JRIA 4CRIA 2PUOB 2CZ6B 2QDLA 5I2MA 2F2XA 4TVRA 3DLMA 3CC2A 1OU9A 1YIJA 4PFPA 3SB2A 1W2BS 1J3TA 4IUQA 3WVDB 1YJ9Q 1QMCA 4D8KA 1WNLA 2IPOB 5KCOA 2DIGA 4ORZA 5IHKA 3OYYA 1Q81U 2DBKA 2XDBA 1K4US 3A98A 2DD5A 3MJXA 1IRXA 5GJVB 2EGAA 3KXTA 2D8JA 1ZUKA 1LJOA 2I2LA 3VS0A 3JCMP 1VQLT 5KYUA 4OVAA 2DXTA 1M3CA 2H3EB 3LGLA 4KUIA 2XK0A 3M56A 3V7RA 4OMMA 1K9MR 2EAYA 4M7DB 1M8VA 2FRWA 4XTYA 3VS1A 1VQ4Q 4HVUA 1ZQ1A 3M0PA 4J9HA 3A8LB 1F1BB 2C0IA 3G71T 1VQKT 3FJ5A 2V8JA 1VQNQ 1MV3A 4J9EA 2NUZA 1WFWA 2BZ8A 1X01A 2CP6A 3EH1A 2RHUA 2NLUA 1SPKA 3G6EQ 1YJ9A 4J9DA 2JW4A 1XNIA 4XU3A 2DIQA 1XOVA 2R5MA 2P0QA 1TS9A 3G4ST 3VS6A 1PG5B 3SHWA 4J9IA 3JCMf 4C8QE 4C0DC 3ASKA 4M7DF 3I5RA 1I07A 5FU6B 3CCMA 2PVDB 2LRQA 4C0FA 5IHNA 2EW3A 1G3SA 1LVKA 4MZTA 3MCAB 1PCXA 5CR2A 4HVWA 2E10A 1YJNQ 5HK0A 2VXFA 2L3QA 2OTJQ 2ZGWA 4C8QC 2R58A 3OYDA 2NWMA 1VQ4A 1UUEA 1Q81R 3HL8A 2EYWA 1SSFA 5FLXE 2XG8D 4PKCC 2QDYB 4FL6A 3NTHA 1FMVA 1VQNA 4ZGDB 3C12A 4DBHA 4E2FB 1D0XA 3CD6T 5GANh 1MHNA 2DL3A 2GCXA 2QTXA 4FYXB 3L2UA 3P8BB 1GFCA 1PC0A 4N4HA 3LYIA 4B9WA 3J7AF 4FSXA 7AT1B 2DLPA 2HEQA 3R6OA 3VYHB 2EYXA 2RJEA 4F04B 1NJIC 4M7DA 2ZPIB 1TXQA 5GAN8 1M1GA 1OX9A 1QKXA 2BE7D 3PVLA 2AKLA 1X6GA 4FT2A 1BBZA 4LUEA 4RTYA 2YRDA 4LE9A 4JPBW 1I5OB 2FHDA 1VUBA 4YTLA 1WHKA 3CC4T 2WSFE 1OI1A 2MYSA 4VUBA 1OZ3A 5GMKl 1HYOA 1UDLA 2K5IA 3RR6A 3OQ5A 2QASA 2E6ZA 1MMAA 2GFAA 2ZPFB 4PFZA 4L5GA 3SDZA 1M8MA 1GCQA 2CKKA 5DM7R 1YJWT 2EBPA 1A0NB 4D8DA 1WI7A 3OS5A 1Q7YC 1WHGA 1YBYA 2DFUA
chains in the Genus database with same CATH topology
3RKXA 3SWNB 2HD0A 4QQDA 5HKCA 2D0QB 2BIVA 2MMPA 4J6WA 1U1TA 5I2SA 1QVFS 2RD1A 3CCJA 2PVGB 2KY9A 4MDWA 2L8DA 2GQVA 4X9DA 2MWOA 3RIRA 4E7LA 2VGNA 3INZA 3V7SA 4EMKA 3QJYA 1P92A 2JOYA 3FDRA 3OBYA 2XDDA 2IVWA 4M7DD 3NTIA 2E65A 3QKJA 1D3BA 2RO0A 3QDRB 4PJOD 4XU1A 1K73U 5LJ3h 4M78F 3NTKA 4C92A 5LJ3e 3PTAA 1Y96A 3JB9J 4KBMB 3CCRA 1JB0E 2A3LA 5GANd 3VJPA 2ZZDA 4MZMA 4PLLA 3DB3A 5GMKm 3CD6A 4RCCA 2P0PA 3RESA 4IUTA 3BDUA 2PUKB 4J7IA 3JCMg 5DY9A 1ZHIA 2BUDA 4E7JA 2E5QA 5L8RE 3H6ZA 4RG2A 4ELYC 2QXFA 3I56T 2VXEA 2EQMA 4IKFA 3UT1A 3BW1A 4M77E 3M53A 4XK8E 4M77G 3GF5A 4J5YA 1VQ8A 2RH2A 4ZGJB 4R56A 2HAXA 4L59A 4A54A 4QQ6A 3X26B 2CGHA 1BI0A 3MP8A 1XQHA 4A53A 3OYAA 2F5KA 1Q86U 2QQAA 4OF1A 1O75A 3OS0A 1M90U 3ER0A 1VQ6A 3X25B 4M7AD 3CMEA 2VUBA 4XTUA 1VQMA 2VYTA 5CCAA 3BFMA 5D6WA 4M78E 4M77C 3VV0A 2EQJA 5IT9E 4MDXA 2AHJB 3CBMA 4IUPA 1KQSS 4M78G 3MP6A 2X4XA 2CZ0B 3JCMb 2JTFA 1G5VA 2Y4XA 4PJOE 2RI5A 1JJ2S 4PJOG 3A5ZB 4OB1B 3CCET 3KUFA 3URGA 5GAN6 4Y28E 5CK9A 5GANj 3Q1JA 1RL2A 3CCLA 4RMOA 3HHTB 4M77A 1YI2T 5GAMd 3LWIA 3G6EA 4DA4A 4JRPA 3M58A 1I4K1 2O4XB 3HSBA 1GXIE 3L2ZA 5IN1A 2QEXT 4A4EA 3UDCA 1VQ5T 1X6OA 4A4GA 3CC4A 1PSEA 2EJFA 3CC7T 4PJOC 4IUUA 3UPUA 3WXMB 5M9OA 4XTWA 2DD4A 3LX7A 3LH0A 5CVIA 5CO7A 2K5LA 3RERA 1U8RA 2RJDA 2WSEE 4M78A 2CYZB 4PL6A 5KE3A 3CCMT 3T9NA 2LDMA 2MAMA 2DO3A 2ZCFB 3ME9A 3J80E 4PJOA 4C92D 1VQOT 3OYJA 4XU2A 2RB6A 3SFMA 1WJSA 2E1HA 1YHQT 3GOXA 4M7AE 2E41A 3VUBA 2YRVA 4M7AG 1KD1C 1YJNA 4DOVA 4FU6A 4M75B 4A4KA 3QYGB 3OYIA 1QP2A 2G3RA 3QHSA 3RMQA 4C0DB 2QQBA 5GANf 3CCSA 4BDZA 5CKDA 1YJWA 1VQ7A 2OTJA 4BB7A 2QI2A 3META 3CCQT 3H8ZA 5LJ5h 3CXCS 3M9QA 2DXCA 1IZ6A 5GAMj 4Q5WA 5LJ5e 4WF2A 2HQEA 1VQKA 2QQRA 3FIFA 4BY6B 1N8RU 2RI2A 1LOJA 4M7AC 3VU3C 3AHUA 2XIDA 1NE8A 2K5FA 4RCBA 3V8JA 4OGEA 5GMKh 2M16A 5HY6A 5GMKe 4C8QB 5FU6C 4O6JA 2QQ9A 4NL2A 3V8LA 5A0DA 3L2WA 3RMSA 1NZ9A 2D6FA 1HK9A 3G7ZA 3M59A 1UGPB 5LJ3d 4M7AA 3OY9A 4XU0A 1K8AC 4JRKA 3OYEA 1OZ2A 2LCLA 5GAOp 2RA2A 3L2RA 1BIAA 3EFSA 2CZ7B 3S3NA 3PIPA 2RI3A 1M5Q1 2RJCA 5CAIA 1XTDA 1WQWA 3A8GB 4J6XA 4MZPA 3I55T 1JJ2A 3OYGA 3A8MB 4C5EA 3OYCA 1Y71A 4M77D 3CPWS 2DXUA 2XU8A 3RKYA 3PT9A 3QIIA 2HQXA 2MWPA 3WVEB 5CKEA 4BE1A 3X20B 2OTLT 3TEEA 5GAMf 1JRIA 2EFIA 3CC2T 3I56A 5AYFA 1BKBA 1WQ7A 3PMTA 3C94A 4N0AA 1YIJT 3QG1A 4IUVA 1NPRA 1QW1A 3OW2S 3JCMW 3CCVT 1S72T 2JZ2A 4JLGA 2FL7A 4C92C 3JB9F 2M1HA 1W4SA 1QVGS 1M1KU 4N4IA 5GAN4 2LC4A 1KHIA 3JCMX 1JBMA 4M78D 3JCMh 4E7KA 4ZGEB 4A4FA 2FYKA 2RHXA 3X28B 3EFRA 3ZFJA 4C8QF 3JCMe 3A8HB 3QBYA 2JNGA 4UC4A 3CPFA 4ZTFA 5LJ3j 3OBWA 3OSSC 2EJ9A 2O01E 2E6NA 3OYNA 2EKOA 2LQKA 4F7UB 4BI4A 1VQ9A 2FVUA 4ATOA 1FX7A 4LDUA 2ZPHB 1G3YA 2LCCA 1EIFA 2PVOB 3OS2A 3CCEA 2M0OA 4M75E 2ZPGB 1KHCA 4QVZA 4L6V5 1IREB 3V7CA 1U1SA 1BI2A 2L3RA 4M75G 1MGQA 2O4XA 3A8OB 1YI2A 3BDLA 3TREA 3M55A 2KAFA 3M5AA 3PGGA 3JAME 3PFSA 1UB4A 2QQSA 3MEWA 2QEXA 2X4WA 2GF7A 3L42A 1H641 2C06A 2DTIA 2JVVA 3DLLA 1K73C 1KQ1A 2JTMA 4JLIA 3FJPA 2F69A 2ZPBB 1RI0A 1DJ7B 4M75C 1N6AA 2H3JA 3JB9G 2XICA 1X75C 2KMTA 2GFUA 3LLRA 4LDYA 2P4TA 2WSCE 4QVDA 3EAEA 4BUGA 4XTZA 5LJ3f 3SD4A 4C5IA 3S3MA 2XKOC 3OYMA 1YITA 4JRQA 2DTOA 2X35A 1AHJB 2RHIA 4M75A 1YHQA 1NPPA 2LNVA 4MMKA 1K9MU 5FRMA 4Z02A 2VC8A 3MP1A 4F7UF 3PIOA 5CIUA 3QXEB 4C0GA 2BKDN 2LX9A 3GP8A 4J83A 3CCJT 5LJ5d 4RG8A 4JS5A 3NFCA 3CPWA 5GAN2 1KC8U 4EDUA 1YJ9T 1N27A 5FU7C 3V7RA 3CCQA 4DOWA 3GIBA 4OGCA 3JCMJ 3C4SA 4D6WA 4M78C 5GAOq 1M90C 4GLKA 3OYBA 4FT4A 3CCUA 2PQWA 3OW2A 1QVFA 1D3BB 3MEVA 4GY5A 3ZEHA 1G3TA 1I8FA 2HBPA 3QZ9B 4LDWA 4OB2B 1UEBA 5CKBA 4ZN1A 2EJGA 1QVGA 5C6SA 1Y96B 1TH7A 5CKFA 1NJIU 3OS1A 2DZ9A 4NS5A 4XAXB 2L5QA 4JJNK 1Q82U 3M4GA 4FIBA 3DKMA 2DVEA 3SWNC 2B8AA 1BIBA 2L89A 2JUFA 4ZN3A 2YLBA 4MMLA 4F7UE 3J81E 3GNGA 1N9RA 2MI6A 4F7UG 1VQ8T 3I55A 1B34A 1YCYA 5GAOr 5GAOn 3MO8A 4JRIA 4CRIA 2PUOB 2CZ6B 5I2MA 4DQ2A 1M4ZA 2QA4A 2R57A 3M4YA 4TVRA 3DLMA 3JRZA 3SWNA 5LJ5j 2FB7A 5GANg 2OTLA 1VQ4T 1PSFA 3CC2A 3S3OA 1FWZA 3O8VA 4P5NA 1VQ6T 3CMET 3L2QA 1QP3A 1YIJA 1N9SA 4PLIA 2KDSA 2XHCA 3SB2A 1W2BS 3TU4K 2DTHA 4IUQA 4QVCA 1S72A 3JCMd 3QYHB 3WVDB 2DK3A 1M9SA 1V29B 1WNLA 4X34A 5KCOA 2DIGA 2E12A 5J26A 1VQNT 3OYYA 3PNWC 5I21A 3RKWA 1Q81U 2RJFA 5A0GA 2V8IA 2XDBA 2E64A 4C5HA 4F7UA 3G6ET 2KSSA 4M75D 4X9CA 2K57A 4RKUE 1KQSA 2DKGA 2DD5A 4M77B 2PU9B 4BE0A 1N8RC 4FM4B 3X24B 2V8KA 4KT0E 4N0AC 2A7YA 2LTOA 3KXTA 1LJOA 2I2LA 1Q7YU 5CKHA 3L1AA 3FC3A 3JCMP 1VQLT 3JB9D 4OVAA 3LWHA 2DXTA 4C0ZA 5GAMg 2X4YA 4C5GA 2Y4YA 3LGLA 1Y07A 4A4HA 4KUIA 2OAUA 2XK0A 2HNIA 2LVMA 1BI3A 3F70A 3M56A 2EAYA 3MHXA 3OYKA 4M7DB 4JS4A 1M8VA 4LDVA 4PJOB 3CXCA 4XTYA 4BE2A 5EG2A 1YJNT 2LT1A 3GLXA 3VKIA 2K4YA 1VQ7T 3CCST 5D6YA 4Y91A 1ZQ1A 2OTJT 3A8LB 3JCMV 1UGRB 3QJ6A 4HT8A 1R8OB 3HFNA 4HCBA 3G71T 1VQKT 2F5TX 2V8JA 2R5AA 4XQ3A 1KG1A 4M77F 4IURA 1X01A 5DLOA 2XD0A 4II1A 4EMHA 1WJQA 2RK1A 2RHUA 3E9FA 2NLUA 3P8HA 4JDSA 3JCMc 2CS7A 3QUIA 3OSVA 1O9SA 1YJ9A 2RHZA 1M1KC 5J39A 5GMKi 1XNIA 3E1SA 4XU3A 4M7DE 3TCJA 2DIQA 3S6WA 3OYHA 3RUXA 1XOVA 2DEQA 2R5MA 1VQ5A 2X4JA 2P0QA 3HFOA 3LGFA 3CC7A 1W2BA 4HT9A 4M7AB 1OYXA 3G4ST 1UGSB 5A2QE 1I5LA 5GAN5 3BY7A 3JCMf 4C0DC 3ASKA 4C8QE 4EMGA 4PJOF 4M7DF 4C8QG 5FU6B 4OB0B 3CCMA 1VQPT 2PVDB 3FB9A 2LRQA 4PNOA 4C0FA 4KULA 4LDXA 3HPWA 1VQOA 3E19A 3CMAT 1G3SA 4BY6C 4MZTA 2WACA 3MCAB 1I81A 3DB4A 3FLGA 3QPHA 5CR2A 4OMFB 5KCHA 2P0KA 1QVPA 2E10A 3E9GA 4BI3A 5HK0A 2VXFA 5LJ3g 2K3XA 3CBPA 5A0LA 4BD3A 2LQ8A 3JCMQ 2ZGWA 4C8QC 4E7IA 2R58A 2YHTA 5CQYA 3OYDA 4OP0A 5FROA 3OMGA 3VUZA 4NL3A 1UGQB 4O5VA 1VQ4A 5HK3A 1Q86C 5FRNA 3HRTA 4EMKB 2XI9A 2ZPEB 3PMIA 2YLCA 3C95A 3HL8A 1SSFA 5FLXE 4LD9K 3M54A 4C8QA 2EIFA 2XG8D 1FXXA 4PKCC 2QDYB 1K9MC 1VQ9T 4FL6A 3CEYA 3NTHA 5J3BA 4LD6A 2K2VA 3GPLA 4B9XA 5GAN3 3CCRT 4C92B 4BDYA 1VQNA 4M7AF 4M7DG 4ZGDB 3C12A 4BI8B 4ZTJA 5GAOl 3CD6T 5GANh 1LNXA 3HRUA 2D9TA 3FRNA 5GANe 1MHNA 2GCXA 2QTXA 1KC8C 3L2UA 3FEOA 3P8BB 4N4HA 3P8DA 3GNFB 3LYIA 5DLQE 1KD1U 4NOYA 4B9WA 1VIFA 2DAQA 4BACA 3J7AF 4FSXA 2KK4A 4M7DC 5LL6S 3OMCA 3JSCA 3R6OA 3VYHB 5C0MA 2RJEA 2VV5A 1VQLA 3ZBDA 3OYLA 1NJIC 2RK2A 1KQ2A 1VQMT 2XDPA 2MF2A 2JN0A 2KVQG 4M7DA 2DJZA 1Q82C 3QSUA 1ZBXA 2M9UA 2ZPIB 5GMKj 5GAN8 1M1GA 3CCVA 5GAN7 1YITT 1WJRA 2RHYA 1G3WA 5CQXA 3HRSA 4FT2A 2VGMA 4C92F 2Y90A 3OA6A 1K8AU 3CCLT 4CI0C 4E7HA 4V2SA 2FHDA 4JUVA 4EPCA 4HCCA 5GAMh 4OB3B 3KBGA 3G71A 4XTVA 2EYQA 1VUBA 5GAMe 3MEUA 1BYMA 4YTLA 5KH6A 4HA8A 3CC4T 2WSFE 1BI1A 2DXBA 4XTXA 2DPPB 3V8KA 4J7FA 1OI1A 3CCUT 2KQWA 4ELZC 1WGSA 1M1FA 3QZ5B 4QQGA 3OB9A 3LW5E 3CBOA 4VUBA 1OZ3A 3MEAA 3UWNA 5GMKl 5LJ5f 4N4GA 5GAOm 2DZCA 2K5IA 2IG0A 3JB9H 4R55A 5FU7B 3OQ5A 3N5BB 5KE2A 2E6ZA 5LJ5g 2GFAA 4ME7A 1Q81C 2LT4A 2RM4A 4C8QD 2ZPFB 4M78B 5IAYA 2EQKA 3G4SA 4L5GA 1VIEA 3HP9A 2EQUA 4J8OA 3HKSA 3M57A 3SDZA 5D6XA 3VYGA 2K3YA 1HXDA 2CZ1B 4C92E 3L2VA 2CKKA 5DM7R 3OYFA 1YJWT 4C92G 1VQPA 4M75F 4E47A 4HCZA 4QW2A 2QA4T 4KUDK 1Y7XA 2EWNA 1B34B 3OS5A 3QO3A 2E70A 3JB9I 3CMAA 1Q7YC 1H3ZA 1YBYA 4HKEA 4EMKC 1WPYA 4J6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C6S A;  4QQD A;  2M16 A;  3OS1 A;  2BIV A;  4NS5 A;  2WAC A;  3DB4 A;  3FLG A;  3L2W A;  5KCH A;  2P0K A;  3E9G A;  2K3X A;  2L8D A;  2B8A A;  2MWO A;  4E7L A;  4BD3 A;  3OY9 A;  3OYE A;  2L89 A;  1OZ2 A;  4E7I A;  2R58 A;  3OYD A;  3L2R A;  3FDR A;  5FRO A;  3OMG A;  3NTI A;  3QKJ A;  3S3N A;  2RO0 A;  3MO8 A;  2RI3 A;  4CRI A;  5FRN A;  2RJC A;  2R57 A;  3NTK A;  3DLM A;  3OYG A;  3PMI A;  4C5E A;  1SSF A;  3OYC A;  3S3O A;  3O8V A;  3QII A;  4BE1 A;  2HQX A;  2MWP A;  4PLL A;  3L2Q A;  4FL6 A;  3CEY A;  3DB3 A;  2EFI A;  3NTH A;  4LD6 A;  4PLI A;  4B9X A;  4IUT A;  4E7J A;  2BUD A;  4IUQ A;  2E5Q A;  4ZTJ A;  3PMT A;  3H6Z A;  4RG2 A;  4IKF A;  2D9T A;  2EQM A;  3UT1 A;  4X34 A;  1MHN A;  5KCO A;  2DIG A;  5J26 A;  2JZ2 A;  3L2U A;  3FEO A;  3PNW C;  2M1H A;  2RJF A;  3P8D A;  4L59 A;  4N4I A;  4N4H A;  3LYI A;  4QQ6 A;  4E7K A;  4A4F A;  2RHX A;  4B9W A;  4C5H A;  2DAQ A;  3MP8 A;  3QBY A;  4UC4 A;  4BAC A;  3OYA A;  4BE0 A;  4ZTF A;  2F5K A;  3OS0 A;  3OMC A;  2E6N A;  3OYN A;  2EKO A;  2LTO A;  2VYT A;  5C0M A;  2RJE A;  5D6W A;  3OS2 A;  2EQJ A;  2LCC A;  3OYL A;  4IUP A;  2M0O A;  3MP6 A;  1KHC A;  2X4X A;  2XDP A;  4QVZ A;  3FC3 A;  2JTF A;  2L3R A;  1G5V A;  2RI5 A;  2O4X A;  4OVA A;  3BDL A;  3KUF A;  1WJR A;  2RHY A;  3Q1J A;  2X4Y A;  4C5G A;  3LGL A;  4A4H A;  2XK0 A;  4BDY A;  2LVM A;  3F70 A;  3OYK A;  3PFS A;  2QQS A;  3MEW A;  2X4W A;  2GF7 A;  2O4X B;  3L42 A;  3OA6 A;  4BE2 A;  5IN1 A;  4E7H A;  4A4E A;  1RI0 A;  2FHD A;  5D6Y A;  4A4G A;  3LLR A;  2GFU A;  4IUU A;  3MEU A;  5KH6 A;  5M9O A;  3LX7 A;  3QJ6 A;  3LH0 A;  3EAE A;  1OI1 A;  3SD4 A;  4C5I A;  2RJD A;  2R5A A;  1WGS A;  3S3M A;  4QQG A;  4PL6 A;  3OB9 A;  4IUR A;  3UWN A;  5KE3 A;  1OZ3 A;  2X35 A;  2RHI A;  2LDM A;  3MEA A;  4N4G A;  3OYM A;  4II1 A;  5FRM A;  1WJQ A;  3ME9 A;  2IG0 A;  2RHU A;  3E9F A;  4Z02 A;  2NLU A;  3P8H A;  3MP1 A;  3OYJ A;  3OQ5 A;  1WJS A;  5KE2 A;  5CIU A;  3GOX A;  2GFA A;  2BKD N;  2RHZ A;  5J39 A;  2YRV A;  1XNI A;  5IAY A;  2EQK A;  2DIQ A;  3S6W A;  4FU6 A;  3OYH A;  3OYI A;  4EDU A;  2R5M A;  2G3R A;  2EQU A;  4BDZ A;  1N27 A;  5D6X A;  3LGF A;  3C4S A;  2K3Y A;  1OYX A;  3MET A;  2CKK A;  3OYB A;  3OYF A;  3H8Z A;  3L2V A;  3M9Q A;  4Q5W A;  4HCZ A;  2HQE A;  4QW2 A;  2QQR A;  2PQW A;  3ASK A;  2RI2 A;  4GY5 A;  3MEV A;  3ZEH A;  1H3Z A;  4IUV A;  2LRQ A; 
#chains in the Genus database with same CATH topology
 3VS3 A;  4QQD A;  4J6W A;  1U1T A;  2CSI A;  3A1P A;  3CCJ A;  5KYX B;  1X2Q A;  3RIR A;  1JXM A;  3INZ A;  1UHC A;  2FPE A;  2VAS A;  3V7S A;  1P92 A;  4QKU A;  2JOY A;  4M7D D;  5FWB A;  2FPD A;  2XMF A;  1E6G A;  1SF9 A;  1UJY A;  3NTK A;  4J9C A;  2CP0 A;  1D0Z A;  5AT1 B;  2ZZD A;  5GMK m;  4RCC A;  3BDU A;  2PUK B;  1VYV A;  3EGD A;  4XK8 E;  3G1J A;  1YCS B;  1VQ8 A;  1JEG A;  2QA4 Q;  1BI0 A;  1AEY A;  4A53 A;  3OYA A;  1Q86 U;  2QQA A;  1M90 U;  4KH1 B;  2M0Y A;  5D6W A;  1QCO A;  3VV0 A;  2D0N A;  4M78 G;  3JCM b;  2RI5 A;  1W70 A;  1JJ2 S;  5GAN 6;  2JM9 A;  5GAN j;  4AFU C;  3HHT B;  4M77 A;  1I4K 1;  2YXY A;  3HSB A;  1SSH A;  2DL5 A;  2E4H A;  3RDV A;  2QEX T;  1ACM B;  4A4G A;  2OI3 A;  3UPU A;  1SHG A;  1SG5 A;  3I56 Q;  2KT8 A;  1W6X A;  1S1N A;  4Z88 A;  2LDM A;  1JO8 A;  2MAM A;  2DIL A;  4PJO A;  1VQO T;  2RB6 A;  4FW2 A;  2AK5 A;  4DOV A;  4M75 B;  3QYG B;  3QHS A;  2QTV A;  2QQB A;  2W10 A;  2NUT B;  5LJ5 h;  1IZ6 A;  4Q5W A;  1VQK A;  2VB6 A;  5KYX A;  3SEM A;  4HXJ A;  3VU3 C;  2DL4 A;  5GMK h;  1YI2 Q;  1X69 A;  2D1X A;  1NZ9 A;  1QKW A;  1HK9 A;  4KRT A;  5LJ3 d;  1VQ5 Q;  3OYE A;  2OX7 A;  5GAO p;  3CC7 Q;  2OAW A;  2RJC A;  5CAI A;  3A8G B;  4J6X A;  5IXB A;  1Y71 A;  4M77 D;  3CPW S;  1H8K A;  3WVE B;  1RLQ C;  1Q86 R;  2EFI A;  3CC2 T;  3I56 A;  1M90 R;  2EVR A;  1YIJ T;  2NUP B;  3EG2 A;  2FL7 A;  4C92 C;  1W4S A;  1QVG S;  2LC4 A;  1EZZ B;  3JCM h;  5ECA A;  2FYK A;  3X28 B;  1WXU A;  3A8H B;  3QBY A;  3CPF A;  2L2P A;  2NYS A;  2JXB A;  3NGP A;  4BI4 A;  2HSP A;  1FX7 A;  2MIO A;  2ZPG B;  1KHC A;  4QVZ A;  5I22 A;  1YI2 A;  1PRL C;  1UB4 A;  3MEW A;  1H64 1;  2JVV A;  3DLL A;  1PRM C;  1KQ1 A;  3FJP A;  2ZPB B;  3JB9 G;  2OTL Q;  1X75 C;  1NM7 A;  3LLR A;  1RAC B;  2CT4 A;  1TUD A;  2P4T A;  4RUG A;  4BUG A;  3S3M A;  3CCV Q;  3OYM A;  4JRQ A;  2DTO A;  2X35 A;  2RHI A;  4M75 A;  4Z02 A;  4IIO A;  2CP2 A;  3RBB B;  5CIU A;  2NUT A;  2LX9 A;  1KC8 U;  4EDU A;  1YJ9 T;  1M3A A;  4DOW A;  1YFN A;  3OYB A;  1YNZ A;  2D8H A;  2LX7 A;  3MEV A;  3CXC S;  1I8F A;  3QZ9 B;  4AT1 B;  1Y96 B;  4JJN K;  1E7O A;  1Q82 U;  1Y57 A;  3DKM A;  2DVE A;  3H0H A;  5IHI A;  2H8H A;  2JUF A;  2YLB A;  4MML A;  2MI6 A;  4F7U G;  1YCY A;  1ZUU A;  3O5Z A;  1M4Z A;  1NYF A;  2GBQ A;  2FG0 A;  3SWN A;  5LJ5 j;  2OTL A;  1VQ4 T;  3O8V A;  2NUP A;  1GBR A;  2KDS A;  2XHC A;  1BB9 A;  2CP5 A;  3M0S A;  3QYH B;  1V29 B;  1VQN T;  2DVJ A;  2E12 A;  5I21 A;  4J9G A;  2KXC A;  2E64 A;  4C5H A;  3G6E T;  1D1A A;  2DBM A;  4M75 D;  4X9C A;  2K57 A;  3EG9 B;  2PU9 B;  1BU1 A;  2DM1 A;  4FM4 B;  3VS7 A;  4KT0 E;  3GBQ A;  2A7Y A;  1SKU B;  5KYY B;  1NLP C;  3L1A A;  1NEG A;  1OV3 A;  5GAM g;  3M0U A;  4A4H A;  1U5S A;  3MHX A;  3OYK A;  1AOJ A;  5EG2 A;  1YJN T;  2LT1 A;  3GLX A;  3CME Q;  2OTJ T;  2JMC A;  1KC8 R;  1QLY A;  4K11 A;  1UGR B;  4HT8 A;  2F5T X;  4XQ3 A;  4AFZ C;  4IUR A;  2KXD A;  5DLO A;  3E9F A;  2CS7 A;  3QUI A;  4FYY B;  4A63 B;  4DBR A;  1M1K C;  1V1C A;  3E1S A;  3S6W A;  3H0F A;  1D1B A;  1Q82 R;  3HFO A;  3UAT A;  1W2B A;  4M7A B;  1OYX A;  4DBF A;  1I5L A;  4JJD A;  3FB9 A;  3D7S B;  4PNO A;  1NLO C;  3HPW A;  1VQO A;  3E19 A;  2JJ9 A;  4BY6 C;  2WAC A;  1I81 A;  1WA7 A;  5KCH A;  4IIM A;  4BI3 A;  5A0L A;  3CCS Q;  4E7I A;  5CQY A;  1AWJ A;  1QCF A;  3OMG A;  4NL3 A;  3R6N A;  5HK3 A;  1QWE A;  3HRT A;  1K8A R;  1KSW A;  4LD9 K;  1RAD B;  2QG9 B;  1K9M C;  1AWW A;  4M7D E;  3GPL A;  4LD6 A;  4M7A F;  4B9X A;  5GAN 3;  2KR3 A;  2Z0W A;  1AT1 B;  4BI8 B;  1UHF A;  1ZX6 A;  3EG9 A;  1SHF A;  3FEO A;  3P8D A;  1KD1 U;  4NOY A;  4BAC A;  3M0T A;  2KK4 A;  4M7D C;  1OOT A;  2VV5 A;  4CC3 A;  3ZBD A;  2RK2 A;  1BCM A;  2CP7 A;  3QWY A;  1TWB A;  1CKB A;  3HRS A;  2CP3 A;  2LQN A;  2Y90 A;  1QVG P;  4E7H A;  4EPC A;  2DET A;  1WDX A;  3CCR Q;  1VQ9 Q;  4XTV A;  2EYQ A;  5GAM e;  2V1R A;  3MEU A;  1BI1 A;  2MPX C;  2KQW A;  4ELZ C;  4QQG A;  3UWN A;  3LW5 E;  1ZSZ B;  5LJ5 f;  3MEA A;  1N5Z A;  3LH5 A;  1KIK A;  1UJ0 A;  3N5B B;  1Q81 C;  2LT4 A;  4M78 B;  1K1Z A;  3HP9 A;  2GTJ A;  3HKS A;  5D6X A;  2K3Y A;  1HXD A;  1SRM A;  2EPD A;  3L2V A;  4C92 G;  4E47 A;  4QW2 A;  2QA4 T;  1B34 B;  3JB9 I;  2E70 A;  4PK4 A;  1YIT Q;  4HKE A;  3RKX A;  1GCP A;  2O9V A;  2MMP A;  1KQS P;  1QVF S;  2RD1 A;  3CCL Q;  2MWO A;  2A28 A;  1VYU A;  4AMC A;  1D3B A;  2RO0 A;  2YDL A;  1K73 U;  2M51 A;  4M78 F;  1RAE B;  2RPN A;  3PTA A;  3JB9 J;  1KD1 R;  3CCR A;  2A3L A;  2HKN A;  2EGC A;  5GAN d;  2EGE A;  3VJP A;  3CXC P;  1IB8 A;  2E5Q A;  2B86 A;  4ELY C;  3I56 T;  2CUD A;  2EQM A;  3UT1 A;  2LNH B;  5IH2 A;  4M77 E;  3UA6 A;  3GF5 A;  1H3H A;  2COW A;  4A54 A;  1WXB A;  1XQH A;  3EFO B;  1B7T A;  4OF1 A;  4M7A D;  2OJ2 A;  2VUB A;  3BFM A;  2EKH A;  4M77 C;  1ZA1 B;  3CBM A;  2LQW A;  4PJO E;  3URG A;  5CK9 A;  1RL2 A;  3CCL A;  1K9A A;  2HSE B;  1WYX A;  1YI2 T;  3LWI A;  3G6E A;  2KRM A;  2O4X B;  1GXI E;  1MMG A;  4A4E A;  2E5K A;  3UDC A;  1VQ5 T;  1X6O A;  2ABL A;  3CC7 T;  4PJO C;  4IUU A;  3LX7 A;  4PJL A;  5CO7 A;  2K5L A;  3RER A;  1U8R A;  2RJD A;  2WSE E;  4M78 A;  4PL6 A;  3NMZ C;  3T9N A;  2DO3 A;  3ME9 A;  3SFM A;  1AWO A;  2E1H A;  1AWX A;  3GOX A;  3VUB A;  2COY A;  2YRV A;  4M7A G;  1YJN A;  3M0Q A;  2DX1 A;  4BDZ A;  4C0D B;  2OTJ A;  4BB7 A;  1GRI A;  3H8Z A;  3QWX X;  3M9Q A;  4WF2 A;  1TUG B;  1N8R U;  2RI2 A;  1LOJ A;  3CCE Q;  1K73 R;  4RCB A;  2CDT A;  4E6R A;  4C8Q B;  1SRL A;  5A0D A;  4NL2 A;  3V8L A;  2VKN A;  3G7Z A;  3M59 A;  1UGP B;  1M3B A;  4JRK A;  2CZ7 B;  3S3N A;  1WQW A;  1X6B A;  4MZP A;  5I11 A;  1JJ2 A;  3OYG A;  4C5E A;  4CC2 A;  2DXU A;  3QII A;  5CKE A;  2COZ A;  2OTL T;  3TEE A;  5GAM f;  4LN2 A;  1YHQ Q;  2KRN A;  5AYF A;  1WQ7 A;  3PMT A;  1WZO A;  2CT3 A;  3CCV T;  2HCK A;  1YWP A;  4JLG A;  2DYI A;  3JB9 F;  3IQL A;  2M1H A;  4N4I A;  5GAN 4;  3CCQ Q;  1KHI A;  1NYG A;  4M78 D;  4E7K A;  4C8Q F;  2JNG A;  2O9S A;  2M02 A;  3OBW A;  2E6N A;  3OYN A;  4ATO A;  2KNB B;  4F7U B;  2FVU A;  4FYV B;  4RTZ A;  2ZPH B;  4KGX B;  2LCC A;  1EIF A;  3CCE A;  4M75 E;  2A08 A;  1MGQ A;  2O4X A;  3BDL A;  1M30 A;  2K2M A;  3QDF A;  1NJI R;  1I0C A;  2KAF A;  3PFS A;  1JQQ A;  2QQS A;  3I55 Q;  2JTM A;  4JLI A;  2F69 A;  1T0H A;  1DJ7 B;  4M75 C;  2XIC A;  2KBT A;  2AZV A;  2WSC E;  4C5I A;  4ESR A;  1S72 Q;  1YHQ A;  1B3Q A;  1NPP A;  4PJM A;  1N8R R;  2DA9 A;  4M4Z A;  3MP1 A;  1W2B P;  4F7U F;  3QXE B;  4C0G A;  1LCK A;  5LJ5 d;  4JS5 A;  3CPW A;  1K0X A;  5FU7 C;  3CCQ A;  1M90 C;  4GLK A;  4E7S A;  3KFV A;  4FT4 A;  2PQW A;  4GBQ A;  1G3T A;  1HD3 A;  4LDW A;  4ZN1 A;  2EJG A;  1QVG A;  5C6S A;  3OS1 A;  1ZBJ A;  1M2V B;  2DZ9 A;  4NS5 A;  2A37 A;  1GL5 A;  1Q7Y R;  3M4G A;  4FIB A;  4EIK A;  3I35 A;  3SWN C;  1BIB A;  9ATC B;  3J81 E;  1AZG B;  3GNG A;  3I55 A;  4FSS A;  2ED0 A;  4DQ2 A;  1RAG B;  2QA4 A;  2V26 A;  3JRZ A;  2FB7 A;  2CRE A;  3S3O A;  1FWZ A;  1TTH B;  3CME T;  2PZ1 A;  3L2Q A;  1QP3 A;  1N9S A;  2ATC B;  2KYB A;  4PLI A;  4QVC A;  1S72 A;  3CQT A;  3JCM d;  2F2V A;  2KEA A;  5J26 A;  2RJF A;  3UF4 A;  4F7U A;  2KSS A;  2BTT A;  1UG1 A;  4RKU E;  1KQS A;  4BE0 A;  2FZG B;  3TSZ A;  3X24 B;  2V8K A;  4N0A C;  2LTO A;  4WTO B;  2AZS A;  2W0Z A;  5CKH A;  1KJW A;  3JB9 D;  2HL5 C;  2FRY A;  4C0Z A;  2DNU A;  4C5G A;  1MMN A;  2LVM A;  1BI3 A;  3F70 A;  3VS4 A;  4JS4 A;  2ECZ A;  4JJB A;  4LDV A;  3CXC A;  2ENM A;  4BE2 A;  3VKI A;  2LZ6 B;  1IHW A;  2K79 A;  1VQ6 Q;  3CCS T;  4Y91 A;  3EGX B;  1Q95 G;  1BCO A;  3HFN A;  1C1A A;  1GBQ A;  2J6K A;  1TUC A;  2RQT A;  4II1 A;  4EMH A;  1WJQ A;  2RK1 A;  3P8H A;  4JDS A;  3JCM c;  1LPL A;  3OSV A;  6AT1 B;  2RHZ A;  1FMW A;  5J39 A;  5GMK i;  3TCJ A;  1TOV A;  1UFF A;  2VWF A;  3OYH A;  1VQ5 A;  2X4J A;  1U06 A;  2DJQ A;  1H92 A;  3HTR A;  3CC7 A;  4HT9 A;  1UGS B;  5GAN 5;  1WHJ A;  4C8Q G;  1IGQ A;  4OB0 B;  4KUL A;  1RAA B;  1C6V X;  3QPH A;  4KH0 B;  1V76 A;  4OMF B;  1QVP A;  3E9G A;  5LJ3 g;  1ARK A;  3CBP A;  3U23 A;  8ATC B;  1VQ7 Q;  2LQ8 A;  2YHT A;  2FO0 A;  2RF0 A;  4OP0 A;  5FRO A;  2A36 A;  1UGQ B;  4KGV B;  1SEM A;  2O31 A;  4EMK B;  2DEU A;  3M54 A;  2EIF A;  1FXX A;  1T3S A;  4LXC A;  1M2O A;  1VQ9 T;  3CCR T;  2K2V A;  2J6F A;  4C92 B;  4DEY A;  2RMO A;  2RN8 A;  3HRU A;  3FRN A;  2D9T A;  2FZK B;  1KC8 C;  3GNF B;  5DLQ E;  1VQP Q;  1UE9 A;  1RI9 A;  4PJJ A;  3OMC A;  1RAH B;  3JSC A;  3CMA Q;  4OMN A;  3MPU B;  2XDP A;  2MF2 A;  2JN0 A;  2KVQ G;  1Q82 C;  3QSU A;  4F16 A;  1ZBX A;  5GMK j;  3CCV A;  2GTO A;  1YIT T;  5GAN 7;  1WHL A;  2F1L A;  1G3W A;  5CQX A;  2VGM A;  3EGX A;  4C92 F;  2HQH A;  5EC7 A;  3OA6 A;  1K8A U;  3CCL T;  1ZA2 B;  1PKT A;  3AT1 B;  1YWO A;  4V2S A;  5GAM h;  1BYM A;  4HA8 A;  2PTK A;  4XTX A;  4J7F A;  4ANJ A;  3OB9 A;  3CBO A;  4N4G A;  3JB9 H;  5KE2 A;  2RM4 A;  2RNA A;  5IAY A;  3H0I A;  1VIE A;  4J8O A;  2EQU A;  3M57 A;  4F17 A;  2CZ1 B;  1VQP A;  1VQM Q;  4KUD K;  4HCZ A;  1D0Y A;  1Y7X A;  2EWN A;  3CMA A;  2HD0 A;  3VRZ A;  2BIV A;  5I2S A;  2QK0 A;  2KY9 A;  2L8D A;  4X9D A;  1JJ2 P;  4EMK A;  4RTX A;  2XDD A;  4FCY A;  2IVW A;  3QKJ A;  2E65 A;  3CCU Q;  4C92 A;  5LJ3 e;  2DYB A;  1Y96 A;  3TQ7 P;  4OMP A;  3C0C A;  4MZM A;  4PLL A;  1WXT A;  3DB3 A;  2DMO A;  1QWF A;  4J7I A;  3RES A;  5DY9 A;  1ZHI A;  2BUD A;  1R0B G;  5L8R E;  3H6Z A;  4RG2 A;  2QXF A;  2VXE A;  1EX4 A;  2F2W A;  2HAX A;  1HJD A;  4L59 A;  2JM8 A;  4QQ6 A;  1FMK A;  3X26 B;  2CGH A;  3MP8 A;  2C0O A;  3ER0 A;  1IGU A;  3CME A;  4KGZ B;  1VQM A;  2LJ1 A;  5CCA A;  4M78 E;  5IT9 E;  4IUP A;  2X4X A;  2CSQ A;  3CCE T;  3KUF A;  4Y28 E;  2HL3 A;  4RMO A;  4JRP A;  2RQR A;  3NPF A;  3E2U A;  1RAF B;  1YN8 A;  2GQI A;  2J6O A;  1G8X A;  1PSE A;  3EG0 A;  5KYY A;  3EH2 A;  2EJF A;  3PVQ A;  1VOM A;  3EHR A;  1NG2 A;  3CPW P;  5KE3 A;  2YT6 A;  2X51 A;  2ZCF B;  3J80 E;  1M27 C;  4C92 D;  4XU2 A;  1YHQ T;  1KD1 C;  1MND A;  3OYI A;  4A4K A;  2DRM A;  4E7Z A;  2DRK A;  1Z9Q A;  2G3R A;  3RMQ A;  3CCS A;  5CKD A;  5KYW B;  1M1K R;  2IIM A;  3CCQ T;  5GAM j;  2KRS A;  3FIF A;  4BY6 B;  2KRO A;  2XID A;  4PJN A;  5FU6 C;  2QQ9 A;  1GCQ C;  3RNJ A;  2D6F A;  4M7A A;  3I9Q A;  1OZ2 A;  1BIA A;  4WCI A;  2C0T A;  4OMQ A;  2RI3 A;  4AG1 C;  1M5Q 1;  3PIP A;  1XTD A;  3I55 T;  3CCM Q;  1X43 A;  2XU8 A;  1E6H A;  2HQX A;  3X20 B;  3M0R A;  1MUZ A;  1BKB A;  3QG1 A;  1WHH A;  3JCM W;  1QW1 A;  1RLP C;  3OW2 S;  1S72 T;  2JZ2 A;  1PD1 A;  1AD5 A;  2YSQ A;  4A4F A;  2RHX A;  3ZFJ A;  2FZC B;  1RAB B;  2AIR B;  4UC4 A;  4ZTF A;  4J9F A;  2O01 E;  1G2B A;  2EKO A;  1VQ9 A;  2RQW A;  4LDU A;  1G3Y A;  1ABO A;  2PVO B;  3OS2 A;  4L6V 5;  4OMO A;  3V7C A;  3EHQ A;  3THK A;  2DER A;  4QT7 A;  3EG3 A;  3M5A A;  2YUN A;  3REB B;  5L23 A;  3L42 A;  2C06 A;  2DTI A;  1K73 C;  2JTE A;  1PHT A;  2MOX A;  2GFU A;  1Z9Z A;  4LDY A;  1NEB A;  2K6D A;  3EAE A;  5LJ3 f;  2QGF B;  2XKO C;  1YIT A;  1AHJ B;  2LNV A;  4MMK A;  5FRM A;  2VC8 A;  2EYY A;  3PIO A;  5KYW A;  3GP8 A;  4J83 A;  2ED1 A;  4RG8 A;  2I0N A;  5GAN 2;  3GIB A;  4JZ4 A;  3JCM J;  2K7A A;  4D6W A;  5GAO q;  1U3O A;  1ZSZ A;  2DE0 X;  3ZEH A;  2HBP A;  1BK2 A;  4OB2 B;  1UEB A;  5CKB A;  1TH7 A;  1NJI U;  2ZAE A;  2KT1 A;  2X3W D;  4F7U E;  1N9R A;  1B34 A;  3EGD B;  5GAO n;  1VYT A;  2R57 A;  3M4Y A;  5GAN g;  1PSF A;  2P4R A;  4P5N A;  1ZUY A;  1VQ6 T;  3CCJ Q;  3TU4 K;  2DTH A;  2DK3 A;  1M9S A;  4X34 A;  3PNW C;  3RKW A;  5A0G A;  2V8I A;  2SRC A;  2P84 A;  2MCN A;  2DKG A;  4M77 B;  1N8R C;  1AVZ C;  1OPL A;  2YWW A;  2BZX A;  2EQI A;  1WX6 A;  1OX8 A;  1Q7Y U;  3FC3 A;  2KE9 A;  1FYN A;  2O88 A;  3LWH A;  1VQ8 Q;  2X4Y A;  2Y4Y A;  1Y07 A;  2OAU A;  4BDY A;  2HNI A;  3EFO A;  3VS5 A;  4JZ3 A;  4PJO B;  3EG1 A;  1JU5 C;  2K4Y A;  1VQ7 T;  5D6Y A;  2QGG A;  4B6M A;  3JCM V;  3QJ6 A;  1R8O B;  4HCB A;  3UA7 A;  1EFN A;  2R5A A;  1KG1 A;  4M77 F;  3VRY A;  4LUD A;  2XD0 A;  3H9N A;  1O9S A;  2J06 A;  2KGT A;  2ESW A;  3RUX A;  2DEQ A;  2QYZ A;  3LGF A;  2K3B A;  2GNC A;  5A2Q E;  2E3H A;  3BY7 A;  4EMG A;  4PJO F;  2KI7 A;  1VQL Q;  1XJW B;  1VQP T;  1UTI A;  4LDX A;  4RTT A;  1AZE A;  2YUP A;  1QQJ A;  1R77 A;  3CMA T;  1TU0 B;  3DB4 A;  3FLG A;  2GGR A;  1PWT A;  2P0K A;  3PE0 A;  2K3X A;  4CC7 A;  4BD3 A;  3JCM Q;  2HMA A;  1PM3 A;  1R0C B;  3VUZ A;  4O5V A;  3G71 Q;  1Q86 C;  1VQK Q;  5FRN A;  2SEM A;  3ZL7 C;  2CUB A;  2XI9 A;  2ZPE B;  3PMI A;  4GLM A;  2YLC A;  3C95 A;  8AT1 B;  4C8Q A;  2ROL A;  4HCK A;  3CEY A;  5J3B A;  5GJW B;  4M7D G;  2L0A A;  4ZTJ A;  5GAO l;  3VS2 A;  1LNX A;  1PNJ A;  2LP5 A;  5GAN e;  3G4S Q;  4Z89 A;  5FW9 A;  3REA B;  2EYZ A;  2L3P A;  1D1C A;  1VIF A;  2DAQ A;  1MV0 B;  4RTW A;  5D7U A;  4Z8A A;  4AG2 C;  1T0J A;  5LL6 S;  2JS2 A;  4HVV A;  1B07 A;  5C0M A;  1NBE B;  1VQL A;  2HDA A;  3OYL A;  1KQ2 A;  1VQM T;  4DEX A;  2DJZ A;  2M9U A;  1WJR A;  2JMA A;  2RHY A;  4JJC A;  3OW2 P;  1QVF P;  2LCS A;  4CI0 C;  4FYW B;  2CH4 W;  4HCC A;  4JUV A;  4OB3 B;  3KBG A;  3G71 A;  5KH6 A;  1I1J A;  2KYM A;  1HSQ A;  4ZNX A;  2PNI A;  3V8K A;  2DXB A;  3CCU T;  2DPP B;  3CD6 Q;  1WGS A;  1M1F A;  3QZ5 B;  2LJ3 A;  2QAZ A;  5GAO m;  2DZC A;  2IG0 A;  2L3S A;  4R55 A;  5FU7 B;  5LJ5 g;  4ME7 A;  4C8Q D;  2EQK A;  2V1Q A;  5KYN A;  3G4S A;  3VYG A;  1IO6 A;  4C92 E;  3OYF A;  4M75 F;  2MK5 A;  3QO3 A;  3TSW A;  1H3Z A;  4LNP A;  2K9G A;  4IUV A;  4EMK C;  1WPY A;  4J6Y A;  3SWN B;  1RUW A;  5HKC A;  2D0Q B;  1MNE A;  2BE9 B;  2PVG B;  4MDW A;  2GQV A;  4E7L A;  2VGN A;  2HKQ B;  1KFZ A;  1D09 B;  3MKD A;  3QJY A;  1TSF A;  3TVT A;  1GFD A;  3FDR A;  3OBY A;  1VA7 A;  3NTI A;  2AT1 B;  4PJO D;  3QDR B;  4DBQ A;  3CC4 Q;  4XU1 A;  5LJ3 h;  2J05 A;  1X27 A;  4KBM B;  1JB0 E;  1M2V A;  1OU8 A;  2HZY A;  2O2O A;  3CD6 A;  1TG0 A;  2P0P A;  3JCM g;  4IUT A;  4E7J A;  4AFS C;  4IKF A;  2YRC A;  2DL7 A;  3BW1 A;  5IXF A;  3JV3 A;  3M53 A;  4M77 G;  1WHM A;  4J5Y A;  1X2K A;  2RH2 A;  4ZGJ B;  4R56 A;  1YJW Q;  1ZSG A;  1JXO A;  1K76 A;  1G83 A;  2F5K A;  4R0K A;  1O75 A;  3OS0 A;  1VQ6 A;  3X25 B;  4XTU A;  2VYT A;  3ULR B;  4MDX A;  2EQJ A;  2VVK A;  2AHJ B;  1KQS S;  3MP6 A;  2CZ0 B;  2JTF A;  1G5V A;  2DF6 A;  2Y4X A;  1W1F A;  4PJO G;  3A5Z B;  4OB1 B;  4F14 A;  3Q1J A;  4OML A;  1ZLM A;  5GAM d;  4DA4 A;  3M58 A;  5HCK A;  4J9B A;  3L2Z A;  5IN1 A;  2LMJ A;  3CC4 A;  2RQU A;  3H41 A;  3WXM B;  5M9O A;  4XTW A;  2DD4 A;  3LH0 A;  5CVI A;  3BE3 A;  1YP5 A;  2CYZ B;  3CCM T;  4PFO A;  1QCN A;  4RTU A;  3OYJ A;  1PD0 A;  1WJS A;  4M7A E;  1C0M A;  2E41 A;  2FEI A;  4FU6 A;  2LJ0 A;  2YUQ A;  1QP2 A;  1YJW A;  5GAN f;  1VQ7 A;  2QI2 A;  3MET A;  2DXC A;  5LJ5 e;  2HQE A;  2QQR A;  4M7A C;  3AHU A;  1NE8 A;  2K5F A;  1CKA A;  3V8J A;  4OGE A;  2M16 A;  5HY6 A;  5GMK e;  3L2W A;  4O6J A;  1T3L A;  5FWC A;  3RMS A;  2QEX Q;  3OY9 A;  4XU0 A;  1K8A C;  4RTV A;  2LCL A;  2RA2 A;  3L2R A;  3EFS A;  4X1V A;  2FPF A;  4FW1 A;  3A8M B;  2G6F X;  3OYC A;  2A0F B;  3RKY A;  3PT9 A;  4BE1 A;  2MWP A;  1VQO Q;  1JRI A;  3C94 A;  4N0A A;  1RAI B;  2JS0 A;  1NPR A;  1UGV A;  1WLP B;  1M1K U;  3JCM X;  1JBM A;  4ZGE B;  3JCM e;  3EFR A;  1OQK A;  4CC4 B;  1KK7 A;  5LJ3 j;  3OSS C;  2EJ9 A;  2X9H A;  2LQK A;  2M0O A;  1IRE B;  1U1S A;  1BI2 A;  2L3R A;  4M75 G;  3A8O B;  3TRE A;  1OEB A;  3M55 A;  2X3X D;  3PGG A;  3JAM E;  2QEX A;  2X4W A;  2GF7 A;  5KYU B;  1UEC A;  4Y92 A;  1ABQ A;  1PKS A;  1RI0 A;  1N6A A;  2H3J A;  1OPK A;  2KMT A;  2ROT A;  3CC2 Q;  4QVD A;  1YIJ Q;  2JT4 A;  4XTZ A;  3SD4 A;  2YUO A;  1K9M U;  1OUL A;  1Y0M A;  2J7I A;  2BKD N;  1ZSZ C;  3CCJ T;  3NFC A;  3I5S A;  1N27 A;  4OGC A;  2BZY A;  3C4S A;  4M78 C;  3NHN A;  1CSK A;  3CCU A;  3OW2 A;  1QVF A;  2E3I A;  1D3B B;  4GY5 A;  2CH4 A;  5CKF A;  1WIE A;  4XAX B;  2L5Q A;  2AKK A;  1IHV A;  4AFQ C;  2HBW A;  2B8A A;  1K0S A;  2DL8 A;  1MMD A;  2RQV A;  2L89 A;  1IXD A;  4ZN3 A;  1VQ8 T;  3EGU A;  5GAO r;  3MO8 A;  4JRI A;  4CRI A;  2PUO B;  2CZ6 B;  2QDL A;  5I2M A;  2F2X A;  4TVR A;  3DLM A;  3CC2 A;  1OU9 A;  1YIJ A;  4PFP A;  3SB2 A;  1W2B S;  1J3T A;  4IUQ A;  3WVD B;  1YJ9 Q;  1QMC A;  4D8K A;  1WNL A;  2IPO B;  5KCO A;  2DIG A;  4ORZ A;  5IHK A;  3OYY A;  1Q81 U;  2DBK A;  2XDB A;  1K4U S;  3A98 A;  2DD5 A;  3MJX A;  1IRX A;  5GJV B;  2EGA A;  3KXT A;  2D8J A;  1ZUK A;  1LJO A;  2I2L A;  3VS0 A;  3JCM P;  1VQL T;  5KYU A;  4OVA A;  2DXT A;  1M3C A;  2H3E B;  3LGL A;  4KUI A;  2XK0 A;  3M56 A;  3V7R A;  4OMM A;  1K9M R;  2EAY A;  4M7D B;  1M8V A;  2FRW A;  4XTY A;  3VS1 A;  1VQ4 Q;  4HVU A;  1ZQ1 A;  3M0P A;  4J9H A;  3A8L B;  1F1B B;  2C0I A;  3G71 T;  1VQK T;  3FJ5 A;  2V8J A;  1VQN Q;  1MV3 A;  4J9E A;  2NUZ A;  1WFW A;  2BZ8 A;  1X01 A;  2CP6 A;  3EH1 A;  2RHU A;  2NLU A;  1SPK A;  3G6E Q;  1YJ9 A;  4J9D A;  2JW4 A;  1XNI A;  4XU3 A;  2DIQ A;  1XOV A;  2R5M A;  2P0Q A;  1TS9 A;  3G4S T;  3VS6 A;  1PG5 B;  3SHW A;  4J9I A;  3JCM f;  4C8Q E;  4C0D C;  3ASK A;  4M7D F;  3I5R A;  1I07 A;  5FU6 B;  3CCM A;  2PVD B;  2LRQ A;  4C0F A;  5IHN A;  2EW3 A;  1G3S A;  1LVK A;  4MZT A;  3MCA B;  1PCX A;  5CR2 A;  4HVW A;  2E10 A;  1YJN Q;  5HK0 A;  2VXF A;  2L3Q A;  2OTJ Q;  2ZGW A;  4C8Q C;  2R58 A;  3OYD A;  2NWM A;  1VQ4 A;  1UUE A;  1Q81 R;  3HL8 A;  2EYW A;  1SSF A;  5FLX E;  2XG8 D;  4PKC C;  2QDY B;  4FL6 A;  3NTH A;  1FMV A;  1VQN A;  4ZGD B;  3C12 A;  4DBH A;  4E2F B;  1D0X A;  3CD6 T;  5GAN h;  1MHN A;  2DL3 A;  2GCX A;  2QTX A;  4FYX B;  3L2U A;  3P8B B;  1GFC A;  1PC0 A;  4N4H A;  3LYI A;  4B9W A;  3J7A F;  4FSX A;  7AT1 B;  2DLP A;  2HEQ A;  3R6O A;  3VYH B;  2EYX A;  2RJE A;  4F04 B;  1NJI C;  4M7D A;  2ZPI B;  1TXQ A;  5GAN 8;  1M1G A;  1OX9 A;  1QKX A;  2BE7 D;  3PVL A;  2AKL A;  1X6G A;  4FT2 A;  1BBZ A;  4LUE A;  4RTY A;  2YRD A;  4LE9 A;  4JPB W;  1I5O B;  2FHD A;  1VUB A;  4YTL A;  1WHK A;  3CC4 T;  2WSF E;  1OI1 A;  2MYS A;  4VUB A;  1OZ3 A;  5GMK l;  1HYO A;  1UDL A;  2K5I A;  3RR6 A;  3OQ5 A;  2QAS A;  2E6Z A;  1MMA A;  2GFA A;  2ZPF B;  4PFZ A;  4L5G A;  3SDZ A;  1M8M A;  1GCQ A;  2CKK A;  5DM7 R;  1YJW T;  2EBP A;  1A0N B;  4D8D A;  1WI7 A;  3OS5 A;  1Q7Y C;  1WHG A;  1YBY A;  2DFU A; 
#chains in the Genus database with same CATH homology
 3RKX A;  3SWN B;  2HD0 A;  4QQD A;  5HKC A;  2D0Q B;  2BIV A;  2MMP A;  4J6W A;  1U1T A;  5I2S A;  1QVF S;  2RD1 A;  3CCJ A;  2PVG B;  2KY9 A;  4MDW A;  2L8D A;  2GQV A;  4X9D A;  2MWO A;  3RIR A;  4E7L A;  2VGN A;  3INZ A;  3V7S A;  4EMK A;  3QJY A;  1P92 A;  2JOY A;  3FDR A;  3OBY A;  2XDD A;  2IVW A;  4M7D D;  3NTI A;  2E65 A;  3QKJ A;  1D3B A;  2RO0 A;  3QDR B;  4PJO D;  4XU1 A;  1K73 U;  5LJ3 h;  4M78 F;  3NTK A;  4C92 A;  5LJ3 e;  3PTA A;  1Y96 A;  3JB9 J;  4KBM B;  3CCR A;  1JB0 E;  2A3L A;  5GAN d;  3VJP A;  2ZZD A;  4MZM A;  4PLL A;  3DB3 A;  5GMK m;  3CD6 A;  4RCC A;  2P0P A;  3RES A;  4IUT A;  3BDU A;  2PUK B;  4J7I A;  3JCM g;  5DY9 A;  1ZHI A;  2BUD A;  4E7J A;  2E5Q A;  5L8R E;  3H6Z A;  4RG2 A;  4ELY C;  2QXF A;  3I56 T;  2VXE A;  2EQM A;  4IKF A;  3UT1 A;  3BW1 A;  4M77 E;  3M53 A;  4XK8 E;  4M77 G;  3GF5 A;  4J5Y A;  1VQ8 A;  2RH2 A;  4ZGJ B;  4R56 A;  2HAX A;  4L59 A;  4A54 A;  4QQ6 A;  3X26 B;  2CGH A;  1BI0 A;  3MP8 A;  1XQH A;  4A53 A;  3OYA A;  2F5K A;  1Q86 U;  2QQA A;  4OF1 A;  1O75 A;  3OS0 A;  1M90 U;  3ER0 A;  1VQ6 A;  3X25 B;  4M7A D;  3CME A;  2VUB A;  4XTU A;  1VQM A;  2VYT A;  5CCA A;  3BFM A;  5D6W A;  4M78 E;  4M77 C;  3VV0 A;  2EQJ A;  5IT9 E;  4MDX A;  2AHJ B;  3CBM A;  4IUP A;  1KQS S;  4M78 G;  3MP6 A;  2X4X A;  2CZ0 B;  3JCM b;  2JTF A;  1G5V A;  2Y4X A;  4PJO E;  2RI5 A;  1JJ2 S;  4PJO G;  3A5Z B;  4OB1 B;  3CCE T;  3KUF A;  3URG A;  5GAN 6;  4Y28 E;  5CK9 A;  5GAN j;  3Q1J A;  1RL2 A;  3CCL A;  4RMO A;  3HHT B;  4M77 A;  1YI2 T;  5GAM d;  3LWI A;  3G6E A;  4DA4 A;  4JRP A;  3M58 A;  1I4K 1;  2O4X B;  3HSB A;  1GXI E;  3L2Z A;  5IN1 A;  2QEX T;  4A4E A;  3UDC A;  1VQ5 T;  1X6O A;  4A4G A;  3CC4 A;  1PSE A;  2EJF A;  3CC7 T;  4PJO C;  4IUU A;  3UPU A;  3WXM B;  5M9O A;  4XTW A;  2DD4 A;  3LX7 A;  3LH0 A;  5CVI A;  5CO7 A;  2K5L A;  3RER A;  1U8R A;  2RJD A;  2WSE E;  4M78 A;  2CYZ B;  4PL6 A;  5KE3 A;  3CCM T;  3T9N A;  2LDM A;  2MAM A;  2DO3 A;  2ZCF B;  3ME9 A;  3J80 E;  4PJO A;  4C92 D;  1VQO T;  3OYJ A;  4XU2 A;  2RB6 A;  3SFM A;  1WJS A;  2E1H A;  1YHQ T;  3GOX A;  4M7A E;  2E41 A;  3VUB A;  2YRV A;  4M7A G;  1KD1 C;  1YJN A;  4DOV A;  4FU6 A;  4M75 B;  4A4K A;  3QYG B;  3OYI A;  1QP2 A;  2G3R A;  3QHS A;  3RMQ A;  4C0D B;  2QQB A;  5GAN f;  3CCS A;  4BDZ A;  5CKD A;  1YJW A;  1VQ7 A;  2OTJ A;  4BB7 A;  2QI2 A;  3MET A;  3CCQ T;  3H8Z A;  5LJ5 h;  3CXC S;  3M9Q A;  2DXC A;  1IZ6 A;  5GAM j;  4Q5W A;  5LJ5 e;  4WF2 A;  2HQE A;  1VQK A;  2QQR A;  3FIF A;  4BY6 B;  1N8R U;  2RI2 A;  1LOJ A;  4M7A C;  3VU3 C;  3AHU A;  2XID A;  1NE8 A;  2K5F A;  4RCB A;  3V8J A;  4OGE A;  5GMK h;  2M16 A;  5HY6 A;  5GMK e;  4C8Q B;  5FU6 C;  4O6J A;  2QQ9 A;  4NL2 A;  3V8L A;  5A0D A;  3L2W A;  3RMS A;  1NZ9 A;  2D6F A;  1HK9 A;  3G7Z A;  3M59 A;  1UGP B;  5LJ3 d;  4M7A A;  3OY9 A;  4XU0 A;  1K8A C;  4JRK A;  3OYE A;  1OZ2 A;  2LCL A;  5GAO p;  2RA2 A;  3L2R A;  1BIA A;  3EFS A;  2CZ7 B;  3S3N A;  3PIP A;  2RI3 A;  1M5Q 1;  2RJC A;  5CAI A;  1XTD A;  1WQW A;  3A8G B;  4J6X A;  4MZP A;  3I55 T;  1JJ2 A;  3OYG A;  3A8M B;  4C5E A;  3OYC A;  1Y71 A;  4M77 D;  3CPW S;  2DXU A;  2XU8 A;  3RKY A;  3PT9 A;  3QII A;  2HQX A;  2MWP A;  3WVE B;  5CKE A;  4BE1 A;  3X20 B;  2OTL T;  3TEE A;  5GAM f;  1JRI A;  2EFI A;  3CC2 T;  3I56 A;  5AYF A;  1BKB A;  1WQ7 A;  3PMT A;  3C94 A;  4N0A A;  1YIJ T;  3QG1 A;  4IUV A;  1NPR A;  1QW1 A;  3OW2 S;  3JCM W;  3CCV T;  1S72 T;  2JZ2 A;  4JLG A;  2FL7 A;  4C92 C;  3JB9 F;  2M1H A;  1W4S A;  1QVG S;  1M1K U;  4N4I A;  5GAN 4;  2LC4 A;  1KHI A;  3JCM X;  1JBM A;  4M78 D;  3JCM h;  4E7K A;  4ZGE B;  4A4F A;  2FYK A;  2RHX A;  3X28 B;  3EFR A;  3ZFJ A;  4C8Q F;  3JCM e;  3A8H B;  3QBY A;  2JNG A;  4UC4 A;  3CPF A;  4ZTF A;  5LJ3 j;  3OBW A;  3OSS C;  2EJ9 A;  2O01 E;  2E6N A;  3OYN A;  2EKO A;  2LQK A;  4F7U B;  4BI4 A;  1VQ9 A;  2FVU A;  4ATO A;  1FX7 A;  4LDU A;  2ZPH B;  1G3Y A;  2LCC A;  1EIF A;  2PVO B;  3OS2 A;  3CCE A;  2M0O A;  4M75 E;  2ZPG B;  1KHC A;  4QVZ A;  4L6V 5;  1IRE B;  3V7C A;  1U1S A;  1BI2 A;  2L3R A;  4M75 G;  1MGQ A;  2O4X A;  3A8O B;  1YI2 A;  3BDL A;  3TRE A;  3M55 A;  2KAF A;  3M5A A;  3PGG A;  3JAM E;  3PFS A;  1UB4 A;  2QQS A;  3MEW A;  2QEX A;  2X4W A;  2GF7 A;  3L42 A;  1H64 1;  2C06 A;  2DTI A;  2JVV A;  3DLL A;  1K73 C;  1KQ1 A;  2JTM A;  4JLI A;  3FJP A;  2F69 A;  2ZPB B;  1RI0 A;  1DJ7 B;  4M75 C;  1N6A A;  2H3J A;  3JB9 G;  2XIC A;  1X75 C;  2KMT A;  2GFU A;  3LLR A;  4LDY A;  2P4T A;  2WSC E;  4QVD A;  3EAE A;  4BUG A;  4XTZ A;  5LJ3 f;  3SD4 A;  4C5I A;  3S3M A;  2XKO C;  3OYM A;  1YIT A;  4JRQ A;  2DTO A;  2X35 A;  1AHJ B;  2RHI A;  4M75 A;  1YHQ A;  1NPP A;  2LNV A;  4MMK A;  1K9M U;  5FRM A;  4Z02 A;  2VC8 A;  3MP1 A;  4F7U F;  3PIO A;  5CIU A;  3QXE B;  4C0G A;  2BKD N;  2LX9 A;  3GP8 A;  4J83 A;  3CCJ T;  5LJ5 d;  4RG8 A;  4JS5 A;  3NFC A;  3CPW A;  5GAN 2;  1KC8 U;  4EDU A;  1YJ9 T;  1N27 A;  5FU7 C;  3V7R A;  3CCQ A;  4DOW A;  3GIB A;  4OGC A;  3JCM J;  3C4S A;  4D6W A;  4M78 C;  5GAO q;  1M90 C;  4GLK A;  3OYB A;  4FT4 A;  3CCU A;  2PQW A;  3OW2 A;  1QVF A;  1D3B B;  3MEV A;  4GY5 A;  3ZEH A;  1G3T A;  1I8F A;  2HBP A;  3QZ9 B;  4LDW A;  4OB2 B;  1UEB A;  5CKB A;  4ZN1 A;  2EJG A;  1QVG A;  5C6S A;  1Y96 B;  1TH7 A;  5CKF A;  1NJI U;  3OS1 A;  2DZ9 A;  4NS5 A;  4XAX B;  2L5Q A;  4JJN K;  1Q82 U;  3M4G A;  4FIB A;  3DKM A;  2DVE A;  3SWN C;  2B8A A;  1BIB A;  2L89 A;  2JUF A;  4ZN3 A;  2YLB A;  4MML A;  4F7U E;  3J81 E;  3GNG A;  1N9R A;  2MI6 A;  4F7U G;  1VQ8 T;  3I55 A;  1B34 A;  1YCY A;  5GAO r;  5GAO n;  3MO8 A;  4JRI A;  4CRI A;  2PUO B;  2CZ6 B;  5I2M A;  4DQ2 A;  1M4Z A;  2QA4 A;  2R57 A;  3M4Y A;  4TVR A;  3DLM A;  3JRZ A;  3SWN A;  5LJ5 j;  2FB7 A;  5GAN g;  2OTL A;  1VQ4 T;  1PSF A;  3CC2 A;  3S3O A;  1FWZ A;  3O8V A;  4P5N A;  1VQ6 T;  3CME T;  3L2Q A;  1QP3 A;  1YIJ A;  1N9S A;  4PLI A;  2KDS A;  2XHC A;  3SB2 A;  1W2B S;  3TU4 K;  2DTH A;  4IUQ A;  4QVC A;  1S72 A;  3JCM d;  3QYH B;  3WVD B;  2DK3 A;  1M9S A;  1V29 B;  1WNL A;  4X34 A;  5KCO A;  2DIG A;  2E12 A;  5J26 A;  1VQN T;  3OYY A;  3PNW C;  5I21 A;  3RKW A;  1Q81 U;  2RJF A;  5A0G A;  2V8I A;  2XDB A;  2E64 A;  4C5H A;  4F7U A;  3G6E T;  2KSS A;  4M75 D;  4X9C A;  2K57 A;  4RKU E;  1KQS A;  2DKG A;  2DD5 A;  4M77 B;  2PU9 B;  4BE0 A;  1N8R C;  4FM4 B;  3X24 B;  2V8K A;  4KT0 E;  4N0A C;  2A7Y A;  2LTO A;  3KXT A;  1LJO A;  2I2L A;  1Q7Y U;  5CKH A;  3L1A A;  3FC3 A;  3JCM P;  1VQL T;  3JB9 D;  4OVA A;  3LWH A;  2DXT A;  4C0Z A;  5GAM g;  2X4Y A;  4C5G A;  2Y4Y A;  3LGL A;  1Y07 A;  4A4H A;  4KUI A;  2OAU A;  2XK0 A;  2HNI A;  2LVM A;  1BI3 A;  3F70 A;  3M56 A;  2EAY A;  3MHX A;  3OYK A;  4M7D B;  4JS4 A;  1M8V A;  4LDV A;  4PJO B;  3CXC A;  4XTY A;  4BE2 A;  5EG2 A;  1YJN T;  2LT1 A;  3GLX A;  3VKI A;  2K4Y A;  1VQ7 T;  3CCS T;  5D6Y A;  4Y91 A;  1ZQ1 A;  2OTJ T;  3A8L B;  3JCM V;  1UGR B;  3QJ6 A;  4HT8 A;  1R8O B;  3HFN A;  4HCB A;  3G71 T;  1VQK T;  2F5T X;  2V8J A;  2R5A A;  4XQ3 A;  1KG1 A;  4M77 F;  4IUR A;  1X01 A;  5DLO A;  2XD0 A;  4II1 A;  4EMH A;  1WJQ A;  2RK1 A;  2RHU A;  3E9F A;  2NLU A;  3P8H A;  4JDS A;  3JCM c;  2CS7 A;  3QUI A;  3OSV A;  1O9S A;  1YJ9 A;  2RHZ A;  1M1K C;  5J39 A;  5GMK i;  1XNI A;  3E1S A;  4XU3 A;  4M7D E;  3TCJ A;  2DIQ A;  3S6W A;  3OYH A;  3RUX A;  1XOV A;  2DEQ A;  2R5M A;  1VQ5 A;  2X4J A;  2P0Q A;  3HFO A;  3LGF A;  3CC7 A;  1W2B A;  4HT9 A;  4M7A B;  1OYX A;  3G4S T;  1UGS B;  5A2Q E;  1I5L A;  5GAN 5;  3BY7 A;  3JCM f;  4C0D C;  3ASK A;  4C8Q E;  4EMG A;  4PJO F;  4M7D F;  4C8Q G;  5FU6 B;  4OB0 B;  3CCM A;  1VQP T;  2PVD B;  3FB9 A;  2LRQ A;  4PNO A;  4C0F A;  4KUL A;  4LDX A;  3HPW A;  1VQO A;  3E19 A;  3CMA T;  1G3S A;  4BY6 C;  4MZT A;  2WAC A;  3MCA B;  1I81 A;  3DB4 A;  3FLG A;  3QPH A;  5CR2 A;  4OMF B;  5KCH A;  2P0K A;  1QVP A;  2E10 A;  3E9G A;  4BI3 A;  5HK0 A;  2VXF A;  5LJ3 g;  2K3X A;  3CBP A;  5A0L A;  4BD3 A;  2LQ8 A;  3JCM Q;  2ZGW A;  4C8Q C;  4E7I A;  2R58 A;  2YHT A;  5CQY A;  3OYD A;  4OP0 A;  5FRO A;  3OMG A;  3VUZ A;  4NL3 A;  1UGQ B;  4O5V A;  1VQ4 A;  5HK3 A;  1Q86 C;  5FRN A;  3HRT A;  4EMK B;  2XI9 A;  2ZPE B;  3PMI A;  2YLC A;  3C95 A;  3HL8 A;  1SSF A;  5FLX E;  4LD9 K;  3M54 A;  4C8Q A;  2EIF A;  2XG8 D;  1FXX A;  4PKC C;  2QDY B;  1K9M C;  1VQ9 T;  4FL6 A;  3CEY A;  3NTH A;  5J3B A;  4LD6 A;  2K2V A;  3GPL A;  4B9X A;  5GAN 3;  3CCR T;  4C92 B;  4BDY A;  1VQN A;  4M7A F;  4M7D G;  4ZGD B;  3C12 A;  4BI8 B;  4ZTJ A;  5GAO l;  3CD6 T;  5GAN h;  1LNX A;  3HRU A;  2D9T A;  3FRN A;  5GAN e;  1MHN A;  2GCX A;  2QTX A;  1KC8 C;  3L2U A;  3FEO A;  3P8B B;  4N4H A;  3P8D A;  3GNF B;  3LYI A;  5DLQ E;  1KD1 U;  4NOY A;  4B9W A;  1VIF A;  2DAQ A;  4BAC A;  3J7A F;  4FSX A;  2KK4 A;  4M7D C;  5LL6 S;  3OMC A;  3JSC A;  3R6O A;  3VYH B;  5C0M A;  2RJE A;  2VV5 A;  1VQL A;  3ZBD A;  3OYL A;  1NJI C;  2RK2 A;  1KQ2 A;  1VQM T;  2XDP A;  2MF2 A;  2JN0 A;  2KVQ G;  4M7D A;  2DJZ A;  1Q82 C;  3QSU A;  1ZBX A;  2M9U A;  2ZPI B;  5GMK j;  5GAN 8;  1M1G A;  3CCV A;  5GAN 7;  1YIT T;  1WJR A;  2RHY A;  1G3W A;  5CQX A;  3HRS A;  4FT2 A;  2VGM A;  4C92 F;  2Y90 A;  3OA6 A;  1K8A U;  3CCL T;  4CI0 C;  4E7H A;  4V2S A;  2FHD A;  4JUV A;  4EPC A;  4HCC A;  5GAM h;  4OB3 B;  3KBG A;  3G71 A;  4XTV A;  2EYQ A;  1VUB A;  5GAM e;  3MEU A;  1BYM A;  4YTL A;  5KH6 A;  4HA8 A;  3CC4 T;  2WSF E;  1BI1 A;  2DXB A;  4XTX A;  2DPP B;  3V8K A;  4J7F A;  1OI1 A;  3CCU T;  2KQW A;  4ELZ C;  1WGS A;  1M1F A;  3QZ5 B;  4QQG A;  3OB9 A;  3LW5 E;  3CBO A;  4VUB A;  1OZ3 A;  3MEA A;  3UWN A;  5GMK l;  5LJ5 f;  4N4G A;  5GAO m;  2DZC A;  2K5I A;  2IG0 A;  3JB9 H;  4R55 A;  5FU7 B;  3OQ5 A;  3N5B B;  5KE2 A;  2E6Z A;  5LJ5 g;  2GFA A;  4ME7 A;  1Q81 C;  2LT4 A;  2RM4 A;  4C8Q D;  2ZPF B;  4M78 B;  5IAY A;  2EQK A;  3G4S A;  4L5G A;  1VIE A;  3HP9 A;  2EQU A;  4J8O A;  3HKS A;  3M57 A;  3SDZ A;  5D6X A;  3VYG A;  2K3Y A;  1HXD A;  2CZ1 B;  4C92 E;  3L2V A;  2CKK A;  5DM7 R;  3OYF A;  1YJW T;  4C92 G;  1VQP A;  4M75 F;  4E47 A;  4HCZ A;  4QW2 A;  2QA4 T;  4KUD K;  1Y7X A;  2EWN A;  1B34 B;  3OS5 A;  3QO3 A;  2E70 A;  3JB9 I;  3CMA A;  1Q7Y C;  1H3Z A;  1YBY A;  4HKE A;  4EMK C;  1WPY A;  4J6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...