4QQ6A

Crystal structure of tudor domain of smn1 in complex with a small organic molecule
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
QQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of tudor domain of SMN1 in complex with a small organic molecule
rcsb
molecule keywords Survival motor neuron protein
molecule tags Rna binding protein
source organism Homo sapiens
total genus 10
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2014-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4qq6A00
2P0KA 3MO8A 5KCHA 4PLLA 4E7KA 4IURA 2RJCA 2E5QA 2EFIA 3DB4A 3MEWA 3Q1JA 2EKOA 3OYGA 2JZ2A 3PMIA 2FHDA 4BDZA 5C6SA 2RI2A 5KE3A 3L2RA 2JTFA 3ASKA 1WJSA 3LLRA 2GFUA 1OYXA 1OZ3A 3PFSA 4X34A 2DAQA 4A4FA 5J26A 1G5VA 3FEOA 4Z02A 2VYTA 3P8DA 3OYBA 2LDMA 2RHIA 1WJRA 2RHXA 3SD4A 3LYIA 3C4SA 4C5EA 3META 3DLMA 3OYKA 4ZTFA 1MHNA 3OQ5A 3S6WA 3NTIA 1OI1A 4HCZA 3LGLA 1RI0A 2X4YA 3FC3A 3ZEHA 3DB3A 2CKKA 3OMGA 4GY5A 2O4XA 1WJQA 4LD6A 3NTKA 3LX7A 3QBYA 2X35A 2RO0A 4II1A 3L2VA 3UWNA 2RJDA 3OS1A 3FDRA 3MP6A 3QJ6A 5KH6A 2RI5A 2F5KA 4OVAA 2R5MA 4PL6A 4QQ6A 5IN1A 1XNIA 3OYNA 4A4GA 3EAEA 4IUPA 3L2QA 3GOXA 2MWPA 4E7JA 4C5GA 4E7IA 3OYHA 3OB9A 3MP8A 3OMCA 2EQKA 2EQMA 3BDLA 1N27A 2L8DA 4N4IA 2L89A 2XDPA 5D6YA 3OYEA 4BDYA 1WGSA 3S3NA 5C0MA 3QIIA 2GFAA 2NLUA 5J39A 3H8ZA 5M9OA 3OYCA 4E7HA 2K3YA 2RJFA 2R58A 3MEUA 3S3OA 4IUTA 2XK0A 3UT1A 4Q5WA 3E9FA 3S3MA 2LRQA 3H6ZA 2X4WA 2RHYA 4N4GA 2WACA 3MP1A 5FROA 4BACA 4C5IA 5FRMA 2R5AA 2YRVA 3L2UA 3OYIA 3MEAA 1SSFA 2RJEA 2LVMA 3FLGA 4BE1A 4PLIA 1H3ZA 2K3XA 4QVZA 4FU6A 2IG0A 2X4XA 2RI3A 3F70A 2D9TA 2QQSA 4UC4A 1KHCA 3PMTA 3OYMA 1OZ2A 2O4XB 4IUVA 3OYJA 3OA6A 3OS0A 2BIVA 2E6NA 3LH0A 2M16A 3NTHA 4QQDA 5D6WA 3OYFA 2B8AA 4N4HA 4L59A 3L42A 5CIUA 2EQJA 3ME9A 5FRNA 3OYDA 2HQXA 3PNWC 3MEVA 3OYAA 4FL6A 5D6XA 2QQRA 4CRIA 2LCCA 3OS2A 4IUQA 4IKFA 3LGFA 2PQWA 4EDUA 3OY9A 5KE2A 4BE2A 3E9GA 3QKJA 4E7LA 3P8HA 4A4EA 4C5HA 3L2WA 2DIQA 3KUFA 3O8VA 4QW2A 2GF7A 2G3RA 2L3RA 4NS5A 2M0OA 2BUDA 5IAYA 2MWOA 4A4HA 2DIGA 4BD3A 2HQEA 2RHZA 4B9WA 3CEYA 4ZTJA 2BKDN 4B9XA 2EQUA 2LTOA 4IUUA 4RG2A 5KCOA 4BE0A 2R57A 4QQGA 3OYLA 2M1HA 3M9QA 2RHUA
chains in the Genus database with same CATH superfamily
3JAME 2OTJT 3JV3A 2NYSA 1ZUYA 4C0FA 4E7KA 3JCMQ 1GBRA 2EQIA 1YCSB 3CCSA 1MNDA 2HZYA 2VGMA 5IXFA 2YRCA 4X34A 2OAUA 2OJ2A 4D8KA 1Q86R 3TU4K 2C0OA 1H641 4F17A 2M51A 2DL7A 4J9IA 1NYGA 1QP3A 2M02A 1OX9A 1YWOA 3NMZC 1M2OA 2DVEA 3CBOA 1K8AU 2FEIA 1AZGB 2MIOA 2DERA 2LQ8A 4ZNXA 1M30A 2E3IA 4EPCA 2HL3A 5HY6A 2KI7A 3VS5A 3L1AA 5GANf 4F14A 3CPWS 3QYGB 2CH4W 3EHRA 3JB9D 1AWOA 4A53A 2K7AA 1MMAA 3G7ZA 4QT7A 2FPDA 2I2LA 2VC8A 2DM1A 2PUOB 5KYWA 2COZA 2YRVA 1H8KA 2C0TA 3V8KA 2LX9A 4MMKA 3F70A 1OULA 4OB2B 1VQ4Q 3OBYA 3M4GA 3A5ZB 3ER0A 3CCLA 3CCLT 2DETA 2VXEA 1I0CA 3PNWC 1YP5A 4FL6A 2YUOA 5GAMf 4PJOC 2DEUA 2EGEA 2EWNA 5CAIA 4RTUA 2EQUA 1K9MR 1NEGA 3TSWA 4M77D 3R6NA 4BUGA 5KYWB 1IO6A 3CCRT 1AEYA 4J5YA 1B7TA 4C92C 4IURA 2KNBB 2DE0X 3DB4A 3Q1JA 5LL6S 3JCMf 4B6MA 2COWA 3TEEA 3LW5E 4BI3A 1B34A 4A4FA 1OZ3A 4OB1B 4RTTA 2F2XA 2QG9B 2X51A 2DBKA 3EGDA 4QVDA 2AIRB 1VQOT 3NTIA 3UF4A 3FJ5A 4F7UE 2DF6A 4CI0C 1RI0A 2DL3A 5DLQE 3LX7A 1BIAA 2Z0WA 3FDRA 4X9CA 2F5KA 1Q81R 1I1JA 2QEXQ 1K9AA 1OQKA 4IUPA 2CP6A 2DD4A 4JZ3A 1Q86C 3OYEA 4JS5A 1WGSA 3S3NA 4O6JA 4RTXA 2AKKA 1IREB 2FPEA 2KRSA 1VQ9A 1PC0A 1VQ9T 1LCKA 5A0GA 2CT4A 1B34B 1QMCA 1WHLA 4QKUA 3EGDB 3MEAA 3OW2S 2RJEA 5I2SA 3VS2A 3DKMA 3INZA 1EFNA 3PMTA 3CCQA 3GIBA 3CCQT 3OS0A 3X25B 1RAIB 5GAN2 2GNCA 4L59A 3M0QA 2YUPA 2BZXA 3JRZA 2JS2A 4FSXA 4L6V5 4BI8B 1Q7YU 2PQWA 4PFOA 3P8HA 3O8VA 2L3RA 6AT1B 4J9HA 1GXIE 5LJ3f 2J06A 2DIGA 2RMOA 1K73R 4ZN3A 2F2WA 2KRMA 4C8QG 1K0SA 4RTWA 2EKHA 2DX1A 1VQPQ 1WXBA 3HHTB 2DRKA 2E12A 2RI2A 1SRLA 1AWWA 2X9HA 4DOVA 4J7FA 1D0XA 1Q86U 5A0DA 5HK3A 3P8BB 4D6WA 1K9MC 5J3BA 2DKGA 3META 3OYKA 2XIDA 1YJNQ 4NL2A 2YXYA 2KGTA 2O2OA 4GY5A 1Y7XA 3I9QA 4LUEA 1BKBA 2Y90A 4JUVA 3JCMe 1SSHA 3G6EQ 4A63B 3CC7Q 4EIKA 3WXMB 2L8DA 5D6YA 2A36A 5GANd 2DTIA 2RD1A 1ABQA 4EMKC 4FT4A 3EFSA 2DJZA 4DQ2A 2K3YA 2E1HA 5GAMj 2YLCA 3V7SA 3CCVA 3E9FA 3CCVT 4RCBA 2XICA 1ZUUA 2XHCA 4KGVB 1D09B 1Q81C 4XU2A 1ACMB 4BE1A 4KH1B 3HRUA 5D7UA 2K4YA 2RI3A 4PNOA 4UC4A 5IHIA 2VKNA 3QPHA 3EG1A 2RN8A 2AZSA 5CK9A 1I4K1 3VS4A 2OTJQ 2EAYA 3REBB 2GTJA 3THKA 5GAMd 1YJWA 4JJBA 3CMEA 4M7AG 3CMET 4QW2A 3CCSQ 2GF7A 1PSFA 2HEQA 1YIJA 1RLQC 5GAOq 4ZN1A 1YIJT 2P4RA 1K9MU 2EYXA 1TXQA 1Z9ZA 3EH2A 3M9QA 5GAMg 2RB6A 1RAGB 1MNEA 2KROA 1D3BA 2AT1B 3JCMd 1AD5A 1NE8A 4CC7A 5GMKl 2K3BA 3VS6A 5LJ3e 2JTFA 3QDFA 3VS1A 3EGXA 1I8FA 1M90C 4Z02A 3PIPA 2E6ZA 3V8LA 1AHJB 4Y28E 5EG2A 2CKKA 3OMGA 2BE9B 4C0DC 2GQVA 1O75A 4M77A 4J9GA 4E47A 1IRXA 1VOMA 2O31A 4M75G 3TCJA 4JRQA 1Q81U 3QJ6A 5IXBA 5CQYA 3EG2A 2DPPB 2JS0A 2R5MA 4M7DG 2CS7A 3OYNA 2LZ6B 4E7JA 1ZSGA 2B86A 1OPLA 2EQKA 2MAMA 4N0AA 4XTWA 4M78D 2FO0A 5C0MA 1D3BB 5IHKA 2FZKB 1FMKA 1N8RU 2DMOA 3CCLQ 5GANh 2EGAA 1LVKA 1RAEB 1BBZA 4RUGA 2P4TA 2E4HA 4Q5WA 4OGEA 2LRQA 4JPBW 4N4GA 3EGXB 1Y96A 4OMLA 2JW4A 2AKLA 1JXOA 4ANJA 1UGQB 4HCCA 2FZGB 1FMVA 1YI2A 1W6XA 2PU9B 1YI2T 1WIEA 4M77B 1UJYA 3V7RA 1TOVA 5D6WA 2VXFA 2YLBA 3OYDA 2ZPBB 3JCMW 1UUEA 2LCCA 1UG1A 1PNJA 2FZCB 4LNPA 1VIEA 5LJ3d 2DTHA 2MWOA 1K73U 2PVDB 3CBMA 2VB6A 4J6YA 2I0NA 2A08A 3BFMA 4LUDA 1Y96B 4LDWA 2V1QA 4N0AC 3NGPA 4XU0A 2OTLA 3QG1A 3NFCA 2RA2A 1F1BB 2RJCA 4PKCC 1KHIA 3J81E 2OTLT 2O01E 2JZ2A 3PMIA 2IPOB 2JMCA 4HT9A 3JCMh 1WQ7A 1TU0B 2GBQA 4WF2A 1ZA2B 2WSCE 3RESA 1IGQA 1VUBA 1CKBA 1D1BA 3HRSA 2QTVA 1YJ9A 1IHWA 4L5GA 1YJ9T 4PJOG 5I11A 1W4SA 4OB0B 1VQ9Q 2QQBA 3NTKA 3URGA 2RJDA 4M4ZA 1S72Q 1VQMA 4J83A 1KC8C 1VQMT 4LXCA 3ZBDA 4OMMA 2KXDA 3L2QA 1WHHA 3JB9I 1V29B 3WVDB 2P0PA 2KVQG 4C0GA 5GMKh 3X26B 5GAN5 1QVGS 1D1AA 1UGVA 4M78E 2R5AA 3OBWA 3FLGA 1JJ2P 4PLIA 3CCEQ 3EG3A 2DRMA 3OYMA 1NG2A 1WQWA 1GCQC 4M75A 1HK9A 3UATA 2KT1A 1VQ6A 2RQTA 1GCPA 9ATCB 4LDYA 4E7LA 4BE2A 4IKFA 3M0RA 2CP0A 2ZCFB 4LD9K 2CP5A 4KUDK 2MF2A 2RHZA 2H8HA 1HXDA 5CO7A 5LJ3h 1YHQQ 1VYVA 2X4JA 2M1HA 5CR2A 2L2PA 1X01A 4FT2A 1K76A 3JB9F 1WPYA 3QJYA 2QDYB 2K57A 2KK4A 5C6SA 3H9NA 4RTYA 4E2FB 1TWBA 5I21A 4HT8A 4M75B 2HSEB 1T3LA 1NPRA 4D8DA 2EVRA 2LDMA 2RHXA 2HBWA 1YFNA 1YWPA 2EYQA 2X35A 3M54A 1OU9A 4MZTA 3CPFA 3L2VA 2GGRA 1LOJA 2QTXA 3MKDA 3OYHA 3OB9A 5CIUA 4BY6C 1WDXA 2KAFA 2EJGA 4LE9A 1W2BS 5FU6B 2DA9A 2JUFA 1TUGB 2CP2A 1J3TA 2K2VA 4M77F 1SHGA 2J7IA 2QDLA 1KQSS 2JNGA 4XTVA 2CZ0B 1YJWQ 3VKIA 4R0KA 3CMEQ 3HP9A 1UB4A 1IZ6A 4OMPA 4OF1A 2EW3A 2ECZA 4ORZA 3OA6A 4QQDA 1PHTA 3WVEB 2L3QA 4DBHA 2CZ7B 4M78A 4NL3A 4RKUE 2FRWA 2LX7A 3TVTA 5HKCA 2QQAA 3I56T 1Y71A 2ROLA 1VQNA 1WHKA 1VQNT 4KULA 1U8RA 1K0XA 2BZYA 3FJPA 4A4KA 4ZTJA 3M56A 2MK5A 1UEBA 4ZGJB 3A8MB 3H0FA 5KCHA 2KYMA 5FLXE 4XU1A 2X3XD 1H3HA 1YCYA 2W10A 3E2UA 4MMLA 2CSIA 4JZ4A 4J9CA 1OOTA 4BDZA 2L3SA 3QWYA 2MCNA 2LNHB 5KE3A 1UE9A 4XTUA 3LLRA 1Y07A 4O5VA 1FX7A 4M78B 4OMQA 2K5LA 4VUBA 1H92A 1SPKA 3VUBA 3FIFA 4EMGA 3CCRA 1G3TA 4WCIA 4XU3A 3QXEB 2JVVA 3QO3A 5EC7A 1RUWA 2JN0A 1Y57A 1IB8A 4OVAA 5IN1A 4C8QD 1DJ7B 2EGCA 1YI2Q 1GFCA 2JT4A 2KRNA 3L2ZA 1VQOA 3SB2A 1V1CA 1QVFS 1VQKA 1VQKT 3GP8A 2V8KA 5GAN7 5DY9A 2K3XA 2X4XA 2O9SA 1PSEA 1XJWB 4FYWB 4LDXA 3A1PA 1M9SA 3VJPA 4IUVA 3RDVA 1HD3A 2LCSA 1T0HA 2ZPFB 5GAN6 2HQXA 5D6XA 3V8JA 5I2MA 3EHQA 2OTLQ 3A8GB 3HKSA 1SHFA 3M5AA 2FL7A 4AT1B 2FYKA 4KRTA 1VYUA 4B9WA 2BKDN 2LC4A 1N6AA 4QQGA 2VUBA 3E1SA 2DD5A 2JM9A 5I22A 1YJ9Q 3UDCA 2EJFA 2LCLA 1OEBA 3HFOA 1QQJA 1MMDA 5KYUA 1VQMQ 2JJ9A 3HFNA 4KGXB 2CREA 2VYTA 1M90R 1C6VX 2M9UA 2CZ6B 4M7AD 4JJNK 4E7ZA 2Y4XA 1UHFA 1UFFA 3X20B 4OMFB 4M77E 4HCBA 4FYYB 5GANj 2QXFA 1RLPC 4XQ3A 2P84A 2FG0A 2RK2A 1QW1A 1X75C 2CYZB 3MEUA 2HL5C 3NPFA 5KYUB 2Y4YA 2HBPA 1NM7A 4AG1C 1VQ7T 2NUPB 1PWTA 4ESRA 1VQ6Q 2WACA 2FB7A 1GFDA 1K1ZA 2CP3A 4DEYA 2ATCB 3FRNA 1JXMA 3HTRA 2V8JA 3KFVA 1WFWA 4HKEA 4OMOA 3H41A 3CC2A 3CC2T 1XOVA 5GJVB 4M75D 4XTZA 2B8AA 3L42A 2J6KA 3KXTA 4M7DD 3SDZA 1WXTA 4IIOA 4E6RA 1VQ5A 1VQ5T 4AFSC 3QKJA 3G1JA 4KT0E 4C5HA 4DBFA 4WTOB 3JCMP 2KBTA 3CQTA 3RKWA 1BI3A 2XI9A 3ULRB 5GANg 2RF0A 4J9FA 3RR6A 1X69A 1V76A 5HCKA 2LTOA 2D0QB 4XAXB 5DLOA 2KXCA 2FVUA 2KEAA 3MO8A 2IVWA 4M78F 2A3LA 2LT1A 5CKBA 4C0ZA 1SF9A 2QGFB 1PD0A 2NUTA 3OYGA 2DO3A 2EKOA 2OAWA 4JJDA 1JEGA 3L2RA 1KK7A 2LJ1A 1OYXA 4GLKA 2BE7D 2K5FA 2LQNA 2COYA 4R55A 4ZTFA 1XQHA 1M27C 2X4YA 4FIBA 1XTDA 1AOJA 4J6XA 4ELYC 3UWNA 1AWJA 4HXJA 2DL4A 2OI3A 1KC8R 4M7AE 5KYXA 2VASA 3GOXA 1RABB 2AHJB 5GMKj 1Q95G 5FWCA 1NPPA 4R56A 5J39A 2NUTB 3JB9J 3JCMg 2QYZA 4RTVA 1UECA 1VYTA 2RM4A 4FSSA 4PJMA 5FRMA 1I5LA 4JS4A 2HKNA 1NZ9A 2V8IA 5LJ5e 1BYMA 2ZAEA 1FWZA 2RQUA 2EYZA 3UA7A 1VQ4T 4PJOD 4C8QA 1OZ2A 2K9GA 1OV3A 1LJOA 2MMPA 3ME9A 1VA7A 4ZGDB 3RMSA 3R6OA 3MEVA 5KYXB 2GTOA 1CKAA 1E6GA 2EYYA 5LJ3j 4DEXA 1X2QA 4M75E 1AWXA 2YSQA 4Z88A 4NS5A 3NHNA 1NJIC 4M7DE 1RI9A 4ELZC 2JMAA 4RG8A 4NOYA 2RQWA 3ZFJA 2DFUA 4K11A 4BE0A 2LQWA 2O88A 3AT1B 1G2BA 3CCRQ 4JRKA 2KE9A 2E5QA 5GJWB 1BI1A 1D0YA 4C8QB 3CXCS 1ZBJA 2DK3A 1WI7A 3PFSA 4M77C 1M90U 3GNGA 3VUZA 2FRYA 1U5SA 3SWNA 2QA4A 2QA4T 5IH2A 1VQOQ 3MJXA 2J6FA 3EFRA 2LT4A 2BZ8A 5GAOm 4HVUA 1NEBA 2QQ9A 1VQKQ 5LJ3g 1ZBXA 4AFQC 2LJ3A 4PJNA 5KYYA 1ZHIA 4OP0A 2ZPEB 3QZ9B 2ENMA 3E19A 1UHCA 3HRTA 3JCMX 3H8ZA 2RJFA 1RACB 1LNXA 1Q82C 2PUKB 2BTTA 4M7AA 2XG8D 2KMTA 2X4WA 5FU7B 5FROA 2E65A 1O9SA 2EYWA 4C5IA 4A54A 1MUZA 3EFOA 4FU6A 3SWNB 3EG0A 3M58A 2YHTA 1B07A 1TUCA 1QCFA 1Y0MA 3GBQA 2E10A 3CCQQ 2NWMA 3OYFA 4C92G 3PIOA 5FRNA 5FU7C 1U1SA 5KYYB 5CKDA 4DBQA 2JTMA 5GAN4 5GAOr 1AT1B 3VS0A 2VV5A 3I5SA 2W0ZA 2ABLA 5IAYA 2RK1A 1U06A 3A98A 1TTHB 4IUUA 4M7AB 1VIFA 3G4SA 2CH4A 1UGPB 3G4ST 4JRPA 3NTHA 1MGQA 2EJ9A 4DBRA 1E7OA 2XDDA 1PD1A 1HYOA 1JJ2A 3PT9A 3EFOB 4M7DA 4PJJA 1G3WA 2JOYA 4FW1A 2WSEE 4X9DA 3BDUA 1ZSZA 2DBMA 1WJSA 3RIRA 4M7AC 2GFUA 3GPLA 3FEOA 1T0JA 2E3HA 2VWFA 2P0QA 2RHIA 4OB3B 1YJNA 3LYIA 1YJNT 1W2BP 1OI1A 1NBEB 2V1RA 2D0NA 2O4XA 2LJ0A 2DZCA 1KQSP 1KD1R 1JU5C 5KH6A 1KC8U 1K8AC 4J6WA 1VQLA 1UDLA 1VQLT 1I5OB 1XNIA 2RQVA 3TQ7P 2HAXA 1SRMA 3SFMA 1RAHB 4PK4A 3OMCA 1SEMA 3BDLA 2NUZA 5LJ5h 3CC2Q 1KQSA 2KR3A 3QIIA 1R0BG 4M7DB 3CPWP 2SRCA 1SKUB 2JTEA 1MMNA 1ZSZB 4FM4B 2XD0A 4LDVA 1VQ5Q 3QZ5B 3OYIA 3CCVQ 1WNLA 2M0YA 4M75C 1T3SA 3CPWA 2DL5A 4XK8E 1R0CB 1WZOA 2D9TA 2X3WD 2H3JA 4M7DC 2O4XB 3HL8A 3LH0A 1BI0A 1C0MA 1KIKA 3CCJA 2DXTA 1OU8A 3CCJT 3LGFA 3CCST 1ZA1B 5A0LA 3L2WA 4AG2C 4HCKA 4KUIA 2M0OA 2D6FA 1QCNA 4TVRA 1M8MA 2K6DA 1YIJQ 4C8QF 4B9XA 5FU6C 1GRIA 2KSSA 2R57A 4PJOA 3C95A 2P0KA 1YITA 1YITT 4Y91A 2XU8A 3IQLA 3MEWA 3CCUA 2CSQA 3CCUT 3I56A 1X2KA 1U3OA 4KGZB 2E5KA 3QWXX 1W70A 3C94A 4C92A 2QGGA 1PRLC 3KBGA 3OQ5A 3S6WA 1QWFA 2F5TX 3GF5A 1SG5A 1JB0E 1QVFP 2IIMA 2QAZA 1U1TA 5GAOp 4II1A 4OGCA 3M0TA 3PVLA 4PJOB 2MWPA 4RTZA 2EQMA 1N27A 1KJWA 2PNIA 1QVFA 2XDPA 5GAN8 7AT1B 3M0UA 2NLUA 2KY9A 3VV0A 5M9OA 3OYCA 1TSFA 3S3OA 1KG1A 3VU3C 1BCOA 3BE3A 2OX7A 1KD1C 4J7IA 2MI6A 4FCYA 2ED0A 4JJCA 2ZGWA 4C92B 1S1NA 2KDSA 2D8JA 4XTYA 3OW2P 2C0IA 4M78C 2V26A 2EPDA 2IG0A 4Z8AA 1LPLA 2WSFE 2QQSA 1KHCA 2YWWA 1NLPC 5GMKi 3LWIA 1MMGA 4F7UG 4GLMA 3N5BB 4JLIA 1E6HA 2AK5A 3OW2A 2JXBA 1X6GA 2HKQB 4EMHA 2YUNA 4FYVB 2A37A 3OYAA 4M7AF 3RMQA 4CRIA 1BK2A 1Q7YC 3RKXA 3RUXA 2DIQA 2LNVA 1G8XA 2DNUA 3EGUA 4BD3A 2RH2A 1WX6A 1ZUKA 5KCOA 1WHMA 3OYLA 3MCAB 1IGUA 2QA4Q 3UA6A 1G83A 2KT8A 3RNJA 1BU1A 5L8RE 3JB9G 2DYIA 2HQHA 3JCMV 3CBPA 3A8HB 2F2VA 1RAFB 1FYNA 2CUDA 3OYBA 2CT3A 1QP2A 3C12A 3CCMA 3CCMT 2H3EB 4IIMA 2HSPA 3HPWA 4V2SA 4FYXB 1N8RR 4M75F 1VQ8A 1VQ8T 2K2MA 1KD1U 4Y92A 1G3YA 1S72A 1S72T 1PG5B 2JM8A 4M7DF 1X6OA 1M3AA 3C0CA 4QQ6A 2ZZDA 2E64A 3EAEA 2KQWA 1UJ0A 2NUPA 2DL8A 3G71A 1JRIA 5GANe 3G71T 2DTOA 5CKEA 4DOWA 2RQRA 1Z9QA 3LH5A 2ZPGB 5DM7R 2D1XA 3M59A 4AFZC 3JCMb 3QSUA 1A0NB 1GL5A 1G3SA 3VRYA 4JDSA 2XMFA 3MP1A 1RL2A 2QASA 4M77G 4EMKA 3L2UA 3CCEA 3CCET 2MYSA 1M3CA 5LJ5f 3GLXA 1QKWA 4J9EA 1FXXA 4F04B 4HA8A 3G4SQ 4MZPA 2F1LA 4C8QE 5GAMe 2DXCA 1VQ7A 2LQKA 3M55A 3I5RA 2SEMA 1PRMC 3OS2A 4IUQA 4BB7A 1ARKA 3M57A 4ME7A 2K5IA 1BB9A 5CKHA 3VRZA 2BUDA 2CZ1B 1NJIR 1ZLMA 1M1GA 1EIFA 5HK0A 3CC4A 3CC4T 5GMKm 5GAN3 3M53A 3PTAA 4EMKB 4PFPA 3X24B 5L23A 2DVJA 3CMAA 1B3QA 2VGNA 3CD6A 3CMAT 3CD6T 3I55A 2VVKA 1YNZA 3I55T 2ZPHB 3BY7A 1VQLQ 4F7UA 1M4ZA 1WHGA 2DAQA 1UGSB 1JBMA 5J26A 1G5VA 2LP5A 3V7CA 1YHQA 4PJOF 4ZGEB 1YHQT 2HDAA 3ZEHA 3DB3A 1EX4A 1WJQA 3OSVA 1PKSA 2GQIA 2HCKA 3ZL7C 2E41A 2L0AA 1TS9A 3HSBA 5CQXA 3A8OB 1P92A 3QHSA 4PL6A 1RADB 2DZ9A 2K79A 5IT9E 3T9NA 1QWEA 3DLLA 1M1KR 3RERA 1HSQA 3MP8A 3LWHA 4C92F 2DJQA 2L89A 1YN8A 2DLPA 4HVVA 2PVGB 1YBYA 5GMKe 4E7HA 1BCMA 3UPUA 1FMWA 1N8RC 4IUTA 2XK0A 1Q82R 4DA4A 4F7UB 3S3MA 4J9BA 3H6ZA 1NYFA 1YJWT 4BACA 3CCJQ 3SHWA 4HVWA 5FW9A 4RMOA 2LVMA 2E70A 1HJDA 1D1CA 2MOXA 1AVZC 4GBQA 3OYJA 2ROTA 2O9VA 2C06A 3JCMJ 3VS7A 4Z89A 4AMCA 1K4US 1YITQ 2DXBA 1EZZB 4C0DB 2CDTA 3OY9A 3E9GA 3OSSC 1KQ1A 1WA7A 3CCUQ 3AHUA 3CXCP 2XKOC 3JSCA 2G3RA 3I56Q 4PJLA 1VQNQ 4KBMB 1VQ4A 3TREA 1K73C 4RG2A 4ATOA 2XDBA 1WYXA 3JCMc 4A4EA 3EG9A 1D0ZA 2MPXC 3CXCA 4PLLA 1PM3A 5CKFA 4YTLA 1PKTA 5ECAA 3MPUB 1M5Q1 1MV0B 2EFIA 1TH7A 2PZ1A 3OS5A 1IHVA 1TG0A 1N5ZA 1N9RA 2DXUA 4C92D 2QK0A 1UTIA 2RPNA 4CC2A 1X43A 1TUDA 4MDXA 3EH1A 1WJRA 3SD4A 3DLMA 1MHNA 4HCZA 5AT1B 1ZX6A 1ABOA 2PTKA 3VYGA 3PGGA 2HD0A 2F69A 3J80E 5LJ5j 3OS1A 3MP6A 2J05A 2RI5A 1K8AR 4CC4B 4OMNA 3M0SA 5FWBA 4JRIA 4MDWA 4C5GA 3EG9B 4J8OA 3JB9H 2ED1A 4N4IA 1X6BA 4QVCA 2EBPA 1M2VA 3H0HA 1I07A 3QYHB 3TSZA 2R58A 1QVPA 1QCOA 1R8OB 3UT1A 4FW2A 1JO8A 4PFZA 4C8QC 2PVOB 1QVGP 2RHYA 2GCXA 2QEXA 2QEXT 5GAMh 1UGRB 3RKYA 1H3ZA 5LJ5d 4QVZA 2YRDA 2RNAA 1M1KC 1CSKA 2A28A 1RAAB 2A0FB 1JQQA 2YUQA 1QVGA 2BIVA 2E6NA 2M16A 4N4HA 1W1FA 2EQJA 4F16A 1KQ2A 4LN2A 3GNFB 1R77A 1KFZA 2QQRA 3SEMA 4EDUA 5LJ5g 1M3BA 1OPKA 2DEQA 1M2VB 3MHXA 1GCQA 1NJIU 3D7SB 3PVQA 5KYNA 2HQEA 2L5QA 5AYFA 3OYYA 3CCMQ 4E7SA 3CEYA 1AZEA 1M1FA 1BI2A 5A2QE 4AFUC 2YDLA 1N9SA 2DYBA 2HMAA 1VQ8Q 4M78G 2L3PA 5CCAA 4PJOE 2EIFA 1WXUA 2FHDA 3SWNC 3O5ZA 3ASKA 2CGHA 1PCXA 8ATCB 3P8DA 2ESWA 3G71Q 2D8HA 3X28B 3C4SA 4C5EA 2YT6A 3PE0A 2KYBA 3LGLA 3FC3A 4C92E 4P5NA 1X27A 1VQPA 4RCCA 1VQPT 2ZPIB 4LD6A 4MZMA 3QBYA 2RO0A 4XTXA 1WHJA 2LMJA 4A4GA 1M1KU 2A7YA 4F7UF 4E7IA 3FB9A 5GAOl 1OX8A 4LDUA 2CP7A 4BDYA 1WLPB 2GFAA 4JLGA 1C1AA 1QKXA 4CC3A 1IXDA 1Q82U 4J9DA 3QUIA 3J7AF 1M8VA 3G6EA 1VQ6T 3G6ET 4X1VA 3QDRB 3REAB 3A8LB 1VQ7Q 3U23A 2J6OA 3CC7A 3CC7T 1SSFA 2QI2A 1W2BA 5CVIA 4BI4A 1MV3A 2DILA 1BIBA 3VS3A 3CC4Q 1KSWA 5IHNA 2AZVA 2CUBA 3VYHB 1I81A 5KE2A 3BW1A 3RBBB 3M0PA 1Q7YR 8AT1B 3CMAQ 3CD6Q 3KUFA 1NLOC 3I35A 3I55Q 1JJ2S 1ZQ1A 2FPFA 4A4HA 5GAOn 3M4YA 4KH0B 1GBQA 3H0IA 1QLYA 4BY6B 2HNIA 1ZSZC 2G6FX 2RHUA 2OTJA
chains in the Genus database with same CATH topology
3JAME 3MO8A 2IVWA 4M78F 2A3LA 2LT1A 5CKBA 2OTJT 4C0ZA 4N0AC 4C0FA 4E7KA 4XU0A 2OTLA 3QG1A 3NFCA 2RA2A 2RJCA 3JCMQ 4PKCC 1KHIA 3J81E 2OTLT 2O01E 5L8RE 2DO3A 2EKOA 3OYGA 3CCSA 3JB9G 2JZ2A 3PMIA 3JCMV 3CBPA 3A8HB 4HT9A 3L2RA 3JCMh 2VGMA 1WQ7A 1OYXA 4X34A 4WF2A 2OAUA 4GLKA 2WSCE 3RESA 3TU4K 2K5FA 3OYBA 1VUBA 1QP2A 3C12A 3CCMA 1H641 3CCMT 3HRSA 4R55A 4ZTFA 4M7DB 1XQHA 3HPWA 1QP3A 4V2SA 2X4YA 1YJ9A 4M75F 4FIBA 1VQ8A 1XTDA 4L5GA 4PJOG 1YJ9T 1VQ8T 4J6XA 4ELYC 1KD1U 1W4SA 4OB0B 2QQBA 3NTKA 1S72A 1G3YA 3URGA 2DVEA 3CBOA 1S72T 3UWNA 2RJDA 4M7DF 1K8AU 1X6OA 1VQMA 4J83A 1KC8C 4QQ6A 1VQMT 4M7AE 2ZZDA 2E64A 3EAEA 2KQWA 3ZBDA 3GOXA 3L2QA 3G71A 2AHJB 2LQ8A 1JRIA 5GANe 3G71T 4EPCA 5GMKj 2DTOA 5HY6A 1NPPA 5CKEA 4DOWA 5GANf 3L1AA 4R56A 3CPWS 3QYGB 5J39A 2ZPGB 3JB9D 5DM7R 3M59A 3JB9J 3JB9I 1V29B 4A53A 3JCMb 3JCMg 3QSUA 1G3SA 3G7ZA 2P0PA 3WVDB 4JDSA 2KVQG 4C0GA 2RM4A 2I2LA 2VC8A 3X26B 5GMKh 5GAN5 1QVGS 2PUOB 3MP1A 1RL2A 5FRMA 4M77G 1Y96B 2R5AA 2YRVA 4M78E 4EMKA 3L2UA 4JS4A 1I5LA 3CCEA 3OBWA 3CCET 1NZ9A 2V8IA 3FLGA 5LJ5e 1BYMA 1FWZA 4PLIA 3V8KA 2LX9A 4MMKA 5LJ5f 1VQ4T 3F70A 4PJOD 3GLXA 4C8QA 3OYMA 1OZ2A 4OB2B 3OBYA 3M4GA 1FXXA 1WQWA 3A5ZB 3ER0A 3CCLA 3CCLT 4HA8A 1LJOA 2MMPA 3ME9A 4M75A 4MZPA 1HK9A 2VXEA 4ZGDB 3RMSA 3R6OA 3PNWC 3MEVA 4C8QE 1VQ6A 5GAMe 2DXCA 4FL6A 2LQKA 1VQ7A 3M55A 3OS2A 4IUQA 4BB7A 4LDYA 4E7LA 4BE2A 4IKFA 5LJ3j 5GAMf 3M57A 4PJOC 4M75E 2ZCFB 4ME7A 2K5IA 4LD9K 2EWNA 4NS5A 4KUDK 5CKHA 2BUDA 2CZ1B 1NJIC 2MF2A 4ELZC 5CAIA 4M7DE 1M1GA 1EIFA 2RHZA 4RG8A 5HK0A 4NOYA 3CC4T 3CC4A 3ZFJA 1HXDA 2EQUA 5CO7A 5LJ3h 4BE0A 5GMKm 5GAN3 2X4JA 3M53A 4M77D 3PTAA 2M1HA 4BUGA 5CR2A 4EMKB 3CCRT 4J5YA 3X24B 4JRKA 1X01A 4FT2A 4C92C 3JB9F 4IURA 1WPYA 2E5QA 3CMAA 2VGNA 3QJYA 3DB4A 3Q1JA 5LL6S 2QDYB 3JCMf 3CMAT 3CD6A 1BI1A 3I55A 3CD6T 2K57A 2KK4A 4C8QB 5C6SA 3I55T 3TEEA 2ZPHB 3LW5E 3CXCS 3BY7A 4BI3A 4F7UA 1M4ZA 2DK3A 1B34A 4A4FA 1OZ3A 3PFSA 4M77C 4OB1B 2DAQA 5I21A 4M75B 1M90U 1UGSB 4HT8A 1NPRA 1JBMA 5J26A 1G5VA 2LDMA 2RHXA 3GNGA 3VUZA 4QVDA 3V7CA 1YHQA 4PJOF 4ZGEB 1YHQT 1VQOT 3NTIA 4F7UE 3SWNA 2QA4A 4CI0C 2QA4T 1RI0A 3ZEHA 3DB3A 3EFRA 5DLQE 2LT4A 2EYQA 1WJQA 3OSVA 5GAOm 3LX7A 2E41A 2X35A 3M54A 4MZTA 1BIAA 3CPFA 2QQ9A 3L2VA 3HSBA 3FDRA 4X9CA 5CQXA 5LJ3g 3A8OB 1ZBXA 2F5KA 1P92A 1ZHIA 3QHSA 4OP0A 3MCAB 2ZPEB 4PL6A 1LOJA 2DZ9A 2QTXA 5IT9E 3T9NA 4IUPA 3QZ9B 3DLLA 3RERA 2DD4A 3OYHA 3OB9A 3MP8A 5CIUA 4BY6C 3LWHA 4C92F 1Q86C 2L89A 3OYEA 4JS5A 3E19A 1WGSA 2KAFA 3S3NA 2PVGB 4O6JA 1YBYA 5GMKe 2EJGA 3HRTA 3JCMX 3H8ZA 4E7HA 1W2BS 2RJFA 3UPUA 5FU6B 1N8RC 1IREB 2JUFA 1LNXA 1Q82C 4IUTA 1VQ9A 2PUKB 2XK0A 1VQ9T 2K2VA 4M77F 4M7AA 4DA4A 5A0GA 4F7UB 2XG8D 3S3MA 1KQSS 1B34B 2JNGA 3H6ZA 2KMTA 4XTVA 2X4WA 5FU7B 5FROA 4BACA 2E65A 1YJWT 1O9SA 4C5IA 2CZ0B 3VKIA 3MEAA 3OW2S 3HP9A 2RJEA 4RMOA 2LVMA 4A54A 1UB4A 1IZ6A 5I2SA 2E70A 3DKMA 4FU6A 3SWNB 4OF1A 3INZA 3M58A 3CCQA 2YHTA 3PMTA 3GIBA 3CCQT 3OYJA 3OA6A 3OS0A 3X25B 2E10A 4QQDA 3OYFA 3JCMJ 5GAN2 2C06A 3WVEB 4L59A 4C92G 2CZ7B 3PIOA 4M78A 5FRNA 4NL3A 3JRZA 1U1SA 4RKUE 5FU7C 4FSXA 4L6V5 2DXBA 4BI8B 5CKDA 5GAN4 2JTMA 4C0DB 5GAOr 1Q7YU 2PQWA 3OY9A 5HKCA 3E9GA 2VV5A 3OSSC 1KQ1A 3P8HA 2QQAA 3I56T 1Y71A 1VQNA 3AHUA 2XKOC 3JSCA 3O8VA 2G3RA 2L3RA 1VQNT 1GXIE 4KULA 1U8RA 5IAYA 2RK1A 4KBMB 5LJ3f 2DIGA 1VQ4A 3FJPA 3TREA 4A4KA 4ZTJA 1K73C 3M56A 1UEBA 4IUUA 4RG2A 4M7AB 1VIFA 4ZN3A 4ZGJB 3G4SA 4ATOA 3A8MB 2XDBA 1UGPB 3G4ST 4JRPA 3NTHA 3JCMc 1MGQA 2EJ9A 4A4EA 4C8QG 2XDDA 5KCHA 3CXCA 4PLLA 5CKFA 4YTLA 5FLXE 1JJ2A 4XU1A 1YCYA 3PT9A 1M5Q1 4M7DA 4MMLA 2EFIA 1G3WA 1TH7A 3HHTB 3OS5A 2E12A 2JOYA 4BDZA 2WSEE 4X9DA 3BDUA 1N9RA 2DXUA 2RI2A 5KE3A 4DOVA 4C92D 4XTUA 4J7FA 1WJSA 3RIRA 3LLRA 2GFUA 1Y07A 4O5VA 1Q86U 4M7AC 1FX7A 4M78B 5A0DA 5HK3A 3GPLA 3FEOA 3P8BB 4MDXA 2K5LA 4VUBA 4D6WA 2P0QA 2RHIA 1WJRA 4OB3B 3SD4A 3LYIA 3VUBA 1YJNA 5J3BA 2DKGA 3DLMA 3META 3OYKA 1MHNA 1YJNT 1K9MC 3FIFA 4EMGA 1OI1A 4HCZA 2XIDA 3CCRA 1G3TA 4NL2A 4GY5A 2O4XA 4XU3A 1Y7XA 3VYGA 3PGGA 2HD0A 2F69A 1BKBA 2JVVA 2DZCA 2Y90A 3QO3A 3QXEB 4JUVA 3JCMe 3J80E 5LJ5j 3OS1A 3MP6A 5KH6A 1KC8U 1K8AC 2JN0A 2RI5A 4J6WA 1VQLA 4OVAA 5IN1A 1VQLT 1XNIA 4C8QD 2HAXA 3WXMB 4JRIA 3SFMA 1DJ7B 4MDWA 4C5GA 3OMCA 4J8OA 3JB9H 3BDLA 4N4IA 2L8DA 5D6YA 4QVCA 5LJ5h 2DTIA 5GANd 1KQSA 2RD1A 4EMKC 3QIIA 3L2ZA 4FT4A 3QYHB 3EFSA 2DJZA 4DQ2A 2K3YA 1VQOA 2E1HA 2R58A 5GAMj 3SB2A 2YLCA 1QVPA 3V7SA 1QVFS 1R8OB 3UT1A 4FM4B 3CCVA 3E9FA 4C8QC 1VQKA 2XD0A 2PVOB 4LDVA 3CCVT 4RCBA 2RHYA 2XICA 1VQKT 2GCXA 2XHCA 3QZ5B 2QEXA 3OYIA 3GP8A 2QEXT 1WNLA 1Q81C 5GAMh 4XU2A 4M75C 2V8KA 5GAN7 3CPWA 4BE1A 1UGRB 3HRUA 5DY9A 3RKYA 5LJ5d 2K3XA 4QVZA 4XK8E 1H3ZA 2X4XA 1M1KC 2K4YA 2RI3A 2D9TA 1PSEA 4M7DC 4PNOA 2H3JA 4UC4A 4LDXA 1M9SA 2O4XB 3VJPA 4IUVA 3QPHA 3HL8A 1QVGA 2BIVA 2E6NA 3LH0A 2M16A 1BI0A 4N4HA 2EQJA 5CK9A 1KQ2A 1I4K1 2ZPFB 5GAN6 3GNFB 2HQXA 2EAYA 5D6XA 2QQRA 2DXTA 3CCJA 3CCJT 5GAMd 1YJWA 3V8JA 3LGFA 5I2MA 4EDUA 5LJ5g 3CMEA 3CCST 3CMET 4M7AG 3A8GB 5A0LA 3L2WA 2DEQA 3HKSA 3M5AA 2FL7A 3MHXA 4QW2A 2FYKA 2GF7A 1PSFA 4KUIA 1NJIU 2M0OA 2D6FA 1YIJA 5GAOq 4ZN1A 1YIJT 4TVRA 2HQEA 4B9WA 1K9MU 2BKDN 2LC4A 4C8QF 4B9XA 2L5QA 5FU6C 1N6AA 2KSSA 2R57A 3OYYA 4QQGA 5AYFA 2VUBA 4PJOA 3C95A 2OTJA 3M9QA 3CEYA 1M1FA 2P0KA 2DD5A 3E1SA 1BI2A 2RB6A 5GAMg 5A2QE 1YITT 1YITA 1N9SA 1D3BA 3UDCA 4M78G 2EJFA 2LCLA 2XU8A 4Y91A 3JCMd 3HFOA 5CCAA 4PJOE 3MEWA 2EIFA 3CCUA 1NE8A 3CCUT 2FHDA 5GMKl 3I56A 3SWNC 5LJ3e 2JTFA 3ASKA 2CGHA 3HFNA 3C94A 1I8FA 4C92A 1M90C 4Z02A 2VYTA 3P8DA 3PIPA 2M9UA 2E6ZA 3X28B 3C4SA 4C5EA 3KBGA 3V8LA 2CZ6B 3OQ5A 3S6WA 1AHJB 4M7AD 2F5TX 3LGLA 4JJNK 3GF5A 4Y28E 3FC3A 5EG2A 2CKKA 3OMGA 4P5NA 4C0DC 4C92E 1JB0E 1O75A 2GQVA 4M77A 4E47A 1VQPA 4RCCA 1VQPT 2ZPIB 4LD6A 1U1TA 4MZMA 3QBYA 5GAOp 2RO0A 4II1A 4M75G 3TCJA 4JRQA 2Y4XA 3QJ6A 4XTXA 1Q81U 4OGCA 5CQYA 2DPPB 3X20B 2R5MA 4M7DG 2CS7A 4OMFB 3OYNA 4A4GA 1M1KU 4M77E 4HCBA 5GANj 4PJOB 2A7YA 2QXFA 4F7UF 4XQ3A 4E7IA 2MWPA 4E7JA 2RK2A 2EQKA 2EQMA 3FB9A 1N27A 5GAOl 2MAMA 4LDUA 2XDPA 4N0AA 5GAN8 1QVFA 4XTWA 4BDYA 1QW1A 1X75C 4M78D 5C0MA 1D3BB 2GFAA 2KY9A 2NLUA 2CYZB 4JLGA 3VV0A 5M9OA 3OYCA 1N8RU 3MEUA 3S3OA 1Q82U 3QUIA 5GANh 3J7AF 1KG1A 3VU3C 1M8VA 2Y4YA 2P4TA 3G6EA 1VQ6T 2HBPA 4Q5WA 1VQ7T 4OGEA 3G6ET 2LRQA 3QDRB 1KD1C 4J7IA 2MI6A 3A8LB 4N4GA 2WACA 1Y96A 2FB7A 2ZGWA 4C92B 3CC7A 2KDSA 3CC7T 1SSFA 1UGQB 3FRNA 4XTYA 4HCCA 4M78C 2V8JA 2QI2A 1W2BA 4HKEA 2IG0A 5CVIA 4BI4A 3CC2A 2WSFE 2QQSA 1YI2A 3CC2T 1KHCA 1XOVA 1BIBA 2PU9B 1YI2T 5GMKi 4M77B 3LWIA 4M75D 4F7UG 3V7RA 5D6WA 2VXFA 4XTZA 2B8AA 3N5BB 2YLBA 3L42A 4JLIA 3KXTA 3OYDA 4M7DD 3SDZA 3OW2A 2ZPBB 4EMHA 3OYAA 4M7AF 1VQ5A 3RMQA 4CRIA 3JCMW 1VQ5T 2LCCA 3VYHB 1I81A 5KE2A 1Q7YC 3BW1A 3QKJA 4KT0E 3RKXA 3RUXA 4C5HA 2DIQA 2LNVA 3KUFA 3JCMP 3RKWA 1JJ2S 1BI3A 1VIEA 1ZQ1A 2XI9A 5LJ3d 5GANg 2DTHA 2MWOA 4A4HA 1K73U 2PVDB 4BD3A 2RH2A 3CBMA 3M4YA 5GAOn 4J6YA 2LTOA 5KCOA 2D0QB 4XAXB 4BY6B 2HNIA 3OYLA 3BFMA 5DLOA 2RHUA 4LDWA 2FVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0K A;  3MO8 A;  5KCH A;  4PLL A;  4E7K A;  4IUR A;  2RJC A;  2E5Q A;  2EFI A;  3DB4 A;  3MEW A;  3Q1J A;  2EKO A;  3OYG A;  2JZ2 A;  3PMI A;  2FHD A;  4BDZ A;  5C6S A;  2RI2 A;  5KE3 A;  3L2R A;  2JTF A;  3ASK A;  1WJS A;  3LLR A;  2GFU A;  1OYX A;  1OZ3 A;  3PFS A;  4X34 A;  2DAQ A;  4A4F A;  5J26 A;  1G5V A;  3FEO A;  4Z02 A;  2VYT A;  3P8D A;  3OYB A;  2LDM A;  2RHI A;  1WJR A;  2RHX A;  3SD4 A;  3LYI A;  3C4S A;  4C5E A;  3MET A;  3DLM A;  3OYK A;  4ZTF A;  1MHN A;  3OQ5 A;  3S6W A;  3NTI A;  1OI1 A;  4HCZ A;  3LGL A;  1RI0 A;  2X4Y A;  3FC3 A;  3ZEH A;  3DB3 A;  2CKK A;  3OMG A;  4GY5 A;  2O4X A;  1WJQ A;  4LD6 A;  3NTK A;  3LX7 A;  3QBY A;  2X35 A;  2RO0 A;  4II1 A;  3L2V A;  3UWN A;  2RJD A;  3OS1 A;  3FDR A;  3MP6 A;  3QJ6 A;  5KH6 A;  2RI5 A;  2F5K A;  4OVA A;  2R5M A;  4PL6 A;  4QQ6 A;  5IN1 A;  1XNI A;  3OYN A;  4A4G A;  3EAE A;  4IUP A;  3L2Q A;  3GOX A;  2MWP A;  4E7J A;  4C5G A;  4E7I A;  3OYH A;  3OB9 A;  3MP8 A;  3OMC A;  2EQK A;  2EQM A;  3BDL A;  1N27 A;  2L8D A;  4N4I A;  2L89 A;  2XDP A;  5D6Y A;  3OYE A;  4BDY A;  1WGS A;  3S3N A;  5C0M A;  3QII A;  2GFA A;  2NLU A;  5J39 A;  3H8Z A;  5M9O A;  3OYC A;  4E7H A;  2K3Y A;  2RJF A;  2R58 A;  3MEU A;  3S3O A;  4IUT A;  2XK0 A;  3UT1 A;  4Q5W A;  3E9F A;  3S3M A;  2LRQ A;  3H6Z A;  2X4W A;  2RHY A;  4N4G A;  2WAC A;  3MP1 A;  5FRO A;  4BAC A;  4C5I A;  5FRM A;  2R5A A;  2YRV A;  3L2U A;  3OYI A;  3MEA A;  1SSF A;  2RJE A;  2LVM A;  3FLG A;  4BE1 A;  4PLI A;  1H3Z A;  2K3X A;  4QVZ A;  4FU6 A;  2IG0 A;  2X4X A;  2RI3 A;  3F70 A;  2D9T A;  2QQS A;  4UC4 A;  1KHC A;  3PMT A;  3OYM A;  1OZ2 A;  2O4X B;  4IUV A;  3OYJ A;  3OA6 A;  3OS0 A;  2BIV A;  2E6N A;  3LH0 A;  2M16 A;  3NTH A;  4QQD A;  5D6W A;  3OYF A;  2B8A A;  4N4H A;  4L59 A;  3L42 A;  5CIU A;  2EQJ A;  3ME9 A;  5FRN A;  3OYD A;  2HQX A;  3PNW C;  3MEV A;  3OYA A;  4FL6 A;  5D6X A;  2QQR A;  4CRI A;  2LCC A;  3OS2 A;  4IUQ A;  4IKF A;  3LGF A;  2PQW A;  4EDU A;  3OY9 A;  5KE2 A;  4BE2 A;  3E9G A;  3QKJ A;  4E7L A;  3P8H A;  4A4E A;  4C5H A;  3L2W A;  2DIQ A;  3KUF A;  3O8V A;  4QW2 A;  2GF7 A;  2G3R A;  2L3R A;  4NS5 A;  2M0O A;  2BUD A;  5IAY A;  2MWO A;  4A4H A;  2DIG A;  4BD3 A;  2HQE A;  2RHZ A;  4B9W A;  3CEY A;  4ZTJ A;  2BKD N;  4B9X A;  2EQU A;  2LTO A;  4IUU A;  4RG2 A;  5KCO A;  4BE0 A;  2R57 A;  4QQG A;  3OYL A;  2M1H A;  3M9Q A;  2RHU A; 
#chains in the Genus database with same CATH topology
 3JAM E;  2OTJ T;  3JV3 A;  2NYS A;  1ZUY A;  4C0F A;  4E7K A;  3JCM Q;  1GBR A;  2EQI A;  1YCS B;  3CCS A;  1MND A;  2HZY A;  2VGM A;  5IXF A;  2YRC A;  4X34 A;  2OAU A;  2OJ2 A;  4D8K A;  1Q86 R;  3TU4 K;  2C0O A;  1H64 1;  4F17 A;  2M51 A;  2DL7 A;  4J9I A;  1NYG A;  1QP3 A;  2M02 A;  1OX9 A;  1YWO A;  3NMZ C;  1M2O A;  2DVE A;  3CBO A;  1K8A U;  2FEI A;  1AZG B;  2MIO A;  2DER A;  2LQ8 A;  4ZNX A;  1M30 A;  2E3I A;  4EPC A;  2HL3 A;  5HY6 A;  2KI7 A;  3VS5 A;  3L1A A;  5GAN f;  4F14 A;  3CPW S;  3QYG B;  2CH4 W;  3EHR A;  3JB9 D;  1AWO A;  4A53 A;  2K7A A;  1MMA A;  3G7Z A;  4QT7 A;  2FPD A;  2I2L A;  2VC8 A;  2DM1 A;  2PUO B;  5KYW A;  2COZ A;  2YRV A;  1H8K A;  2C0T A;  3V8K A;  2LX9 A;  4MMK A;  3F70 A;  1OUL A;  4OB2 B;  1VQ4 Q;  3OBY A;  3M4G A;  3A5Z B;  3ER0 A;  3CCL A;  3CCL T;  2DET A;  2VXE A;  1I0C A;  3PNW C;  1YP5 A;  4FL6 A;  2YUO A;  5GAM f;  4PJO C;  2DEU A;  2EGE A;  2EWN A;  5CAI A;  4RTU A;  2EQU A;  1K9M R;  1NEG A;  3TSW A;  4M77 D;  3R6N A;  4BUG A;  5KYW B;  1IO6 A;  3CCR T;  1AEY A;  4J5Y A;  1B7T A;  4C92 C;  4IUR A;  2KNB B;  2DE0 X;  3DB4 A;  3Q1J A;  5LL6 S;  3JCM f;  4B6M A;  2COW A;  3TEE A;  3LW5 E;  4BI3 A;  1B34 A;  4A4F A;  1OZ3 A;  4OB1 B;  4RTT A;  2F2X A;  2QG9 B;  2X51 A;  2DBK A;  3EGD A;  4QVD A;  2AIR B;  1VQO T;  3NTI A;  3UF4 A;  3FJ5 A;  4F7U E;  2DF6 A;  4CI0 C;  1RI0 A;  2DL3 A;  5DLQ E;  3LX7 A;  1BIA A;  2Z0W A;  3FDR A;  4X9C A;  2F5K A;  1Q81 R;  1I1J A;  2QEX Q;  1K9A A;  1OQK A;  4IUP A;  2CP6 A;  2DD4 A;  4JZ3 A;  1Q86 C;  3OYE A;  4JS5 A;  1WGS A;  3S3N A;  4O6J A;  4RTX A;  2AKK A;  1IRE B;  2FPE A;  2KRS A;  1VQ9 A;  1PC0 A;  1VQ9 T;  1LCK A;  5A0G A;  2CT4 A;  1B34 B;  1QMC A;  1WHL A;  4QKU A;  3EGD B;  3MEA A;  3OW2 S;  2RJE A;  5I2S A;  3VS2 A;  3DKM A;  3INZ A;  1EFN A;  3PMT A;  3CCQ A;  3GIB A;  3CCQ T;  3OS0 A;  3X25 B;  1RAI B;  5GAN 2;  2GNC A;  4L59 A;  3M0Q A;  2YUP A;  2BZX A;  3JRZ A;  2JS2 A;  4FSX A;  4L6V 5;  4BI8 B;  1Q7Y U;  2PQW A;  4PFO A;  3P8H A;  3O8V A;  2L3R A;  6AT1 B;  4J9H A;  1GXI E;  5LJ3 f;  2J06 A;  2DIG A;  2RMO A;  1K73 R;  4ZN3 A;  2F2W A;  2KRM A;  4C8Q G;  1K0S A;  4RTW A;  2EKH A;  2DX1 A;  1VQP Q;  1WXB A;  3HHT B;  2DRK A;  2E12 A;  2RI2 A;  1SRL A;  1AWW A;  2X9H A;  4DOV A;  4J7F A;  1D0X A;  1Q86 U;  5A0D A;  5HK3 A;  3P8B B;  4D6W A;  1K9M C;  5J3B A;  2DKG A;  3MET A;  3OYK A;  2XID A;  1YJN Q;  4NL2 A;  2YXY A;  2KGT A;  2O2O A;  4GY5 A;  1Y7X A;  3I9Q A;  4LUE A;  1BKB A;  2Y90 A;  4JUV A;  3JCM e;  1SSH A;  3G6E Q;  4A63 B;  3CC7 Q;  4EIK A;  3WXM B;  2L8D A;  5D6Y A;  2A36 A;  5GAN d;  2DTI A;  2RD1 A;  1ABQ A;  4EMK C;  4FT4 A;  3EFS A;  2DJZ A;  4DQ2 A;  2K3Y A;  2E1H A;  5GAM j;  2YLC A;  3V7S A;  3CCV A;  3E9F A;  3CCV T;  4RCB A;  2XIC A;  1ZUU A;  2XHC A;  4KGV B;  1D09 B;  1Q81 C;  4XU2 A;  1ACM B;  4BE1 A;  4KH1 B;  3HRU A;  5D7U A;  2K4Y A;  2RI3 A;  4PNO A;  4UC4 A;  5IHI A;  2VKN A;  3QPH A;  3EG1 A;  2RN8 A;  2AZS A;  5CK9 A;  1I4K 1;  3VS4 A;  2OTJ Q;  2EAY A;  3REB B;  2GTJ A;  3THK A;  5GAM d;  1YJW A;  4JJB A;  3CME A;  4M7A G;  3CME T;  4QW2 A;  3CCS Q;  2GF7 A;  1PSF A;  2HEQ A;  1YIJ A;  1RLQ C;  5GAO q;  4ZN1 A;  1YIJ T;  2P4R A;  1K9M U;  2EYX A;  1TXQ A;  1Z9Z A;  3EH2 A;  3M9Q A;  5GAM g;  2RB6 A;  1RAG B;  1MNE A;  2KRO A;  1D3B A;  2AT1 B;  3JCM d;  1AD5 A;  1NE8 A;  4CC7 A;  5GMK l;  2K3B A;  3VS6 A;  5LJ3 e;  2JTF A;  3QDF A;  3VS1 A;  3EGX A;  1I8F A;  1M90 C;  4Z02 A;  3PIP A;  2E6Z A;  3V8L A;  1AHJ B;  4Y28 E;  5EG2 A;  2CKK A;  3OMG A;  2BE9 B;  4C0D C;  2GQV A;  1O75 A;  4M77 A;  4J9G A;  4E47 A;  1IRX A;  1VOM A;  2O31 A;  4M75 G;  3TCJ A;  4JRQ A;  1Q81 U;  3QJ6 A;  5IXB A;  5CQY A;  3EG2 A;  2DPP B;  2JS0 A;  2R5M A;  4M7D G;  2CS7 A;  3OYN A;  2LZ6 B;  4E7J A;  1ZSG A;  2B86 A;  1OPL A;  2EQK A;  2MAM A;  4N0A A;  4XTW A;  4M78 D;  2FO0 A;  5C0M A;  1D3B B;  5IHK A;  2FZK B;  1FMK A;  1N8R U;  2DMO A;  3CCL Q;  5GAN h;  2EGA A;  1LVK A;  1RAE B;  1BBZ A;  4RUG A;  2P4T A;  2E4H A;  4Q5W A;  4OGE A;  2LRQ A;  4JPB W;  4N4G A;  3EGX B;  1Y96 A;  4OML A;  2JW4 A;  2AKL A;  1JXO A;  4ANJ A;  1UGQ B;  4HCC A;  2FZG B;  1FMV A;  1YI2 A;  1W6X A;  2PU9 B;  1YI2 T;  1WIE A;  4M77 B;  1UJY A;  3V7R A;  1TOV A;  5D6W A;  2VXF A;  2YLB A;  3OYD A;  2ZPB B;  3JCM W;  1UUE A;  2LCC A;  1UG1 A;  1PNJ A;  2FZC B;  4LNP A;  1VIE A;  5LJ3 d;  2DTH A;  2MWO A;  1K73 U;  2PVD B;  3CBM A;  2VB6 A;  4J6Y A;  2I0N A;  2A08 A;  3BFM A;  4LUD A;  1Y96 B;  4LDW A;  2V1Q A;  4N0A C;  3NGP A;  4XU0 A;  2OTL A;  3QG1 A;  3NFC A;  2RA2 A;  1F1B B;  2RJC A;  4PKC C;  1KHI A;  3J81 E;  2OTL T;  2O01 E;  2JZ2 A;  3PMI A;  2IPO B;  2JMC A;  4HT9 A;  3JCM h;  1WQ7 A;  1TU0 B;  2GBQ A;  4WF2 A;  1ZA2 B;  2WSC E;  3RES A;  1IGQ A;  1VUB A;  1CKB A;  1D1B A;  3HRS A;  2QTV A;  1YJ9 A;  1IHW A;  4L5G A;  1YJ9 T;  4PJO G;  5I11 A;  1W4S A;  4OB0 B;  1VQ9 Q;  2QQB A;  3NTK A;  3URG A;  2RJD A;  4M4Z A;  1S72 Q;  1VQM A;  4J83 A;  1KC8 C;  1VQM T;  4LXC A;  3ZBD A;  4OMM A;  2KXD A;  3L2Q A;  1WHH A;  3JB9 I;  1V29 B;  3WVD B;  2P0P A;  2KVQ G;  4C0G A;  5GMK h;  3X26 B;  5GAN 5;  1QVG S;  1D1A A;  1UGV A;  4M78 E;  2R5A A;  3OBW A;  3FLG A;  1JJ2 P;  4PLI A;  3CCE Q;  3EG3 A;  2DRM A;  3OYM A;  1NG2 A;  1WQW A;  1GCQ C;  4M75 A;  1HK9 A;  3UAT A;  2KT1 A;  1VQ6 A;  2RQT A;  1GCP A;  9ATC B;  4LDY A;  4E7L A;  4BE2 A;  4IKF A;  3M0R A;  2CP0 A;  2ZCF B;  4LD9 K;  2CP5 A;  4KUD K;  2MF2 A;  2RHZ A;  2H8H A;  1HXD A;  5CO7 A;  5LJ3 h;  1YHQ Q;  1VYV A;  2X4J A;  2M1H A;  5CR2 A;  2L2P A;  1X01 A;  4FT2 A;  1K76 A;  3JB9 F;  1WPY A;  3QJY A;  2QDY B;  2K57 A;  2KK4 A;  5C6S A;  3H9N A;  4RTY A;  4E2F B;  1TWB A;  5I21 A;  4HT8 A;  4M75 B;  2HSE B;  1T3L A;  1NPR A;  4D8D A;  2EVR A;  2LDM A;  2RHX A;  2HBW A;  1YFN A;  1YWP A;  2EYQ A;  2X35 A;  3M54 A;  1OU9 A;  4MZT A;  3CPF A;  3L2V A;  2GGR A;  1LOJ A;  2QTX A;  3MKD A;  3OYH A;  3OB9 A;  5CIU A;  4BY6 C;  1WDX A;  2KAF A;  2EJG A;  4LE9 A;  1W2B S;  5FU6 B;  2DA9 A;  2JUF A;  1TUG B;  2CP2 A;  1J3T A;  2K2V A;  4M77 F;  1SHG A;  2J7I A;  2QDL A;  1KQS S;  2JNG A;  4XTV A;  2CZ0 B;  1YJW Q;  3VKI A;  4R0K A;  3CME Q;  3HP9 A;  1UB4 A;  1IZ6 A;  4OMP A;  4OF1 A;  2EW3 A;  2ECZ A;  4ORZ A;  3OA6 A;  4QQD A;  1PHT A;  3WVE B;  2L3Q A;  4DBH A;  2CZ7 B;  4M78 A;  4NL3 A;  4RKU E;  2FRW A;  2LX7 A;  3TVT A;  5HKC A;  2QQA A;  3I56 T;  1Y71 A;  2ROL A;  1VQN A;  1WHK A;  1VQN T;  4KUL A;  1U8R A;  1K0X A;  2BZY A;  3FJP A;  4A4K A;  4ZTJ A;  3M56 A;  2MK5 A;  1UEB A;  4ZGJ B;  3A8M B;  3H0F A;  5KCH A;  2KYM A;  5FLX E;  4XU1 A;  2X3X D;  1H3H A;  1YCY A;  2W10 A;  3E2U A;  4MML A;  2CSI A;  4JZ4 A;  4J9C A;  1OOT A;  4BDZ A;  2L3S A;  3QWY A;  2MCN A;  2LNH B;  5KE3 A;  1UE9 A;  4XTU A;  3LLR A;  1Y07 A;  4O5V A;  1FX7 A;  4M78 B;  4OMQ A;  2K5L A;  4VUB A;  1H92 A;  1SPK A;  3VUB A;  3FIF A;  4EMG A;  3CCR A;  1G3T A;  4WCI A;  4XU3 A;  3QXE B;  2JVV A;  3QO3 A;  5EC7 A;  1RUW A;  2JN0 A;  1Y57 A;  1IB8 A;  4OVA A;  5IN1 A;  4C8Q D;  1DJ7 B;  2EGC A;  1YI2 Q;  1GFC A;  2JT4 A;  2KRN A;  3L2Z A;  1VQO A;  3SB2 A;  1V1C A;  1QVF S;  1VQK A;  1VQK T;  3GP8 A;  2V8K A;  5GAN 7;  5DY9 A;  2K3X A;  2X4X A;  2O9S A;  1PSE A;  1XJW B;  4FYW B;  4LDX A;  3A1P A;  1M9S A;  3VJP A;  4IUV A;  3RDV A;  1HD3 A;  2LCS A;  1T0H A;  2ZPF B;  5GAN 6;  2HQX A;  5D6X A;  3V8J A;  5I2M A;  3EHQ A;  2OTL Q;  3A8G B;  3HKS A;  1SHF A;  3M5A A;  2FL7 A;  4AT1 B;  2FYK A;  4KRT A;  1VYU A;  4B9W A;  2BKD N;  2LC4 A;  1N6A A;  4QQG A;  2VUB A;  3E1S A;  2DD5 A;  2JM9 A;  5I22 A;  1YJ9 Q;  3UDC A;  2EJF A;  2LCL A;  1OEB A;  3HFO A;  1QQJ A;  1MMD A;  5KYU A;  1VQM Q;  2JJ9 A;  3HFN A;  4KGX B;  2CRE A;  2VYT A;  1M90 R;  1C6V X;  2M9U A;  2CZ6 B;  4M7A D;  4JJN K;  4E7Z A;  2Y4X A;  1UHF A;  1UFF A;  3X20 B;  4OMF B;  4M77 E;  4HCB A;  4FYY B;  5GAN j;  2QXF A;  1RLP C;  4XQ3 A;  2P84 A;  2FG0 A;  2RK2 A;  1QW1 A;  1X75 C;  2CYZ B;  3MEU A;  2HL5 C;  3NPF A;  5KYU B;  2Y4Y A;  2HBP A;  1NM7 A;  4AG1 C;  1VQ7 T;  2NUP B;  1PWT A;  4ESR A;  1VQ6 Q;  2WAC A;  2FB7 A;  1GFD A;  1K1Z A;  2CP3 A;  4DEY A;  2ATC B;  3FRN A;  1JXM A;  3HTR A;  2V8J A;  3KFV A;  1WFW A;  4HKE A;  4OMO A;  3H41 A;  3CC2 A;  3CC2 T;  1XOV A;  5GJV B;  4M75 D;  4XTZ A;  2B8A A;  3L42 A;  2J6K A;  3KXT A;  4M7D D;  3SDZ A;  1WXT A;  4IIO A;  4E6R A;  1VQ5 A;  1VQ5 T;  4AFS C;  3QKJ A;  3G1J A;  4KT0 E;  4C5H A;  4DBF A;  4WTO B;  3JCM P;  2KBT A;  3CQT A;  3RKW A;  1BI3 A;  2XI9 A;  3ULR B;  5GAN g;  2RF0 A;  4J9F A;  3RR6 A;  1X69 A;  1V76 A;  5HCK A;  2LTO A;  2D0Q B;  4XAX B;  5DLO A;  2KXC A;  2FVU A;  2KEA A;  3MO8 A;  2IVW A;  4M78 F;  2A3L A;  2LT1 A;  5CKB A;  4C0Z A;  1SF9 A;  2QGF B;  1PD0 A;  2NUT A;  3OYG A;  2DO3 A;  2EKO A;  2OAW A;  4JJD A;  1JEG A;  3L2R A;  1KK7 A;  2LJ1 A;  1OYX A;  4GLK A;  2BE7 D;  2K5F A;  2LQN A;  2COY A;  4R55 A;  4ZTF A;  1XQH A;  1M27 C;  2X4Y A;  4FIB A;  1XTD A;  1AOJ A;  4J6X A;  4ELY C;  3UWN A;  1AWJ A;  4HXJ A;  2DL4 A;  2OI3 A;  1KC8 R;  4M7A E;  5KYX A;  2VAS A;  3GOX A;  1RAB B;  2AHJ B;  5GMK j;  1Q95 G;  5FWC A;  1NPP A;  4R56 A;  5J39 A;  2NUT B;  3JB9 J;  3JCM g;  2QYZ A;  4RTV A;  1UEC A;  1VYT A;  2RM4 A;  4FSS A;  4PJM A;  5FRM A;  1I5L A;  4JS4 A;  2HKN A;  1NZ9 A;  2V8I A;  5LJ5 e;  1BYM A;  2ZAE A;  1FWZ A;  2RQU A;  2EYZ A;  3UA7 A;  1VQ4 T;  4PJO D;  4C8Q A;  1OZ2 A;  2K9G A;  1OV3 A;  1LJO A;  2MMP A;  3ME9 A;  1VA7 A;  4ZGD B;  3RMS A;  3R6O A;  3MEV A;  5KYX B;  2GTO A;  1CKA A;  1E6G A;  2EYY A;  5LJ3 j;  4DEX A;  1X2Q A;  4M75 E;  1AWX A;  2YSQ A;  4Z88 A;  4NS5 A;  3NHN A;  1NJI C;  4M7D E;  1RI9 A;  4ELZ C;  2JMA A;  4RG8 A;  4NOY A;  2RQW A;  3ZFJ A;  2DFU A;  4K11 A;  4BE0 A;  2LQW A;  2O88 A;  3AT1 B;  1G2B A;  3CCR Q;  4JRK A;  2KE9 A;  2E5Q A;  5GJW B;  1BI1 A;  1D0Y A;  4C8Q B;  3CXC S;  1ZBJ A;  2DK3 A;  1WI7 A;  3PFS A;  4M77 C;  1M90 U;  3GNG A;  3VUZ A;  2FRY A;  1U5S A;  3SWN A;  2QA4 A;  2QA4 T;  5IH2 A;  1VQO Q;  3MJX A;  2J6F A;  3EFR A;  2LT4 A;  2BZ8 A;  5GAO m;  4HVU A;  1NEB A;  2QQ9 A;  1VQK Q;  5LJ3 g;  1ZBX A;  4AFQ C;  2LJ3 A;  4PJN A;  5KYY A;  1ZHI A;  4OP0 A;  2ZPE B;  3QZ9 B;  2ENM A;  3E19 A;  1UHC A;  3HRT A;  3JCM X;  3H8Z A;  2RJF A;  1RAC B;  1LNX A;  1Q82 C;  2PUK B;  2BTT A;  4M7A A;  2XG8 D;  2KMT A;  2X4W A;  5FU7 B;  5FRO A;  2E65 A;  1O9S A;  2EYW A;  4C5I A;  4A54 A;  1MUZ A;  3EFO A;  4FU6 A;  3SWN B;  3EG0 A;  3M58 A;  2YHT A;  1B07 A;  1TUC A;  1QCF A;  1Y0M A;  3GBQ A;  2E10 A;  3CCQ Q;  2NWM A;  3OYF A;  4C92 G;  3PIO A;  5FRN A;  5FU7 C;  1U1S A;  5KYY B;  5CKD A;  4DBQ A;  2JTM A;  5GAN 4;  5GAO r;  1AT1 B;  3VS0 A;  2VV5 A;  3I5S A;  2W0Z A;  2ABL A;  5IAY A;  2RK1 A;  1U06 A;  3A98 A;  1TTH B;  4IUU A;  4M7A B;  1VIF A;  3G4S A;  2CH4 A;  1UGP B;  3G4S T;  4JRP A;  3NTH A;  1MGQ A;  2EJ9 A;  4DBR A;  1E7O A;  2XDD A;  1PD1 A;  1HYO A;  1JJ2 A;  3PT9 A;  3EFO B;  4M7D A;  4PJJ A;  1G3W A;  2JOY A;  4FW1 A;  2WSE E;  4X9D A;  3BDU A;  1ZSZ A;  2DBM A;  1WJS A;  3RIR A;  4M7A C;  2GFU A;  3GPL A;  3FEO A;  1T0J A;  2E3H A;  2VWF A;  2P0Q A;  2RHI A;  4OB3 B;  1YJN A;  3LYI A;  1YJN T;  1W2B P;  1OI1 A;  1NBE B;  2V1R A;  2D0N A;  2O4X A;  2LJ0 A;  2DZC A;  1KQS P;  1KD1 R;  1JU5 C;  5KH6 A;  1KC8 U;  1K8A C;  4J6W A;  1VQL A;  1UDL A;  1VQL T;  1I5O B;  1XNI A;  2RQV A;  3TQ7 P;  2HAX A;  1SRM A;  3SFM A;  1RAH B;  4PK4 A;  3OMC A;  1SEM A;  3BDL A;  2NUZ A;  5LJ5 h;  3CC2 Q;  1KQS A;  2KR3 A;  3QII A;  1R0B G;  4M7D B;  3CPW P;  2SRC A;  1SKU B;  2JTE A;  1MMN A;  1ZSZ B;  4FM4 B;  2XD0 A;  4LDV A;  1VQ5 Q;  3QZ5 B;  3OYI A;  3CCV Q;  1WNL A;  2M0Y A;  4M75 C;  1T3S A;  3CPW A;  2DL5 A;  4XK8 E;  1R0C B;  1WZO A;  2D9T A;  2X3W D;  2H3J A;  4M7D C;  2O4X B;  3HL8 A;  3LH0 A;  1BI0 A;  1C0M A;  1KIK A;  3CCJ A;  2DXT A;  1OU8 A;  3CCJ T;  3LGF A;  3CCS T;  1ZA1 B;  5A0L A;  3L2W A;  4AG2 C;  4HCK A;  4KUI A;  2M0O A;  2D6F A;  1QCN A;  4TVR A;  1M8M A;  2K6D A;  1YIJ Q;  4C8Q F;  4B9X A;  5FU6 C;  1GRI A;  2KSS A;  2R57 A;  4PJO A;  3C95 A;  2P0K A;  1YIT A;  1YIT T;  4Y91 A;  2XU8 A;  3IQL A;  3MEW A;  3CCU A;  2CSQ A;  3CCU T;  3I56 A;  1X2K A;  1U3O A;  4KGZ B;  2E5K A;  3QWX X;  1W70 A;  3C94 A;  4C92 A;  2QGG A;  1PRL C;  3KBG A;  3OQ5 A;  3S6W A;  1QWF A;  2F5T X;  3GF5 A;  1SG5 A;  1JB0 E;  1QVF P;  2IIM A;  2QAZ A;  1U1T A;  5GAO p;  4II1 A;  4OGC A;  3M0T A;  3PVL A;  4PJO B;  2MWP A;  4RTZ A;  2EQM A;  1N27 A;  1KJW A;  2PNI A;  1QVF A;  2XDP A;  5GAN 8;  7AT1 B;  3M0U A;  2NLU A;  2KY9 A;  3VV0 A;  5M9O A;  3OYC A;  1TSF A;  3S3O A;  1KG1 A;  3VU3 C;  1BCO A;  3BE3 A;  2OX7 A;  1KD1 C;  4J7I A;  2MI6 A;  4FCY A;  2ED0 A;  4JJC A;  2ZGW A;  4C92 B;  1S1N A;  2KDS A;  2D8J A;  4XTY A;  3OW2 P;  2C0I A;  4M78 C;  2V26 A;  2EPD A;  2IG0 A;  4Z8A A;  1LPL A;  2WSF E;  2QQS A;  1KHC A;  2YWW A;  1NLP C;  5GMK i;  3LWI A;  1MMG A;  4F7U G;  4GLM A;  3N5B B;  4JLI A;  1E6H A;  2AK5 A;  3OW2 A;  2JXB A;  1X6G A;  2HKQ B;  4EMH A;  2YUN A;  4FYV B;  2A37 A;  3OYA A;  4M7A F;  3RMQ A;  4CRI A;  1BK2 A;  1Q7Y C;  3RKX A;  3RUX A;  2DIQ A;  2LNV A;  1G8X A;  2DNU A;  3EGU A;  4BD3 A;  2RH2 A;  1WX6 A;  1ZUK A;  5KCO A;  1WHM A;  3OYL A;  3MCA B;  1IGU A;  2QA4 Q;  3UA6 A;  1G83 A;  2KT8 A;  3RNJ A;  1BU1 A;  5L8R E;  3JB9 G;  2DYI A;  2HQH A;  3JCM V;  3CBP A;  3A8H B;  2F2V A;  1RAF B;  1FYN A;  2CUD A;  3OYB A;  2CT3 A;  1QP2 A;  3C12 A;  3CCM A;  3CCM T;  2H3E B;  4IIM A;  2HSP A;  3HPW A;  4V2S A;  4FYX B;  1N8R R;  4M75 F;  1VQ8 A;  1VQ8 T;  2K2M A;  1KD1 U;  4Y92 A;  1G3Y A;  1S72 A;  1S72 T;  1PG5 B;  2JM8 A;  4M7D F;  1X6O A;  1M3A A;  3C0C A;  4QQ6 A;  2ZZD A;  2E64 A;  3EAE A;  2KQW A;  1UJ0 A;  2NUP A;  2DL8 A;  3G71 A;  1JRI A;  5GAN e;  3G71 T;  2DTO A;  5CKE A;  4DOW A;  2RQR A;  1Z9Q A;  3LH5 A;  2ZPG B;  5DM7 R;  2D1X A;  3M59 A;  4AFZ C;  3JCM b;  3QSU A;  1A0N B;  1GL5 A;  1G3S A;  3VRY A;  4JDS A;  2XMF A;  3MP1 A;  1RL2 A;  2QAS A;  4M77 G;  4EMK A;  3L2U A;  3CCE A;  3CCE T;  2MYS A;  1M3C A;  5LJ5 f;  3GLX A;  1QKW A;  4J9E A;  1FXX A;  4F04 B;  4HA8 A;  3G4S Q;  4MZP A;  2F1L A;  4C8Q E;  5GAM e;  2DXC A;  1VQ7 A;  2LQK A;  3M55 A;  3I5R A;  2SEM A;  1PRM C;  3OS2 A;  4IUQ A;  4BB7 A;  1ARK A;  3M57 A;  4ME7 A;  2K5I A;  1BB9 A;  5CKH A;  3VRZ A;  2BUD A;  2CZ1 B;  1NJI R;  1ZLM A;  1M1G A;  1EIF A;  5HK0 A;  3CC4 A;  3CC4 T;  5GMK m;  5GAN 3;  3M53 A;  3PTA A;  4EMK B;  4PFP A;  3X24 B;  5L23 A;  2DVJ A;  3CMA A;  1B3Q A;  2VGN A;  3CD6 A;  3CMA T;  3CD6 T;  3I55 A;  2VVK A;  1YNZ A;  3I55 T;  2ZPH B;  3BY7 A;  1VQL Q;  4F7U A;  1M4Z A;  1WHG A;  2DAQ A;  1UGS B;  1JBM A;  5J26 A;  1G5V A;  2LP5 A;  3V7C A;  1YHQ A;  4PJO F;  4ZGE B;  1YHQ T;  2HDA A;  3ZEH A;  3DB3 A;  1EX4 A;  1WJQ A;  3OSV A;  1PKS A;  2GQI A;  2HCK A;  3ZL7 C;  2E41 A;  2L0A A;  1TS9 A;  3HSB A;  5CQX A;  3A8O B;  1P92 A;  3QHS A;  4PL6 A;  1RAD B;  2DZ9 A;  2K79 A;  5IT9 E;  3T9N A;  1QWE A;  3DLL A;  1M1K R;  3RER A;  1HSQ A;  3MP8 A;  3LWH A;  4C92 F;  2DJQ A;  2L89 A;  1YN8 A;  2DLP A;  4HVV A;  2PVG B;  1YBY A;  5GMK e;  4E7H A;  1BCM A;  3UPU A;  1FMW A;  1N8R C;  4IUT A;  2XK0 A;  1Q82 R;  4DA4 A;  4F7U B;  3S3M A;  4J9B A;  3H6Z A;  1NYF A;  1YJW T;  4BAC A;  3CCJ Q;  3SHW A;  4HVW A;  5FW9 A;  4RMO A;  2LVM A;  2E70 A;  1HJD A;  1D1C A;  2MOX A;  1AVZ C;  4GBQ A;  3OYJ A;  2ROT A;  2O9V A;  2C06 A;  3JCM J;  3VS7 A;  4Z89 A;  4AMC A;  1K4U S;  1YIT Q;  2DXB A;  1EZZ B;  4C0D B;  2CDT A;  3OY9 A;  3E9G A;  3OSS C;  1KQ1 A;  1WA7 A;  3CCU Q;  3AHU A;  3CXC P;  2XKO C;  3JSC A;  2G3R A;  3I56 Q;  4PJL A;  1VQN Q;  4KBM B;  1VQ4 A;  3TRE A;  1K73 C;  4RG2 A;  4ATO A;  2XDB A;  1WYX A;  3JCM c;  4A4E A;  3EG9 A;  1D0Z A;  2MPX C;  3CXC A;  4PLL A;  1PM3 A;  5CKF A;  4YTL A;  1PKT A;  5ECA A;  3MPU B;  1M5Q 1;  1MV0 B;  2EFI A;  1TH7 A;  2PZ1 A;  3OS5 A;  1IHV A;  1TG0 A;  1N5Z A;  1N9R A;  2DXU A;  4C92 D;  2QK0 A;  1UTI A;  2RPN A;  4CC2 A;  1X43 A;  1TUD A;  4MDX A;  3EH1 A;  1WJR A;  3SD4 A;  3DLM A;  1MHN A;  4HCZ A;  5AT1 B;  1ZX6 A;  1ABO A;  2PTK A;  3VYG A;  3PGG A;  2HD0 A;  2F69 A;  3J80 E;  5LJ5 j;  3OS1 A;  3MP6 A;  2J05 A;  2RI5 A;  1K8A R;  4CC4 B;  4OMN A;  3M0S A;  5FWB A;  4JRI A;  4MDW A;  4C5G A;  3EG9 B;  4J8O A;  3JB9 H;  2ED1 A;  4N4I A;  1X6B A;  4QVC A;  2EBP A;  1M2V A;  3H0H A;  1I07 A;  3QYH B;  3TSZ A;  2R58 A;  1QVP A;  1QCO A;  1R8O B;  3UT1 A;  4FW2 A;  1JO8 A;  4PFZ A;  4C8Q C;  2PVO B;  1QVG P;  2RHY A;  2GCX A;  2QEX A;  2QEX T;  5GAM h;  1UGR B;  3RKY A;  1H3Z A;  5LJ5 d;  4QVZ A;  2YRD A;  2RNA A;  1M1K C;  1CSK A;  2A28 A;  1RAA B;  2A0F B;  1JQQ A;  2YUQ A;  1QVG A;  2BIV A;  2E6N A;  2M16 A;  4N4H A;  1W1F A;  2EQJ A;  4F16 A;  1KQ2 A;  4LN2 A;  3GNF B;  1R77 A;  1KFZ A;  2QQR A;  3SEM A;  4EDU A;  5LJ5 g;  1M3B A;  1OPK A;  2DEQ A;  1M2V B;  3MHX A;  1GCQ A;  1NJI U;  3D7S B;  3PVQ A;  5KYN A;  2HQE A;  2L5Q A;  5AYF A;  3OYY A;  3CCM Q;  4E7S A;  3CEY A;  1AZE A;  1M1F A;  1BI2 A;  5A2Q E;  4AFU C;  2YDL A;  1N9S A;  2DYB A;  2HMA A;  1VQ8 Q;  4M78 G;  2L3P A;  5CCA A;  4PJO E;  2EIF A;  1WXU A;  2FHD A;  3SWN C;  3O5Z A;  3ASK A;  2CGH A;  1PCX A;  8ATC B;  3P8D A;  2ESW A;  3G71 Q;  2D8H A;  3X28 B;  3C4S A;  4C5E A;  2YT6 A;  3PE0 A;  2KYB A;  3LGL A;  3FC3 A;  4C92 E;  4P5N A;  1X27 A;  1VQP A;  4RCC A;  1VQP T;  2ZPI B;  4LD6 A;  4MZM A;  3QBY A;  2RO0 A;  4XTX A;  1WHJ A;  2LMJ A;  4A4G A;  1M1K U;  2A7Y A;  4F7U F;  4E7I A;  3FB9 A;  5GAO l;  1OX8 A;  4LDU A;  2CP7 A;  4BDY A;  1WLP B;  2GFA A;  4JLG A;  1C1A A;  1QKX A;  4CC3 A;  1IXD A;  1Q82 U;  4J9D A;  3QUI A;  3J7A F;  1M8V A;  3G6E A;  1VQ6 T;  3G6E T;  4X1V A;  3QDR B;  3REA B;  3A8L B;  1VQ7 Q;  3U23 A;  2J6O A;  3CC7 A;  3CC7 T;  1SSF A;  2QI2 A;  1W2B A;  5CVI A;  4BI4 A;  1MV3 A;  2DIL A;  1BIB A;  3VS3 A;  3CC4 Q;  1KSW A;  5IHN A;  2AZV A;  2CUB A;  3VYH B;  1I81 A;  5KE2 A;  3BW1 A;  3RBB B;  3M0P A;  1Q7Y R;  8AT1 B;  3CMA Q;  3CD6 Q;  3KUF A;  1NLO C;  3I35 A;  3I55 Q;  1JJ2 S;  1ZQ1 A;  2FPF A;  4A4H A;  5GAO n;  3M4Y A;  4KH0 B;  1GBQ A;  3H0I A;  1QLY A;  4BY6 B;  2HNI A;  1ZSZ C;  2G6F X;  2RHU A;  2OTJ A; 
#chains in the Genus database with same CATH homology
 3JAM E;  3MO8 A;  2IVW A;  4M78 F;  2A3L A;  2LT1 A;  5CKB A;  2OTJ T;  4C0Z A;  4N0A C;  4C0F A;  4E7K A;  4XU0 A;  2OTL A;  3QG1 A;  3NFC A;  2RA2 A;  2RJC A;  3JCM Q;  4PKC C;  1KHI A;  3J81 E;  2OTL T;  2O01 E;  5L8R E;  2DO3 A;  2EKO A;  3OYG A;  3CCS A;  3JB9 G;  2JZ2 A;  3PMI A;  3JCM V;  3CBP A;  3A8H B;  4HT9 A;  3L2R A;  3JCM h;  2VGM A;  1WQ7 A;  1OYX A;  4X34 A;  4WF2 A;  2OAU A;  4GLK A;  2WSC E;  3RES A;  3TU4 K;  2K5F A;  3OYB A;  1VUB A;  1QP2 A;  3C12 A;  3CCM A;  1H64 1;  3CCM T;  3HRS A;  4R55 A;  4ZTF A;  4M7D B;  1XQH A;  3HPW A;  1QP3 A;  4V2S A;  2X4Y A;  1YJ9 A;  4M75 F;  4FIB A;  1VQ8 A;  1XTD A;  4L5G A;  4PJO G;  1YJ9 T;  1VQ8 T;  4J6X A;  4ELY C;  1KD1 U;  1W4S A;  4OB0 B;  2QQB A;  3NTK A;  1S72 A;  1G3Y A;  3URG A;  2DVE A;  3CBO A;  1S72 T;  3UWN A;  2RJD A;  4M7D F;  1K8A U;  1X6O A;  1VQM A;  4J83 A;  1KC8 C;  4QQ6 A;  1VQM T;  4M7A E;  2ZZD A;  2E64 A;  3EAE A;  2KQW A;  3ZBD A;  3GOX A;  3L2Q A;  3G71 A;  2AHJ B;  2LQ8 A;  1JRI A;  5GAN e;  3G71 T;  4EPC A;  5GMK j;  2DTO A;  5HY6 A;  1NPP A;  5CKE A;  4DOW A;  5GAN f;  3L1A A;  4R56 A;  3CPW S;  3QYG B;  5J39 A;  2ZPG B;  3JB9 D;  5DM7 R;  3M59 A;  3JB9 J;  3JB9 I;  1V29 B;  4A53 A;  3JCM b;  3JCM g;  3QSU A;  1G3S A;  3G7Z A;  2P0P A;  3WVD B;  4JDS A;  2KVQ G;  4C0G A;  2RM4 A;  2I2L A;  2VC8 A;  3X26 B;  5GMK h;  5GAN 5;  1QVG S;  2PUO B;  3MP1 A;  1RL2 A;  5FRM A;  4M77 G;  1Y96 B;  2R5A A;  2YRV A;  4M78 E;  4EMK A;  3L2U A;  4JS4 A;  1I5L A;  3CCE A;  3OBW A;  3CCE T;  1NZ9 A;  2V8I A;  3FLG A;  5LJ5 e;  1BYM A;  1FWZ A;  4PLI A;  3V8K A;  2LX9 A;  4MMK A;  5LJ5 f;  1VQ4 T;  3F70 A;  4PJO D;  3GLX A;  4C8Q A;  3OYM A;  1OZ2 A;  4OB2 B;  3OBY A;  3M4G A;  1FXX A;  1WQW A;  3A5Z B;  3ER0 A;  3CCL A;  3CCL T;  4HA8 A;  1LJO A;  2MMP A;  3ME9 A;  4M75 A;  4MZP A;  1HK9 A;  2VXE A;  4ZGD B;  3RMS A;  3R6O A;  3PNW C;  3MEV A;  4C8Q E;  1VQ6 A;  5GAM e;  2DXC A;  4FL6 A;  2LQK A;  1VQ7 A;  3M55 A;  3OS2 A;  4IUQ A;  4BB7 A;  4LDY A;  4E7L A;  4BE2 A;  4IKF A;  5LJ3 j;  5GAM f;  3M57 A;  4PJO C;  4M75 E;  2ZCF B;  4ME7 A;  2K5I A;  4LD9 K;  2EWN A;  4NS5 A;  4KUD K;  5CKH A;  2BUD A;  2CZ1 B;  1NJI C;  2MF2 A;  4ELZ C;  5CAI A;  4M7D E;  1M1G A;  1EIF A;  2RHZ A;  4RG8 A;  5HK0 A;  4NOY A;  3CC4 T;  3CC4 A;  3ZFJ A;  1HXD A;  2EQU A;  5CO7 A;  5LJ3 h;  4BE0 A;  5GMK m;  5GAN 3;  2X4J A;  3M53 A;  4M77 D;  3PTA A;  2M1H A;  4BUG A;  5CR2 A;  4EMK B;  3CCR T;  4J5Y A;  3X24 B;  4JRK A;  1X01 A;  4FT2 A;  4C92 C;  3JB9 F;  4IUR A;  1WPY A;  2E5Q A;  3CMA A;  2VGN A;  3QJY A;  3DB4 A;  3Q1J A;  5LL6 S;  2QDY B;  3JCM f;  3CMA T;  3CD6 A;  1BI1 A;  3I55 A;  3CD6 T;  2K57 A;  2KK4 A;  4C8Q B;  5C6S A;  3I55 T;  3TEE A;  2ZPH B;  3LW5 E;  3CXC S;  3BY7 A;  4BI3 A;  4F7U A;  1M4Z A;  2DK3 A;  1B34 A;  4A4F A;  1OZ3 A;  3PFS A;  4M77 C;  4OB1 B;  2DAQ A;  5I21 A;  4M75 B;  1M90 U;  1UGS B;  4HT8 A;  1NPR A;  1JBM A;  5J26 A;  1G5V A;  2LDM A;  2RHX A;  3GNG A;  3VUZ A;  4QVD A;  3V7C A;  1YHQ A;  4PJO F;  4ZGE B;  1YHQ T;  1VQO T;  3NTI A;  4F7U E;  3SWN A;  2QA4 A;  4CI0 C;  2QA4 T;  1RI0 A;  3ZEH A;  3DB3 A;  3EFR A;  5DLQ E;  2LT4 A;  2EYQ A;  1WJQ A;  3OSV A;  5GAO m;  3LX7 A;  2E41 A;  2X35 A;  3M54 A;  4MZT A;  1BIA A;  3CPF A;  2QQ9 A;  3L2V A;  3HSB A;  3FDR A;  4X9C A;  5CQX A;  5LJ3 g;  3A8O B;  1ZBX A;  2F5K A;  1P92 A;  1ZHI A;  3QHS A;  4OP0 A;  3MCA B;  2ZPE B;  4PL6 A;  1LOJ A;  2DZ9 A;  2QTX A;  5IT9 E;  3T9N A;  4IUP A;  3QZ9 B;  3DLL A;  3RER A;  2DD4 A;  3OYH A;  3OB9 A;  3MP8 A;  5CIU A;  4BY6 C;  3LWH A;  4C92 F;  1Q86 C;  2L89 A;  3OYE A;  4JS5 A;  3E19 A;  1WGS A;  2KAF A;  3S3N A;  2PVG B;  4O6J A;  1YBY A;  5GMK e;  2EJG A;  3HRT A;  3JCM X;  3H8Z A;  4E7H A;  1W2B S;  2RJF A;  3UPU A;  5FU6 B;  1N8R C;  1IRE B;  2JUF A;  1LNX A;  1Q82 C;  4IUT A;  1VQ9 A;  2PUK B;  2XK0 A;  1VQ9 T;  2K2V A;  4M77 F;  4M7A A;  4DA4 A;  5A0G A;  4F7U B;  2XG8 D;  3S3M A;  1KQS S;  1B34 B;  2JNG A;  3H6Z A;  2KMT A;  4XTV A;  2X4W A;  5FU7 B;  5FRO A;  4BAC A;  2E65 A;  1YJW T;  1O9S A;  4C5I A;  2CZ0 B;  3VKI A;  3MEA A;  3OW2 S;  3HP9 A;  2RJE A;  4RMO A;  2LVM A;  4A54 A;  1UB4 A;  1IZ6 A;  5I2S A;  2E70 A;  3DKM A;  4FU6 A;  3SWN B;  4OF1 A;  3INZ A;  3M58 A;  3CCQ A;  2YHT A;  3PMT A;  3GIB A;  3CCQ T;  3OYJ A;  3OA6 A;  3OS0 A;  3X25 B;  2E10 A;  4QQD A;  3OYF A;  3JCM J;  5GAN 2;  2C06 A;  3WVE B;  4L59 A;  4C92 G;  2CZ7 B;  3PIO A;  4M78 A;  5FRN A;  4NL3 A;  3JRZ A;  1U1S A;  4RKU E;  5FU7 C;  4FSX A;  4L6V 5;  2DXB A;  4BI8 B;  5CKD A;  5GAN 4;  2JTM A;  4C0D B;  5GAO r;  1Q7Y U;  2PQW A;  3OY9 A;  5HKC A;  3E9G A;  2VV5 A;  3OSS C;  1KQ1 A;  3P8H A;  2QQA A;  3I56 T;  1Y71 A;  1VQN A;  3AHU A;  2XKO C;  3JSC A;  3O8V A;  2G3R A;  2L3R A;  1VQN T;  1GXI E;  4KUL A;  1U8R A;  5IAY A;  2RK1 A;  4KBM B;  5LJ3 f;  2DIG A;  1VQ4 A;  3FJP A;  3TRE A;  4A4K A;  4ZTJ A;  1K73 C;  3M56 A;  1UEB A;  4IUU A;  4RG2 A;  4M7A B;  1VIF A;  4ZN3 A;  4ZGJ B;  3G4S A;  4ATO A;  3A8M B;  2XDB A;  1UGP B;  3G4S T;  4JRP A;  3NTH A;  3JCM c;  1MGQ A;  2EJ9 A;  4A4E A;  4C8Q G;  2XDD A;  5KCH A;  3CXC A;  4PLL A;  5CKF A;  4YTL A;  5FLX E;  1JJ2 A;  4XU1 A;  1YCY A;  3PT9 A;  1M5Q 1;  4M7D A;  4MML A;  2EFI A;  1G3W A;  1TH7 A;  3HHT B;  3OS5 A;  2E12 A;  2JOY A;  4BDZ A;  2WSE E;  4X9D A;  3BDU A;  1N9R A;  2DXU A;  2RI2 A;  5KE3 A;  4DOV A;  4C92 D;  4XTU A;  4J7F A;  1WJS A;  3RIR A;  3LLR A;  2GFU A;  1Y07 A;  4O5V A;  1Q86 U;  4M7A C;  1FX7 A;  4M78 B;  5A0D A;  5HK3 A;  3GPL A;  3FEO A;  3P8B B;  4MDX A;  2K5L A;  4VUB A;  4D6W A;  2P0Q A;  2RHI A;  1WJR A;  4OB3 B;  3SD4 A;  3LYI A;  3VUB A;  1YJN A;  5J3B A;  2DKG A;  3DLM A;  3MET A;  3OYK A;  1MHN A;  1YJN T;  1K9M C;  3FIF A;  4EMG A;  1OI1 A;  4HCZ A;  2XID A;  3CCR A;  1G3T A;  4NL2 A;  4GY5 A;  2O4X A;  4XU3 A;  1Y7X A;  3VYG A;  3PGG A;  2HD0 A;  2F69 A;  1BKB A;  2JVV A;  2DZC A;  2Y90 A;  3QO3 A;  3QXE B;  4JUV A;  3JCM e;  3J80 E;  5LJ5 j;  3OS1 A;  3MP6 A;  5KH6 A;  1KC8 U;  1K8A C;  2JN0 A;  2RI5 A;  4J6W A;  1VQL A;  4OVA A;  5IN1 A;  1VQL T;  1XNI A;  4C8Q D;  2HAX A;  3WXM B;  4JRI A;  3SFM A;  1DJ7 B;  4MDW A;  4C5G A;  3OMC A;  4J8O A;  3JB9 H;  3BDL A;  4N4I A;  2L8D A;  5D6Y A;  4QVC A;  5LJ5 h;  2DTI A;  5GAN d;  1KQS A;  2RD1 A;  4EMK C;  3QII A;  3L2Z A;  4FT4 A;  3QYH B;  3EFS A;  2DJZ A;  4DQ2 A;  2K3Y A;  1VQO A;  2E1H A;  2R58 A;  5GAM j;  3SB2 A;  2YLC A;  1QVP A;  3V7S A;  1QVF S;  1R8O B;  3UT1 A;  4FM4 B;  3CCV A;  3E9F A;  4C8Q C;  1VQK A;  2XD0 A;  2PVO B;  4LDV A;  3CCV T;  4RCB A;  2RHY A;  2XIC A;  1VQK T;  2GCX A;  2XHC A;  3QZ5 B;  2QEX A;  3OYI A;  3GP8 A;  2QEX T;  1WNL A;  1Q81 C;  5GAM h;  4XU2 A;  4M75 C;  2V8K A;  5GAN 7;  3CPW A;  4BE1 A;  1UGR B;  3HRU A;  5DY9 A;  3RKY A;  5LJ5 d;  2K3X A;  4QVZ A;  4XK8 E;  1H3Z A;  2X4X A;  1M1K C;  2K4Y A;  2RI3 A;  2D9T A;  1PSE A;  4M7D C;  4PNO A;  2H3J A;  4UC4 A;  4LDX A;  1M9S A;  2O4X B;  3VJP A;  4IUV A;  3QPH A;  3HL8 A;  1QVG A;  2BIV A;  2E6N A;  3LH0 A;  2M16 A;  1BI0 A;  4N4H A;  2EQJ A;  5CK9 A;  1KQ2 A;  1I4K 1;  2ZPF B;  5GAN 6;  3GNF B;  2HQX A;  2EAY A;  5D6X A;  2QQR A;  2DXT A;  3CCJ A;  3CCJ T;  5GAM d;  1YJW A;  3V8J A;  3LGF A;  5I2M A;  4EDU A;  5LJ5 g;  3CME A;  3CCS T;  3CME T;  4M7A G;  3A8G B;  5A0L A;  3L2W A;  2DEQ A;  3HKS A;  3M5A A;  2FL7 A;  3MHX A;  4QW2 A;  2FYK A;  2GF7 A;  1PSF A;  4KUI A;  1NJI U;  2M0O A;  2D6F A;  1YIJ A;  5GAO q;  4ZN1 A;  1YIJ T;  4TVR A;  2HQE A;  4B9W A;  1K9M U;  2BKD N;  2LC4 A;  4C8Q F;  4B9X A;  2L5Q A;  5FU6 C;  1N6A A;  2KSS A;  2R57 A;  3OYY A;  4QQG A;  5AYF A;  2VUB A;  4PJO A;  3C95 A;  2OTJ A;  3M9Q A;  3CEY A;  1M1F A;  2P0K A;  2DD5 A;  3E1S A;  1BI2 A;  2RB6 A;  5GAM g;  5A2Q E;  1YIT T;  1YIT A;  1N9S A;  1D3B A;  3UDC A;  4M78 G;  2EJF A;  2LCL A;  2XU8 A;  4Y91 A;  3JCM d;  3HFO A;  5CCA A;  4PJO E;  3MEW A;  2EIF A;  3CCU A;  1NE8 A;  3CCU T;  2FHD A;  5GMK l;  3I56 A;  3SWN C;  5LJ3 e;  2JTF A;  3ASK A;  2CGH A;  3HFN A;  3C94 A;  1I8F A;  4C92 A;  1M90 C;  4Z02 A;  2VYT A;  3P8D A;  3PIP A;  2M9U A;  2E6Z A;  3X28 B;  3C4S A;  4C5E A;  3KBG A;  3V8L A;  2CZ6 B;  3OQ5 A;  3S6W A;  1AHJ B;  4M7A D;  2F5T X;  3LGL A;  4JJN K;  3GF5 A;  4Y28 E;  3FC3 A;  5EG2 A;  2CKK A;  3OMG A;  4P5N A;  4C0D C;  4C92 E;  1JB0 E;  1O75 A;  2GQV A;  4M77 A;  4E47 A;  1VQP A;  4RCC A;  1VQP T;  2ZPI B;  4LD6 A;  1U1T A;  4MZM A;  3QBY A;  5GAO p;  2RO0 A;  4II1 A;  4M75 G;  3TCJ A;  4JRQ A;  2Y4X A;  3QJ6 A;  4XTX A;  1Q81 U;  4OGC A;  5CQY A;  2DPP B;  3X20 B;  2R5M A;  4M7D G;  2CS7 A;  4OMF B;  3OYN A;  4A4G A;  1M1K U;  4M77 E;  4HCB A;  5GAN j;  4PJO B;  2A7Y A;  2QXF A;  4F7U F;  4XQ3 A;  4E7I A;  2MWP A;  4E7J A;  2RK2 A;  2EQK A;  2EQM A;  3FB9 A;  1N27 A;  5GAO l;  2MAM A;  4LDU A;  2XDP A;  4N0A A;  5GAN 8;  1QVF A;  4XTW A;  4BDY A;  1QW1 A;  1X75 C;  4M78 D;  5C0M A;  1D3B B;  2GFA A;  2KY9 A;  2NLU A;  2CYZ B;  4JLG A;  3VV0 A;  5M9O A;  3OYC A;  1N8R U;  3MEU A;  3S3O A;  1Q82 U;  3QUI A;  5GAN h;  3J7A F;  1KG1 A;  3VU3 C;  1M8V A;  2Y4Y A;  2P4T A;  3G6E A;  1VQ6 T;  2HBP A;  4Q5W A;  1VQ7 T;  4OGE A;  3G6E T;  2LRQ A;  3QDR B;  1KD1 C;  4J7I A;  2MI6 A;  3A8L B;  4N4G A;  2WAC A;  1Y96 A;  2FB7 A;  2ZGW A;  4C92 B;  3CC7 A;  2KDS A;  3CC7 T;  1SSF A;  1UGQ B;  3FRN A;  4XTY A;  4HCC A;  4M78 C;  2V8J A;  2QI2 A;  1W2B A;  4HKE A;  2IG0 A;  5CVI A;  4BI4 A;  3CC2 A;  2WSF E;  2QQS A;  1YI2 A;  3CC2 T;  1KHC A;  1XOV A;  1BIB A;  2PU9 B;  1YI2 T;  5GMK i;  4M77 B;  3LWI A;  4M75 D;  4F7U G;  3V7R A;  5D6W A;  2VXF A;  4XTZ A;  2B8A A;  3N5B B;  2YLB A;  3L42 A;  4JLI A;  3KXT A;  3OYD A;  4M7D D;  3SDZ A;  3OW2 A;  2ZPB B;  4EMH A;  3OYA A;  4M7A F;  1VQ5 A;  3RMQ A;  4CRI A;  3JCM W;  1VQ5 T;  2LCC A;  3VYH B;  1I81 A;  5KE2 A;  1Q7Y C;  3BW1 A;  3QKJ A;  4KT0 E;  3RKX A;  3RUX A;  4C5H A;  2DIQ A;  2LNV A;  3KUF A;  3JCM P;  3RKW A;  1JJ2 S;  1BI3 A;  1VIE A;  1ZQ1 A;  2XI9 A;  5LJ3 d;  5GAN g;  2DTH A;  2MWO A;  4A4H A;  1K73 U;  2PVD B;  4BD3 A;  2RH2 A;  3CBM A;  3M4Y A;  5GAO n;  4J6Y A;  2LTO A;  5KCO A;  2D0Q B;  4XAX B;  4BY6 B;  2HNI A;  3OYL A;  3BFM A;  5DLO A;  2RHU A;  4LDW A;  2FVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...