4QQ6A

Crystal structure of tudor domain of smn1 in complex with a small organic molecule
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
QQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of tudor domain of SMN1 in complex with a small organic molecule
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Survival motor neuron protein
total genus 10
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2014-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4qq6A00
2XK0A 5FRMA 4QQGA 5M9OA 3OS1A 4A4HA 4E7JA 3QBYA 2D9TA 4NS5A 2XDPA 2DIQA 2JZ2A 3SD4A 2FHDA 2R58A 4E7IA 3FLGA 1WJRA 2EKOA 5IN1A 3OYGA 3OYMA 4ZTJA 4HCZA 3S3MA 2LTOA 1N27A 3L2QA 4C5GA 3MO8A 3MEVA 3UWNA 2LCCA 3QIIA 4EDUA 4IUQA 2LRQA 2RJEA 3OS0A 2EFIA 3DLMA 4N4HA 3L2WA 4PLLA 2EQKA 3NTIA 3S3NA 3MP6A 3H6ZA 4QQ6A 2E5QA 1MHNA 2DAQA 2EQMA 3OYCA 3F70A 4IUTA 4IUVA 3MEUA 1WGSA 4E7HA 5CIUA 2F5KA 2RI3A 3FEOA 5KH6A 3OQ5A 4BE2A 2RJFA 2GFAA 2L8DA 2MWOA 5J26A 4PL6A 4C5EA 3BDLA 3UT1A 3OYIA 2RO0A 2BUDA 2YRVA 2R5AA 4N4IA 3OYEA 4IUUA 4II1A 3PMTA 2VYTA 2X4XA 3L2VA 4A4FA 3NTHA 1OYXA 4N4GA 4Z02A 4A4EA 3LX7A 3OMCA 4Q5WA 2IG0A 3PNWC 4LD6A 3L2UA 4L59A 2GFUA 3GOXA 2GF7A 3OYHA 3EAEA 5IAYA 4A4GA 3OS2A 2RHXA 2RHIA 2RHUA 2RI5A 2HQEA 2NLUA 2K3YA 4C5HA 3OYKA 2R57A 2G3RA 3OYJA 4BDYA 5C6SA 5KE3A 4FU6A 5KCHA 1RI0A 1SSFA 1WJQA 3M9QA 4UC4A 5D6WA 3QKJA 3P8HA 4CRIA 2O4XB 3CEYA 4C5IA 2RJCA 3MP8A 3ZEHA 5FROA 2RHZA 2JTFA 2EQJA 2P0KA 3DB3A 3META 3OYBA 3OYNA 1OZ3A 2QQRA 3L42A 1G5VA 1H3ZA 2DIGA 2LVMA 2E6NA 4IURA 2BKDN 2X35A 5C0MA 3FDRA 3OY9A 3LLRA 4BACA 2M1HA 3LH0A 3NTKA 4B9XA 4E7KA 3S3OA 4FL6A 4IKFA 5D6XA 2CKKA 4BE0A 2RHYA 3ME9A 3Q1JA 3OB9A 3PFSA 3P8DA 2M0OA 3LGFA 4X34A 3E9GA 3MEWA 3MEAA 4E7LA 4BDZA 5KCOA 2L89A 3QJ6A 4QQDA 4BE1A 3OYLA 4ZTFA 5FRNA 3PMIA 2HQXA 1OI1A 3MP1A 4QVZA 2MWPA 2X4WA 1KHCA 1OZ2A 3O8VA 1XNIA 5D6YA 3LGLA 2R5MA 2O4XA 2BIVA 2WACA 2RJDA 3LYIA 4OVAA 3KUFA 5J39A 4QW2A 2EQUA 5KE2A 3C4SA 2RI2A 2PQWA 3DB4A 4B9WA 4PLIA 2QQSA 3OYDA 3FC3A 3ASKA 3OYFA 2B8AA 2K3XA 4IUPA 3L2RA 2M16A 2LDMA 4BD3A 2X4YA 2L3RA 4RG2A 3OMGA 1WJSA 4GY5A 3OA6A 3S6WA 3OYAA 3E9FA 3H8ZA
chains in the Genus database with same CATH superfamily
2QEXQ 2E6ZA 2LJ1A 4A4HA 3PE0A 5LJ3f 4E7JA 2OTLA 1PKSA 4F7UB 1BI2A 4XU3A 1M1GA 1N5ZA 1M2VA 4J9GA 1OU8A 3CCLA 1VQ9A 1Y07A 1YN8A 4FYWB 4E47A 2J05A 4C92F 3UATA 2LCCA 3I35A 2E65A 3L2WA 4C0FA 4M77B 3NTIA 3G7ZA 5EG2A 1BBZA 3JCMW 4C8QA 3UT1A 1TS9A 4R0KA 1QVPA 1N6AA 2CDTA 4Z88A 1K9MC 4A4EA 1PWTA 1YJNT 2LNVA 1IB8A 2NLUA 1KQ2A 3CCSQ 4OMFB 3G71T 4FU6A 3M9QA 4CRIA 3CCRT 4CI0C 3V8JA 2A37A 4J9IA 2MCNA 5FROA 5IHKA 4PJOC 1FX7A 1NYGA 1QVFS 1BU1A 4MZPA 4BE0A 3CC4A 3WXMB 2QG9B 1YITT 1UECA 1WIEA 4X34A 2OTJA 4X9DA 3RMQA 2GQVA 2RK1A 1ACMB 2HQXA 3CBMA 2DF6A 1K73U 2QI2A 3HRUA 4OMNA 2F1LA 2WACA 2DL8A 2ZZDA 4AG2C 4HKEA 3I55A 1U1SA 4Y28E 1M3BA 2CP2A 3HHTB 1OOTA 1VQ9Q 1GXIE 1IGQA 4BD3A 4RTTA 4KH0B 1HSQA 1VQ7Q 2L5QA 1UHFA 4AG1C 3D7SB 4J83A 5LJ5h 1K9AA 2K9GA 4M75D 4E7IA 4KGXB 2AT1B 1UG1A 2DD4A 2C06A 5IHNA 4C8QF 2QTXA 4C5GA 3A98A 2HNIA 3CCJQ 3E19A 2D8HA 1KIKA 2KK4A 4JPBW 2LRQA 3DLMA 2XICA 4HA8A 5I2MA 1ZUKA 2E5QA 3M5AA 2RQWA 5ECAA 2MI6A 3OQ5A 4M7DG 2K2MA 1JU5C 2K3BA 4M75B 3JCMQ 4VUBA 3BW1A 5KYNA 1K73R 3E1SA 2HQHA 2YRDA 1R8OB 2FL7A 4RTWA 3OYJA 2KY9A 3HP9A 1YJWA 4JUVA 3CEYA 3TVTA 1TXQA 2CZ7B 2KXDA 2DIGA 2RQVA 5GANg 4KBMB 1W4SA 3FDRA 3LWIA 1VQPQ 1XOVA 2OI3A 1PD1A 4PJOG 3S3OA 5GAN7 4IKFA 2GTOA 2CKKA 3BY7A 1PHTA 3MEWA 4RCCA 3MEAA 3JSCA 2P84A 5LJ3e 1UUEA 1UGSB 1MNEA 3OSSC 3J80E 3C94A 1E7OA 3O8VA 5KYXA 1KHIA 5D6YA 3LGLA 1WFWA 2EYWA 1M90U 4K11A 1YWOA 5J39A 5LL6S 2VV5A 3DKMA 3GBQA 1NJIC 3J7AF 2MIOA 1NPPA 4PJOF 3DB4A 3FC3A 5I11A 4CC3A 1YIJQ 1D1AA 4JDSA 1SPKA 3OS1A 5CCAA 4D6WA 3V7CA 4F04B 2J06A 2DIQA 1M8MA 3M55A 1RAAB 4RTUA 2DZ9A 1QKWA 5CVIA 4DBFA 4M77E 4N0AC 3SWNA 4EMHA 2CREA 1NZ9A 2RQUA 1NJIR 1D1CA 1M90C 2E1HA 2DFUA 1AWWA 4D8KA 2IPOB 1I1JA 3PMTA 4FT2A 5KYXB 2VYTA 4EPCA 1YIJA 3NTHA 4X9CA 3JCMg 2EGEA 4M7AE 1VQPT 4M77G 4JZ3A 4A4GA 4M78E 2YT6A 2EAYA 2G3RA 1JJ2S 2VVKA 2EGCA 4F16A 2DE0X 3ZEHA 4C0GA 1KSWA 2JTFA 2P0KA 1OZ3A 4DOWA 2JNGA 5GANd 1VQ4T 1YP5A 4DA4A 2FVUA 3OB9A 3CCMT 1HJDA 1AD5A 1Y96B 1RAFB 4ME7A 3CD6Q 2NYSA 2R5MA 2BIVA 2L0AA 1OEBA 2LCLA 5A0GA 4DOVA 2YUPA 5LJ5e 2RN8A 1VUBA 5LJ5f 1UJYA 4EMGA 1C0MA 3L2RA 4IUPA 3EFRA 3PGGA 2XDBA 2BZXA 4ANJA 1OV3A 2DMOA 1UTIA 2YLCA 6AT1B 4NL3A 1OPKA 1V76A 2ZPIB 2CS7A 2GBQA 4OMLA 2LQWA 3QG1A 1VQLQ 1WJRA 1JXOA 3JCMd 1TU0B 2LJ0A 5AT1B 2LTOA 2W0ZA 1UGRB 2LT4A 3M56A 1TUGB 3CCMQ 2QA4Q 1RAIB 2DYIA 1VQ4Q 3MP6A 2Y90A 3CPWS 1QVFA 2EJ9A 3UF4A 1WGSA 4E7HA 2ABLA 2RI3A 2DTOA 3A8MB 3OYIA 1RADB 2L3PA 4J7FA 5GMKj 5L23A 1NLPC 2CUBA 1Y96A 4M7DC 2YUOA 3TEEA 2DTIA 3GP8A 3GOXA 1VYTA 3EAEA 3C95A 5LJ3j 4PFOA 2V8IA 2KRNA 3JCMV 3QKJA 4MMKA 2RJCA 1JJ2A 3EGXB 4QVDA 1G5VA 3L42A 4M7AB 2IIMA 5CAIA 2LVMA 1AHJB 2E70A 4M7AA 3RKWA 5C0MA 1UFFA 4KRTA 5HCKA 3JB9H 3JB9D 2DTHA 3M0UA 2ZPFB 2M0OA 2XKOC 3CMAT 4M75G 5DLQE 1SEMA 3PMIA 4GLKA 1VQLT 3EFOA 4C92B 2A0FB 2GTJA 3HRSA 4M75A 5FWBA 2CT4A 5FU7B 3X20B 2XMFA 2FPFA 5FU6B 1GCQC 3C4SA 2DKGA 2RMOA 2FG0A 1W2BA 1I81A 2LDMA 1RLQC 3JCMe 1QVGP 2EBPA 1G3WA 3KBGA 2KBTA 2KRSA 2KNBB 2DL3A 3M0TA 1A0NB 1GFCA 3M58A 2KRMA 2KEAA 1I8FA 3V7SA 5GMKe 3TU4K 3CCMA 5GAOp 1ZSZB 3AHUA 3I5SA 4IUQA 2EQKA 3DLLA 1SHGA 3JAME 3CCLQ 3OYYA 4LXCA 1T3LA 2CSQA 1NEGA 2QA4T 4C5EA 1G3SA 4OMPA 2H8HA 1OPLA 2EGAA 2H3EB 4XK8E 3OYEA 2DVJA 3NPFA 1M90R 1YJ9A 2J6OA 3PVQA 1M9SA 1HK9A 2DVEA 2COYA 1YHQA 3QDFA 2XG8D 2RQTA 4OMQA 4LUEA 1PM3A 4XU1A 4QKUA 5CQYA 1YIJT 1KD1C 1RL2A 3M59A 3P8HA 3QZ5B 3CD6A 5GMKi 3ER0A 5GAOn 1BIBA 4J6XA 2ZPHB 1H3ZA 1Q82C 2MYSA 5GANj 2D0QB 2M1HA 3EH2A 1H3HA 1FMKA 3VYHB 4JJDA 3CC7A 4JRQA 2CYZB 1AVZC 1EZZB 2DBKA 1O9SA 7AT1B 2QQBA 5EC7A 1QWEA 1WPYA 3CCLT 4PJMA 2P0PA 4OVAA 1MUZA 1BCOA 5GAMe 3R6OA 3QWXX 4MMLA 5GAMg 3M0QA 2Y4XA 2RK2A 1X6BA 3ULRB 2COZA 2V1QA 2PTKA 5KYUB 2K5LA 3EGDA 3VRYA 3GF5A 1RI9A 5GAN3 3I56T 3GLXA 1KQSP 4HT8A 4XTYA 2DEQA 1K0XA 1MHNA 1DJ7B 2D8JA 4IIMA 2CUDA 3OYCA 1YJWQ 1CKBA 4IUVA 2DK3A 4PFPA 2HKQB 4BE2A 1M3CA 2GFAA 5J26A 2MF2A 4RG8A 3SDZA 4II1A 3TSZA 3H0IA 2X3XD 1HD3A 1QQJA 4HVWA 1OYXA 2C0TA 3OMCA 1N8RR 3U23A 5LJ3h 2LP5A 5KYWA 1NLOC 2EJFA 2ZCFB 5DY9A 2ZGWA 4QT7A 1NG2A 4LD9K 2VXEA 1Q81U 2JS2A 1YJNQ 5L8RE 2MAMA 3VKIA 4XQ3A 1BI1A 1PD0A 1WJQA 2J6KA 4EMKB 3QZ9B 4P5NA 1YFNA 1G3YA 3RBBB 4C5IA 2RHZA 2LQKA 3CPFA 2LNHB 3UPUA 1XJWB 3LLRA 3EFSA 3CMAA 2HKNA 1Q81R 4BY6C 2K7AA 3PFSA 4OGCA 2DA9A 1BCMA 1N8RU 1PSFA 4QQDA 4XU2A 1QW1A 2CSIA 2L3QA 4J9HA 1WQ7A 4M77A 4E7SA 3M57A 1VQMA 3CC7T 5J3BA 2EVRA 4D8DA 4M78G 2RQRA 2LMJA 1YBYA 1KQSS 5A2QE 4E7ZA 3CD6T 1HXDA 4XTUA 4M77C 4ZGDB 4GY5A 1MMDA 3S6WA 1ZSZA 2K6DA 3JCMb 1NM7A 5FRMA 2RD1A 5GJVB 5CQXA 2BE7D 1IXDA 1S72T 2JZ2A 2CGHA 2FHDA 2R58A 1M1KC 2LC4A 3CCEQ 3JCMh 2ROLA 2ZAEA 1BKBA 5GAN6 3MO8A 1KJWA 5DLOA 1JRIA 3VJPA 3QYHB 1NYFA 1N9RA 2MPXC 4RMOA 1VQKT 1ZHIA 4NOYA 3VV0A 4ATOA 5CIUA 1R0CB 2SEMA 2VASA 3G4SA 2M9UA 2R5AA 2EIFA 4IUUA 2A28A 2FZKB 2JVVA 3PT9A 2NWMA 4KGVB 4C0DB 2XHCA 2DYBA 4Z02A 1ZSGA 4R55A 4J9FA 1E6HA 4JS5A 3CCQT 2QQ9A 3L2UA 2JJ9A 1FWZA 1KC8U 4C0DC 1KG1A 2RHIA 5IXBA 1YJ9T 1JBMA 3RESA 5C6SA 1MV3A 2K2VA 1AWOA 4OMOA 3VS4A 1SSFA 4UC4A 4NL2A 3CCET 4MDXA 3T9NA 4C0ZA 1N9SA 2QQRA 2X9HA 1OQKA 1CSKA 2QA4A 2EYZA 5FWCA 1ZBXA 1Q82R 3CBOA 2DL4A 3WVEB 3FB9A 2WSFE 1VQLA 2W10A 3ME9A 1KD1R 2JM8A 3EG2A 3CCVT 5HY6A 3TQ7P 5LJ5g 1VQ9T 1SKUB 2LT1A 1Y7XA 1B34B 3PIOA 2LJ3A 1K8AR 4PJOE 5CKFA 3CC7Q 2JW4A 1IHWA 3MKDA 2QQSA 4WTOB 2DXCA 2F2WA 4KH1B 2DJQA 4V2SA 4FSSA 2FPDA 2E12A 3CPWP 1ZUUA 1B3QA 2KE9A 3SWNC 5GAMf 2C0IA 3QYGB 1VQOT 1RABB 4M75E 1P92A 3S3MA 3LH5A 2YXYA 1YHQQ 1N27A 3L2QA 1G83A 4HCKA 1YJ9Q 2QK0A 2XD0A 5KYYB 1FMVA 1LOJA 4PJLA 2PVDB 4AMCA 2VC8A 1D09B 2H3JA 2EKHA 4JRPA 2PUOB 3QSUA 1K8AC 2FEIA 1ABOA 4F7UA 4RUGA 2ZPEB 1YI2A 2X4XA 1LJOA 4A4FA 1QVGA 2M51A 4RTZA 4BY6B 2IG0A 2KGTA 2KQWA 2RHXA 1C6VX 5GAOr 4C92D 2DXTA 1KD1U 3A8GB 3M4YA 3H0HA 2O4XB 2O31A 4OMMA 4JRKA 1X6OA 2LCSA 2EW3A 4FL6A 1VQ8T 4AFUC 1MV0B 2E4HA 3CMET 2YHTA 3FJ5A 3N5BB 4CC4B 1QCOA 5FU7C 2SRCA 2QASA 5KCOA 2ED0A 2EYQA 1QP2A 1OI1A 2LX7A 2X4WA 1VQ6T 4HCBA 2XU8A 3CC2T 2KR3A 1WA7A 2DXUA 4J9CA 3VS6A 2DNUA 3A8LB 4DEYA 4PLIA 3CCEA 3PVLA 1UGQB 3OMGA 1VQ5T 2Z0WA 3E9FA 1VIEA 5D7UA 2JM9A 3RNJA 3EG9A 4CC2A 2XDPA 3V7RA 2RH2A 5FLXE 1V1CA 2DRMA 3QDRB 3SFMA 3G6ET 1WZOA 1Q7YR 1X2KA 1RAHB 3P8BB 2CZ0B 3G71Q 1BK2A 4N4HA 2P4RA 3TSWA 4LDXA 2E5KA 2FB7A 3F70A 3VS1A 5KH6A 5CR2A 1OX9A 2HEQA 2VUBA 1TG0A 1I5LA 5GAN8 3VUZA 2ED1A 3G6EA 3EGXA 1WXBA 2V1RA 3A1PA 4M75F 5A0DA 1S72Q 1GL5A 2MOXA 3JCMc 1D3BA 1QCNA 4FIBA 1Q81C 4F14A 3OS2A 4J9EA 1K9MU 1U5SA 3CCRQ 2HQEA 2K3YA 2FO0A 4BDYA 2ECZA 1H92A 3H9NA 2WSEE 3TCJA 2AZVA 1K76A 1JJ2P 3META 2EQJA 3DB3A 2QDYB 1WYXA 2RNAA 3VS0A 2KYBA 1WQWA 2QAZA 3VS7A 3CC2A 4M7DF 3VYGA 2ATCB 4JLGA 4DQ2A 3VS2A 2K57A 4M4ZA 4M78C 1N8RC 3QWYA 5FRNA 1T0JA 2F2VA 1D3BB 4ZTFA 2HZYA 2JTEA 1QWFA 4ZGJB 1WNLA 1TWBA 4RTXA 4HXJA 3LYIA 3G71A 3M54A 3EG3A 4X1VA 1PRMC 1YCSB 5CKBA 2PNIA 3I55Q 2L2PA 3ASKA 3CMAQ 9ATCB 2NUPB 1PCXA 2QDLA 2AIRB 5HK0A 2HMAA 5GANe 4XTZA 4C92G 5GAN4 2OTJQ 1MMAA 3I5RA 1Q7YC 3JV3A 3FLGA 1FXXA 3CCJT 4HCZA 3OW2P 2LQNA 1W1FA 1BI0A 3QIIA 2NUTA 2DL5A 4J6YA 1PSEA 4ELZC 1ZA1B 1BI3A 2KI7A 2DZCA 1R0BG 1OU9A 4QQ6A 2JOYA 3H6ZA 3S3NA 4L6V5 5GAMh 2HBWA 1GBQA 4PK4A 2GCXA 1WHKA 4BB7A 3BDLA 2RO0A 2FZCB 3EG0A 4JJCA 3SHWA 1EIFA 1X01A 4ZGEB 1Q86C 5IT9E 1WXTA 2EWNA 2FPEA 4XAXB 1NEBA 2JN0A 2RB6A 1JO8A 4ESRA 1AWXA 5CKEA 3C12A 2FZGB 3V8KA 3NMZC 2COWA 5CKHA 3I55T 1ABQA 2E6NA 2BKDN 2KXCA 1QVFP 1WDXA 2PU9B 1YI2Q 2VGNA 1QCFA 4F7UG 2CH4W 1BYMA 4M7DD 2OAWA 3LGFA 2OTLQ 1X75C 2HCKA 4BE1A 1V29B 4BI8B 4OB1B 1VQOA 3JB9I 1PNJA 3SB2A 2CZ6B 1U1TA 2RJDA 2CP5A 1EFNA 1BB9A 3KFVA 4WF2A 5CO7A 3GPLA 1IRXA 1TSFA 2B8AA 4DEXA 4RTVA 3RKYA 3HSBA 3J81E 3SWNB 3FRNA 1MMGA 1I4K1 1YWPA 3H8ZA 2YRCA 3OS5A 2RPNA 1JQQA 2D9TA 3IQLA 4NS5A 4PNOA 4PJNA 3CCQA 2EYYA 3M0SA 3I9QA 3MCAB 3VS5A 3OYMA 1C1AA 1ZSZC 1WHGA 2E64A 4M78F 3EH1A 3REAB 2VWFA 1YITA 1GRIA 4MDWA 2D1XA 3AT1B 1WHMA 3I56A 2XIDA 4FT4A 2NUPA 4FYYB 3EGDB 3HPWA 3CCQQ 2EQIA 1VQ5Q 2YUNA 3RIRA 2YRVA 4OF1A 1F1BB 3KXTA 5CK9A 1SG5A 5HKCA 4DBHA 3QPHA 2YWWA 2ESWA 4L59A 2GFUA 2YLBA 5IAYA 1NPRA 2IVWA 2K79A 2F2XA 2V8JA 2ENMA 5KCHA 5GANf 1AEYA 1XQHA 1QP3A 4C92E 4BI4A 1RACB 3JCMX 2JXBA 3LWHA 3V8LA 4CC7A 4LDYA 3A8HB 3ZFJA 2E3IA 3NTKA 4QVCA 1IREB 1RAEB 1VQ6Q 4F7UE 1WHLA 4E7LA 4J9DA 2DEUA 2EJGA 2MWPA 2BE9B 2QGGA 1NE8A 2KROA 1JB0E 1XNIA 2X4JA 4LDWA 1Y57A 5GAN2 1MMNA 1CKAA 2L3SA 4N0AA 1Z9QA 4M7DB 4BUGA 5GMKl 5AYFA 4B6MA 3OW2A 3VRZA 1Q7YU 2NUTB 2DETA 2CP3A 5M9OA 4KT0E 2KT1A 4EIKA 2C0OA 2BTTA 4FYVB 1T3SA 3CCSA 2LZ6B 2DXBA 3CQTA 1R77A 2I2LA 2J7IA 4M7AC 2G6FX 4XU0A 3OW2S 2M02A 1X27A 2DX1A 1TUCA 1UDLA 2F5TX 3RKXA 1SSHA 3X24B 1JEGA 4FCYA 2F69A 2E10A 4PLLA 4A53A 1H8KA 3CCVA 2GGRA 2DAQA 4LN2A 4GLMA 4JJBA 1VA7A 4WCIA 3VUBA 4IIOA 3HFOA 1KQSA 4R56A 1U3OA 1UEBA 1D1BA 1FYNA 3H0FA 4Y91A 1W6XA 4A4KA 1X2QA 3UDCA 2WSCE 2BZYA 4DBQA 3OYHA 4F17A 4EMKC 8AT1B 4OP0A 1Y71A 3INZA 2LQ8A 2E3HA 2DD5A 1YJNA 2A7YA 1M27C 3RR6A 1ZUYA 1W2BS 4J7IA 2HSEB 3FIFA 4ZNXA 4B9XA 4E7KA 2P0QA 2QQAA 3P8DA 4RKUE 4BDZA 1U06A 2YUQA 1OZ2A 3CCST 3X26B 4HT9A 1Y0MA 4YTLA 2X51A 4KULA 1EX4A 1ZX6A 3HTRA 2EPDA 5I2SA 2QYZA 1G3TA 1O75A 4JZ4A 4C8QG 4F7UF 1S72A 4ZN1A 4ORZA 2OTLT 3THKA 1WHHA 2M16A 3M4GA 2O9SA 3G6EQ 4M7AG 3CXCP 4BI3A 2B86A 4QQGA 1X43A 1M2OA 2VB6A 5CKDA 3VU3C 5HK3A 3EHQA 4ZTJA 3CCVQ 5DM7R 2KVQG 2OAUA 2HSPA 3TREA 4KUDK 3CCUA 4AFZC 1LVKA 2PUKB 2EFIA 4OGEA 1WHJA 3HFNA 1M3AA 3E2UA 2X3WD 3MPUB 3MEUA 3GNFB 3FEOA 4OB3B 3EG1A 2AK5A 2RJFA 2L8DA 3JCMJ 2CP7A 2GQIA 2QEXT 2QGFB 1MGQA 1VIFA 3EFOB 4C92A 5LJ5j 4N4GA 2ROTA 4GBQA 3PNWC 2KSSA 2YSQA 2KYMA 4PJOA 2RI5A 3EHRA 3FJPA 1VQ5A 4C5HA 2R57A 1X6GA 4AFSC 1PG5B 3L2ZA 4M78A 4M77F 1QMCA 4PFZA 3RUXA 1OX8A 2X35A 1IGUA 3QUIA 3OY9A 1TOVA 2Y4YA 2DO3A 4BACA 2FRYA 1KQ1A 1M1KR 4LDVA 1ARKA 1KFZA 5I22A 1VYUA 4JRIA 3QXEB 3E9GA 1AZEA 4O5VA 4LDUA 4ZN3A 1VQNT 1RAGB 3CMEA 1VQ8A 1OULA 4M78B 4MZMA 2XDDA 2DRKA 3JB9G 3CCJA 1VOMA 5KE2A 1VQ7T 4B9WA 5GAOl 2K3XA 2MMPA 1VQPA 3QHSA 2L3RA 1WI7A 1WJSA 2AKKA 1VQ8Q 1VQOQ 2K5FA 1IO6A 3LW5E 1LPLA 2K5IA 3QBYA 3CPWA 3SD4A 1QVGS 3QJYA 5IN1A 1IZ6A 2EKOA 3I56Q 2JMCA 2HAXA 3CBPA 1M5Q1 3M0PA 5LJ3g 4M78D 1VQKA 1GFDA 1WXUA 4KUIA 1YITQ 2RF0A 4M7DE 1YNZA 4EDUA 3MJXA 2RJEA 3OS0A 2CH4A 3JCMf 4DBRA 2DM1A 2QTVA 4M7DA 1UB4A 4IUTA 4J6WA 1GBRA 2HD0A 2MWOA 1K73C 1KK7A 4J5YA 2CP0A 2PVGB 1SRLA 3L2VA 3BDUA 3LX7A 4C8QC 1W70A 1PKTA 2BZ8A 4LD6A 4AFQC 2YDLA 3X25B 4XTWA 2RA2A 2RHUA 2PVOB 2O2OA 2PZ1A 1YHQT 1RI0A 1S1NA 3C0CA 1K4US 2E41A 5GMKm 1VQ7A 1HYOA 3RERA 3HL8A 1PC0A 3CCUQ 3OSVA 1WX6A 4PJOB 2DBMA 2RHYA 2EYXA 1ZA2B 2CP6A 2J6FA 3PIPA 1K9MR 1XTDA 3EGUA 1NBEB 5GAMd 1M1FA 4LUDA 1SHFA 1VQ4A 3M53A 2O4XA 4Y92A 2JS0A 1YJWT 2KDSA 3KUFA 2RM4A 1AWJA 1E6GA 2EQUA 3CC4Q 3A5ZB 5GAOm 2M0YA 2PQWA 5A0LA 3UA7A 3OYDA 3M0RA 4A63B 2AHJB 1UHCA 1D0YA 5GMKh 5FW9A 2HBPA 3G4SQ 3CXCA 5GAN5 1YI2T 2OJ2A 2GNCA 3SEMA 2VXFA 2V8KA 1VQNA 3EG9B 4Z89A 4FM4B 5GAMj 4A54A 4M7AF 3OBWA 2DL7A 2FYKA 1SRMA 2F5KA 4OB0B 4PL6A 1WLPB 4N4IA 2DLPA 1I0CA 1KC8C 4C92C 2CZ1B 4M7AD 2AKLA 4Q5WA 3L1AA 1UGPB 4M75C 1M4ZA 1VQKQ 3H41A 4C8QD 2JT4A 3R6NA 3X28B 1M1KU 3PTAA 4HVUA 1TUDA 4HCCA 1I07A 3RMSA 3OYKA 1UGVA 3VS3A 4ELYC 3JB9J 2KMTA 5D6WA 1VQMQ 1FMWA 2AZSA 3MP8A 4L5GA 2QEXA 3OYNA 1K1ZA 4IURA 4EMKA 3G1JA 4FSXA 1U8RA 1I5OB 4E6RA 1PRLC 2K4YA 1IHVA 5IH2A 2OTJT 3CC2Q 3A8OB 1Q95G 5D6XA 5I21A 4JS4A 3UA6A 3JCMP 3Q1JA 3CCUT 1Q86R 4C8QE 3GNGA 3QJ6A 1VYVA 3MP1A 5KYYA 4OB2B 3CMEQ 4FW2A 3ZL7C 2O88A 4MZTA 2JTMA 4HVVA 3CCRA 3REBB 4XTVA 2P4TA 5GANh 2A36A 4PJOD 4RCBA 3HRTA 2RI2A 5GAOq 2D0NA 1B07A 3OYFA 5IHIA 2DJZA 4PKCC 3ZBDA 3O5ZA 2X4YA 2HL5C 1SF9A 3OA6A 3OYAA 2XK0A 1AZGB 3URGA 4Z8AA 4J8OA 2NUZA 3OBYA 5KYUA 3MHXA 1VQ6A 3JB9F 3CXCS 4FW1A 3BE3A 1MNDA 3NHNA 3OYGA 1VQMT 1M2VB 3RDVA 1RUWA 4LE9A 2JUFA 2HDAA 3MEVA 5FU6C 3UWNA 5GJWB 1AT1B 3NGPA 1TH7A 1J3TA 1GCQA 2QXFA 1M8VA 1UJ0A 1RLPC 2DPPB 1QKXA 2EQMA 2VKNA 3HKSA 1B7TA 2MK5A 3BFMA 4KGZB 1YCYA 1ZQ1A 2HL3A 8ATCB 2BUDA 2D6FA 2ZPGB 1ZBJA 1LNXA 2ZPBB 3QO3A 4E2FB 1B34A 2A3LA 2DERA 2VGMA 3JRZA 1X69A 1K8AU 1LCKA 2A08A 1AOJA 2V26A 2OX7A 2KT8A 1W2BP 2JMAA 2KAFA 2GF7A 2O01E 2CT3A 1Q86U 1BIAA 4TVRA 5IXFA 5KE3A 2O9VA 3WVDB 4PJJA 2I0NA 3OYBA 2XI9A 4O6JA 5LJ5d 1Q82U 1D0XA 4LNPA 1K0SA 1H641 1Z9ZA 3NFCA 3G4ST 2LX9A 3LH0A 4RTYA 4C8QB 2FRWA 1M30A 1T0HA 4J9BA 2L89A 3OYLA 4FYXB 2DILA 1D0ZA 1KC8R 3CC4T 4QVZA 4JJNK 1KHCA 1ZLMA 1JXMA 1GCPA 4AT1B 3GIBA 1UE9A 4QW2A 1QLYA 4JLIA 1TTHB 1VQNQ 4M77D 5LJ3d 4XTXA 1G2BA 4RG2A 5KYWB 1NJIU 1G8XA
chains in the Genus database with same CATH topology
2E6ZA 4QQGA 1G3WA 3KBGA 4A4HA 5LJ3f 4E7JA 2OTLA 5CKDA 2XDPA 3V7RA 1BI2A 2RH2A 1M1GA 4XU3A 3VU3C 5FLXE 4F7UB 3CCLA 5HK3A 3M58A 3QDRB 4ZTJA 1VQ9A 1Y07A 3SFMA 5DM7R 3G6ET 1I8FA 3V7SA 2KVQG 2OAUA 5GMKe 4E47A 3TU4K 3CCMA 3P8BB 3TREA 4C92F 2CZ0B 5GAOp 2LCCA 3CCUA 4KUDK 3AHUA 2E65A 2PUKB 4IUQA 3L2WA 4C0FA 2EFIA 4N4HA 4OGEA 3HFNA 2EQKA 3NTIA 4M77B 3DLLA 4LDXA 3JAME 2FB7A 3F70A 3OYYA 3MEUA 3GNFB 3FEOA 3G7ZA 4OB3B 5EG2A 5KH6A 5CR2A 2QA4T 2RJFA 1G3SA 2L8DA 4C5EA 3JCMJ 2VUBA 3JCMW 4C8QA 1I5LA 2QEXT 3UT1A 4XK8E 1MGQA 3OYEA 5GAN8 1QVPA 1N6AA 1VIFA 3VUZA 4C92A 5LJ5j 3G6EA 4N4GA 1K9MC 4A4EA 1YJ9A 3PNWC 4M75F 1YJNT 5A0DA 1M9SA 1HK9A 2DVEA 2KSSA 2LNVA 3JCMc 1D3BA 1YHQA 4FIBA 2XG8D 1Q81C 3OS2A 4PJOA 1K9MU 2RI5A 3FJPA 2HQEA 1VQ5A 2NLUA 2K3YA 4XU1A 5CQYA 2R57A 4C5HA 4BDYA 1KQ2A 1YIJT 4OMFB 3G71T 2WSEE 4FU6A 3M9QA 3TCJA 3L2ZA 4M78A 1KD1C 4CRIA 1RL2A 3M59A 3P8HA 3QZ5B 3V8JA 4CI0C 3CCRT 3CD6A 5GMKi 5FROA 3ER0A 3META 2EQJA 1BIBA 3DB3A 4M77F 5GAOn 4J6XA 2QDYB 3RUXA 2ZPHB 1H3ZA 4PJOC 2X35A 1Q82C 3QUIA 1FX7A 3OY9A 5GANj 2Y4YA 1WQWA 2D0QB 2DO3A 4BACA 2M1HA 1KQ1A 3CC2A 1QVFS 4LDVA 4M7DF 3VYGA 4MZPA 3VYHB 4BE0A 4JLGA 4DQ2A 3CC7A 3CC4A 2K57A 4JRQA 2CYZB 3QXEB 4JRIA 3WXMB 4M78C 1YITT 4X34A 3E9GA 1N8RC 4O5VA 2OTJA 4X9DA 4LDUA 1O9SA 3RMQA 4ZN3A 5FRNA 4ZTFA 1D3BB 1VQNT 2GQVA 2QQBA 2RK1A 2HQXA 1WPYA 3CBMA 3CMEA 1K73U 1VQ8A 3CCLT 2QI2A 4ZGJB 3HRUA 2P0PA 2WACA 1WNLA 4M78B 2ZZDA 4MZMA 3LYIA 4OVAA 2XDDA 3G71A 3JB9G 4HKEA 3M54A 3CCJA 3I55A 1U1SA 4Y28E 5CKBA 5KE2A 5GAMe 1VQ7T 3R6OA 4B9WA 3HHTB 3ASKA 5GAOl 2K3XA 2MMPA 1GXIE 1VQPA 4MMLA 4BD3A 3QHSA 2L3RA 5GAMg 1WJSA 5HK0A 2K5FA 2Y4XA 2L5QA 3LW5E 5GANe 4J83A 4XTZA 4C92G 5LJ5h 5GAN4 2K5IA 2RK2A 3QBYA 3CPWA 4M75D 3SD4A 4E7IA 1QVGS 1Q7YC 3QJYA 2DD4A 3FLGA 1IZ6A 2EKOA 5IN1A 1FXXA 3CCJT 2C06A 4HCZA 4C8QF 2K5LA 2HAXA 3CBPA 1M5Q1 5LJ3g 2QTXA 3GF5A 4M78D 4C5GA 1VQKA 2HNIA 5GAN3 3I56T 4KUIA 3E19A 1BI0A 3QIIA 4M7DE 2KK4A 4EDUA 3GLXA 2LRQA 1PSEA 2RJEA 3DLMA 4J6YA 3JCMf 4ELZC 1BI3A 4XTYA 2DEQA 3OS0A 2XICA 4HA8A 2DZCA 2JOYA 3S3NA 3H6ZA 4QQ6A 2E5QA 1MHNA 1DJ7B 5I2MA 4L6V5 5GAMh 3OYCA 3M5AA 4M7DA 1UB4A 4IUTA 4J6WA 2HD0A 4IUVA 2DK3A 2MI6A 3OQ5A 2GCXA 4BE2A 4M7DG 2GFAA 5J26A 2MWOA 2MF2A 1K73C 4BB7A 3BDLA 2RO0A 4J5YA 4RG8A 3SDZA 4II1A 2PVGB 3L2VA 4M75B 3JCMQ 3BDUA 4VUBA 1EIFA 1OYXA 3LX7A 1X01A 3OMCA 3BW1A 4ZGEB 5LJ3h 4C8QC 5IT9E 1Q86C 2EJFA 2ZCFB 4LD6A 2EWNA 3E1SA 5DY9A 2ZGWA 3X25B 4LD9K 2VXEA 1Q81U 4XTWA 4XAXB 5L8RE 2MAMA 2RA2A 2RHUA 3VKIA 1R8OB 2FL7A 2JN0A 2PVOB 3OYJA 2RB6A 4XQ3A 1BI1A 2KY9A 3HP9A 1RI0A 5CKEA 1WJQA 1YHQT 1YJWA 4JUVA 4EMKB 3C12A 2E41A 3CEYA 1G3YA 3QZ9B 4P5NA 2RHZA 4C5IA 5GMKm 2LQKA 3V8KA 1VQ7A 2CZ7B 5CKHA 3RERA 3I55T 2DIGA 5GANg 2E6NA 3HL8A 2BKDN 4KBMB 3CPFA 1W4SA 3FDRA 3UPUA 3OSVA 3LLRA 3LWIA 3EFSA 3CMAA 1XOVA 2PU9B 4PJOG 3S3OA 5GAN7 4PJOB 4BY6C 4IKFA 2CKKA 2VGNA 4F7UG 2RHYA 3PFSA 4OGCA 1BYMA 3BY7A 4M7DD 3LGFA 3MEWA 4RCCA 3MEAA 1X75C 3JSCA 3PIPA 1XTDA 1N8RU 1PSFA 4QQDA 4XU2A 1UGSB 1QW1A 5LJ3e 4BE1A 1V29B 1WQ7A 4M77A 5GAMd 1M1FA 3OSSC 4BI8B 3M57A 1VQMA 3J80E 4OB1B 5J3BA 3CC7T 1VQOA 3C94A 3JB9I 1VQ4A 3SB2A 2CZ6B 3O8VA 1KHIA 5D6YA 3LGLA 3M53A 1U1TA 2O4XA 1M90U 2RJDA 1YJWT 2KDSA 4M78G 5J39A 3KUFA 2VV5A 2RM4A 5LL6S 3DKMA 2EQUA 1YBYA 4WF2A 1NJIC 1KQSS 3J7AF 3A5ZB 5GAOm 1NPPA 5CO7A 5A2QE 4PJOF 2PQWA 3GPLA 3DB4A 5A0LA 3OYDA 3FC3A 3CD6T 1HXDA 2B8AA 2AHJB 4XTUA 3RKYA 3HSBA 4M77C 3J81E 3SWNB 3FRNA 4JDSA 4GY5A 4ZGDB 1I4K1 3S6WA 5GMKh 3JCMb 3H8ZA 2HBPA 3OS5A 5FRMA 2RD1A 3CXCA 5CQXA 5GAN5 3OS1A 1YI2T 5CCAA 4D6WA 3V7CA 2D9TA 4NS5A 3CCQA 4PNOA 1S72T 2DIQA 2CGHA 2JZ2A 2FHDA 2R58A 1M1KC 3M55A 2LC4A 3MCAB 3OYMA 3JCMh 2E64A 2VXFA 2V8KA 4M78F 2DZ9A 1VQNA 5CVIA 1BKBA 5GAN6 3MO8A 4FM4B 5GAMj 1YITA 4A54A 4MDWA 4M77E 5DLOA 1JRIA 4N0AC 3OBWA 3SWNA 3VJPA 4M7AF 3QYHB 3I56A 1N9RA 4EMHA 2XIDA 4RMOA 1NZ9A 1ZHIA 4NOYA 2FYKA 1M90C 1VQKT 4FT4A 2E1HA 3VV0A 4ATOA 3HPWA 5CIUA 2F5KA 4OB0B 4PL6A 3RIRA 3G4SA 2YRVA 2M9UA 2R5AA 2EIFA 4N4IA 4IUUA 4OF1A 2JVVA 3PT9A 3PMTA 4FT2A 1KC8C 2VYTA 4C0DB 4C92C 4EPCA 3KXTA 1YIJA 2CZ1B 5CK9A 3NTHA 2XHCA 4X9CA 4Z02A 5HKCA 3JCMg 4R55A 4M7AD 4Q5WA 3L1AA 3QPHA 4JS5A 1UGPB 2QQ9A 4M75C 1M4ZA 3L2UA 4L59A 3CCQT 4M7AE 1FWZA 2GFUA 4M77G 1VQPT 2YLBA 5IAYA 4C0DC 1NPRA 4C8QD 1KC8U 3X28B 4A4GA 1KG1A 2IVWA 3PTAA 1M1KU 2RHIA 1YJ9T 4HCCA 4M78E 3RMSA 1JBMA 2EAYA 3OYKA 2G3RA 1JJ2S 2V8JA 3RESA 4ELYC 2K2VA 5C6SA 5KCHA 3JB9J 1SSFA 2KMTA 4UC4A 5D6WA 5GANf 4NL2A 3CCET 4MDXA 3MP8A 3ZEHA 1XQHA 4C0GA 4L5GA 2JTFA 2P0KA 3T9NA 4C0ZA 2QEXA 1QP3A 4C92E 3OYNA 1N9SA 1OZ3A 2QQRA 4BI4A 2QA4A 4IURA 4EMKA 1ZBXA 4FSXA 4DOWA 3JCMX 2JNGA 5GANd 1U8RA 3LWHA 3V8LA 4LDYA 3A8HB 2K4YA 3CBOA 3NTKA 3ZFJA 2OTJT 3WVEB 3FB9A 1VQ4T 4DA4A 3A8OB 2WSFE 5D6XA 5I21A 4JS4A 1VQLA 4QVCA 1IREB 3ME9A 2FVUA 3Q1JA 3OB9A 4F7UE 3CCUT 3JCMP 3CCMT 4C8QE 4E7LA 3GNGA 3QJ6A 3CCVT 5HY6A 1Y96B 4ME7A 5LJ5g 1VQ9T 3MP1A 2EJGA 2MWPA 2LT1A 1Y7XA 4OB2B 1B34B 4MZTA 1NE8A 2X4JA 1JB0E 1XNIA 2JTMA 4LDWA 2R5MA 3PIOA 2BIVA 3CCRA 2LCLA 4PJOE 5A0GA 4XTVA 2P4TA 5GAN2 5CKFA 4DOVA 5GANh 4PJOD 5LJ5e 1VUBA 5LJ5f 4RCBA 3HRTA 2RI2A 4EMGA 5GAOq 4N0AA 4M7DB 2QQSA 4BUGA 5GMKl 3L2RA 3OYFA 4IUPA 1NJIU 3EFRA 3PGGA 2DJZA 4PKCC 3ZBDA 5AYFA 2XDBA 2X4YA 3OW2A 2DXCA 3OA6A 3OYAA 1Q7YU 2XK0A 2YLCA 4V2SA 5M9OA 4KT0E 3URGA 4J8OA 3OBYA 4NL3A 2ZPIB 2E12A 3MHXA 2CS7A 5GAMf 3SWNC 3CCSA 1VQ6A 2DXBA 3JB9F 3QYGB 3CXCS 3QG1A 1VQOT 2I2LA 1WJRA 3OYGA 4M75E 1VQMT 1P92A 4M7AC 3JCMd 3S3MA 4XU0A 2LTOA 3OW2S 1N27A 1UGRB 3L2QA 2JUFA 2F5TX 2LT4A 3M56A 3MEVA 5FU6C 3RKXA 3UWNA 3X24B 2XD0A 2F69A 1LOJA 1TH7A 2E10A 4PLLA 4A53A 2PVDB 2QXFA 1M8VA 3MP6A 3CCVA 2DPPB 2Y90A 2VC8A 3CPWS 1QVFA 2DAQA 2EQMA 2EJ9A 2H3JA 3HKSA 4JRPA 2PUOB 1WGSA 4E7HA 3BFMA 3QSUA 1YCYA 2RI3A 2DTOA 1ZQ1A 1K8AC 3A8MB 3VUBA 3HFOA 1KQSA 3OYIA 2BUDA 2D6FA 4F7UA 2ZPGB 4R56A 2ZPEB 1LNXA 1UEBA 2ZPBB 3QO3A 1B34A 2A3LA 2X4XA 4Y91A 2VGMA 4J7FA 1LJOA 5GMKj 3JRZA 4A4FA 1QVGA 1K8AU 4BY6B 4A4KA 1Y96A 2IG0A 4M7DC 3TEEA 3UDCA 2WSCE 2DTIA 3GP8A 2KAFA 3GOXA 2GF7A 3OYHA 3EAEA 2O01E 2KQWA 2RHXA 3C95A 4EMKC 5GAOr 5LJ3j 4OP0A 4C92D 1Q86U 1Y71A 1BIAA 2DXTA 3INZA 4TVRA 2LQ8A 3A8GB 2V8IA 3M4YA 5KE3A 1KD1U 3WVDB 2DD5A 3JCMV 3QKJA 2O4XB 4MMKA 2RJCA 1YJNA 1JJ2A 3OYBA 2XI9A 4QVDA 4O6JA 2A7YA 3L42A 4M7AB 5CAIA 5LJ5d 1G5VA 2LVMA 1AHJB 2E70A 1Q82U 3RKWA 4HT8A 4M7AA 4JRKA 5C0MA 1W2BS 1X6OA 4J7IA 1H641 3NFCA 3FIFA 3G4ST 2LX9A 3LH0A 3JB9H 4C8QB 4B9XA 4E7KA 4FL6A 3JB9D 1VQ8T 2DTHA 2P0QA 3CMET 2QQAA 2YHTA 3N5BB 2ZPFB 3P8DA 2M0OA 5FU7C 2XKOC 3CMAT 4RKUE 4BDZA 4M75G 2L89A 5KCOA 3OYLA 5DLQE 2EYQA 3PMIA 1QP2A 1OI1A 4GLKA 4QVZA 3CC4T 1VQLT 2X4WA 4JJNK 1KHCA 4C92B 4HCBA 2XU8A 1OZ2A 3CCST 3CC2T 1VQ6T 3X26B 3GIBA 4HT9A 3HRSA 4M75A 4YTLA 4KULA 5FU7B 3X20B 4QW2A 2DXUA 5FU6B 5I2SA 1G3TA 1O75A 3C4SA 4JLIA 4C8QG 4F7UF 3A8LB 2DKGA 1S72A 4M77D 4PLIA 4ZN1A 3CCEA 2OTLT 1W2BA 1I81A 2M16A 2LDMA 3M4GA 1UGQB 5LJ3d 4XTXA 3JCMe 4RG2A 3OMGA 4M7AG 1VQ5T 4BI3A 3E9FA 1YI2A 1VIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XK0 A;  5FRM A;  4QQG A;  5M9O A;  3OS1 A;  4A4H A;  4E7J A;  3QBY A;  2D9T A;  4NS5 A;  2XDP A;  2DIQ A;  2JZ2 A;  3SD4 A;  2FHD A;  2R58 A;  4E7I A;  3FLG A;  1WJR A;  2EKO A;  5IN1 A;  3OYG A;  3OYM A;  4ZTJ A;  4HCZ A;  3S3M A;  2LTO A;  1N27 A;  3L2Q A;  4C5G A;  3MO8 A;  3MEV A;  3UWN A;  2LCC A;  3QII A;  4EDU A;  4IUQ A;  2LRQ A;  2RJE A;  3OS0 A;  2EFI A;  3DLM A;  4N4H A;  3L2W A;  4PLL A;  2EQK A;  3NTI A;  3S3N A;  3MP6 A;  3H6Z A;  4QQ6 A;  2E5Q A;  1MHN A;  2DAQ A;  2EQM A;  3OYC A;  3F70 A;  4IUT A;  4IUV A;  3MEU A;  1WGS A;  4E7H A;  5CIU A;  2F5K A;  2RI3 A;  3FEO A;  5KH6 A;  3OQ5 A;  4BE2 A;  2RJF A;  2GFA A;  2L8D A;  2MWO A;  5J26 A;  4PL6 A;  4C5E A;  3BDL A;  3UT1 A;  3OYI A;  2RO0 A;  2BUD A;  2YRV A;  2R5A A;  4N4I A;  3OYE A;  4IUU A;  4II1 A;  3PMT A;  2VYT A;  2X4X A;  3L2V A;  4A4F A;  3NTH A;  1OYX A;  4N4G A;  4Z02 A;  4A4E A;  3LX7 A;  3OMC A;  4Q5W A;  2IG0 A;  3PNW C;  4LD6 A;  3L2U A;  4L59 A;  2GFU A;  3GOX A;  2GF7 A;  3OYH A;  3EAE A;  5IAY A;  4A4G A;  3OS2 A;  2RHX A;  2RHI A;  2RHU A;  2RI5 A;  2HQE A;  2NLU A;  2K3Y A;  4C5H A;  3OYK A;  2R57 A;  2G3R A;  3OYJ A;  4BDY A;  5C6S A;  5KE3 A;  4FU6 A;  5KCH A;  1RI0 A;  1SSF A;  1WJQ A;  3M9Q A;  4UC4 A;  5D6W A;  3QKJ A;  3P8H A;  4CRI A;  2O4X B;  3CEY A;  4C5I A;  2RJC A;  3MP8 A;  3ZEH A;  5FRO A;  2RHZ A;  2JTF A;  2EQJ A;  2P0K A;  3DB3 A;  3MET A;  3OYB A;  3OYN A;  1OZ3 A;  2QQR A;  3L42 A;  1G5V A;  1H3Z A;  2DIG A;  2LVM A;  2E6N A;  4IUR A;  2BKD N;  2X35 A;  5C0M A;  3FDR A;  3OY9 A;  3LLR A;  4BAC A;  2M1H A;  3LH0 A;  3NTK A;  4B9X A;  4E7K A;  3S3O A;  4FL6 A;  4IKF A;  5D6X A;  2CKK A;  4BE0 A;  2RHY A;  3ME9 A;  3Q1J A;  3OB9 A;  3PFS A;  3P8D A;  2M0O A;  3LGF A;  4X34 A;  3E9G A;  3MEW A;  3MEA A;  4E7L A;  4BDZ A;  5KCO A;  2L89 A;  3QJ6 A;  4QQD A;  4BE1 A;  3OYL A;  4ZTF A;  5FRN A;  3PMI A;  2HQX A;  1OI1 A;  3MP1 A;  4QVZ A;  2MWP A;  2X4W A;  1KHC A;  1OZ2 A;  3O8V A;  1XNI A;  5D6Y A;  3LGL A;  2R5M A;  2O4X A;  2BIV A;  2WAC A;  2RJD A;  3LYI A;  4OVA A;  3KUF A;  5J39 A;  4QW2 A;  2EQU A;  5KE2 A;  3C4S A;  2RI2 A;  2PQW A;  3DB4 A;  4B9W A;  4PLI A;  2QQS A;  3OYD A;  3FC3 A;  3ASK A;  3OYF A;  2B8A A;  2K3X A;  4IUP A;  3L2R A;  2M16 A;  2LDM A;  4BD3 A;  2X4Y A;  2L3R A;  4RG2 A;  3OMG A;  1WJS A;  4GY5 A;  3OA6 A;  3S6W A;  3OYA A;  3E9F A;  3H8Z A; 
#chains in the Genus database with same CATH topology
 2QEX Q;  2E6Z A;  2LJ1 A;  4A4H A;  3PE0 A;  5LJ3 f;  4E7J A;  2OTL A;  1PKS A;  4F7U B;  1BI2 A;  4XU3 A;  1M1G A;  1N5Z A;  1M2V A;  4J9G A;  1OU8 A;  3CCL A;  1VQ9 A;  1Y07 A;  1YN8 A;  4FYW B;  4E47 A;  2J05 A;  4C92 F;  3UAT A;  2LCC A;  3I35 A;  2E65 A;  3L2W A;  4C0F A;  4M77 B;  3NTI A;  3G7Z A;  5EG2 A;  1BBZ A;  3JCM W;  4C8Q A;  3UT1 A;  1TS9 A;  4R0K A;  1QVP A;  1N6A A;  2CDT A;  4Z88 A;  1K9M C;  4A4E A;  1PWT A;  1YJN T;  2LNV A;  1IB8 A;  2NLU A;  1KQ2 A;  3CCS Q;  4OMF B;  3G71 T;  4FU6 A;  3M9Q A;  4CRI A;  3CCR T;  4CI0 C;  3V8J A;  2A37 A;  4J9I A;  2MCN A;  5FRO A;  5IHK A;  4PJO C;  1FX7 A;  1NYG A;  1QVF S;  1BU1 A;  4MZP A;  4BE0 A;  3CC4 A;  3WXM B;  2QG9 B;  1YIT T;  1UEC A;  1WIE A;  4X34 A;  2OTJ A;  4X9D A;  3RMQ A;  2GQV A;  2RK1 A;  1ACM B;  2HQX A;  3CBM A;  2DF6 A;  1K73 U;  2QI2 A;  3HRU A;  4OMN A;  2F1L A;  2WAC A;  2DL8 A;  2ZZD A;  4AG2 C;  4HKE A;  3I55 A;  1U1S A;  4Y28 E;  1M3B A;  2CP2 A;  3HHT B;  1OOT A;  1VQ9 Q;  1GXI E;  1IGQ A;  4BD3 A;  4RTT A;  4KH0 B;  1HSQ A;  1VQ7 Q;  2L5Q A;  1UHF A;  4AG1 C;  3D7S B;  4J83 A;  5LJ5 h;  1K9A A;  2K9G A;  4M75 D;  4E7I A;  4KGX B;  2AT1 B;  1UG1 A;  2DD4 A;  2C06 A;  5IHN A;  4C8Q F;  2QTX A;  4C5G A;  3A98 A;  2HNI A;  3CCJ Q;  3E19 A;  2D8H A;  1KIK A;  2KK4 A;  4JPB W;  2LRQ A;  3DLM A;  2XIC A;  4HA8 A;  5I2M A;  1ZUK A;  2E5Q A;  3M5A A;  2RQW A;  5ECA A;  2MI6 A;  3OQ5 A;  4M7D G;  2K2M A;  1JU5 C;  2K3B A;  4M75 B;  3JCM Q;  4VUB A;  3BW1 A;  5KYN A;  1K73 R;  3E1S A;  2HQH A;  2YRD A;  1R8O B;  2FL7 A;  4RTW A;  3OYJ A;  2KY9 A;  3HP9 A;  1YJW A;  4JUV A;  3CEY A;  3TVT A;  1TXQ A;  2CZ7 B;  2KXD A;  2DIG A;  2RQV A;  5GAN g;  4KBM B;  1W4S A;  3FDR A;  3LWI A;  1VQP Q;  1XOV A;  2OI3 A;  1PD1 A;  4PJO G;  3S3O A;  5GAN 7;  4IKF A;  2GTO A;  2CKK A;  3BY7 A;  1PHT A;  3MEW A;  4RCC A;  3MEA A;  3JSC A;  2P84 A;  5LJ3 e;  1UUE A;  1UGS B;  1MNE A;  3OSS C;  3J80 E;  3C94 A;  1E7O A;  3O8V A;  5KYX A;  1KHI A;  5D6Y A;  3LGL A;  1WFW A;  2EYW A;  1M90 U;  4K11 A;  1YWO A;  5J39 A;  5LL6 S;  2VV5 A;  3DKM A;  3GBQ A;  1NJI C;  3J7A F;  2MIO A;  1NPP A;  4PJO F;  3DB4 A;  3FC3 A;  5I11 A;  4CC3 A;  1YIJ Q;  1D1A A;  4JDS A;  1SPK A;  3OS1 A;  5CCA A;  4D6W A;  3V7C A;  4F04 B;  2J06 A;  2DIQ A;  1M8M A;  3M55 A;  1RAA B;  4RTU A;  2DZ9 A;  1QKW A;  5CVI A;  4DBF A;  4M77 E;  4N0A C;  3SWN A;  4EMH A;  2CRE A;  1NZ9 A;  2RQU A;  1NJI R;  1D1C A;  1M90 C;  2E1H A;  2DFU A;  1AWW A;  4D8K A;  2IPO B;  1I1J A;  3PMT A;  4FT2 A;  5KYX B;  2VYT A;  4EPC A;  1YIJ A;  3NTH A;  4X9C A;  3JCM g;  2EGE A;  4M7A E;  1VQP T;  4M77 G;  4JZ3 A;  4A4G A;  4M78 E;  2YT6 A;  2EAY A;  2G3R A;  1JJ2 S;  2VVK A;  2EGC A;  4F16 A;  2DE0 X;  3ZEH A;  4C0G A;  1KSW A;  2JTF A;  2P0K A;  1OZ3 A;  4DOW A;  2JNG A;  5GAN d;  1VQ4 T;  1YP5 A;  4DA4 A;  2FVU A;  3OB9 A;  3CCM T;  1HJD A;  1AD5 A;  1Y96 B;  1RAF B;  4ME7 A;  3CD6 Q;  2NYS A;  2R5M A;  2BIV A;  2L0A A;  1OEB A;  2LCL A;  5A0G A;  4DOV A;  2YUP A;  5LJ5 e;  2RN8 A;  1VUB A;  5LJ5 f;  1UJY A;  4EMG A;  1C0M A;  3L2R A;  4IUP A;  3EFR A;  3PGG A;  2XDB A;  2BZX A;  4ANJ A;  1OV3 A;  2DMO A;  1UTI A;  2YLC A;  6AT1 B;  4NL3 A;  1OPK A;  1V76 A;  2ZPI B;  2CS7 A;  2GBQ A;  4OML A;  2LQW A;  3QG1 A;  1VQL Q;  1WJR A;  1JXO A;  3JCM d;  1TU0 B;  2LJ0 A;  5AT1 B;  2LTO A;  2W0Z A;  1UGR B;  2LT4 A;  3M56 A;  1TUG B;  3CCM Q;  2QA4 Q;  1RAI B;  2DYI A;  1VQ4 Q;  3MP6 A;  2Y90 A;  3CPW S;  1QVF A;  2EJ9 A;  3UF4 A;  1WGS A;  4E7H A;  2ABL A;  2RI3 A;  2DTO A;  3A8M B;  3OYI A;  1RAD B;  2L3P A;  4J7F A;  5GMK j;  5L23 A;  1NLP C;  2CUB A;  1Y96 A;  4M7D C;  2YUO A;  3TEE A;  2DTI A;  3GP8 A;  3GOX A;  1VYT A;  3EAE A;  3C95 A;  5LJ3 j;  4PFO A;  2V8I A;  2KRN A;  3JCM V;  3QKJ A;  4MMK A;  2RJC A;  1JJ2 A;  3EGX B;  4QVD A;  1G5V A;  3L42 A;  4M7A B;  2IIM A;  5CAI A;  2LVM A;  1AHJ B;  2E70 A;  4M7A A;  3RKW A;  5C0M A;  1UFF A;  4KRT A;  5HCK A;  3JB9 H;  3JB9 D;  2DTH A;  3M0U A;  2ZPF B;  2M0O A;  2XKO C;  3CMA T;  4M75 G;  5DLQ E;  1SEM A;  3PMI A;  4GLK A;  1VQL T;  3EFO A;  4C92 B;  2A0F B;  2GTJ A;  3HRS A;  4M75 A;  5FWB A;  2CT4 A;  5FU7 B;  3X20 B;  2XMF A;  2FPF A;  5FU6 B;  1GCQ C;  3C4S A;  2DKG A;  2RMO A;  2FG0 A;  1W2B A;  1I81 A;  2LDM A;  1RLQ C;  3JCM e;  1QVG P;  2EBP A;  1G3W A;  3KBG A;  2KBT A;  2KRS A;  2KNB B;  2DL3 A;  3M0T A;  1A0N B;  1GFC A;  3M58 A;  2KRM A;  2KEA A;  1I8F A;  3V7S A;  5GMK e;  3TU4 K;  3CCM A;  5GAO p;  1ZSZ B;  3AHU A;  3I5S A;  4IUQ A;  2EQK A;  3DLL A;  1SHG A;  3JAM E;  3CCL Q;  3OYY A;  4LXC A;  1T3L A;  2CSQ A;  1NEG A;  2QA4 T;  4C5E A;  1G3S A;  4OMP A;  2H8H A;  1OPL A;  2EGA A;  2H3E B;  4XK8 E;  3OYE A;  2DVJ A;  3NPF A;  1M90 R;  1YJ9 A;  2J6O A;  3PVQ A;  1M9S A;  1HK9 A;  2DVE A;  2COY A;  1YHQ A;  3QDF A;  2XG8 D;  2RQT A;  4OMQ A;  4LUE A;  1PM3 A;  4XU1 A;  4QKU A;  5CQY A;  1YIJ T;  1KD1 C;  1RL2 A;  3M59 A;  3P8H A;  3QZ5 B;  3CD6 A;  5GMK i;  3ER0 A;  5GAO n;  1BIB A;  4J6X A;  2ZPH B;  1H3Z A;  1Q82 C;  2MYS A;  5GAN j;  2D0Q B;  2M1H A;  3EH2 A;  1H3H A;  1FMK A;  3VYH B;  4JJD A;  3CC7 A;  4JRQ A;  2CYZ B;  1AVZ C;  1EZZ B;  2DBK A;  1O9S A;  7AT1 B;  2QQB A;  5EC7 A;  1QWE A;  1WPY A;  3CCL T;  4PJM A;  2P0P A;  4OVA A;  1MUZ A;  1BCO A;  5GAM e;  3R6O A;  3QWX X;  4MML A;  5GAM g;  3M0Q A;  2Y4X A;  2RK2 A;  1X6B A;  3ULR B;  2COZ A;  2V1Q A;  2PTK A;  5KYU B;  2K5L A;  3EGD A;  3VRY A;  3GF5 A;  1RI9 A;  5GAN 3;  3I56 T;  3GLX A;  1KQS P;  4HT8 A;  4XTY A;  2DEQ A;  1K0X A;  1MHN A;  1DJ7 B;  2D8J A;  4IIM A;  2CUD A;  3OYC A;  1YJW Q;  1CKB A;  4IUV A;  2DK3 A;  4PFP A;  2HKQ B;  4BE2 A;  1M3C A;  2GFA A;  5J26 A;  2MF2 A;  4RG8 A;  3SDZ A;  4II1 A;  3TSZ A;  3H0I A;  2X3X D;  1HD3 A;  1QQJ A;  4HVW A;  1OYX A;  2C0T A;  3OMC A;  1N8R R;  3U23 A;  5LJ3 h;  2LP5 A;  5KYW A;  1NLO C;  2EJF A;  2ZCF B;  5DY9 A;  2ZGW A;  4QT7 A;  1NG2 A;  4LD9 K;  2VXE A;  1Q81 U;  2JS2 A;  1YJN Q;  5L8R E;  2MAM A;  3VKI A;  4XQ3 A;  1BI1 A;  1PD0 A;  1WJQ A;  2J6K A;  4EMK B;  3QZ9 B;  4P5N A;  1YFN A;  1G3Y A;  3RBB B;  4C5I A;  2RHZ A;  2LQK A;  3CPF A;  2LNH B;  3UPU A;  1XJW B;  3LLR A;  3EFS A;  3CMA A;  2HKN A;  1Q81 R;  4BY6 C;  2K7A A;  3PFS A;  4OGC A;  2DA9 A;  1BCM A;  1N8R U;  1PSF A;  4QQD A;  4XU2 A;  1QW1 A;  2CSI A;  2L3Q A;  4J9H A;  1WQ7 A;  4M77 A;  4E7S A;  3M57 A;  1VQM A;  3CC7 T;  5J3B A;  2EVR A;  4D8D A;  4M78 G;  2RQR A;  2LMJ A;  1YBY A;  1KQS S;  5A2Q E;  4E7Z A;  3CD6 T;  1HXD A;  4XTU A;  4M77 C;  4ZGD B;  4GY5 A;  1MMD A;  3S6W A;  1ZSZ A;  2K6D A;  3JCM b;  1NM7 A;  5FRM A;  2RD1 A;  5GJV B;  5CQX A;  2BE7 D;  1IXD A;  1S72 T;  2JZ2 A;  2CGH A;  2FHD A;  2R58 A;  1M1K C;  2LC4 A;  3CCE Q;  3JCM h;  2ROL A;  2ZAE A;  1BKB A;  5GAN 6;  3MO8 A;  1KJW A;  5DLO A;  1JRI A;  3VJP A;  3QYH B;  1NYF A;  1N9R A;  2MPX C;  4RMO A;  1VQK T;  1ZHI A;  4NOY A;  3VV0 A;  4ATO A;  5CIU A;  1R0C B;  2SEM A;  2VAS A;  3G4S A;  2M9U A;  2R5A A;  2EIF A;  4IUU A;  2A28 A;  2FZK B;  2JVV A;  3PT9 A;  2NWM A;  4KGV B;  4C0D B;  2XHC A;  2DYB A;  4Z02 A;  1ZSG A;  4R55 A;  4J9F A;  1E6H A;  4JS5 A;  3CCQ T;  2QQ9 A;  3L2U A;  2JJ9 A;  1FWZ A;  1KC8 U;  4C0D C;  1KG1 A;  2RHI A;  5IXB A;  1YJ9 T;  1JBM A;  3RES A;  5C6S A;  1MV3 A;  2K2V A;  1AWO A;  4OMO A;  3VS4 A;  1SSF A;  4UC4 A;  4NL2 A;  3CCE T;  4MDX A;  3T9N A;  4C0Z A;  1N9S A;  2QQR A;  2X9H A;  1OQK A;  1CSK A;  2QA4 A;  2EYZ A;  5FWC A;  1ZBX A;  1Q82 R;  3CBO A;  2DL4 A;  3WVE B;  3FB9 A;  2WSF E;  1VQL A;  2W10 A;  3ME9 A;  1KD1 R;  2JM8 A;  3EG2 A;  3CCV T;  5HY6 A;  3TQ7 P;  5LJ5 g;  1VQ9 T;  1SKU B;  2LT1 A;  1Y7X A;  1B34 B;  3PIO A;  2LJ3 A;  1K8A R;  4PJO E;  5CKF A;  3CC7 Q;  2JW4 A;  1IHW A;  3MKD A;  2QQS A;  4WTO B;  2DXC A;  2F2W A;  4KH1 B;  2DJQ A;  4V2S A;  4FSS A;  2FPD A;  2E12 A;  3CPW P;  1ZUU A;  1B3Q A;  2KE9 A;  3SWN C;  5GAM f;  2C0I A;  3QYG B;  1VQO T;  1RAB B;  4M75 E;  1P92 A;  3S3M A;  3LH5 A;  2YXY A;  1YHQ Q;  1N27 A;  3L2Q A;  1G83 A;  4HCK A;  1YJ9 Q;  2QK0 A;  2XD0 A;  5KYY B;  1FMV A;  1LOJ A;  4PJL A;  2PVD B;  4AMC A;  2VC8 A;  1D09 B;  2H3J A;  2EKH A;  4JRP A;  2PUO B;  3QSU A;  1K8A C;  2FEI A;  1ABO A;  4F7U A;  4RUG A;  2ZPE B;  1YI2 A;  2X4X A;  1LJO A;  4A4F A;  1QVG A;  2M51 A;  4RTZ A;  4BY6 B;  2IG0 A;  2KGT A;  2KQW A;  2RHX A;  1C6V X;  5GAO r;  4C92 D;  2DXT A;  1KD1 U;  3A8G B;  3M4Y A;  3H0H A;  2O4X B;  2O31 A;  4OMM A;  4JRK A;  1X6O A;  2LCS A;  2EW3 A;  4FL6 A;  1VQ8 T;  4AFU C;  1MV0 B;  2E4H A;  3CME T;  2YHT A;  3FJ5 A;  3N5B B;  4CC4 B;  1QCO A;  5FU7 C;  2SRC A;  2QAS A;  5KCO A;  2ED0 A;  2EYQ A;  1QP2 A;  1OI1 A;  2LX7 A;  2X4W A;  1VQ6 T;  4HCB A;  2XU8 A;  3CC2 T;  2KR3 A;  1WA7 A;  2DXU A;  4J9C A;  3VS6 A;  2DNU A;  3A8L B;  4DEY A;  4PLI A;  3CCE A;  3PVL A;  1UGQ B;  3OMG A;  1VQ5 T;  2Z0W A;  3E9F A;  1VIE A;  5D7U A;  2JM9 A;  3RNJ A;  3EG9 A;  4CC2 A;  2XDP A;  3V7R A;  2RH2 A;  5FLX E;  1V1C A;  2DRM A;  3QDR B;  3SFM A;  3G6E T;  1WZO A;  1Q7Y R;  1X2K A;  1RAH B;  3P8B B;  2CZ0 B;  3G71 Q;  1BK2 A;  4N4H A;  2P4R A;  3TSW A;  4LDX A;  2E5K A;  2FB7 A;  3F70 A;  3VS1 A;  5KH6 A;  5CR2 A;  1OX9 A;  2HEQ A;  2VUB A;  1TG0 A;  1I5L A;  5GAN 8;  3VUZ A;  2ED1 A;  3G6E A;  3EGX A;  1WXB A;  2V1R A;  3A1P A;  4M75 F;  5A0D A;  1S72 Q;  1GL5 A;  2MOX A;  3JCM c;  1D3B A;  1QCN A;  4FIB A;  1Q81 C;  4F14 A;  3OS2 A;  4J9E A;  1K9M U;  1U5S A;  3CCR Q;  2HQE A;  2K3Y A;  2FO0 A;  4BDY A;  2ECZ A;  1H92 A;  3H9N A;  2WSE E;  3TCJ A;  2AZV A;  1K76 A;  1JJ2 P;  3MET A;  2EQJ A;  3DB3 A;  2QDY B;  1WYX A;  2RNA A;  3VS0 A;  2KYB A;  1WQW A;  2QAZ A;  3VS7 A;  3CC2 A;  4M7D F;  3VYG A;  2ATC B;  4JLG A;  4DQ2 A;  3VS2 A;  2K57 A;  4M4Z A;  4M78 C;  1N8R C;  3QWY A;  5FRN A;  1T0J A;  2F2V A;  1D3B B;  4ZTF A;  2HZY A;  2JTE A;  1QWF A;  4ZGJ B;  1WNL A;  1TWB A;  4RTX A;  4HXJ A;  3LYI A;  3G71 A;  3M54 A;  3EG3 A;  4X1V A;  1PRM C;  1YCS B;  5CKB A;  2PNI A;  3I55 Q;  2L2P A;  3ASK A;  3CMA Q;  9ATC B;  2NUP B;  1PCX A;  2QDL A;  2AIR B;  5HK0 A;  2HMA A;  5GAN e;  4XTZ A;  4C92 G;  5GAN 4;  2OTJ Q;  1MMA A;  3I5R A;  1Q7Y C;  3JV3 A;  3FLG A;  1FXX A;  3CCJ T;  4HCZ A;  3OW2 P;  2LQN A;  1W1F A;  1BI0 A;  3QII A;  2NUT A;  2DL5 A;  4J6Y A;  1PSE A;  4ELZ C;  1ZA1 B;  1BI3 A;  2KI7 A;  2DZC A;  1R0B G;  1OU9 A;  4QQ6 A;  2JOY A;  3H6Z A;  3S3N A;  4L6V 5;  5GAM h;  2HBW A;  1GBQ A;  4PK4 A;  2GCX A;  1WHK A;  4BB7 A;  3BDL A;  2RO0 A;  2FZC B;  3EG0 A;  4JJC A;  3SHW A;  1EIF A;  1X01 A;  4ZGE B;  1Q86 C;  5IT9 E;  1WXT A;  2EWN A;  2FPE A;  4XAX B;  1NEB A;  2JN0 A;  2RB6 A;  1JO8 A;  4ESR A;  1AWX A;  5CKE A;  3C12 A;  2FZG B;  3V8K A;  3NMZ C;  2COW A;  5CKH A;  3I55 T;  1ABQ A;  2E6N A;  2BKD N;  2KXC A;  1QVF P;  1WDX A;  2PU9 B;  1YI2 Q;  2VGN A;  1QCF A;  4F7U G;  2CH4 W;  1BYM A;  4M7D D;  2OAW A;  3LGF A;  2OTL Q;  1X75 C;  2HCK A;  4BE1 A;  1V29 B;  4BI8 B;  4OB1 B;  1VQO A;  3JB9 I;  1PNJ A;  3SB2 A;  2CZ6 B;  1U1T A;  2RJD A;  2CP5 A;  1EFN A;  1BB9 A;  3KFV A;  4WF2 A;  5CO7 A;  3GPL A;  1IRX A;  1TSF A;  2B8A A;  4DEX A;  4RTV A;  3RKY A;  3HSB A;  3J81 E;  3SWN B;  3FRN A;  1MMG A;  1I4K 1;  1YWP A;  3H8Z A;  2YRC A;  3OS5 A;  2RPN A;  1JQQ A;  2D9T A;  3IQL A;  4NS5 A;  4PNO A;  4PJN A;  3CCQ A;  2EYY A;  3M0S A;  3I9Q A;  3MCA B;  3VS5 A;  3OYM A;  1C1A A;  1ZSZ C;  1WHG A;  2E64 A;  4M78 F;  3EH1 A;  3REA B;  2VWF A;  1YIT A;  1GRI A;  4MDW A;  2D1X A;  3AT1 B;  1WHM A;  3I56 A;  2XID A;  4FT4 A;  2NUP A;  4FYY B;  3EGD B;  3HPW A;  3CCQ Q;  2EQI A;  1VQ5 Q;  2YUN A;  3RIR A;  2YRV A;  4OF1 A;  1F1B B;  3KXT A;  5CK9 A;  1SG5 A;  5HKC A;  4DBH A;  3QPH A;  2YWW A;  2ESW A;  4L59 A;  2GFU A;  2YLB A;  5IAY A;  1NPR A;  2IVW A;  2K79 A;  2F2X A;  2V8J A;  2ENM A;  5KCH A;  5GAN f;  1AEY A;  1XQH A;  1QP3 A;  4C92 E;  4BI4 A;  1RAC B;  3JCM X;  2JXB A;  3LWH A;  3V8L A;  4CC7 A;  4LDY A;  3A8H B;  3ZFJ A;  2E3I A;  3NTK A;  4QVC A;  1IRE B;  1RAE B;  1VQ6 Q;  4F7U E;  1WHL A;  4E7L A;  4J9D A;  2DEU A;  2EJG A;  2MWP A;  2BE9 B;  2QGG A;  1NE8 A;  2KRO A;  1JB0 E;  1XNI A;  2X4J A;  4LDW A;  1Y57 A;  5GAN 2;  1MMN A;  1CKA A;  2L3S A;  4N0A A;  1Z9Q A;  4M7D B;  4BUG A;  5GMK l;  5AYF A;  4B6M A;  3OW2 A;  3VRZ A;  1Q7Y U;  2NUT B;  2DET A;  2CP3 A;  5M9O A;  4KT0 E;  2KT1 A;  4EIK A;  2C0O A;  2BTT A;  4FYV B;  1T3S A;  3CCS A;  2LZ6 B;  2DXB A;  3CQT A;  1R77 A;  2I2L A;  2J7I A;  4M7A C;  2G6F X;  4XU0 A;  3OW2 S;  2M02 A;  1X27 A;  2DX1 A;  1TUC A;  1UDL A;  2F5T X;  3RKX A;  1SSH A;  3X24 B;  1JEG A;  4FCY A;  2F69 A;  2E10 A;  4PLL A;  4A53 A;  1H8K A;  3CCV A;  2GGR A;  2DAQ A;  4LN2 A;  4GLM A;  4JJB A;  1VA7 A;  4WCI A;  3VUB A;  4IIO A;  3HFO A;  1KQS A;  4R56 A;  1U3O A;  1UEB A;  1D1B A;  1FYN A;  3H0F A;  4Y91 A;  1W6X A;  4A4K A;  1X2Q A;  3UDC A;  2WSC E;  2BZY A;  4DBQ A;  3OYH A;  4F17 A;  4EMK C;  8AT1 B;  4OP0 A;  1Y71 A;  3INZ A;  2LQ8 A;  2E3H A;  2DD5 A;  1YJN A;  2A7Y A;  1M27 C;  3RR6 A;  1ZUY A;  1W2B S;  4J7I A;  2HSE B;  3FIF A;  4ZNX A;  4B9X A;  4E7K A;  2P0Q A;  2QQA A;  3P8D A;  4RKU E;  4BDZ A;  1U06 A;  2YUQ A;  1OZ2 A;  3CCS T;  3X26 B;  4HT9 A;  1Y0M A;  4YTL A;  2X51 A;  4KUL A;  1EX4 A;  1ZX6 A;  3HTR A;  2EPD A;  5I2S A;  2QYZ A;  1G3T A;  1O75 A;  4JZ4 A;  4C8Q G;  4F7U F;  1S72 A;  4ZN1 A;  4ORZ A;  2OTL T;  3THK A;  1WHH A;  2M16 A;  3M4G A;  2O9S A;  3G6E Q;  4M7A G;  3CXC P;  4BI3 A;  2B86 A;  4QQG A;  1X43 A;  1M2O A;  2VB6 A;  5CKD A;  3VU3 C;  5HK3 A;  3EHQ A;  4ZTJ A;  3CCV Q;  5DM7 R;  2KVQ G;  2OAU A;  2HSP A;  3TRE A;  4KUD K;  3CCU A;  4AFZ C;  1LVK A;  2PUK B;  2EFI A;  4OGE A;  1WHJ A;  3HFN A;  1M3A A;  3E2U A;  2X3W D;  3MPU B;  3MEU A;  3GNF B;  3FEO A;  4OB3 B;  3EG1 A;  2AK5 A;  2RJF A;  2L8D A;  3JCM J;  2CP7 A;  2GQI A;  2QEX T;  2QGF B;  1MGQ A;  1VIF A;  3EFO B;  4C92 A;  5LJ5 j;  4N4G A;  2ROT A;  4GBQ A;  3PNW C;  2KSS A;  2YSQ A;  2KYM A;  4PJO A;  2RI5 A;  3EHR A;  3FJP A;  1VQ5 A;  4C5H A;  2R57 A;  1X6G A;  4AFS C;  1PG5 B;  3L2Z A;  4M78 A;  4M77 F;  1QMC A;  4PFZ A;  3RUX A;  1OX8 A;  2X35 A;  1IGU A;  3QUI A;  3OY9 A;  1TOV A;  2Y4Y A;  2DO3 A;  4BAC A;  2FRY A;  1KQ1 A;  1M1K R;  4LDV A;  1ARK A;  1KFZ A;  5I22 A;  1VYU A;  4JRI A;  3QXE B;  3E9G A;  1AZE A;  4O5V A;  4LDU A;  4ZN3 A;  1VQN T;  1RAG B;  3CME A;  1VQ8 A;  1OUL A;  4M78 B;  4MZM A;  2XDD A;  2DRK A;  3JB9 G;  3CCJ A;  1VOM A;  5KE2 A;  1VQ7 T;  4B9W A;  5GAO l;  2K3X A;  2MMP A;  1VQP A;  3QHS A;  2L3R A;  1WI7 A;  1WJS A;  2AKK A;  1VQ8 Q;  1VQO Q;  2K5F A;  1IO6 A;  3LW5 E;  1LPL A;  2K5I A;  3QBY A;  3CPW A;  3SD4 A;  1QVG S;  3QJY A;  5IN1 A;  1IZ6 A;  2EKO A;  3I56 Q;  2JMC A;  2HAX A;  3CBP A;  1M5Q 1;  3M0P A;  5LJ3 g;  4M78 D;  1VQK A;  1GFD A;  1WXU A;  4KUI A;  1YIT Q;  2RF0 A;  4M7D E;  1YNZ A;  4EDU A;  3MJX A;  2RJE A;  3OS0 A;  2CH4 A;  3JCM f;  4DBR A;  2DM1 A;  2QTV A;  4M7D A;  1UB4 A;  4IUT A;  4J6W A;  1GBR A;  2HD0 A;  2MWO A;  1K73 C;  1KK7 A;  4J5Y A;  2CP0 A;  2PVG B;  1SRL A;  3L2V A;  3BDU A;  3LX7 A;  4C8Q C;  1W70 A;  1PKT A;  2BZ8 A;  4LD6 A;  4AFQ C;  2YDL A;  3X25 B;  4XTW A;  2RA2 A;  2RHU A;  2PVO B;  2O2O A;  2PZ1 A;  1YHQ T;  1RI0 A;  1S1N A;  3C0C A;  1K4U S;  2E41 A;  5GMK m;  1VQ7 A;  1HYO A;  3RER A;  3HL8 A;  1PC0 A;  3CCU Q;  3OSV A;  1WX6 A;  4PJO B;  2DBM A;  2RHY A;  2EYX A;  1ZA2 B;  2CP6 A;  2J6F A;  3PIP A;  1K9M R;  1XTD A;  3EGU A;  1NBE B;  5GAM d;  1M1F A;  4LUD A;  1SHF A;  1VQ4 A;  3M53 A;  2O4X A;  4Y92 A;  2JS0 A;  1YJW T;  2KDS A;  3KUF A;  2RM4 A;  1AWJ A;  1E6G A;  2EQU A;  3CC4 Q;  3A5Z B;  5GAO m;  2M0Y A;  2PQW A;  5A0L A;  3UA7 A;  3OYD A;  3M0R A;  4A63 B;  2AHJ B;  1UHC A;  1D0Y A;  5GMK h;  5FW9 A;  2HBP A;  3G4S Q;  3CXC A;  5GAN 5;  1YI2 T;  2OJ2 A;  2GNC A;  3SEM A;  2VXF A;  2V8K A;  1VQN A;  3EG9 B;  4Z89 A;  4FM4 B;  5GAM j;  4A54 A;  4M7A F;  3OBW A;  2DL7 A;  2FYK A;  1SRM A;  2F5K A;  4OB0 B;  4PL6 A;  1WLP B;  4N4I A;  2DLP A;  1I0C A;  1KC8 C;  4C92 C;  2CZ1 B;  4M7A D;  2AKL A;  4Q5W A;  3L1A A;  1UGP B;  4M75 C;  1M4Z A;  1VQK Q;  3H41 A;  4C8Q D;  2JT4 A;  3R6N A;  3X28 B;  1M1K U;  3PTA A;  4HVU A;  1TUD A;  4HCC A;  1I07 A;  3RMS A;  3OYK A;  1UGV A;  3VS3 A;  4ELY C;  3JB9 J;  2KMT A;  5D6W A;  1VQM Q;  1FMW A;  2AZS A;  3MP8 A;  4L5G A;  2QEX A;  3OYN A;  1K1Z A;  4IUR A;  4EMK A;  3G1J A;  4FSX A;  1U8R A;  1I5O B;  4E6R A;  1PRL C;  2K4Y A;  1IHV A;  5IH2 A;  2OTJ T;  3CC2 Q;  3A8O B;  1Q95 G;  5D6X A;  5I21 A;  4JS4 A;  3UA6 A;  3JCM P;  3Q1J A;  3CCU T;  1Q86 R;  4C8Q E;  3GNG A;  3QJ6 A;  1VYV A;  3MP1 A;  5KYY A;  4OB2 B;  3CME Q;  4FW2 A;  3ZL7 C;  2O88 A;  4MZT A;  2JTM A;  4HVV A;  3CCR A;  3REB B;  4XTV A;  2P4T A;  5GAN h;  2A36 A;  4PJO D;  4RCB A;  3HRT A;  2RI2 A;  5GAO q;  2D0N A;  1B07 A;  3OYF A;  5IHI A;  2DJZ A;  4PKC C;  3ZBD A;  3O5Z A;  2X4Y A;  2HL5 C;  1SF9 A;  3OA6 A;  3OYA A;  2XK0 A;  1AZG B;  3URG A;  4Z8A A;  4J8O A;  2NUZ A;  3OBY A;  5KYU A;  3MHX A;  1VQ6 A;  3JB9 F;  3CXC S;  4FW1 A;  3BE3 A;  1MND A;  3NHN A;  3OYG A;  1VQM T;  1M2V B;  3RDV A;  1RUW A;  4LE9 A;  2JUF A;  2HDA A;  3MEV A;  5FU6 C;  3UWN A;  5GJW B;  1AT1 B;  3NGP A;  1TH7 A;  1J3T A;  1GCQ A;  2QXF A;  1M8V A;  1UJ0 A;  1RLP C;  2DPP B;  1QKX A;  2EQM A;  2VKN A;  3HKS A;  1B7T A;  2MK5 A;  3BFM A;  4KGZ B;  1YCY A;  1ZQ1 A;  2HL3 A;  8ATC B;  2BUD A;  2D6F A;  2ZPG B;  1ZBJ A;  1LNX A;  2ZPB B;  3QO3 A;  4E2F B;  1B34 A;  2A3L A;  2DER A;  2VGM A;  3JRZ A;  1X69 A;  1K8A U;  1LCK A;  2A08 A;  1AOJ A;  2V26 A;  2OX7 A;  2KT8 A;  1W2B P;  2JMA A;  2KAF A;  2GF7 A;  2O01 E;  2CT3 A;  1Q86 U;  1BIA A;  4TVR A;  5IXF A;  5KE3 A;  2O9V A;  3WVD B;  4PJJ A;  2I0N A;  3OYB A;  2XI9 A;  4O6J A;  5LJ5 d;  1Q82 U;  1D0X A;  4LNP A;  1K0S A;  1H64 1;  1Z9Z A;  3NFC A;  3G4S T;  2LX9 A;  3LH0 A;  4RTY A;  4C8Q B;  2FRW A;  1M30 A;  1T0H A;  4J9B A;  2L89 A;  3OYL A;  4FYX B;  2DIL A;  1D0Z A;  1KC8 R;  3CC4 T;  4QVZ A;  4JJN K;  1KHC A;  1ZLM A;  1JXM A;  1GCP A;  4AT1 B;  3GIB A;  1UE9 A;  4QW2 A;  1QLY A;  4JLI A;  1TTH B;  1VQN Q;  4M77 D;  5LJ3 d;  4XTX A;  1G2B A;  4RG2 A;  5KYW B;  1NJI U;  1G8X A; 
#chains in the Genus database with same CATH homology
 2E6Z A;  4QQG A;  1G3W A;  3KBG A;  4A4H A;  5LJ3 f;  4E7J A;  2OTL A;  5CKD A;  2XDP A;  3V7R A;  1BI2 A;  2RH2 A;  1M1G A;  4XU3 A;  3VU3 C;  5FLX E;  4F7U B;  3CCL A;  5HK3 A;  3M58 A;  3QDR B;  4ZTJ A;  1VQ9 A;  1Y07 A;  3SFM A;  5DM7 R;  3G6E T;  1I8F A;  3V7S A;  2KVQ G;  2OAU A;  5GMK e;  4E47 A;  3TU4 K;  3CCM A;  3P8B B;  3TRE A;  4C92 F;  2CZ0 B;  5GAO p;  2LCC A;  3CCU A;  4KUD K;  3AHU A;  2E65 A;  2PUK B;  4IUQ A;  3L2W A;  4C0F A;  2EFI A;  4N4H A;  4OGE A;  3HFN A;  2EQK A;  3NTI A;  4M77 B;  3DLL A;  4LDX A;  3JAM E;  2FB7 A;  3F70 A;  3OYY A;  3MEU A;  3GNF B;  3FEO A;  3G7Z A;  4OB3 B;  5EG2 A;  5KH6 A;  5CR2 A;  2QA4 T;  2RJF A;  1G3S A;  2L8D A;  4C5E A;  3JCM J;  2VUB A;  3JCM W;  4C8Q A;  1I5L A;  2QEX T;  3UT1 A;  4XK8 E;  1MGQ A;  3OYE A;  5GAN 8;  1QVP A;  1N6A A;  1VIF A;  3VUZ A;  4C92 A;  5LJ5 j;  3G6E A;  4N4G A;  1K9M C;  4A4E A;  1YJ9 A;  3PNW C;  4M75 F;  1YJN T;  5A0D A;  1M9S A;  1HK9 A;  2DVE A;  2KSS A;  2LNV A;  3JCM c;  1D3B A;  1YHQ A;  4FIB A;  2XG8 D;  1Q81 C;  3OS2 A;  4PJO A;  1K9M U;  2RI5 A;  3FJP A;  2HQE A;  1VQ5 A;  2NLU A;  2K3Y A;  4XU1 A;  5CQY A;  2R57 A;  4C5H A;  4BDY A;  1KQ2 A;  1YIJ T;  4OMF B;  3G71 T;  2WSE E;  4FU6 A;  3M9Q A;  3TCJ A;  3L2Z A;  4M78 A;  1KD1 C;  4CRI A;  1RL2 A;  3M59 A;  3P8H A;  3QZ5 B;  3V8J A;  4CI0 C;  3CCR T;  3CD6 A;  5GMK i;  5FRO A;  3ER0 A;  3MET A;  2EQJ A;  1BIB A;  3DB3 A;  4M77 F;  5GAO n;  4J6X A;  2QDY B;  3RUX A;  2ZPH B;  1H3Z A;  4PJO C;  2X35 A;  1Q82 C;  3QUI A;  1FX7 A;  3OY9 A;  5GAN j;  2Y4Y A;  1WQW A;  2D0Q B;  2DO3 A;  4BAC A;  2M1H A;  1KQ1 A;  3CC2 A;  1QVF S;  4LDV A;  4M7D F;  3VYG A;  4MZP A;  3VYH B;  4BE0 A;  4JLG A;  4DQ2 A;  3CC7 A;  3CC4 A;  2K57 A;  4JRQ A;  2CYZ B;  3QXE B;  4JRI A;  3WXM B;  4M78 C;  1YIT T;  4X34 A;  3E9G A;  1N8R C;  4O5V A;  2OTJ A;  4X9D A;  4LDU A;  1O9S A;  3RMQ A;  4ZN3 A;  5FRN A;  4ZTF A;  1D3B B;  1VQN T;  2GQV A;  2QQB A;  2RK1 A;  2HQX A;  1WPY A;  3CBM A;  3CME A;  1K73 U;  1VQ8 A;  3CCL T;  2QI2 A;  4ZGJ B;  3HRU A;  2P0P A;  2WAC A;  1WNL A;  4M78 B;  2ZZD A;  4MZM A;  3LYI A;  4OVA A;  2XDD A;  3G71 A;  3JB9 G;  4HKE A;  3M54 A;  3CCJ A;  3I55 A;  1U1S A;  4Y28 E;  5CKB A;  5KE2 A;  5GAM e;  1VQ7 T;  3R6O A;  4B9W A;  3HHT B;  3ASK A;  5GAO l;  2K3X A;  2MMP A;  1GXI E;  1VQP A;  4MML A;  4BD3 A;  3QHS A;  2L3R A;  5GAM g;  1WJS A;  5HK0 A;  2K5F A;  2Y4X A;  2L5Q A;  3LW5 E;  5GAN e;  4J83 A;  4XTZ A;  4C92 G;  5LJ5 h;  5GAN 4;  2K5I A;  2RK2 A;  3QBY A;  3CPW A;  4M75 D;  3SD4 A;  4E7I A;  1QVG S;  1Q7Y C;  3QJY A;  2DD4 A;  3FLG A;  1IZ6 A;  2EKO A;  5IN1 A;  1FXX A;  3CCJ T;  2C06 A;  4HCZ A;  4C8Q F;  2K5L A;  2HAX A;  3CBP A;  1M5Q 1;  5LJ3 g;  2QTX A;  3GF5 A;  4M78 D;  4C5G A;  1VQK A;  2HNI A;  5GAN 3;  3I56 T;  4KUI A;  3E19 A;  1BI0 A;  3QII A;  4M7D E;  2KK4 A;  4EDU A;  3GLX A;  2LRQ A;  1PSE A;  2RJE A;  3DLM A;  4J6Y A;  3JCM f;  4ELZ C;  1BI3 A;  4XTY A;  2DEQ A;  3OS0 A;  2XIC A;  4HA8 A;  2DZC A;  2JOY A;  3S3N A;  3H6Z A;  4QQ6 A;  2E5Q A;  1MHN A;  1DJ7 B;  5I2M A;  4L6V 5;  5GAM h;  3OYC A;  3M5A A;  4M7D A;  1UB4 A;  4IUT A;  4J6W A;  2HD0 A;  4IUV A;  2DK3 A;  2MI6 A;  3OQ5 A;  2GCX A;  4BE2 A;  4M7D G;  2GFA A;  5J26 A;  2MWO A;  2MF2 A;  1K73 C;  4BB7 A;  3BDL A;  2RO0 A;  4J5Y A;  4RG8 A;  3SDZ A;  4II1 A;  2PVG B;  3L2V A;  4M75 B;  3JCM Q;  3BDU A;  4VUB A;  1EIF A;  1OYX A;  3LX7 A;  1X01 A;  3OMC A;  3BW1 A;  4ZGE B;  5LJ3 h;  4C8Q C;  5IT9 E;  1Q86 C;  2EJF A;  2ZCF B;  4LD6 A;  2EWN A;  3E1S A;  5DY9 A;  2ZGW A;  3X25 B;  4LD9 K;  2VXE A;  1Q81 U;  4XTW A;  4XAX B;  5L8R E;  2MAM A;  2RA2 A;  2RHU A;  3VKI A;  1R8O B;  2FL7 A;  2JN0 A;  2PVO B;  3OYJ A;  2RB6 A;  4XQ3 A;  1BI1 A;  2KY9 A;  3HP9 A;  1RI0 A;  5CKE A;  1WJQ A;  1YHQ T;  1YJW A;  4JUV A;  4EMK B;  3C12 A;  2E41 A;  3CEY A;  1G3Y A;  3QZ9 B;  4P5N A;  2RHZ A;  4C5I A;  5GMK m;  2LQK A;  3V8K A;  1VQ7 A;  2CZ7 B;  5CKH A;  3RER A;  3I55 T;  2DIG A;  5GAN g;  2E6N A;  3HL8 A;  2BKD N;  4KBM B;  3CPF A;  1W4S A;  3FDR A;  3UPU A;  3OSV A;  3LLR A;  3LWI A;  3EFS A;  3CMA A;  1XOV A;  2PU9 B;  4PJO G;  3S3O A;  5GAN 7;  4PJO B;  4BY6 C;  4IKF A;  2CKK A;  2VGN A;  4F7U G;  2RHY A;  3PFS A;  4OGC A;  1BYM A;  3BY7 A;  4M7D D;  3LGF A;  3MEW A;  4RCC A;  3MEA A;  1X75 C;  3JSC A;  3PIP A;  1XTD A;  1N8R U;  1PSF A;  4QQD A;  4XU2 A;  1UGS B;  1QW1 A;  5LJ3 e;  4BE1 A;  1V29 B;  1WQ7 A;  4M77 A;  5GAM d;  1M1F A;  3OSS C;  4BI8 B;  3M57 A;  1VQM A;  3J80 E;  4OB1 B;  5J3B A;  3CC7 T;  1VQO A;  3C94 A;  3JB9 I;  1VQ4 A;  3SB2 A;  2CZ6 B;  3O8V A;  1KHI A;  5D6Y A;  3LGL A;  3M53 A;  1U1T A;  2O4X A;  1M90 U;  2RJD A;  1YJW T;  2KDS A;  4M78 G;  5J39 A;  3KUF A;  2VV5 A;  2RM4 A;  5LL6 S;  3DKM A;  2EQU A;  1YBY A;  4WF2 A;  1NJI C;  1KQS S;  3J7A F;  3A5Z B;  5GAO m;  1NPP A;  5CO7 A;  5A2Q E;  4PJO F;  2PQW A;  3GPL A;  3DB4 A;  5A0L A;  3OYD A;  3FC3 A;  3CD6 T;  1HXD A;  2B8A A;  2AHJ B;  4XTU A;  3RKY A;  3HSB A;  4M77 C;  3J81 E;  3SWN B;  3FRN A;  4JDS A;  4GY5 A;  4ZGD B;  1I4K 1;  3S6W A;  5GMK h;  3JCM b;  3H8Z A;  2HBP A;  3OS5 A;  5FRM A;  2RD1 A;  3CXC A;  5CQX A;  5GAN 5;  3OS1 A;  1YI2 T;  5CCA A;  4D6W A;  3V7C A;  2D9T A;  4NS5 A;  3CCQ A;  4PNO A;  1S72 T;  2DIQ A;  2CGH A;  2JZ2 A;  2FHD A;  2R58 A;  1M1K C;  3M55 A;  2LC4 A;  3MCA B;  3OYM A;  3JCM h;  2E64 A;  2VXF A;  2V8K A;  4M78 F;  2DZ9 A;  1VQN A;  5CVI A;  1BKB A;  5GAN 6;  3MO8 A;  4FM4 B;  5GAM j;  1YIT A;  4A54 A;  4MDW A;  4M77 E;  5DLO A;  1JRI A;  4N0A C;  3OBW A;  3SWN A;  3VJP A;  4M7A F;  3QYH B;  3I56 A;  1N9R A;  4EMH A;  2XID A;  4RMO A;  1NZ9 A;  1ZHI A;  4NOY A;  2FYK A;  1M90 C;  1VQK T;  4FT4 A;  2E1H A;  3VV0 A;  4ATO A;  3HPW A;  5CIU A;  2F5K A;  4OB0 B;  4PL6 A;  3RIR A;  3G4S A;  2YRV A;  2M9U A;  2R5A A;  2EIF A;  4N4I A;  4IUU A;  4OF1 A;  2JVV A;  3PT9 A;  3PMT A;  4FT2 A;  1KC8 C;  2VYT A;  4C0D B;  4C92 C;  4EPC A;  3KXT A;  1YIJ A;  2CZ1 B;  5CK9 A;  3NTH A;  2XHC A;  4X9C A;  4Z02 A;  5HKC A;  3JCM g;  4R55 A;  4M7A D;  4Q5W A;  3L1A A;  3QPH A;  4JS5 A;  1UGP B;  2QQ9 A;  4M75 C;  1M4Z A;  3L2U A;  4L59 A;  3CCQ T;  4M7A E;  1FWZ A;  2GFU A;  4M77 G;  1VQP T;  2YLB A;  5IAY A;  4C0D C;  1NPR A;  4C8Q D;  1KC8 U;  3X28 B;  4A4G A;  1KG1 A;  2IVW A;  3PTA A;  1M1K U;  2RHI A;  1YJ9 T;  4HCC A;  4M78 E;  3RMS A;  1JBM A;  2EAY A;  3OYK A;  2G3R A;  1JJ2 S;  2V8J A;  3RES A;  4ELY C;  2K2V A;  5C6S A;  5KCH A;  3JB9 J;  1SSF A;  2KMT A;  4UC4 A;  5D6W A;  5GAN f;  4NL2 A;  3CCE T;  4MDX A;  3MP8 A;  3ZEH A;  1XQH A;  4C0G A;  4L5G A;  2JTF A;  2P0K A;  3T9N A;  4C0Z A;  2QEX A;  1QP3 A;  4C92 E;  3OYN A;  1N9S A;  1OZ3 A;  2QQR A;  4BI4 A;  2QA4 A;  4IUR A;  4EMK A;  1ZBX A;  4FSX A;  4DOW A;  3JCM X;  2JNG A;  5GAN d;  1U8R A;  3LWH A;  3V8L A;  4LDY A;  3A8H B;  2K4Y A;  3CBO A;  3NTK A;  3ZFJ A;  2OTJ T;  3WVE B;  3FB9 A;  1VQ4 T;  4DA4 A;  3A8O B;  2WSF E;  5D6X A;  5I21 A;  4JS4 A;  1VQL A;  4QVC A;  1IRE B;  3ME9 A;  2FVU A;  3Q1J A;  3OB9 A;  4F7U E;  3CCU T;  3JCM P;  3CCM T;  4C8Q E;  4E7L A;  3GNG A;  3QJ6 A;  3CCV T;  5HY6 A;  1Y96 B;  4ME7 A;  5LJ5 g;  1VQ9 T;  3MP1 A;  2EJG A;  2MWP A;  2LT1 A;  1Y7X A;  4OB2 B;  1B34 B;  4MZT A;  1NE8 A;  2X4J A;  1JB0 E;  1XNI A;  2JTM A;  4LDW A;  2R5M A;  3PIO A;  2BIV A;  3CCR A;  2LCL A;  4PJO E;  5A0G A;  4XTV A;  2P4T A;  5GAN 2;  5CKF A;  4DOV A;  5GAN h;  4PJO D;  5LJ5 e;  1VUB A;  5LJ5 f;  4RCB A;  3HRT A;  2RI2 A;  4EMG A;  5GAO q;  4N0A A;  4M7D B;  2QQS A;  4BUG A;  5GMK l;  3L2R A;  3OYF A;  4IUP A;  1NJI U;  3EFR A;  3PGG A;  2DJZ A;  4PKC C;  3ZBD A;  5AYF A;  2XDB A;  2X4Y A;  3OW2 A;  2DXC A;  3OA6 A;  3OYA A;  1Q7Y U;  2XK0 A;  2YLC A;  4V2S A;  5M9O A;  4KT0 E;  3URG A;  4J8O A;  3OBY A;  4NL3 A;  2ZPI B;  2E12 A;  3MHX A;  2CS7 A;  5GAM f;  3SWN C;  3CCS A;  1VQ6 A;  2DXB A;  3JB9 F;  3QYG B;  3CXC S;  3QG1 A;  1VQO T;  2I2L A;  1WJR A;  3OYG A;  4M75 E;  1VQM T;  1P92 A;  4M7A C;  3JCM d;  3S3M A;  4XU0 A;  2LTO A;  3OW2 S;  1N27 A;  1UGR B;  3L2Q A;  2JUF A;  2F5T X;  2LT4 A;  3M56 A;  3MEV A;  5FU6 C;  3RKX A;  3UWN A;  3X24 B;  2XD0 A;  2F69 A;  1LOJ A;  1TH7 A;  2E10 A;  4PLL A;  4A53 A;  2PVD B;  2QXF A;  1M8V A;  3MP6 A;  3CCV A;  2DPP B;  2Y90 A;  2VC8 A;  3CPW S;  1QVF A;  2DAQ A;  2EQM A;  2EJ9 A;  2H3J A;  3HKS A;  4JRP A;  2PUO B;  1WGS A;  4E7H A;  3BFM A;  3QSU A;  1YCY A;  2RI3 A;  2DTO A;  1ZQ1 A;  1K8A C;  3A8M B;  3VUB A;  3HFO A;  1KQS A;  3OYI A;  2BUD A;  2D6F A;  4F7U A;  2ZPG B;  4R56 A;  2ZPE B;  1LNX A;  1UEB A;  2ZPB B;  3QO3 A;  1B34 A;  2A3L A;  2X4X A;  4Y91 A;  2VGM A;  4J7F A;  1LJO A;  5GMK j;  3JRZ A;  4A4F A;  1QVG A;  1K8A U;  4BY6 B;  4A4K A;  1Y96 A;  2IG0 A;  4M7D C;  3TEE A;  3UDC A;  2WSC E;  2DTI A;  3GP8 A;  2KAF A;  3GOX A;  2GF7 A;  3OYH A;  3EAE A;  2O01 E;  2KQW A;  2RHX A;  3C95 A;  4EMK C;  5GAO r;  5LJ3 j;  4OP0 A;  4C92 D;  1Q86 U;  1Y71 A;  1BIA A;  2DXT A;  3INZ A;  4TVR A;  2LQ8 A;  3A8G B;  2V8I A;  3M4Y A;  5KE3 A;  1KD1 U;  3WVD B;  2DD5 A;  3JCM V;  3QKJ A;  2O4X B;  4MMK A;  2RJC A;  1YJN A;  1JJ2 A;  3OYB A;  2XI9 A;  4QVD A;  4O6J A;  2A7Y A;  3L42 A;  4M7A B;  5CAI A;  5LJ5 d;  1G5V A;  2LVM A;  1AHJ B;  2E70 A;  1Q82 U;  3RKW A;  4HT8 A;  4M7A A;  4JRK A;  5C0M A;  1W2B S;  1X6O A;  4J7I A;  1H64 1;  3NFC A;  3FIF A;  3G4S T;  2LX9 A;  3LH0 A;  3JB9 H;  4C8Q B;  4B9X A;  4E7K A;  4FL6 A;  3JB9 D;  1VQ8 T;  2DTH A;  2P0Q A;  3CME T;  2QQA A;  2YHT A;  3N5B B;  2ZPF B;  3P8D A;  2M0O A;  5FU7 C;  2XKO C;  3CMA T;  4RKU E;  4BDZ A;  4M75 G;  2L89 A;  5KCO A;  3OYL A;  5DLQ E;  2EYQ A;  3PMI A;  1QP2 A;  1OI1 A;  4GLK A;  4QVZ A;  3CC4 T;  1VQL T;  2X4W A;  4JJN K;  1KHC A;  4C92 B;  4HCB A;  2XU8 A;  1OZ2 A;  3CCS T;  3CC2 T;  1VQ6 T;  3X26 B;  3GIB A;  4HT9 A;  3HRS A;  4M75 A;  4YTL A;  4KUL A;  5FU7 B;  3X20 B;  4QW2 A;  2DXU A;  5FU6 B;  5I2S A;  1G3T A;  1O75 A;  3C4S A;  4JLI A;  4C8Q G;  4F7U F;  3A8L B;  2DKG A;  1S72 A;  4M77 D;  4PLI A;  4ZN1 A;  3CCE A;  2OTL T;  1W2B A;  1I81 A;  2M16 A;  2LDM A;  3M4G A;  1UGQ B;  5LJ3 d;  4XTX A;  3JCM e;  4RG2 A;  3OMG A;  4M7A G;  1VQ5 T;  4BI3 A;  3E9F A;  1YI2 A;  1VIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...