4QQ7A

Crystal structure of putative stringent starvation protein a from burkholderia cenocepacia with bound glutathione
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
204
structure length
204
Chain Sequence
SMMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDISVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLMPADPVQRARARLFLLNFEKELFVHVSTLENEKGKAAEKNHEKARLAIRDRLTQLAPIFVKNKYMLGEEFSMLDVAIAPLLWRLDHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative stringent starvation protein A
publication title Crystal Structure of Putative stringent starvation protein A from Burkholderia cenocepacia with bound glutathione
rcsb
source organism Burkholderia cenocepacia
molecule tags Transferase
total genus 76
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4qq7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4qq7A01
4GLTA 3VK9A 1OYJA 2PVQA 4Z7XA 4ILFA 1XOAA 1QUWA 2FLSA 1M9AA 2E7PA 4L0WA 5IMCA 3GKKA 2YJ7A 2H30A 5DCGA 1K0OA 4WETA 4JBBA 4G0LA 3VPQA 1U88A 2LTKA 1GSQA 3ZVJD 2H6YA 5D93A 1H4OA 5IIZA 4PQIA 3IPZA 3WD6A 1TU8A 3WGDA 4HQZA 4ZL7A 2R5GA 2KP1A 2VCVA 14GSA 3LYKA 1EOHA 4MCUA 3KP8A 2GSSA 5HFGA 3R3EA 3VLNA 5G2ZA 1EGOA 3GKNA 2G2QA 4LL4B 4O92A 1MD3A 4KSOA 2WZ9A 4ZBBA 2EIQA 2DSAA 4BVYB 2CX4A 3IOSA 5EL8A 5IO0A 1DSBA 2HRKB 1HNAA 1VF2A 1GWCA 3PINA 5DALB 3QFAC 4IBPA 5HQPA 2LV3A 4DEJA 2VLUA 1Z6MA 2HXKA 2H1GA 4O32A 3IXRA 4MF7A 4YQMA 1ST9A 3M1GA 4MJEA 2EIOA 1LJRA 1WJKA 2HYXA 2GZPA 3HJPA 1Z3EA 1GTIA 3FW2A 3PPUA 3ZIVA 4G9HA 3HZ4A 1MDKA 3TRXA 1M9BA 1NM3A 4XRAA 4EVMA 1UN2A 3HVVA 3TKSC 2LKUA 3CSJA 1PX6A 4JZQA 4H86A 2O7KA 3F0IA 3PH9A 4IP6A 2GVPA 3LGCA 5E59A 5ECHB 2VLVA 4G0KA 6GSSA 1BX9A 1OVNA 3D22A 3GKXA 1XXUA 4QL7A 2OA7A 1AXDA 1XFLA 3L4NA 2R37A 4FH8A 1EP8A 3LQ7A 3DKSA 3UL3A 1MTCA 4GF0A 4MZWA 2XPDA 2OACA 1UC7A 5IOWA 3IRAA 3ERFA 3E0UA 2H74A 1DE2A 4PNFA 4JE1A 20GSA 3G7IA 1YJ6A 3E3EA 2HI7A 3D21A 2PWJA 5DAKA 2VCQA 3LXZA 4EO3A 1LU4A 2YOIA 1T8EB 3KZQA 4J57E 1K0AA 3UEMA 3C1SA 4I97A 1XWGA 5LNKe 1WE0A 2GSQA 5J9CA 1AIUA 2GGTA 2V6KA 3ZZXA 2GQKA 3LEFA 2FGXA 2ON5A 2WB9A 5H5SA 4TXVA 2M80A 5G30A 1GTUA 5GAPD 2E2GA 1GTBA 1QK8A 4AJ7A 4E8EA 5F05A 2PBJA 3D0ZA 1X5DA 5ENUA 1TK5B 4TN8A 5F07A 2YWMA 2E0QA 1URMA 1R26A 4POMA 1R7HA 3RPPA 1A2LA 2HSMA 5KN2A 4Q5NA 1OC9B 1VF4A 2KHPA 3H93A 1A2MA 1EWXA 4QQ7A 4ACSA 5DVBA 2CVKA 2LJKA 2RM5A 4GQFA 3IA1A 2AAWA 3F63A 3TJFA 5IMVA 4WF5A 4XS4A 4NWYA 3UVTA 1TU7A 4GQCA 4XCSA 3QDNA 1GP1A 1TOFA 3M0FA 2OBIA 5BMUA 2J23A 3ZYWA 1JZOA 3DWVA 1T7PB 4KW6A 2MMAA 3IC4A 4ZXGA 4ECBA 1GUMA 3TJBA 3EU3A 5JWQB 2F8FA 17GSA 4OCFA 4WKWA 3FRCA 1ACVA 2LEGA 2D2ZA 2HRFA 2HNLA 1Q4JA 3UMAA 2IMKA 1XWBA 3GH9A 3M9KA 5IMAA 1U3AA 3EMPA 4CDOA 1TTZA 2B1LA 1RW1A 1SJZA 1XVWA 4TR4A 1SL0B 1OE8A 3S9FA 2GT5A 4ID0A 1SYRA 1GSFA 3FR6A 4HQSA 1GSYA 1ABAA 3MDKA 1PL1A 4TR1A 5A5KA 3EMXA 3U5RE 2IL3A 1B48A 1V57A 4TOPA 1GLPA 1Z7RA 2PPTA 2V2GA 4HOJA 4KUNA 3KTBA 1X5EA 2PN8A 2O8VB 3G7JA 5B7CA 4WEYA 1S3AA 3C71A 1PX7A 2WS2A 3DXBA 1B8XA 2DIYA 3LWAA 3K8NA 5C04A 1ZL9A 3E9JB 1TRSA 1K0CA 3SBCA 2TRCP 4IW9A 3F4SA 4F2IA 2CVBA 5JWOB 1BAYA 2HZFA 2G0FA 3WGEA 5IPGA 5ELGA 2K8VA 1V58A 3IC8A 5KN3A 1FB6A 4F0CA 2F51A 2HRNA 3ZVJA 4EL1A 4LMVA 6GSWA 3HZ8A 2H1BA 4WBJA 1XWCA 4V1Ap 3PR8A 2ON7A 3GL3A 4MF5A 3VI7A 3L9UA 1ILOA 3DYRA 2JACA 4YQUA 4K9ZA 4PGTA 5ID2B 3L78A 2IMDA 2LRTA 3LORA 1QMVA 1ERTA 1WWJA 5D9XA 3HA9A 2BTOT 3RBTA 3F4TA 4ISDA 2B3SA 5KEJA 2H8LA 2R3XA 4P3YB 4G19A 2YV9A 3WYWA 4YAVA 3FZ5A 5DCHA 1JLWA 4NHZA 2OJLA 1PD21 1FW1A 1E2YA 4MLYA 4KDUA 1YY7A 3EYTA 3RAZA 2IFQA 4OO5A 4K6XA 2VL3A 3NZNA 3APOA 5ABRA 4ML1A 1SK1A 1G0TA 2L6CA 5IMFA 3FZ4A 1J9BA 5COHA 3QMXA 2VO4A 1O8XA 2OE0A 4IELA 4GTUA 5EVOA 3D4MA 4OO4A 3N9JA 5GSTA 3TOTA 5ECSA 5L71A 3GNJA 2CZ3A 1ZCPA 1PQNA 4MMMA 3M3MA 1K0MA 1ZZYA 1V40A 4G10A 5AISA 5G31A 4TW5A 5H5RA 1MDIA 3CRUA 2LJAA 1ML6A 2LRNA 4O7HA 1ZYQB 4OFMA 2YANA 3ZL5A 5HFKA 1K3LA 2PMTA 1M2BA 3JCML 2GZZA 1JZDA 3L9VA 3TKSA 4DVCA 3FR3A 4BL7B 3FZAA 3GFKA 5F06A 2C3NA 3I6AA 2FA8A 1TJDA 3W6GA 3ZLPA 1BJXA 3MSZA 4RI6A 4GWRA 5ECLB 4HS1A 5J5NA 3ZMKA 4KGIA 2GZYA 3APSA 1JZRA 4MPGA 1BYEA 2VCWA 1YF0A 2WULA 4N0ZA 3ZREA 3IAM2 4ZB9A 4EUYA 1U3IA 2FWHA 1ZYEA 5IQYA 4GSNA 3ME8A 2HSYA 4LL1B 1TKDB 2H1AA 5J4UA 3APQA 1JHBA 2AUVA 2OBKA 2A2SA 3F8UA 1XWAA 4PTSA 4K7IA 2FWGA 3IHQA 2V41A 3GL5A 2GLRA 1ERVA 2DLXA 1GRXA 2O89A 2OADA 4PQHA 2NVLA 4KAEA 2J9HA 4JRRA 1V2AA 4HJMA 2F9SA 1YDKA 2IWTA 3CTFA 3H1NA 1TP9A 2JADA 3KH9A 2QGVA 2GTUA 1IYIA 3TCOA 4BVXA 5JWRB 1KBNA 4DSRA 1I9DA 3WT1A 3H4KA 1AW9A 2VL2A 4IGJA 2I3YA 2VD1A 2ZNMA 4FYBA 3N5OA 2H0GA 4N10A 1KTEA 3NIVA 1M7TA 4CHSA 4PUFC 1A24A 1GH2A 3ZMLA 4OMVA 1SL2B 1O73A 2M72A 3LSZA 1F37A 1K3OA 4GRFA 3RPNA 2VM2A 4RQXA 4YQVA 1SKSB 3UVHA 4F03A 2B5YA 2ES7A 2JZRA 3ZITA 3GSSA 5J3RA 4KNDA 1XW6A 4NAXA 4F9ZA 2DIZA 4J56E 3FR9A 3EU4A 4HUAA 4TRXA 5KN0A 3QAGA 2DJ0A 3A2WA 1PA3A 1G6YA 2H19A 2N5AA 3P2AA 1EGRA 2N5BA 4G2EA 5CRHA 4OFNA 4JR6A 3TJJA 4L5LA 4IQ1A 2VCXA 3RDWA 3TKSE 4PXOA 3ZFBA 2IIYA 2X8GA 4YAPA 3LXTA 4BVYA 4Q5RA 2K9FA 4JEDA 3VWVA 5J41A 2HRKA 1EV4A 1S3CA 2CZ2A 1DUGA 2YWNA 4HZ4A 5DALA 1QGVA 5IOXA 4WR5A 3ISOA 3G9BA 1M0UA 3F3RA 3F3QA 1XCCA 3IE3A 3IAS2 2H66A 1F9MA 5B8BA 3FY7A 1PMTA 1U6TA 3L9SA 1EP7A 4GSTA 5FHIA 1YEPA 5B6NA 2C0FA 1Y6EA 2DJ3A 1GSUA 4JR4A 2MMNA 2L4QA 2DMMA 2YWIA 4K7OA 4KF9A 3Q6OA 2X8CA 4BWQA 3UIWA 3QR6A 4MZCA 5ECIB 3J7Yk 3QOUA 4F0BA 1WPIA 1F6MC 1O81A 4ZIJA 1ERWA 1PKWA 5B8AA 2VL2C 5IMDA 4GCIA 1TDIA 2OKAA 1O8WA 4IQAA 2YN1A 2FD3A 4MDCA 3US3A 4KH7A 4FQUA 2DC5A 2PVOC 2VCZA 1OKDA 3L0HA 1T00A 3ME7A 1K0NA 3Q18A 3UBKA 3U6VA 1O7UA 2L5LA 4HDEA 4JU5A 2JSZA 4N0VA 3V1WA 2B1KA 1B9XC 2L4CA 1EOGA 2H0IA 2TIRA 1JZWA 2DJ2A 4RUVA 5D9VA 3UAPA 1VGLA 3GSTA 1SL1B 2AB6A 2FWEA 1JLVA 2YCDA 1AUCA 3KH7A 4AGSA 1HYUA 3KD0A 4USSA 16GSA 3GKMA 2H0HA 2P31A 3TGZA 4ULXA 2K8SA 3IK9A 3Q19A 22GSA 3HCZA 5JCUA 2HFDA 1ZGNA 5ECPB 2FA4A 2I81A 2E2MA 1T3BA 4V1Ag 3W8JA 1EEMA 3A2XA 2LQOA 4FYCA 3VFIA 3VI5A 6GSUA 2H1DA 1SKRB 5HR0A 1AQWA 1FHEA 4ECIA 2MBSA 3EC3A 1MEKA 1OC3A 4IVFA 2VIMA 4N30A 3A5WA 3BD2A 2H71A 1HQOA 3CRTA 1W4VA 3DEXA 2DJKA 1X0RA 3H8QA 1OC9A 3IK7A 5CRDA 4MH3A 3AY8A 2KOKA 3TJGA 2KLXA 1ERUA 2A2RA 4L8EA 5FT3A 3C1RA 2CT6A 2Z9SA 3TKRA 2CA8A 3DIEA 2H76A 2DBCA 2NPBA 3QCPA 1K0BA 1G7EA 1NHOA 1K0DA 1HNCA 5DDLA 2L5OA 3GRXA 4KCEA 1LBKA 2CQ9A 4DSQA 5G1KA 3A2VA 3EURA 1A8YA 1G7OA 4KDXA 4ZB6A 1TI1A 6GSXA 4K1FA 1WOUA 4KB3A 1NSWA 3O3TA 2QC7A 2R4VA 2MZCA 4XTSA 5DJLA 1UA5A 5J9BA 2DJJA 3C7MA 2H75A 2L59A 4IS0A 4KA0A 1B9YC 4WR4A 2H01A 2JL4A 3FEUA 2H72A 5AIVA 5LD0A 4PUAA 2CX3A 3DD3A 3FK8A 2IPAA 2I4AA 3FKFA 2V1MA 3BBYA 4MJCA 3VPTA 1ZOFA 1AAZA 1X9MB 4I2UA 3F6FA 2MBTA 4LLRA 3CBUA 1T4YA 5EY6A 2GT6A 2X64A 5IMZA 1IYHA 3EWLA 7GSSA 2GDRA 5DQSA 2PERA 1R4WA 1J08A 3LG6A 1G6WA 2GSRA 2FCHA 1FOVA 1N2AA 4KX4A 5A4VA 2LRCA 5ELAA 4XHMA 2JZTA 5ECRB 2B5XA 4BWSA 4KDYA 3P90A 1FO5A 4I8BA 3GTUB 1PL2A 2BMXA 2WCIA 5G1LA 2M46A 2VOCA 1R5AA 3J7Yb 2K18A 3LJRA 4ECCA 3TDGA 3CSHA 1SENA 1U87A 2C4JA 3HHVA 2C0GA 4XS1A 4X43A 2N5FA 4IJ3A 2IMIA 5ECOB 4ZB8A 2C0EA 1X9WB 4IHUA 2LJRA 3CYNA 4ZBAA 3GIXA 5ID2A 3WT2A 1USBA 3IR4A 4K7NA 1GL8A 1A0RP 1XWKA 4EXJA 2PUKC 5EPFA 4OD7A 3I69A 5ECMB 5HR3A 1SJIA 3IBHA 3EINA 5IPHA 1EV9A 5GSSA 1NW2A 5IM9A 5DJMA 4HJ2A 3KXOA 2QKEA 3GV1A 3D6IA 5CO3A 4O5RA 4K8MA 2ZUPA 1I5GA 2RUEA 4ECJA 1S3DA 3EVIA 3TRQA 3UOMA 1Y25A 4MA9A 2WRTA 1KNGA 2IMEA 1BEDA 1R5PA 4V2NA 2GQLA 3RHBA 4EF0A 4L5OA 3TRPA 2OE1A 3NOFA 5D8IA 1HD2A 2FHEA 3O6TA 1PKZA 2RLIA 3QD9A 3D4TA 2H70A 4OWYA 5CNWA 4KSMA 5CRGA 5CYYA 5B6MA 4HI7A 5AGYA 3GMFA 2LNSA 1M99A 6GSYA 5HFIA 4POLA 1XZOA 2CAQA 1YF1A 2B7KA 3IV4A 1FB0A 2GS3A 2EIRA 1EZKA 2IN3A 2VD0A 3OR5A 4TKYA 5F0GA 2WGRA 5CP1A 2H73A 5ECQB 2PGTA 18GSA 2KP2A 4BL7A 3CSIA 4PURA 2LNTA 3A3TA 2HLSA 1B4QA 3VWUA 1TW9A 1AC1A 1QXHA 3GX8A 1T1VA 3KP9A 4I5QA 1GSDA 4I2TA 5G5FA 1MD4A 4ZILA 5D9TA 1OE7A 2HSHA 4DSSB 1SD8A 1TXXA 2I1UA 2NDOA 5CREA 3DGQA 2YNXA 4NV5A 4J2FA 1EEJA 4EE0A 2P5QA 3KCMA 2R6KA 1H75A 4WXTA 2IJYA 3GHAA 1VF1A 3TUEA 2HRAA 1M2DA 1AQVA 1Q98A 2B6MA 3F9UA 3LYPA 1FG4A 2KUCA 3GH6A 5HR2A 5DAKB 3GX0A 2O85A 4MH2A 2GQMA 2RUFA 2F3MA 2UZ8A 1SU9A 3KEBA 3UBLA 1TRUA 5HR1A 2PU9C 3KMOA 3ZTLA 1FAAA 4X0XA 1GTAA 3DVWA 1GUKA 4RI7A 1GNEA 3HXSA 1SYXA 3BCIA 1XVQA 2FNOA 4EKZA 1SKWB 2TRXA 3HVSA 2A4VA 2AV4A 4GSSA 1Z7PA 3VURA 5D73A 3M9JA 4D73B 3MAKA 1YKAA 6GSTA 1E6BA 3HD5A 2HT9A 1F2EA 4NHWA 4DSSA 3KJYA 4LA1A 2XBQA 4AF2A 1TRVA 3ERWA 1YQ1A 4V2LA 2HSNB 2BJXA 2HSMB 1ZMAA 4FYUA 4I6XA 4MJBA 5G5EA 3CXGA 2LSTA 19GSA 4N11A 1M2AA 5F8BA 3LFLA 3ERGA 2V32A 2AYTA 1OC8A 3GURA 5GZZB 3BJ5A 4FO5A 1PGTA 5D96A 3HJOA 5FWGA 4XS4B 1BQ7A 3QAVA 2LUSA 2VL9A 4IJIA 3DVXA 3VWWA 2YJHA 4NMUA 1YZXA 1GNWA 1VRSD 2HE3A 5DQYA 3I43A 1C72A 4ZBDA 1J0FA 2VLTA 5INYA 2RM6A 1PSQA 4BPYA 1AQXA 1WIKA 4HEA2 4D73A 2MMZA 3QPMA 3C73A 3O76A 4XS6A 2FUG2 3CTGA 1WP0A 5GAND 3Q74A 2HQTA 3ZFLA 1THOA 1THXA 3BCKA 5JCGA 4HU9A 2CVDA 3QFBC 1TI3A 5DBQA 4TR1B 2AJQB 2GSTA 4MJAA 4MF6A 4TR3A 4F82A 4TXOB 2XHFA 1TRWA 2EC4A 1XW5A 3BOAA 3P7XA 1T4ZA 4EDZA 9GSSA 1TK8B 13GSA 3ZIJA 2LS5A 3KM6A 1XW9A 2F8AA 2JSYA 1QFNA 3UARA 1A23A 1A8LA 5IO2A 2QSIA 3M8NA 4MABA 3CMIA 2WFCA 4V2MA 5ECNB 4MZBA 2WJUA 1XBSA 4YH2A 4GXZA 2NBSA 4OCEA 5ECKB 4IKHA 4K0NA 1VF3A 1CQHA 1ON4A 5C00A 5A4WA 4K0GA 1MDJA 3TKPA 2B7JA 4PQ1A 3SWLA 3KIJA 1GUHA 1F3AA 4POBA 3HKRA 2DJ1A 4XRDA 3EE2A 4KE3A 1BG5A 2H6XA 4NV2A 3UJ1A 1GULA 1V9WA 2C8UA 5A4UA 3HVXA 1CQGA 4ML6A 11GSA 2OE3A 4EDYA 2IMFA 4X1UA 1SD9A 3PGTA 2MMOA 3D5JA 4IN0A 4K2DA 4FIWA 1GSEA 4XIHA 2VM1A 4KCAA 10GSA 4NPBA 5AN1A 2C80A 4Q5QA 1WRYA 3VWXA 4POKA 4TXOA 3HYPA 1Z6NA 1Z9HA 2LQQA 5D9WA 1DBYA 1GLQA 1FVJA 2YZHA 2MYGA 4MK3A 2P5RA 1K3YA 1HNBA 4HU7A 2IFQB 4TR0A 2DMLA 4E8HA 3DMLA 1Z5YE 1SK2A 4QL9A 2XBIA 2R2JA 4AJ8A 1OKTA 5KN1A 4ZL9A 2L57A 4MP4A 2YWOA 4Q5FA 2K6VA 2REMA 5LCZA 1RQMA 2XPEA 2C3QA 2NTOA 3ZRDA 2ZCTA 3GA4A 4WF4A 4RQRA 4HZ2A 1A0FA 2H6ZA 2C3TA 2HZEB 1NHYA 2YP6A 3FYGA 1X5CA 1PN9A 3RHCA 3QAWA 1YEXA 2XC2A 1XPVA 1N8JA 5CRWA 2X8HA 3TKQA 2C1YA 4PX1A 3KMNA 5JCWA 3WGXA 4WBRD 3W8SA 2FY6A 1XOBA 4TVEA 2X99A 2CV4A 1YKCA 2FWFA 2V6OA 5AIXA 1TK0B 4LMWA 4G0IA 3FHKA 2P0GA 3H79A 3MNGA 2VAFA 4EC0A 4MPFA 2VUPA 3HJMA 3I9V2 3G7YA 1OAZA 3F4RA 1KEBA 2YZUA 8GSSA 3IDVA 1O85A 3TOUA 1SK0A 3GUSA 2AHEA 3KTLA 3FZ9A 2O87A 4BA7A 1A2JA 5CAXA 1SJ6A 1UVZA 4ZL8A 3ED3A 2CAIA 1QQ2A 3HDCA 4NXIA 5H5QA 2ALBA 4CW9A 3TB2A 2C0DA 2HZEA 4OFTA 1PRXA 1WMJA 1JFUA 3HY2A 2B5EA 2JZSA 4PNGA 3GYKA 3F6DA 1X9SB 5E4WA 1O6JA 2L6DA 3TJKA 6GSVA 3C8EA 1W89A 2VCTA 3R2QA 1FVKA 4BVXB 4IP1A 2YPMA 3GTUA 3MWHA 1V98A 1RK4A 1GSSA 1XIYA 2RIIA 12GSA 3P8WA 2JU5A 3DRNA 2YV7A 2WDUA 2I9HA 3KGKA 3GN3A 4L0UA 1DE1A 4AJ6A 1B4PA 1F3BA
chains in the Genus database with same CATH superfamily
4GLTA 3VK9A 1OYJA 2PVQA 4Z7XA 4ILFA 1XOAA 1QUWA 2FLSA 1M9AA 2E7PA 4L0WA 5IMCA 3GKKA 2YJ7A 2X4AA 2H30A 5DCGA 1K0OA 4WETA 4JBBA 4G0LA 3VPQA 1U88A 2LTKA 1GSQA 3ZVJD 2H6YA 5D93A 1H4OA 5IIZA 2R0GA 4PQIA 3IPZA 3WD6A 1TU8A 3WGDA 4HQZA 4ZL7A 2R5GA 2KP1A 2VCVA 14GSA 3LYKA 1EOHA 4MCUA 3KP8A 4YKFA 2GSSA 5HFGA 3R3EA 3VLNA 5G2ZA 1EGOA 3GKNA 2G2QA 4LL4B 4O92A 1MD3A 4KSOA 2WZ9A 4ZBBA 2EIQA 2DSAA 4BVYB 2CX4A 3IOSA 5EL8A 5IO0A 1DSBA 2HRKB 1HNAA 1VF2A 1GWCA 2WW1A 3PINA 5DALB 3QFAC 4IBPA 5HQPA 2LV3A 4DEJA 2VLUA 1Z6MA 2HXKA 2H1GA 4O32A 3IXRA 4MF7A 4YQMA 1ST9A 3M1GA 2WVXA 4MJEA 1ZYPA 3FMWA 2EIOA 1LJRA 1WJKA 2HYXA 2GZPA 3HJPA 1Z3EA 1GTIA 3FW2A 3PPUA 3ZIVA 4G9HA 3HZ4A 1MDKA 3TRXA 1M9BA 1NM3A 4XRAA 4EVMA 1UN2A 3HVVA 3TKSC 2LKUA 3CSJA 1PX6A 4JZQA 4H86A 2O7KA 3F0IA 4YKGA 3PH9A 4IP6A 2GVPA 3LGCA 3LW9A 5E59A 5ECHB 2VLVA 1BF5A 4G0KA 6GSSA 1BX9A 1OVNA 3D22A 3GKXA 1XXUA 4QL7A 2OA7A 1AXDA 1XFLA 3L4NA 2R37A 4FH8A 1EP8A 3LQ7A 3DKSA 3UL3A 1MTCA 4GF0A 4MZWA 2XPDA 2OACA 1UC7A 5IOWA 3IRAA 3ERFA 3E0UA 2H74A 1DE2A 4PNFA 4JE1A 20GSA 3G7IA 1YJ6A 3E3EA 2HI7A 3D21A 2PWJA 5DAKA 2VCQA 3LXZA 4EO3A 1LU4A 2YOIA 1T8EB 3KZQA 4J57E 1K0AA 4AKGA 3UEMA 4Z2RA 3C1SA 4I97A 1SVMA 1XWGA 5LNKe 1WE0A 2GSQA 5J9CA 1AIUA 2GGTA 2V6KA 3ZZXA 2GQKA 3LEFA 2FGXA 2ON5A 2WB9A 5H5SA 4TXVA 2M80A 5G30A 1GTUA 5GAPD 2E2GA 1GTBA 1QK8A 4AJ7A 4E8EA 5F05A 5KOXA 4FXYP 2PBJA 3D0ZA 1X5DA 5ENUA 1TK5B 4TN8A 5F07A 2YWMA 2E0QA 2WZSA 1URMA 1R26A 4POMA 1R7HA 3RPPA 1A2LA 2HSNA 2HSMA 5KN2A 4Q5NA 1OC9B 1VF4A 2KHPA 3H93A 1A2MA 1EWXA 4QQ7A 4ACSA 5DVBA 2CVKA 2H1LA 2LJKA 2RM5A 4GQFA 3IA1A 4EIQA 2AAWA 3F63A 5A34A 3TJFA 5IMVA 3RGBC 4WF5A 4XS4A 4NWYA 3UVTA 1TU7A 4GQCA 4XCSA 3QDNA 1GP1A 1TOFA 3M0FA 2OBIA 5BMUA 2J23A 3ZYWA 1JZOA 3DWVA 1T7PB 4KW6A 2MMAA 3IC4A 4ZXGA 4ECBA 1GUMA 3TJBA 3EU3A 5JWQB 2F8FA 3CWGA 17GSA 4OCFA 4WKWA 3FRCA 1ACVA 2LEGA 2D2ZA 2HRFA 2HNLA 1Q4JA 3UMAA 2IMKA 1XWBA 3GH9A 3M9KA 5IMAA 1U3AA 3EMPA 4CDOA 1TTZA 2B1LA 1RW1A 1SJZA 1XVWA 4TR4A 1SL0B 1OE8A 3S9FA 2GT5A 4ID0A 1SYRA 1GSFA 3FR6A 4HQSA 1GSYA 1ABAA 3MDKA 1PL1A 4TR1A 5A5KA 3EMXA 3U5RE 2IL3A 1B48A 1V57A 4TOPA 1GLPA 1Z7RA 2PPTA 2V2GA 4HOJA 4KUNA 3KTBA 1X5EA 2PN8A 2O8VB 2OT3A 3G7JA 5B7CA 4WEYA 1S3AA 3C71A 1PX7A 2R0PA 2WS2A 3DXBA 1B8XA 2WVZA 2DIYA 3LWAA 3K8NA 5C04A 1ZL9A 3E9JB 1TRSA 1K0CA 3SBCA 2TRCP 4IW9A 1PN0A 3F4SA 4F2IA 2CVBA 4O5QA 5JWOB 1BAYA 2HZFA 2G0FA 4ICYA 3WGEA 5IPGA 4K5SA 5ELGA 2K8VA 1V58A 3IC8A 5KN3A 1FB6A 4F0CA 2F51A 2HRNA 3ZVJA 4EL1A 2WVYA 4LMVA 6GSWA 3HZ8A 2H1BA 4WBJA 1XWCA 4V1Ap 3PR8A 2ON7A 3GL3A 4MF5A 3VI7A 3L9UA 1ILOA 3DYRA 2JACA 4YQUA 4K9ZA 5J47A 4PGTA 5ID2B 3L78A 2IMDA 2LRTA 3LORA 1QMVA 1ERTA 1WWJA 5D9XA 3HA9A 2BTOT 3RBTA 3F4TA 4ISDA 3MYDA 2B3SA 5KEJA 2H8LA 2R3XA 4P3YB 4G19A 2YV9A 3WYWA 4YAVA 3FZ5A 5DCHA 1JLWA 4NHZA 2OJLA 1PD21 4AKHA 1FW1A 1E2YA 4MLYA 4KDUA 1YY7A 3EYTA 3RAZA 2IFQA 4OO5A 4K6XA 2VL3A 3NZNA 3APOA 5ABRA 4ML1A 1SK1A 1G0TA 5A5HB 1TXUA 2L6CA 5IMFA 3FZ4A 1J9BA 5COHA 3QMXA 2VO4A 1O8XA 2OE0A 4IELA 4GTUA 5EVOA 3D4MA 4OO4A 3N9JA 5GSTA 3TOTA 5ECSA 5L71A 3GNJA 2CZ3A 1ZCPA 1PQNA 4MMMA 3M3MA 1K0MA 1ZZYA 1V40A 4G10A 5AISA 5G31A 4TW5A 5H5RA 1MDIA 3CRUA 2LJAA 1ML6A 2LRNA 4O7HA 1ZYQB 4OFMA 1XG8A 2YANA 3ZL5A 5HFKA 1K3LA 2PMTA 1M2BA 3JCML 2GZZA 1JZDA 3L9VA 3TKSA 4DVCA 3FR3A 4BL7B 3FZAA 3GFKA 5F06A 2C3NA 3I6AA 2FA8A 1TJDA 3W6GA 3ZLPA 1BJXA 3MSZA 2WW2A 4RI6A 4GWRA 5ECLB 4HS1A 5J5NA 3ZMKA 4KGIA 2GZYA 3APSA 1JZRA 4MPGA 1BYEA 2VCWA 1YF0A 1M3JA 2WULA 4N0ZA 3ZREA 3IAM2 4ZB9A 4EUYA 1N25A 1U3IA 2FWHA 1ZYEA 5IQYA 4GSNA 3ME8A 2HSYA 2QA1A 4LL1B 1TKDB 2H1AA 5J4UA 3APQA 1JHBA 2AUVA 2OBKA 2A2SA 3F8UA 5BRTA 1XWAA 4PTSA 4K7IA 2FWGA 3IHQA 2V41A 3GL5A 2GLRA 1ERVA 2DLXA 1GRXA 2O89A 2OADA 4PQHA 2NVLA 4KAEA 2J9HA 4JRRA 1V2AA 4HJMA 2F9SA 1YDKA 2IWTA 3CTFA 3H1NA 1TP9A 2JADA 3KH9A 2QGVA 2GTUA 1IYIA 3TCOA 4BVXA 4CY8A 5JWRB 1KBNA 4DSRA 1I9DA 3WT1A 3H4KA 1AW9A 2VL2A 5A1NB 4IGJA 2I3YA 2VD1A 2ZNMA 4FYBA 3N5OA 2H0GA 4N10A 1KTEA 3NIVA 1M7TA 4CHSA 4PUFC 2O5VA 1A24A 1GH2A 3ZMLA 4OMVA 1SL2B 1O73A 2M72A 3MIXA 3LSZA 1F37A 1K3OA 4GRFA 3RPNA 2VM2A 4RQXA 4YQVA 1SKSB 3UVHA 4F03A 2B5YA 2ES7A 2JZRA 3ZITA 3GSSA 5J3RA 4KNDA 1XW6A 4NAXA 4PI2C 4F9ZA 2DIZA 4J56E 3FR9A 3EU4A 4HUAA 4TRXA 5KN0A 3QAGA 2DJ0A 3A2WA 1PA3A 1G6YA 2H19A 2N5AA 3P2AA 3RFRC 2WW3A 1EGRA 2N5BA 4G2EA 1PFOA 5CRHA 4OFNA 4JR6A 3TJJA 4L5LA 4IQ1A 2VCXA 3RDWA 3TKSE 4PXOA 3ZFBA 4X4JA 2IIYA 2X8GA 2EFHA 4YAPA 3LXTA 5A1NA 4BVYA 4Q5RA 2K9FA 4JEDA 3VWVA 5J41A 4N3ZA 2HRKA 1EV4A 1S3CA 2CZ2A 1DUGA 2YWNA 4HZ4A 5DALA 1QGVA 5IOXA 4WR5A 3ISOA 3G9BA 1M0UA 3F3RA 3F3QA 1XCCA 3IE3A 3IAS2 4CY6A 2H66A 1F9MA 5B8BA 3FY7A 1PMTA 1U6TA 3L9SA 1EP7A 4GSTA 5FHIA 1YEPA 5B6NA 2C0FA 1Y6EA 2DJ3A 1GSUA 4JR4A 2MMNA 2L4QA 2DMMA 2YWIA 4K7OA 4KF9A 3Q6OA 2X8CA 4BWQA 3UIWA 3QR6A 4MZCA 5ECIB 3J7Yk 3QOUA 4F0BA 1WPIA 1F6MC 1O81A 4ZIJA 1ERWA 1PKWA 1FOHA 5B8AA 2VL2C 5IMDA 4GCIA 1TDIA 2OKAA 1O8WA 4IQAA 2YN1A 2FD3A 4MDCA 3US3A 4KH7A 4FQUA 2DC5A 2PVOC 2VCZA 1OKDA 3L0HA 1T00A 3ME7A 1K0NA 3Q18A 3UBKA 3U6VA 1O7UA 2L5LA 4HDEA 4JU5A 2JSZA 4N0VA 3V1WA 2B1KA 1B9XC 2L4CA 1EOGA 2H0IA 2TIRA 1JZWA 2DJ2A 5KOWA 4RUVA 5D9VA 3UAPA 4AKXB 1VGLA 3GSTA 1SL1B 4AI6A 2AB6A 2FWEA 1JLVA 2YCDA 1AUCA 3KH7A 4AGSA 1HYUA 3KD0A 4USSA 16GSA 3GKMA 2H0HA 2P31A 3TGZA 4ULXA 1YVLA 2K8SA 3IK9A 3Q19A 22GSA 3HCZA 5JCUA 2HFDA 1ZGNA 5ECPB 2FA4A 2I81A 2E2MA 2EFDA 1T3BA 4V1Ag 3W8JA 1EEMA 3A2XA 2LQOA 4FYCA 3VFIA 3VI5A 6GSUA 2H1DA 1SKRB 5HR0A 1AQWA 1FHEA 4ECIA 2MBSA 4QMKA 3EC3A 1MEKA 1OC3A 4IVFA 2VIMA 4N30A 3A5WA 3BD2A 2H71A 1HQOA 3CRTA 1W4VA 3DEXA 2DJKA 1X0RA 4E68A 1S4BP 3H8QA 1OC9A 1ZYNA 1YEWC 3IK7A 5CRDA 4MH3A 3AY8A 2KOKA 3TJGA 5J4YA 2KLXA 1ERUA 2A2RA 4L8EA 5FT3A 3C1RA 4MNNA 2CT6A 2Z9SA 3TKRA 2CA8A 3DIEA 2H76A 2DBCA 2NPBA 2A2PA 3QCPA 1K0BA 1G7EA 1NHOA 1K0DA 1HNCA 5DDLA 2L5OA 3GRXA 4KCEA 1LBKA 2CQ9A 4DSQA 5G1KA 3A2VA 3EURA 1A8YA 1G7OA 4KDXA 4ZB6A 1TI1A 2X49A 6GSXA 4K1FA 1WOUA 4KB3A 1NSWA 3O3TA 2QC7A 2R4VA 2MZCA 4XTSA 5DJLA 1UA5A 5J9BA 2DJJA 3C7MA 2H75A 2L59A 4IS0A 4KA0A 1B9YC 4WR4A 2H01A 2JL4A 3FEUA 2H72A 5AIVA 5LD0A 4PUAA 2CX3A 3DD3A 3FK8A 2IPAA 2I4AA 3FKFA 2V1MA 3BBYA 4MJCA 3VPTA 1ZOFA 1AAZA 1X9MB 4I2UA 3F6FA 2MBTA 4LLRA 3CBUA 1T4YA 5EY6A 2GT6A 2X64A 5IMZA 1IYHA 3EWLA 7GSSA 2GDRA 5DQSA 2PERA 1R4WA 1J08A 3LG6A 1G6WA 2GSRA 2FCHA 1FOVA 2DKIA 1N2AA 4KX4A 5A4VA 2LRCA 5ELAA 4XHMA 2JZTA 5ECRB 2B5XA 4BWSA 4KDYA 3P90A 1FO5A 5J40A 4I8BA 3GTUB 1PL2A 2BMXA 2WCIA 5G1LA 2M46A 2VOCA 1R5AA 3J7Yb 2K18A 3LJRA 4ECCA 3TDGA 3CSHA 1SENA 1U87A 2C4JA 3HHVA 2C0GA 4XS1A 4X43A 2N5FA 4IJ3A 3A5IA 2IMIA 5ECOB 4ZB8A 2C0EA 4PHZC 1X9WB 1S3RA 4IHUA 2LJRA 3CYNA 4ZBAA 3GIXA 5ID2A 3WT2A 1USBA 3IR4A 4K7NA 1GL8A 1A0RP 1XWKA 4EXJA 2PUKC 5EPFA 4OD7A 3I69A 5ECMB 5HR3A 1SJIA 3IBHA 3EINA 5IPHA 1EV9A 5GSSA 1NW2A 5IM9A 5DJMA 4HJ2A 3KXOA 2QKEA 3GV1A 3D6IA 4O5UA 4A5PA 5CO3A 4O5RA 4K8MA 2ZUPA 1I5GA 2RUEA 4ECJA 1S3DA 3EVIA 3TRQA 5A5HA 3UOMA 1I1IP 1Y25A 4MA9A 2WRTA 1KNGA 2IMEA 1BEDA 1R5PA 4V2NA 2GQLA 3RHBA 4EF0A 4L5OA 3TRPA 2OE1A 3NOFA 5D8IA 1HD2A 2FHEA 3O6TA 1PKZA 2RLIA 3QD9A 3D4TA 2H70A 4OWYA 5CNWA 4KSMA 5CRGA 5CYYA 5B6MA 4HI7A 5AGYA 2WVXB 3GMFA 2LNSA 1M99A 6GSYA 5HFIA 4POLA 1XZOA 2CAQA 1YF1A 2B7KA 3IV4A 1FB0A 2GS3A 2EIRA 1EZKA 2IN3A 4W66A 2VD0A 3OR5A 4TKYA 5F0GA 2WGRA 5CP1A 2H73A 5ECQB 2PGTA 18GSA 2KP2A 4BL7A 3CSIA 4PURA 2LNTA 3A3TA 2HLSA 1B4QA 3VWUA 1TW9A 1AC1A 1QXHA 3GX8A 1T1VA 3KP9A 4I5QA 1GSDA 4G01A 4I2TA 5G5FA 1MD4A 4ZILA 5D9TA 1OE7A 2HSHA 4DSSB 1SD8A 1TXXA 2I1UA 2NDOA 5CREA 3DGQA 2YNXA 1M3IA 4NV5A 4J2FA 1EEJA 4EE0A 2P5QA 3KCMA 2R6KA 1H75A 4WXTA 2IJYA 3GHAA 1VF1A 3TUEA 2HRAA 1M2DA 3CQFA 4K5RA 1AQVA 1Q98A 2B6MA 3F9UA 3LYPA 1FG4A 2KUCA 3GH6A 5HR2A 5DAKB 3GX0A 2O85A 4MH2A 2GQMA 2VKZG 2RUFA 2F3MA 2UZ8A 1SU9A 3KEBA 3UBLA 2EFCA 1TRUA 5HR1A 2PU9C 3KMOA 3ZTLA 1FAAA 4X0XA 3EPTA 1GTAA 3DVWA 1GUKA 4RI7A 1GNEA 3HXSA 1SYXA 3BCIA 1XVQA 2FNOA 4EKZA 1SKWB 2TRXA 3HVSA 2A4VA 2AV4A 4GSSA 1Z7PA 3VURA 5D73A 3M9JA 4D73B 3MAKA 1YKAA 6GSTA 1E6BA 3HD5A 3HVNA 2HT9A 1F2EA 4NHWA 4DSSA 3KJYA 4LA1A 2XBQA 4AF2A 1TRVA 3ERWA 1YQ1A 4V2LA 2HSNB 2BJXA 2HSMB 1ZMAA 4FYUA 4I6XA 4MJBA 5G5EA 2DKHA 4ZB7A 3CXGA 2LSTA 19GSA 4N11A 1M2AA 5F8BA 3LFLA 3ERGA 2V32A 4K2XA 2AYTA 1OC8A 3GURA 5GZZB 3BJ5A 4FO5A 1PGTA 5D96A 5A34B 3HJOA 5FWGA 4XS4B 1BQ7A 3QAVA 2LUSA 2VL9A 4IJIA 3DVXA 3VWWA 5BMUB 2YJHA 4NMUA 1YZXA 1GNWA 1VRSD 4Z2UA 2HE3A 5DQYA 3I43A 1C72A 4ZBDA 4Z2TA 1J0FA 2VLTA 5INYA 2RM6A 1PSQA 4BPYA 1AQXA 1WIKA 3IHGA 4HEA2 4D73A 2MMZA 3QPMA 3C73A 3O76A 4XS6A 2FUG2 3CTGA 1WP0A 5GAND 3Q74A 2HQTA 3ZFLA 1THOA 1THXA 4PI0C 3BCKA 5JCGA 4HU9A 2CVDA 1Y1UA 1TI3A 3QFBC 4EIPA 5DBQA 4TR1B 2AJQB 2GSTA 4MJAA 4MF6A 4TR3A 4F82A 4TXOB 2XHFA 1TRWA 2EC4A 1XW5A 3BOAA 3P7XA 1T4ZA 4EDZA 9GSSA 1TK8B 13GSA 3ZIJA 2LS5A 3KM6A 1XW9A 2F8AA 2JSYA 1QFNA 3UARA 1A23A 1A8LA 5IO2A 2QSIA 3M8NA 4MABA 3CMIA 2WFCA 2QA2A 4V2MA 5ECNB 4MZBA 2WJUA 1XBSA 4HSCX 4YH2A 4GXZA 2UV8G 2NBSA 4OCEA 5ECKB 4IKHA 4K0NA 1VF3A 1CQHA 1ON4A 5C00A 5A4WA 4BIKA 4K0GA 1MDJA 3TKPA 2B7JA 4PQ1A 3SWLA 3KIJA 1GUHA 1F3AA 4POBA 3HKRA 2DJ1A 4XRDA 3EE2A 4KE3A 1BG5A 2H6XA 4NV2A 3UJ1A 1GULA 1V9WA 2C8UA 5A4UA 3HVXA 1CQGA 4ML6A 11GSA 2OE3A 4EDYA 2IMFA 4X1UA 1SD9A 3PGTA 2MMOA 3D5JA 4IN0A 4K2DA 4FIWA 1GSEA 4XIHA 2VM1A 4KCAA 2EFEA 10GSA 4NPBA 5AN1A 2C80A 4Q5QA 1WRYA 3VWXA 4POKA 4AKIA 4TXOA 3HYPA 1Z6NA 1Z9HA 2LQQA 5D9WA 3TU3B 4GDFA 1DBYA 5J4VA 1GLQA 1FVJA 2YZHA 2MYGA 4MK3A 2P5RA 1SVOA 1K3YA 1HNBA 2WW0A 4HU7A 2IFQB 4TR0A 2DMLA 4E8HA 3DMLA 1Z5YE 1SK2A 4QL9A 2XBIA 2R2JA 4AJ8A 1OKTA 5KN1A 4ZL9A 2L57A 4MP4A 2YWOA 4Q5FA 2K6VA 2REMA 5LCZA 1RQMA 2XPEA 2C3QA 2NTOA 3ZRDA 2ZCTA 3HMJG 3GA4A 4WF4A 4RQRA 4HZ2A 1A0FA 2H6ZA 2C3TA 2R0CA 2HZEB 2A4HA 1NHYA 2YP6A 3FYGA 1X5CA 1PN9A 3RHCA 3QAWA 1YEXA 2XC2A 1XPVA 1N8JA 5CRWA 2O36A 2X8HA 3TKQA 1BG1A 2C1YA 4PX1A 3KMNA 5JCWA 3WGXA 4WBRD 3W8SA 2FY6A 1XOBA 4TVEA 2X99A 2CV4A 1YKCA 2FWFA 2V6OA 5AIXA 1TK0B 4LMWA 4G0IA 3FHKA 2P0GA 3H79A 3MNGA 2VAFA 4EC0A 4MPFA 2VUPA 3HJMA 3I9V2 3G7YA 1OAZA 3F4RA 1KEBA 2YZUA 8GSSA 3IDVA 1O85A 3TOUA 1SK0A 3GUSA 2AHEA 3KTLA 3FZ9A 2O87A 4BA7A 1A2JA 5CAXA 1SJ6A 1UVZA 4ZL8A 3ED3A 2CAIA 1QQ2A 3HDCA 4NXIA 5H5QA 2ALBA 4CW9A 2O3EA 3TB2A 2C0DA 2HZEA 4OFTA 1PRXA 1WMJA 1JFUA 3HY2A 2B5EA 2JZSA 4PNGA 3GYKA 3F6DA 1X9SB 5E4WA 1O6JA 2L6DA 3TJKA 6GSVA 3C8EA 1W89A 2VCTA 3R2QA 1FVKA 3CHXC 4BVXB 4IP1A 2YPMA 3GTUA 3MWHA 1V98A 1RK4A 1GSSA 1XIYA 1SVLA 2RIIA 12GSA 3P8WA 2JU5A 3DRNA 2YV7A 2WDUA 2I9HA 3KGKA 3GN3A 4L0UA 1DE1A 4AJ6A 1B4PA 1F3BA
chains in the Genus database with same CATH topology
4GLTA 3VK9A 1OYJA 2PVQA 4Z7XA 4ILFA 1XOAA 1QUWA 2FLSA 1M9AA 2E7PA 4L0WA 5IMCA 3GKKA 2YJ7A 2X4AA 2H30A 5DCGA 1K0OA 4WETA 4JBBA 4G0LA 3VPQA 1U88A 2LTKA 1GSQA 3ZVJD 2H6YA 5D93A 1H4OA 5IIZA 2R0GA 4PQIA 3IPZA 3WD6A 1TU8A 3WGDA 4HQZA 4ZL7A 2R5GA 2KP1A 2VCVA 14GSA 3LYKA 1EOHA 4MCUA 3KP8A 4YKFA 2GSSA 5HFGA 3R3EA 3VLNA 5G2ZA 1EGOA 3GKNA 2G2QA 4LL4B 4O92A 1MD3A 4KSOA 2WZ9A 4ZBBA 2EIQA 2DSAA 4BVYB 2CX4A 3IOSA 5EL8A 5IO0A 1DSBA 2HRKB 1HNAA 1VF2A 1GWCA 3PINA 5DALB 3QFAC 4IBPA 5HQPA 2LV3A 4DEJA 2VLUA 1Z6MA 2HXKA 2H1GA 4O32A 3IXRA 4MF7A 4YQMA 1ST9A 3M1GA 4MJEA 1ZYPA 3FMWA 2EIOA 1LJRA 1WJKA 2HYXA 2GZPA 3HJPA 1Z3EA 1GTIA 3FW2A 3PPUA 3ZIVA 4G9HA 3HZ4A 1MDKA 3TRXA 1M9BA 1NM3A 4XRAA 4EVMA 1UN2A 3HVVA 3TKSC 2LKUA 3CSJA 1PX6A 4JZQA 4H86A 2O7KA 3F0IA 4YKGA 3PH9A 4IP6A 2GVPA 3LGCA 3LW9A 5E59A 5ECHB 2VLVA 1BF5A 4G0KA 6GSSA 1BX9A 1OVNA 3D22A 3GKXA 1XXUA 4QL7A 2OA7A 1AXDA 1XFLA 3L4NA 2R37A 4FH8A 1EP8A 3LQ7A 3DKSA 3UL3A 1MTCA 4GF0A 4MZWA 2XPDA 2OACA 1UC7A 5IOWA 3IRAA 3ERFA 3E0UA 2H74A 1DE2A 4PNFA 4JE1A 20GSA 3G7IA 1YJ6A 3E3EA 2HI7A 3D21A 2PWJA 5DAKA 2VCQA 3LXZA 4EO3A 1LU4A 2YOIA 1T8EB 3KZQA 4J57E 1K0AA 4AKGA 3UEMA 4Z2RA 3C1SA 4I97A 1SVMA 1XWGA 5LNKe 1WE0A 2GSQA 5J9CA 1AIUA 2GGTA 2V6KA 3ZZXA 2GQKA 3LEFA 2FGXA 2ON5A 2WB9A 5H5SA 4TXVA 2M80A 5G30A 1GTUA 5GAPD 2E2GA 1GTBA 1QK8A 4AJ7A 4E8EA 5F05A 5KOXA 2PBJA 3D0ZA 1X5DA 5ENUA 1TK5B 4TN8A 5F07A 2YWMA 2E0QA 1URMA 1R26A 4POMA 1R7HA 3RPPA 1A2LA 2HSNA 2HSMA 5KN2A 4Q5NA 1OC9B 1VF4A 2KHPA 3H93A 1A2MA 1EWXA 4QQ7A 4ACSA 5DVBA 2CVKA 2H1LA 2LJKA 2RM5A 4GQFA 3IA1A 4EIQA 2AAWA 3F63A 5A34A 3TJFA 5IMVA 4WF5A 4XS4A 4NWYA 3UVTA 1TU7A 4GQCA 4XCSA 3QDNA 1GP1A 1TOFA 3M0FA 2OBIA 5BMUA 2J23A 3ZYWA 1JZOA 3DWVA 1T7PB 4KW6A 2MMAA 3IC4A 4ZXGA 4ECBA 1GUMA 3TJBA 3EU3A 5JWQB 2F8FA 3CWGA 17GSA 4OCFA 4WKWA 3FRCA 1ACVA 2LEGA 2D2ZA 2HRFA 2HNLA 1Q4JA 3UMAA 2IMKA 1XWBA 3GH9A 3M9KA 5IMAA 1U3AA 3EMPA 4CDOA 1TTZA 2B1LA 1RW1A 1SJZA 1XVWA 4TR4A 1SL0B 1OE8A 3S9FA 2GT5A 4ID0A 1SYRA 1GSFA 3FR6A 4HQSA 1GSYA 1ABAA 3MDKA 1PL1A 4TR1A 5A5KA 3EMXA 3U5RE 2IL3A 1B48A 1V57A 4TOPA 1GLPA 1Z7RA 2PPTA 2V2GA 4HOJA 4KUNA 3KTBA 1X5EA 2PN8A 2O8VB 2OT3A 3G7JA 5B7CA 4WEYA 1S3AA 3C71A 1PX7A 2R0PA 2WS2A 3DXBA 1B8XA 2DIYA 3LWAA 3K8NA 5C04A 1ZL9A 3E9JB 1TRSA 1K0CA 3SBCA 2TRCP 4IW9A 1PN0A 3F4SA 4F2IA 2CVBA 4O5QA 5JWOB 1BAYA 2HZFA 2G0FA 4ICYA 3WGEA 5IPGA 4K5SA 5ELGA 2K8VA 1V58A 3IC8A 5KN3A 1FB6A 4F0CA 2F51A 2HRNA 3ZVJA 4EL1A 4LMVA 6GSWA 3HZ8A 2H1BA 4WBJA 1XWCA 4V1Ap 3PR8A 2ON7A 3GL3A 4MF5A 3VI7A 3L9UA 1ILOA 3DYRA 2JACA 4YQUA 4K9ZA 5J47A 4PGTA 5ID2B 3L78A 2IMDA 2LRTA 3LORA 1QMVA 1ERTA 1WWJA 5D9XA 3HA9A 2BTOT 3RBTA 3F4TA 4ISDA 3MYDA 2B3SA 5KEJA 2H8LA 2R3XA 4P3YB 4G19A 2YV9A 3WYWA 4YAVA 3FZ5A 5DCHA 1JLWA 4NHZA 2OJLA 1PD21 4AKHA 1FW1A 1E2YA 4MLYA 4KDUA 1YY7A 3EYTA 3RAZA 2IFQA 4OO5A 4K6XA 2VL3A 3NZNA 3APOA 5ABRA 4ML1A 1SK1A 1G0TA 5A5HB 1TXUA 2L6CA 5IMFA 3FZ4A 1J9BA 5COHA 3QMXA 2VO4A 1O8XA 2OE0A 4IELA 4GTUA 5EVOA 3D4MA 4OO4A 3N9JA 5GSTA 3TOTA 5ECSA 5L71A 3GNJA 2CZ3A 1ZCPA 1PQNA 4MMMA 3M3MA 1K0MA 1ZZYA 1V40A 4G10A 5AISA 5G31A 4TW5A 5H5RA 1MDIA 3CRUA 2LJAA 1ML6A 2LRNA 4O7HA 1ZYQB 4OFMA 2YANA 3ZL5A 5HFKA 1K3LA 2PMTA 1M2BA 3JCML 2GZZA 1JZDA 3L9VA 3TKSA 4DVCA 3FR3A 4BL7B 3FZAA 3GFKA 5F06A 2C3NA 3I6AA 2FA8A 1TJDA 3W6GA 3ZLPA 1BJXA 3MSZA 4RI6A 4GWRA 5ECLB 4HS1A 5J5NA 3ZMKA 4KGIA 2GZYA 3APSA 1JZRA 4MPGA 1BYEA 2VCWA 1YF0A 2WULA 4N0ZA 3ZREA 3IAM2 4ZB9A 4EUYA 1N25A 1U3IA 2FWHA 1ZYEA 5IQYA 4GSNA 3ME8A 2HSYA 2QA1A 4LL1B 1TKDB 2H1AA 5J4UA 3APQA 1JHBA 2AUVA 2OBKA 2A2SA 3F8UA 5BRTA 1XWAA 4PTSA 4K7IA 2FWGA 3IHQA 2V41A 3GL5A 2GLRA 1ERVA 2DLXA 1GRXA 2O89A 2OADA 4PQHA 2NVLA 4KAEA 2J9HA 4JRRA 1V2AA 4HJMA 2F9SA 1YDKA 2IWTA 3CTFA 3H1NA 1TP9A 2JADA 3KH9A 2QGVA 2GTUA 1IYIA 3TCOA 4BVXA 4CY8A 5JWRB 1KBNA 4DSRA 1I9DA 3WT1A 3H4KA 1AW9A 2VL2A 5A1NB 4IGJA 2I3YA 2VD1A 2ZNMA 4FYBA 3N5OA 2H0GA 4N10A 1KTEA 3NIVA 1M7TA 4CHSA 4PUFC 2O5VA 1A24A 1GH2A 3ZMLA 4OMVA 1SL2B 1O73A 2M72A 3MIXA 3LSZA 1F37A 1K3OA 4GRFA 3RPNA 2VM2A 4RQXA 4YQVA 1SKSB 3UVHA 4F03A 2B5YA 2ES7A 2JZRA 3ZITA 3GSSA 5J3RA 4KNDA 1XW6A 4NAXA 4F9ZA 2DIZA 4J56E 3FR9A 3EU4A 4HUAA 4TRXA 5KN0A 3QAGA 2DJ0A 3A2WA 1PA3A 1G6YA 2H19A 2N5AA 3P2AA 1EGRA 2N5BA 4G2EA 5CRHA 4OFNA 4JR6A 3TJJA 4L5LA 4IQ1A 2VCXA 3RDWA 3TKSE 4PXOA 3ZFBA 4X4JA 2IIYA 2X8GA 2EFHA 4YAPA 3LXTA 5A1NA 4BVYA 4Q5RA 2K9FA 4JEDA 3VWVA 5J41A 4N3ZA 2HRKA 1EV4A 1S3CA 2CZ2A 1DUGA 2YWNA 4HZ4A 5DALA 1QGVA 5IOXA 4WR5A 3ISOA 3G9BA 1M0UA 3F3RA 3F3QA 1XCCA 3IE3A 3IAS2 4CY6A 2H66A 1F9MA 5B8BA 3FY7A 1PMTA 1U6TA 3L9SA 1EP7A 4GSTA 5FHIA 1YEPA 5B6NA 2C0FA 1Y6EA 2DJ3A 1GSUA 4JR4A 2MMNA 2L4QA 2DMMA 2YWIA 4K7OA 4KF9A 3Q6OA 2X8CA 4BWQA 3UIWA 3QR6A 4MZCA 5ECIB 3J7Yk 3QOUA 4F0BA 1WPIA 1F6MC 1O81A 4ZIJA 1ERWA 1PKWA 1FOHA 5B8AA 2VL2C 5IMDA 4GCIA 1TDIA 2OKAA 1O8WA 4IQAA 2YN1A 2FD3A 4MDCA 3US3A 4KH7A 4FQUA 2DC5A 2PVOC 2VCZA 1OKDA 3L0HA 1T00A 3ME7A 1K0NA 3Q18A 3UBKA 3U6VA 1O7UA 2L5LA 4HDEA 4JU5A 2JSZA 4N0VA 3V1WA 2B1KA 1B9XC 2L4CA 1EOGA 2H0IA 2TIRA 1JZWA 2DJ2A 5KOWA 4RUVA 5D9VA 3UAPA 4AKXB 1VGLA 3GSTA 1SL1B 4AI6A 2AB6A 2FWEA 1JLVA 2YCDA 1AUCA 3KH7A 4AGSA 1HYUA 3KD0A 4USSA 16GSA 3GKMA 2H0HA 2P31A 3TGZA 4ULXA 1YVLA 2K8SA 3IK9A 3Q19A 22GSA 3HCZA 5JCUA 2HFDA 1ZGNA 5ECPB 2FA4A 2I81A 2E2MA 2EFDA 1T3BA 4V1Ag 3W8JA 1EEMA 3A2XA 2LQOA 4FYCA 3VFIA 3VI5A 6GSUA 2H1DA 1SKRB 5HR0A 1AQWA 1FHEA 4ECIA 2MBSA 4QMKA 3EC3A 1MEKA 1OC3A 4IVFA 2VIMA 4N30A 3A5WA 3BD2A 2H71A 1HQOA 3CRTA 1W4VA 3DEXA 2DJKA 1X0RA 4E68A 3H8QA 1OC9A 1ZYNA 3IK7A 5CRDA 4MH3A 3AY8A 2KOKA 3TJGA 5J4YA 2KLXA 1ERUA 2A2RA 4L8EA 5FT3A 3C1RA 4MNNA 2CT6A 2Z9SA 3TKRA 2CA8A 3DIEA 2H76A 2DBCA 2NPBA 2A2PA 3QCPA 1K0BA 1G7EA 1NHOA 1K0DA 1HNCA 5DDLA 2L5OA 3GRXA 4KCEA 1LBKA 2CQ9A 4DSQA 5G1KA 3A2VA 3EURA 1A8YA 1G7OA 4KDXA 4ZB6A 1TI1A 2X49A 6GSXA 4K1FA 1WOUA 4KB3A 1NSWA 3O3TA 2QC7A 2R4VA 2MZCA 4XTSA 5DJLA 1UA5A 5J9BA 2DJJA 3C7MA 2H75A 2L59A 4IS0A 4KA0A 1B9YC 4WR4A 2H01A 2JL4A 3FEUA 2H72A 5AIVA 5LD0A 4PUAA 2CX3A 3DD3A 3FK8A 2IPAA 2I4AA 3FKFA 2V1MA 3BBYA 4MJCA 3VPTA 1ZOFA 1AAZA 1X9MB 4I2UA 3F6FA 2MBTA 4LLRA 3CBUA 1T4YA 5EY6A 2GT6A 2X64A 5IMZA 1IYHA 3EWLA 7GSSA 2GDRA 5DQSA 2PERA 1R4WA 1J08A 3LG6A 1G6WA 2GSRA 2FCHA 1FOVA 2DKIA 1N2AA 4KX4A 5A4VA 2LRCA 5ELAA 4XHMA 2JZTA 5ECRB 2B5XA 4BWSA 4KDYA 3P90A 1FO5A 5J40A 4I8BA 3GTUB 1PL2A 2BMXA 2WCIA 5G1LA 2M46A 2VOCA 1R5AA 3J7Yb 2K18A 3LJRA 4ECCA 3TDGA 3CSHA 1SENA 1U87A 2C4JA 3HHVA 2C0GA 4XS1A 4X43A 2N5FA 4IJ3A 3A5IA 2IMIA 5ECOB 4ZB8A 2C0EA 1X9WB 4IHUA 2LJRA 3CYNA 4ZBAA 3GIXA 5ID2A 3WT2A 1USBA 3IR4A 4K7NA 1GL8A 1A0RP 1XWKA 4EXJA 2PUKC 5EPFA 4OD7A 3I69A 5ECMB 5HR3A 1SJIA 3IBHA 3EINA 5IPHA 1EV9A 5GSSA 1NW2A 5IM9A 5DJMA 4HJ2A 3KXOA 2QKEA 3GV1A 3D6IA 4O5UA 4A5PA 5CO3A 4O5RA 4K8MA 2ZUPA 1I5GA 2RUEA 4ECJA 1S3DA 3EVIA 3TRQA 5A5HA 3UOMA 1Y25A 4MA9A 2WRTA 1KNGA 2IMEA 1BEDA 1R5PA 4V2NA 2GQLA 3RHBA 4EF0A 4L5OA 3TRPA 2OE1A 3NOFA 5D8IA 1HD2A 2FHEA 3O6TA 1PKZA 2RLIA 3QD9A 3D4TA 2H70A 4OWYA 5CNWA 4KSMA 5CRGA 5CYYA 5B6MA 4HI7A 5AGYA 3GMFA 2LNSA 1M99A 6GSYA 5HFIA 4POLA 1XZOA 2CAQA 1YF1A 2B7KA 3IV4A 1FB0A 2GS3A 2EIRA 1EZKA 2IN3A 4W66A 2VD0A 3OR5A 4TKYA 5F0GA 2WGRA 5CP1A 2H73A 5ECQB 2PGTA 18GSA 2KP2A 4BL7A 3CSIA 4PURA 2LNTA 3A3TA 2HLSA 1B4QA 3VWUA 1TW9A 1AC1A 1QXHA 3GX8A 1T1VA 3KP9A 4I5QA 1GSDA 4G01A 4I2TA 5G5FA 1MD4A 4ZILA 5D9TA 1OE7A 2HSHA 4DSSB 1SD8A 1TXXA 2I1UA 2NDOA 5CREA 3DGQA 2YNXA 4NV5A 4J2FA 1EEJA 4EE0A 2P5QA 3KCMA 2R6KA 1H75A 4WXTA 2IJYA 3GHAA 1VF1A 3TUEA 2HRAA 1M2DA 4K5RA 1AQVA 1Q98A 2B6MA 3F9UA 3LYPA 1FG4A 2KUCA 3GH6A 5HR2A 5DAKB 3GX0A 2O85A 4MH2A 2GQMA 2VKZG 2RUFA 2F3MA 2UZ8A 1SU9A 3KEBA 3UBLA 2EFCA 1TRUA 5HR1A 2PU9C 3KMOA 3ZTLA 1FAAA 4X0XA 3EPTA 1GTAA 3DVWA 1GUKA 4RI7A 1GNEA 3HXSA 1SYXA 3BCIA 1XVQA 2FNOA 4EKZA 1SKWB 2TRXA 3HVSA 2A4VA 2AV4A 4GSSA 1Z7PA 3VURA 5D73A 3M9JA 4D73B 3MAKA 1YKAA 6GSTA 1E6BA 3HD5A 2HT9A 1F2EA 4NHWA 4DSSA 3KJYA 4LA1A 2XBQA 4AF2A 1TRVA 3ERWA 1YQ1A 4V2LA 2HSNB 2BJXA 2HSMB 1ZMAA 4FYUA 4I6XA 4MJBA 5G5EA 2DKHA 4ZB7A 3CXGA 2LSTA 19GSA 4N11A 1M2AA 5F8BA 3LFLA 3ERGA 2V32A 4K2XA 2AYTA 1OC8A 3GURA 5GZZB 3BJ5A 4FO5A 1PGTA 5D96A 5A34B 3HJOA 5FWGA 4XS4B 1BQ7A 3QAVA 2LUSA 2VL9A 4IJIA 3DVXA 3VWWA 5BMUB 2YJHA 4NMUA 1YZXA 1GNWA 1VRSD 4Z2UA 2HE3A 5DQYA 3I43A 1C72A 4ZBDA 4Z2TA 1J0FA 2VLTA 5INYA 2RM6A 1PSQA 4BPYA 1AQXA 1WIKA 3IHGA 4HEA2 4D73A 2MMZA 3QPMA 3C73A 3O76A 4XS6A 2FUG2 3CTGA 1WP0A 5GAND 3Q74A 2HQTA 3ZFLA 1THOA 1THXA 3BCKA 5JCGA 4HU9A 2CVDA 1Y1UA 1TI3A 3QFBC 4EIPA 5DBQA 4TR1B 2AJQB 2GSTA 4MJAA 4MF6A 4TR3A 4F82A 4TXOB 2XHFA 1TRWA 2EC4A 1XW5A 3BOAA 3P7XA 1T4ZA 4EDZA 9GSSA 1TK8B 13GSA 3ZIJA 2LS5A 3KM6A 1XW9A 2F8AA 2JSYA 1QFNA 3UARA 1A23A 1A8LA 5IO2A 2QSIA 3M8NA 4MABA 3CMIA 2WFCA 2QA2A 4V2MA 5ECNB 4MZBA 2WJUA 1XBSA 4YH2A 4GXZA 2UV8G 2NBSA 4OCEA 5ECKB 4IKHA 4K0NA 1VF3A 1CQHA 1ON4A 5C00A 5A4WA 4K0GA 1MDJA 3TKPA 2B7JA 4PQ1A 3SWLA 3KIJA 1GUHA 1F3AA 4POBA 3HKRA 2DJ1A 4XRDA 3EE2A 4KE3A 1BG5A 2H6XA 4NV2A 3UJ1A 1GULA 1V9WA 2C8UA 5A4UA 3HVXA 1CQGA 4ML6A 11GSA 2OE3A 4EDYA 2IMFA 4X1UA 1SD9A 3PGTA 2MMOA 3D5JA 4IN0A 4K2DA 4FIWA 1GSEA 4XIHA 2VM1A 4KCAA 2EFEA 10GSA 4NPBA 5AN1A 2C80A 4Q5QA 1WRYA 3VWXA 4POKA 4AKIA 4TXOA 3HYPA 1Z6NA 1Z9HA 2LQQA 5D9WA 3TU3B 4GDFA 1DBYA 5J4VA 1GLQA 1FVJA 2YZHA 2MYGA 4MK3A 2P5RA 1SVOA 1K3YA 1HNBA 4HU7A 2IFQB 4TR0A 2DMLA 4E8HA 3DMLA 1Z5YE 1SK2A 4QL9A 2XBIA 2R2JA 4AJ8A 1OKTA 5KN1A 4ZL9A 2L57A 4MP4A 2YWOA 4Q5FA 2K6VA 2REMA 5LCZA 1RQMA 2XPEA 2C3QA 2NTOA 3ZRDA 2ZCTA 3HMJG 3GA4A 4WF4A 4RQRA 4HZ2A 1A0FA 2H6ZA 2C3TA 2R0CA 2HZEB 2A4HA 1NHYA 2YP6A 3FYGA 1X5CA 1PN9A 3RHCA 3QAWA 1YEXA 2XC2A 1XPVA 1N8JA 5CRWA 2X8HA 3TKQA 1BG1A 2C1YA 4PX1A 3KMNA 5JCWA 3WGXA 4WBRD 3W8SA 2FY6A 1XOBA 4TVEA 2X99A 2CV4A 1YKCA 2FWFA 2V6OA 5AIXA 1TK0B 4LMWA 4G0IA 3FHKA 2P0GA 3H79A 3MNGA 2VAFA 4EC0A 4MPFA 2VUPA 3HJMA 3I9V2 3G7YA 1OAZA 3F4RA 1KEBA 2YZUA 8GSSA 3IDVA 1O85A 3TOUA 1SK0A 3GUSA 2AHEA 3KTLA 3FZ9A 2O87A 4BA7A 1A2JA 5CAXA 1SJ6A 1UVZA 4ZL8A 3ED3A 2CAIA 1QQ2A 3HDCA 4NXIA 5H5QA 2ALBA 4CW9A 3TB2A 2C0DA 2HZEA 4OFTA 1PRXA 1WMJA 1JFUA 3HY2A 2B5EA 2JZSA 4PNGA 3GYKA 3F6DA 1X9SB 5E4WA 1O6JA 2L6DA 3TJKA 6GSVA 3C8EA 1W89A 2VCTA 3R2QA 1FVKA 4BVXB 4IP1A 2YPMA 3GTUA 3MWHA 1V98A 1RK4A 1GSSA 1XIYA 1SVLA 2RIIA 12GSA 3P8WA 2JU5A 3DRNA 2YV7A 2WDUA 2I9HA 3KGKA 3GN3A 4L0UA 1DE1A 4AJ6A 1B4PA 1F3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLT A;  3VK9 A;  1OYJ A;  2PVQ A;  4Z7X A;  4ILF A;  1XOA A;  1QUW A;  2FLS A;  1M9A A;  2E7P A;  4L0W A;  5IMC A;  3GKK A;  2YJ7 A;  2H30 A;  5DCG A;  1K0O A;  4WET A;  4JBB A;  4G0L A;  3VPQ A;  1U88 A;  2LTK A;  1GSQ A;  3ZVJ D;  2H6Y A;  5D93 A;  1H4O A;  5IIZ A;  4PQI A;  3IPZ A;  3WD6 A;  1TU8 A;  3WGD A;  4HQZ A;  4ZL7 A;  2R5G A;  2KP1 A;  2VCV A;  14GS A;  3LYK A;  1EOH A;  4MCU A;  3KP8 A;  2GSS A;  5HFG A;  3R3E A;  3VLN A;  5G2Z A;  1EGO A;  3GKN A;  2G2Q A;  4LL4 B;  4O92 A;  1MD3 A;  4KSO A;  2WZ9 A;  4ZBB A;  2EIQ A;  2DSA A;  4BVY B;  2CX4 A;  3IOS A;  5EL8 A;  5IO0 A;  1DSB A;  2HRK B;  1HNA A;  1VF2 A;  1GWC A;  3PIN A;  5DAL B;  3QFA C;  4IBP A;  5HQP A;  2LV3 A;  4DEJ A;  2VLU A;  1Z6M A;  2HXK A;  2H1G A;  4O32 A;  3IXR A;  4MF7 A;  4YQM A;  1ST9 A;  3M1G A;  4MJE A;  2EIO A;  1LJR A;  1WJK A;  2HYX A;  2GZP A;  3HJP A;  1Z3E A;  1GTI A;  3FW2 A;  3PPU A;  3ZIV A;  4G9H A;  3HZ4 A;  1MDK A;  3TRX A;  1M9B A;  1NM3 A;  4XRA A;  4EVM A;  1UN2 A;  3HVV A;  3TKS C;  2LKU A;  3CSJ A;  1PX6 A;  4JZQ A;  4H86 A;  2O7K A;  3F0I A;  3PH9 A;  4IP6 A;  2GVP A;  3LGC A;  5E59 A;  5ECH B;  2VLV A;  4G0K A;  6GSS A;  1BX9 A;  1OVN A;  3D22 A;  3GKX A;  1XXU A;  4QL7 A;  2OA7 A;  1AXD A;  1XFL A;  3L4N A;  2R37 A;  4FH8 A;  1EP8 A;  3LQ7 A;  3DKS A;  3UL3 A;  1MTC A;  4GF0 A;  4MZW A;  2XPD A;  2OAC A;  1UC7 A;  5IOW A;  3IRA A;  3ERF A;  3E0U A;  2H74 A;  1DE2 A;  4PNF A;  4JE1 A;  20GS A;  3G7I A;  1YJ6 A;  3E3E A;  2HI7 A;  3D21 A;  2PWJ A;  5DAK A;  2VCQ A;  3LXZ A;  4EO3 A;  1LU4 A;  2YOI A;  1T8E B;  3KZQ A;  4J57 E;  1K0A A;  3UEM A;  3C1S A;  4I97 A;  1XWG A;  5LNK e;  1WE0 A;  2GSQ A;  5J9C A;  1AIU A;  2GGT A;  2V6K A;  3ZZX A;  2GQK A;  3LEF A;  2FGX A;  2ON5 A;  2WB9 A;  5H5S A;  4TXV A;  2M80 A;  5G30 A;  1GTU A;  5GAP D;  2E2G A;  1GTB A;  1QK8 A;  4AJ7 A;  4E8E A;  5F05 A;  2PBJ A;  3D0Z A;  1X5D A;  5ENU A;  1TK5 B;  4TN8 A;  5F07 A;  2YWM A;  2E0Q A;  1URM A;  1R26 A;  4POM A;  1R7H A;  3RPP A;  1A2L A;  2HSM A;  5KN2 A;  4Q5N A;  1OC9 B;  1VF4 A;  2KHP A;  3H93 A;  1A2M A;  1EWX A;  4QQ7 A;  4ACS A;  5DVB A;  2CVK A;  2LJK A;  2RM5 A;  4GQF A;  3IA1 A;  2AAW A;  3F63 A;  3TJF A;  5IMV A;  4WF5 A;  4XS4 A;  4NWY A;  3UVT A;  1TU7 A;  4GQC A;  4XCS A;  3QDN A;  1GP1 A;  1TOF A;  3M0F A;  2OBI A;  5BMU A;  2J23 A;  3ZYW A;  1JZO A;  3DWV A;  1T7P B;  4KW6 A;  2MMA A;  3IC4 A;  4ZXG A;  4ECB A;  1GUM A;  3TJB A;  3EU3 A;  5JWQ B;  2F8F A;  17GS A;  4OCF A;  4WKW A;  3FRC A;  1ACV A;  2LEG A;  2D2Z A;  2HRF A;  2HNL A;  1Q4J A;  3UMA A;  2IMK A;  1XWB A;  3GH9 A;  3M9K A;  5IMA A;  1U3A A;  3EMP A;  4CDO A;  1TTZ A;  2B1L A;  1RW1 A;  1SJZ A;  1XVW A;  4TR4 A;  1SL0 B;  1OE8 A;  3S9F A;  2GT5 A;  4ID0 A;  1SYR A;  1GSF A;  3FR6 A;  4HQS A;  1GSY A;  1ABA A;  3MDK A;  1PL1 A;  4TR1 A;  5A5K A;  3EMX A;  3U5R E;  2IL3 A;  1B48 A;  1V57 A;  4TOP A;  1GLP A;  1Z7R A;  2PPT A;  2V2G A;  4HOJ A;  4KUN A;  3KTB A;  1X5E A;  2PN8 A;  2O8V B;  3G7J A;  5B7C A;  4WEY A;  1S3A A;  3C71 A;  1PX7 A;  2WS2 A;  3DXB A;  1B8X A;  2DIY A;  3LWA A;  3K8N A;  5C04 A;  1ZL9 A;  3E9J B;  1TRS A;  1K0C A;  3SBC A;  2TRC P;  4IW9 A;  3F4S A;  4F2I A;  2CVB A;  5JWO B;  1BAY A;  2HZF A;  2G0F A;  3WGE A;  5IPG A;  5ELG A;  2K8V A;  1V58 A;  3IC8 A;  5KN3 A;  1FB6 A;  4F0C A;  2F51 A;  2HRN A;  3ZVJ A;  4EL1 A;  4LMV A;  6GSW A;  3HZ8 A;  2H1B A;  4WBJ A;  1XWC A;  4V1A p;  3PR8 A;  2ON7 A;  3GL3 A;  4MF5 A;  3VI7 A;  3L9U A;  1ILO A;  3DYR A;  2JAC A;  4YQU A;  4K9Z A;  4PGT A;  5ID2 B;  3L78 A;  2IMD A;  2LRT A;  3LOR A;  1QMV A;  1ERT A;  1WWJ A;  5D9X A;  3HA9 A;  2BTO T;  3RBT A;  3F4T A;  4ISD A;  2B3S A;  5KEJ A;  2H8L A;  2R3X A;  4P3Y B;  4G19 A;  2YV9 A;  3WYW A;  4YAV A;  3FZ5 A;  5DCH A;  1JLW A;  4NHZ A;  2OJL A;  1PD2 1;  1FW1 A;  1E2Y A;  4MLY A;  4KDU A;  1YY7 A;  3EYT A;  3RAZ A;  2IFQ A;  4OO5 A;  4K6X A;  2VL3 A;  3NZN A;  3APO A;  5ABR A;  4ML1 A;  1SK1 A;  1G0T A;  2L6C A;  5IMF A;  3FZ4 A;  1J9B A;  5COH A;  3QMX A;  2VO4 A;  1O8X A;  2OE0 A;  4IEL A;  4GTU A;  5EVO A;  3D4M A;  4OO4 A;  3N9J A;  5GST A;  3TOT A;  5ECS A;  5L71 A;  3GNJ A;  2CZ3 A;  1ZCP A;  1PQN A;  4MMM A;  3M3M A;  1K0M A;  1ZZY A;  1V40 A;  4G10 A;  5AIS A;  5G31 A;  4TW5 A;  5H5R A;  1MDI A;  3CRU A;  2LJA A;  1ML6 A;  2LRN A;  4O7H A;  1ZYQ B;  4OFM A;  2YAN A;  3ZL5 A;  5HFK A;  1K3L A;  2PMT A;  1M2B A;  3JCM L;  2GZZ A;  1JZD A;  3L9V A;  3TKS A;  4DVC A;  3FR3 A;  4BL7 B;  3FZA A;  3GFK A;  5F06 A;  2C3N A;  3I6A A;  2FA8 A;  1TJD A;  3W6G A;  3ZLP A;  1BJX A;  3MSZ A;  4RI6 A;  4GWR A;  5ECL B;  4HS1 A;  5J5N A;  3ZMK A;  4KGI A;  2GZY A;  3APS A;  1JZR A;  4MPG A;  1BYE A;  2VCW A;  1YF0 A;  2WUL A;  4N0Z A;  3ZRE A;  3IAM 2;  4ZB9 A;  4EUY A;  1U3I A;  2FWH A;  1ZYE A;  5IQY A;  4GSN A;  3ME8 A;  2HSY A;  4LL1 B;  1TKD B;  2H1A A;  5J4U A;  3APQ A;  1JHB A;  2AUV A;  2OBK A;  2A2S A;  3F8U A;  1XWA A;  4PTS A;  4K7I A;  2FWG A;  3IHQ A;  2V41 A;  3GL5 A;  2GLR A;  1ERV A;  2DLX A;  1GRX A;  2O89 A;  2OAD A;  4PQH A;  2NVL A;  4KAE A;  2J9H A;  4JRR A;  1V2A A;  4HJM A;  2F9S A;  1YDK A;  2IWT A;  3CTF A;  3H1N A;  1TP9 A;  2JAD A;  3KH9 A;  2QGV A;  2GTU A;  1IYI A;  3TCO A;  4BVX A;  5JWR B;  1KBN A;  4DSR A;  1I9D A;  3WT1 A;  3H4K A;  1AW9 A;  2VL2 A;  4IGJ A;  2I3Y A;  2VD1 A;  2ZNM A;  4FYB A;  3N5O A;  2H0G A;  4N10 A;  1KTE A;  3NIV A;  1M7T A;  4CHS A;  4PUF C;  1A24 A;  1GH2 A;  3ZML A;  4OMV A;  1SL2 B;  1O73 A;  2M72 A;  3LSZ A;  1F37 A;  1K3O A;  4GRF A;  3RPN A;  2VM2 A;  4RQX A;  4YQV A;  1SKS B;  3UVH A;  4F03 A;  2B5Y A;  2ES7 A;  2JZR A;  3ZIT A;  3GSS A;  5J3R A;  4KND A;  1XW6 A;  4NAX A;  4F9Z A;  2DIZ A;  4J56 E;  3FR9 A;  3EU4 A;  4HUA A;  4TRX A;  5KN0 A;  3QAG A;  2DJ0 A;  3A2W A;  1PA3 A;  1G6Y A;  2H19 A;  2N5A A;  3P2A A;  1EGR A;  2N5B A;  4G2E A;  5CRH A;  4OFN A;  4JR6 A;  3TJJ A;  4L5L A;  4IQ1 A;  2VCX A;  3RDW A;  3TKS E;  4PXO A;  3ZFB A;  2IIY A;  2X8G A;  4YAP A;  3LXT A;  4BVY A;  4Q5R A;  2K9F A;  4JED A;  3VWV A;  5J41 A;  2HRK A;  1EV4 A;  1S3C A;  2CZ2 A;  1DUG A;  2YWN A;  4HZ4 A;  5DAL A;  1QGV A;  5IOX A;  4WR5 A;  3ISO A;  3G9B A;  1M0U A;  3F3R A;  3F3Q A;  1XCC A;  3IE3 A;  3IAS 2;  2H66 A;  1F9M A;  5B8B A;  3FY7 A;  1PMT A;  1U6T A;  3L9S A;  1EP7 A;  4GST A;  5FHI A;  1YEP A;  5B6N A;  2C0F A;  1Y6E A;  2DJ3 A;  1GSU A;  4JR4 A;  2MMN A;  2L4Q A;  2DMM A;  2YWI A;  4K7O A;  4KF9 A;  3Q6O A;  2X8C A;  4BWQ A;  3UIW A;  3QR6 A;  4MZC A;  5ECI B;  3J7Y k;  3QOU A;  4F0B A;  1WPI A;  1F6M C;  1O81 A;  4ZIJ A;  1ERW A;  1PKW A;  5B8A A;  2VL2 C;  5IMD A;  4GCI A;  1TDI A;  2OKA A;  1O8W A;  4IQA A;  2YN1 A;  2FD3 A;  4MDC A;  3US3 A;  4KH7 A;  4FQU A;  2DC5 A;  2PVO C;  2VCZ A;  1OKD A;  3L0H A;  1T00 A;  3ME7 A;  1K0N A;  3Q18 A;  3UBK A;  3U6V A;  1O7U A;  2L5L A;  4HDE A;  4JU5 A;  2JSZ A;  4N0V A;  3V1W A;  2B1K A;  1B9X C;  2L4C A;  1EOG A;  2H0I A;  2TIR A;  1JZW A;  2DJ2 A;  4RUV A;  5D9V A;  3UAP A;  1VGL A;  3GST A;  1SL1 B;  2AB6 A;  2FWE A;  1JLV A;  2YCD A;  1AUC A;  3KH7 A;  4AGS A;  1HYU A;  3KD0 A;  4USS A;  16GS A;  3GKM A;  2H0H A;  2P31 A;  3TGZ A;  4ULX A;  2K8S A;  3IK9 A;  3Q19 A;  22GS A;  3HCZ A;  5JCU A;  2HFD A;  1ZGN A;  5ECP B;  2FA4 A;  2I81 A;  2E2M A;  1T3B A;  4V1A g;  3W8J A;  1EEM A;  3A2X A;  2LQO A;  4FYC A;  3VFI A;  3VI5 A;  6GSU A;  2H1D A;  1SKR B;  5HR0 A;  1AQW A;  1FHE A;  4ECI A;  2MBS A;  3EC3 A;  1MEK A;  1OC3 A;  4IVF A;  2VIM A;  4N30 A;  3A5W A;  3BD2 A;  2H71 A;  1HQO A;  3CRT A;  1W4V A;  3DEX A;  2DJK A;  1X0R A;  3H8Q A;  1OC9 A;  3IK7 A;  5CRD A;  4MH3 A;  3AY8 A;  2KOK A;  3TJG A;  2KLX A;  1ERU A;  2A2R A;  4L8E A;  5FT3 A;  3C1R A;  2CT6 A;  2Z9S A;  3TKR A;  2CA8 A;  3DIE A;  2H76 A;  2DBC A;  2NPB A;  3QCP A;  1K0B A;  1G7E A;  1NHO A;  1K0D A;  1HNC A;  5DDL A;  2L5O A;  3GRX A;  4KCE A;  1LBK A;  2CQ9 A;  4DSQ A;  5G1K A;  3A2V A;  3EUR A;  1A8Y A;  1G7O A;  4KDX A;  4ZB6 A;  1TI1 A;  6GSX A;  4K1F A;  1WOU A;  4KB3 A;  1NSW A;  3O3T A;  2QC7 A;  2R4V A;  2MZC A;  4XTS A;  5DJL A;  1UA5 A;  5J9B A;  2DJJ A;  3C7M A;  2H75 A;  2L59 A;  4IS0 A;  4KA0 A;  1B9Y C;  4WR4 A;  2H01 A;  2JL4 A;  3FEU A;  2H72 A;  5AIV A;  5LD0 A;  4PUA A;  2CX3 A;  3DD3 A;  3FK8 A;  2IPA A;  2I4A A;  3FKF A;  2V1M A;  3BBY A;  4MJC A;  3VPT A;  1ZOF A;  1AAZ A;  1X9M B;  4I2U A;  3F6F A;  2MBT A;  4LLR A;  3CBU A;  1T4Y A;  5EY6 A;  2GT6 A;  2X64 A;  5IMZ A;  1IYH A;  3EWL A;  7GSS A;  2GDR A;  5DQS A;  2PER A;  1R4W A;  1J08 A;  3LG6 A;  1G6W A;  2GSR A;  2FCH A;  1FOV A;  1N2A A;  4KX4 A;  5A4V A;  2LRC A;  5ELA A;  4XHM A;  2JZT A;  5ECR B;  2B5X A;  4BWS A;  4KDY A;  3P90 A;  1FO5 A;  4I8B A;  3GTU B;  1PL2 A;  2BMX A;  2WCI A;  5G1L A;  2M46 A;  2VOC A;  1R5A A;  3J7Y b;  2K18 A;  3LJR A;  4ECC A;  3TDG A;  3CSH A;  1SEN A;  1U87 A;  2C4J A;  3HHV A;  2C0G A;  4XS1 A;  4X43 A;  2N5F A;  4IJ3 A;  2IMI A;  5ECO B;  4ZB8 A;  2C0E A;  1X9W B;  4IHU A;  2LJR A;  3CYN A;  4ZBA A;  3GIX A;  5ID2 A;  3WT2 A;  1USB A;  3IR4 A;  4K7N A;  1GL8 A;  1A0R P;  1XWK A;  4EXJ A;  2PUK C;  5EPF A;  4OD7 A;  3I69 A;  5ECM B;  5HR3 A;  1SJI A;  3IBH A;  3EIN A;  5IPH A;  1EV9 A;  5GSS A;  1NW2 A;  5IM9 A;  5DJM A;  4HJ2 A;  3KXO A;  2QKE A;  3GV1 A;  3D6I A;  5CO3 A;  4O5R A;  4K8M A;  2ZUP A;  1I5G A;  2RUE A;  4ECJ A;  1S3D A;  3EVI A;  3TRQ A;  3UOM A;  1Y25 A;  4MA9 A;  2WRT A;  1KNG A;  2IME A;  1BED A;  1R5P A;  4V2N A;  2GQL A;  3RHB A;  4EF0 A;  4L5O A;  3TRP A;  2OE1 A;  3NOF A;  5D8I A;  1HD2 A;  2FHE A;  3O6T A;  1PKZ A;  2RLI A;  3QD9 A;  3D4T A;  2H70 A;  4OWY A;  5CNW A;  4KSM A;  5CRG A;  5CYY A;  5B6M A;  4HI7 A;  5AGY A;  3GMF A;  2LNS A;  1M99 A;  6GSY A;  5HFI A;  4POL A;  1XZO A;  2CAQ A;  1YF1 A;  2B7K A;  3IV4 A;  1FB0 A;  2GS3 A;  2EIR A;  1EZK A;  2IN3 A;  2VD0 A;  3OR5 A;  4TKY A;  5F0G A;  2WGR A;  5CP1 A;  2H73 A;  5ECQ B;  2PGT A;  18GS A;  2KP2 A;  4BL7 A;  3CSI A;  4PUR A;  2LNT A;  3A3T A;  2HLS A;  1B4Q A;  3VWU A;  1TW9 A;  1AC1 A;  1QXH A;  3GX8 A;  1T1V A;  3KP9 A;  4I5Q A;  1GSD A;  4I2T A;  5G5F A;  1MD4 A;  4ZIL A;  5D9T A;  1OE7 A;  2HSH A;  4DSS B;  1SD8 A;  1TXX A;  2I1U A;  2NDO A;  5CRE A;  3DGQ A;  2YNX A;  4NV5 A;  4J2F A;  1EEJ A;  4EE0 A;  2P5Q A;  3KCM A;  2R6K A;  1H75 A;  4WXT A;  2IJY A;  3GHA A;  1VF1 A;  3TUE A;  2HRA A;  1M2D A;  1AQV A;  1Q98 A;  2B6M A;  3F9U A;  3LYP A;  1FG4 A;  2KUC A;  3GH6 A;  5HR2 A;  5DAK B;  3GX0 A;  2O85 A;  4MH2 A;  2GQM A;  2RUF A;  2F3M A;  2UZ8 A;  1SU9 A;  3KEB A;  3UBL A;  1TRU A;  5HR1 A;  2PU9 C;  3KMO A;  3ZTL A;  1FAA A;  4X0X A;  1GTA A;  3DVW A;  1GUK A;  4RI7 A;  1GNE A;  3HXS A;  1SYX A;  3BCI A;  1XVQ A;  2FNO A;  4EKZ A;  1SKW B;  2TRX A;  3HVS A;  2A4V A;  2AV4 A;  4GSS A;  1Z7P A;  3VUR A;  5D73 A;  3M9J A;  4D73 B;  3MAK A;  1YKA A;  6GST A;  1E6B A;  3HD5 A;  2HT9 A;  1F2E A;  4NHW A;  4DSS A;  3KJY A;  4LA1 A;  2XBQ A;  4AF2 A;  1TRV A;  3ERW A;  1YQ1 A;  4V2L A;  2HSN B;  2BJX A;  2HSM B;  1ZMA A;  4FYU A;  4I6X A;  4MJB A;  5G5E A;  3CXG A;  2LST A;  19GS A;  4N11 A;  1M2A A;  5F8B A;  3LFL A;  3ERG A;  2V32 A;  2AYT A;  1OC8 A;  3GUR A;  5GZZ B;  3BJ5 A;  4FO5 A;  1PGT A;  5D96 A;  3HJO A;  5FWG A;  4XS4 B;  1BQ7 A;  3QAV A;  2LUS A;  2VL9 A;  4IJI A;  3DVX A;  3VWW A;  2YJH A;  4NMU A;  1YZX A;  1GNW A;  1VRS D;  2HE3 A;  5DQY A;  3I43 A;  1C72 A;  4ZBD A;  1J0F A;  2VLT A;  5INY A;  2RM6 A;  1PSQ A;  4BPY A;  1AQX A;  1WIK A;  4HEA 2;  4D73 A;  2MMZ A;  3QPM A;  3C73 A;  3O76 A;  4XS6 A;  2FUG 2;  3CTG A;  1WP0 A;  5GAN D;  3Q74 A;  2HQT A;  3ZFL A;  1THO A;  1THX A;  3BCK A;  5JCG A;  4HU9 A;  2CVD A;  3QFB C;  1TI3 A;  5DBQ A;  4TR1 B;  2AJQ B;  2GST A;  4MJA A;  4MF6 A;  4TR3 A;  4F82 A;  4TXO B;  2XHF A;  1TRW A;  2EC4 A;  1XW5 A;  3BOA A;  3P7X A;  1T4Z A;  4EDZ A;  9GSS A;  1TK8 B;  13GS A;  3ZIJ A;  2LS5 A;  3KM6 A;  1XW9 A;  2F8A A;  2JSY A;  1QFN A;  3UAR A;  1A23 A;  1A8L A;  5IO2 A;  2QSI A;  3M8N A;  4MAB A;  3CMI A;  2WFC A;  4V2M A;  5ECN B;  4MZB A;  2WJU A;  1XBS A;  4YH2 A;  4GXZ A;  2NBS A;  4OCE A;  5ECK B;  4IKH A;  4K0N A;  1VF3 A;  1CQH A;  1ON4 A;  5C00 A;  5A4W A;  4K0G A;  1MDJ A;  3TKP A;  2B7J A;  4PQ1 A;  3SWL A;  3KIJ A;  1GUH A;  1F3A A;  4POB A;  3HKR A;  2DJ1 A;  4XRD A;  3EE2 A;  4KE3 A;  1BG5 A;  2H6X A;  4NV2 A;  3UJ1 A;  1GUL A;  1V9W A;  2C8U A;  5A4U A;  3HVX A;  1CQG A;  4ML6 A;  11GS A;  2OE3 A;  4EDY A;  2IMF A;  4X1U A;  1SD9 A;  3PGT A;  2MMO A;  3D5J A;  4IN0 A;  4K2D A;  4FIW A;  1GSE A;  4XIH A;  2VM1 A;  4KCA A;  10GS A;  4NPB A;  5AN1 A;  2C80 A;  4Q5Q A;  1WRY A;  3VWX A;  4POK A;  4TXO A;  3HYP A;  1Z6N A;  1Z9H A;  2LQQ A;  5D9W A;  1DBY A;  1GLQ A;  1FVJ A;  2YZH A;  2MYG A;  4MK3 A;  2P5R A;  1K3Y A;  1HNB A;  4HU7 A;  2IFQ B;  4TR0 A;  2DML A;  4E8H A;  3DML A;  1Z5Y E;  1SK2 A;  4QL9 A;  2XBI A;  2R2J A;  4AJ8 A;  1OKT A;  5KN1 A;  4ZL9 A;  2L57 A;  4MP4 A;  2YWO A;  4Q5F A;  2K6V A;  2REM A;  5LCZ A;  1RQM A;  2XPE A;  2C3Q A;  2NTO A;  3ZRD A;  2ZCT A;  3GA4 A;  4WF4 A;  4RQR A;  4HZ2 A;  1A0F A;  2H6Z A;  2C3T A;  2HZE B;  1NHY A;  2YP6 A;  3FYG A;  1X5C A;  1PN9 A;  3RHC A;  3QAW A;  1YEX A;  2XC2 A;  1XPV A;  1N8J A;  5CRW A;  2X8H A;  3TKQ A;  2C1Y A;  4PX1 A;  3KMN A;  5JCW A;  3WGX A;  4WBR D;  3W8S A;  2FY6 A;  1XOB A;  4TVE A;  2X99 A;  2CV4 A;  1YKC A;  2FWF A;  2V6O A;  5AIX A;  1TK0 B;  4LMW A;  4G0I A;  3FHK A;  2P0G A;  3H79 A;  3MNG A;  2VAF A;  4EC0 A;  4MPF A;  2VUP A;  3HJM A;  3I9V 2;  3G7Y A;  1OAZ A;  3F4R A;  1KEB A;  2YZU A;  8GSS A;  3IDV A;  1O85 A;  3TOU A;  1SK0 A;  3GUS A;  2AHE A;  3KTL A;  3FZ9 A;  2O87 A;  4BA7 A;  1A2J A;  5CAX A;  1SJ6 A;  1UVZ A;  4ZL8 A;  3ED3 A;  2CAI A;  1QQ2 A;  3HDC A;  4NXI A;  5H5Q A;  2ALB A;  4CW9 A;  3TB2 A;  2C0D A;  2HZE A;  4OFT A;  1PRX A;  1WMJ A;  1JFU A;  3HY2 A;  2B5E A;  2JZS A;  4PNG A;  3GYK A;  3F6D A;  1X9S B;  5E4W A;  1O6J A;  2L6D A;  3TJK A;  6GSV A;  3C8E A;  1W89 A;  2VCT A;  3R2Q A;  1FVK A;  4BVX B;  4IP1 A;  2YPM A;  3GTU A;  3MWH A;  1V98 A;  1RK4 A;  1GSS A;  1XIY A;  2RII A;  12GS A;  3P8W A;  2JU5 A;  3DRN A;  2YV7 A;  2WDU A;  2I9H A;  3KGK A;  3GN3 A;  4L0U A;  1DE1 A;  4AJ6 A;  1B4P A;  1F3B A; 
#chains in the Genus database with same CATH topology
 4GLT A;  3VK9 A;  1OYJ A;  2PVQ A;  4Z7X A;  4ILF A;  1XOA A;  1QUW A;  2FLS A;  1M9A A;  2E7P A;  4L0W A;  5IMC A;  3GKK A;  2YJ7 A;  2X4A A;  2H30 A;  5DCG A;  1K0O A;  4WET A;  4JBB A;  4G0L A;  3VPQ A;  1U88 A;  2LTK A;  1GSQ A;  3ZVJ D;  2H6Y A;  5D93 A;  1H4O A;  5IIZ A;  2R0G A;  4PQI A;  3IPZ A;  3WD6 A;  1TU8 A;  3WGD A;  4HQZ A;  4ZL7 A;  2R5G A;  2KP1 A;  2VCV A;  14GS A;  3LYK A;  1EOH A;  4MCU A;  3KP8 A;  4YKF A;  2GSS A;  5HFG A;  3R3E A;  3VLN A;  5G2Z A;  1EGO A;  3GKN A;  2G2Q A;  4LL4 B;  4O92 A;  1MD3 A;  4KSO A;  2WZ9 A;  4ZBB A;  2EIQ A;  2DSA A;  4BVY B;  2CX4 A;  3IOS A;  5EL8 A;  5IO0 A;  1DSB A;  2HRK B;  1HNA A;  1VF2 A;  1GWC A;  2WW1 A;  3PIN A;  5DAL B;  3QFA C;  4IBP A;  5HQP A;  2LV3 A;  4DEJ A;  2VLU A;  1Z6M A;  2HXK A;  2H1G A;  4O32 A;  3IXR A;  4MF7 A;  4YQM A;  1ST9 A;  3M1G A;  2WVX A;  4MJE A;  1ZYP A;  3FMW A;  2EIO A;  1LJR A;  1WJK A;  2HYX A;  2GZP A;  3HJP A;  1Z3E A;  1GTI A;  3FW2 A;  3PPU A;  3ZIV A;  4G9H A;  3HZ4 A;  1MDK A;  3TRX A;  1M9B A;  1NM3 A;  4XRA A;  4EVM A;  1UN2 A;  3HVV A;  3TKS C;  2LKU A;  3CSJ A;  1PX6 A;  4JZQ A;  4H86 A;  2O7K A;  3F0I A;  4YKG A;  3PH9 A;  4IP6 A;  2GVP A;  3LGC A;  3LW9 A;  5E59 A;  5ECH B;  2VLV A;  1BF5 A;  4G0K A;  6GSS A;  1BX9 A;  1OVN A;  3D22 A;  3GKX A;  1XXU A;  4QL7 A;  2OA7 A;  1AXD A;  1XFL A;  3L4N A;  2R37 A;  4FH8 A;  1EP8 A;  3LQ7 A;  3DKS A;  3UL3 A;  1MTC A;  4GF0 A;  4MZW A;  2XPD A;  2OAC A;  1UC7 A;  5IOW A;  3IRA A;  3ERF A;  3E0U A;  2H74 A;  1DE2 A;  4PNF A;  4JE1 A;  20GS A;  3G7I A;  1YJ6 A;  3E3E A;  2HI7 A;  3D21 A;  2PWJ A;  5DAK A;  2VCQ A;  3LXZ A;  4EO3 A;  1LU4 A;  2YOI A;  1T8E B;  3KZQ A;  4J57 E;  1K0A A;  4AKG A;  3UEM A;  4Z2R A;  3C1S A;  4I97 A;  1SVM A;  1XWG A;  5LNK e;  1WE0 A;  2GSQ A;  5J9C A;  1AIU A;  2GGT A;  2V6K A;  3ZZX A;  2GQK A;  3LEF A;  2FGX A;  2ON5 A;  2WB9 A;  5H5S A;  4TXV A;  2M80 A;  5G30 A;  1GTU A;  5GAP D;  2E2G A;  1GTB A;  1QK8 A;  4AJ7 A;  4E8E A;  5F05 A;  5KOX A;  4FXY P;  2PBJ A;  3D0Z A;  1X5D A;  5ENU A;  1TK5 B;  4TN8 A;  5F07 A;  2YWM A;  2E0Q A;  2WZS A;  1URM A;  1R26 A;  4POM A;  1R7H A;  3RPP A;  1A2L A;  2HSN A;  2HSM A;  5KN2 A;  4Q5N A;  1OC9 B;  1VF4 A;  2KHP A;  3H93 A;  1A2M A;  1EWX A;  4QQ7 A;  4ACS A;  5DVB A;  2CVK A;  2H1L A;  2LJK A;  2RM5 A;  4GQF A;  3IA1 A;  4EIQ A;  2AAW A;  3F63 A;  5A34 A;  3TJF A;  5IMV A;  3RGB C;  4WF5 A;  4XS4 A;  4NWY A;  3UVT A;  1TU7 A;  4GQC A;  4XCS A;  3QDN A;  1GP1 A;  1TOF A;  3M0F A;  2OBI A;  5BMU A;  2J23 A;  3ZYW A;  1JZO A;  3DWV A;  1T7P B;  4KW6 A;  2MMA A;  3IC4 A;  4ZXG A;  4ECB A;  1GUM A;  3TJB A;  3EU3 A;  5JWQ B;  2F8F A;  3CWG A;  17GS A;  4OCF A;  4WKW A;  3FRC A;  1ACV A;  2LEG A;  2D2Z A;  2HRF A;  2HNL A;  1Q4J A;  3UMA A;  2IMK A;  1XWB A;  3GH9 A;  3M9K A;  5IMA A;  1U3A A;  3EMP A;  4CDO A;  1TTZ A;  2B1L A;  1RW1 A;  1SJZ A;  1XVW A;  4TR4 A;  1SL0 B;  1OE8 A;  3S9F A;  2GT5 A;  4ID0 A;  1SYR A;  1GSF A;  3FR6 A;  4HQS A;  1GSY A;  1ABA A;  3MDK A;  1PL1 A;  4TR1 A;  5A5K A;  3EMX A;  3U5R E;  2IL3 A;  1B48 A;  1V57 A;  4TOP A;  1GLP A;  1Z7R A;  2PPT A;  2V2G A;  4HOJ A;  4KUN A;  3KTB A;  1X5E A;  2PN8 A;  2O8V B;  2OT3 A;  3G7J A;  5B7C A;  4WEY A;  1S3A A;  3C71 A;  1PX7 A;  2R0P A;  2WS2 A;  3DXB A;  1B8X A;  2WVZ A;  2DIY A;  3LWA A;  3K8N A;  5C04 A;  1ZL9 A;  3E9J B;  1TRS A;  1K0C A;  3SBC A;  2TRC P;  4IW9 A;  1PN0 A;  3F4S A;  4F2I A;  2CVB A;  4O5Q A;  5JWO B;  1BAY A;  2HZF A;  2G0F A;  4ICY A;  3WGE A;  5IPG A;  4K5S A;  5ELG A;  2K8V A;  1V58 A;  3IC8 A;  5KN3 A;  1FB6 A;  4F0C A;  2F51 A;  2HRN A;  3ZVJ A;  4EL1 A;  2WVY A;  4LMV A;  6GSW A;  3HZ8 A;  2H1B A;  4WBJ A;  1XWC A;  4V1A p;  3PR8 A;  2ON7 A;  3GL3 A;  4MF5 A;  3VI7 A;  3L9U A;  1ILO A;  3DYR A;  2JAC A;  4YQU A;  4K9Z A;  5J47 A;  4PGT A;  5ID2 B;  3L78 A;  2IMD A;  2LRT A;  3LOR A;  1QMV A;  1ERT A;  1WWJ A;  5D9X A;  3HA9 A;  2BTO T;  3RBT A;  3F4T A;  4ISD A;  3MYD A;  2B3S A;  5KEJ A;  2H8L A;  2R3X A;  4P3Y B;  4G19 A;  2YV9 A;  3WYW A;  4YAV A;  3FZ5 A;  5DCH A;  1JLW A;  4NHZ A;  2OJL A;  1PD2 1;  4AKH A;  1FW1 A;  1E2Y A;  4MLY A;  4KDU A;  1YY7 A;  3EYT A;  3RAZ A;  2IFQ A;  4OO5 A;  4K6X A;  2VL3 A;  3NZN A;  3APO A;  5ABR A;  4ML1 A;  1SK1 A;  1G0T A;  5A5H B;  1TXU A;  2L6C A;  5IMF A;  3FZ4 A;  1J9B A;  5COH A;  3QMX A;  2VO4 A;  1O8X A;  2OE0 A;  4IEL A;  4GTU A;  5EVO A;  3D4M A;  4OO4 A;  3N9J A;  5GST A;  3TOT A;  5ECS A;  5L71 A;  3GNJ A;  2CZ3 A;  1ZCP A;  1PQN A;  4MMM A;  3M3M A;  1K0M A;  1ZZY A;  1V40 A;  4G10 A;  5AIS A;  5G31 A;  4TW5 A;  5H5R A;  1MDI A;  3CRU A;  2LJA A;  1ML6 A;  2LRN A;  4O7H A;  1ZYQ B;  4OFM A;  1XG8 A;  2YAN A;  3ZL5 A;  5HFK A;  1K3L A;  2PMT A;  1M2B A;  3JCM L;  2GZZ A;  1JZD A;  3L9V A;  3TKS A;  4DVC A;  3FR3 A;  4BL7 B;  3FZA A;  3GFK A;  5F06 A;  2C3N A;  3I6A A;  2FA8 A;  1TJD A;  3W6G A;  3ZLP A;  1BJX A;  3MSZ A;  2WW2 A;  4RI6 A;  4GWR A;  5ECL B;  4HS1 A;  5J5N A;  3ZMK A;  4KGI A;  2GZY A;  3APS A;  1JZR A;  4MPG A;  1BYE A;  2VCW A;  1YF0 A;  1M3J A;  2WUL A;  4N0Z A;  3ZRE A;  3IAM 2;  4ZB9 A;  4EUY A;  1N25 A;  1U3I A;  2FWH A;  1ZYE A;  5IQY A;  4GSN A;  3ME8 A;  2HSY A;  2QA1 A;  4LL1 B;  1TKD B;  2H1A A;  5J4U A;  3APQ A;  1JHB A;  2AUV A;  2OBK A;  2A2S A;  3F8U A;  5BRT A;  1XWA A;  4PTS A;  4K7I A;  2FWG A;  3IHQ A;  2V41 A;  3GL5 A;  2GLR A;  1ERV A;  2DLX A;  1GRX A;  2O89 A;  2OAD A;  4PQH A;  2NVL A;  4KAE A;  2J9H A;  4JRR A;  1V2A A;  4HJM A;  2F9S A;  1YDK A;  2IWT A;  3CTF A;  3H1N A;  1TP9 A;  2JAD A;  3KH9 A;  2QGV A;  2GTU A;  1IYI A;  3TCO A;  4BVX A;  4CY8 A;  5JWR B;  1KBN A;  4DSR A;  1I9D A;  3WT1 A;  3H4K A;  1AW9 A;  2VL2 A;  5A1N B;  4IGJ A;  2I3Y A;  2VD1 A;  2ZNM A;  4FYB A;  3N5O A;  2H0G A;  4N10 A;  1KTE A;  3NIV A;  1M7T A;  4CHS A;  4PUF C;  2O5V A;  1A24 A;  1GH2 A;  3ZML A;  4OMV A;  1SL2 B;  1O73 A;  2M72 A;  3MIX A;  3LSZ A;  1F37 A;  1K3O A;  4GRF A;  3RPN A;  2VM2 A;  4RQX A;  4YQV A;  1SKS B;  3UVH A;  4F03 A;  2B5Y A;  2ES7 A;  2JZR A;  3ZIT A;  3GSS A;  5J3R A;  4KND A;  1XW6 A;  4NAX A;  4PI2 C;  4F9Z A;  2DIZ A;  4J56 E;  3FR9 A;  3EU4 A;  4HUA A;  4TRX A;  5KN0 A;  3QAG A;  2DJ0 A;  3A2W A;  1PA3 A;  1G6Y A;  2H19 A;  2N5A A;  3P2A A;  3RFR C;  2WW3 A;  1EGR A;  2N5B A;  4G2E A;  1PFO A;  5CRH A;  4OFN A;  4JR6 A;  3TJJ A;  4L5L A;  4IQ1 A;  2VCX A;  3RDW A;  3TKS E;  4PXO A;  3ZFB A;  4X4J A;  2IIY A;  2X8G A;  2EFH A;  4YAP A;  3LXT A;  5A1N A;  4BVY A;  4Q5R A;  2K9F A;  4JED A;  3VWV A;  5J41 A;  4N3Z A;  2HRK A;  1EV4 A;  1S3C A;  2CZ2 A;  1DUG A;  2YWN A;  4HZ4 A;  5DAL A;  1QGV A;  5IOX A;  4WR5 A;  3ISO A;  3G9B A;  1M0U A;  3F3R A;  3F3Q A;  1XCC A;  3IE3 A;  3IAS 2;  4CY6 A;  2H66 A;  1F9M A;  5B8B A;  3FY7 A;  1PMT A;  1U6T A;  3L9S A;  1EP7 A;  4GST A;  5FHI A;  1YEP A;  5B6N A;  2C0F A;  1Y6E A;  2DJ3 A;  1GSU A;  4JR4 A;  2MMN A;  2L4Q A;  2DMM A;  2YWI A;  4K7O A;  4KF9 A;  3Q6O A;  2X8C A;  4BWQ A;  3UIW A;  3QR6 A;  4MZC A;  5ECI B;  3J7Y k;  3QOU A;  4F0B A;  1WPI A;  1F6M C;  1O81 A;  4ZIJ A;  1ERW A;  1PKW A;  1FOH A;  5B8A A;  2VL2 C;  5IMD A;  4GCI A;  1TDI A;  2OKA A;  1O8W A;  4IQA A;  2YN1 A;  2FD3 A;  4MDC A;  3US3 A;  4KH7 A;  4FQU A;  2DC5 A;  2PVO C;  2VCZ A;  1OKD A;  3L0H A;  1T00 A;  3ME7 A;  1K0N A;  3Q18 A;  3UBK A;  3U6V A;  1O7U A;  2L5L A;  4HDE A;  4JU5 A;  2JSZ A;  4N0V A;  3V1W A;  2B1K A;  1B9X C;  2L4C A;  1EOG A;  2H0I A;  2TIR A;  1JZW A;  2DJ2 A;  5KOW A;  4RUV A;  5D9V A;  3UAP A;  4AKX B;  1VGL A;  3GST A;  1SL1 B;  4AI6 A;  2AB6 A;  2FWE A;  1JLV A;  2YCD A;  1AUC A;  3KH7 A;  4AGS A;  1HYU A;  3KD0 A;  4USS A;  16GS A;  3GKM A;  2H0H A;  2P31 A;  3TGZ A;  4ULX A;  1YVL A;  2K8S A;  3IK9 A;  3Q19 A;  22GS A;  3HCZ A;  5JCU A;  2HFD A;  1ZGN A;  5ECP B;  2FA4 A;  2I81 A;  2E2M A;  2EFD A;  1T3B A;  4V1A g;  3W8J A;  1EEM A;  3A2X A;  2LQO A;  4FYC A;  3VFI A;  3VI5 A;  6GSU A;  2H1D A;  1SKR B;  5HR0 A;  1AQW A;  1FHE A;  4ECI A;  2MBS A;  4QMK A;  3EC3 A;  1MEK A;  1OC3 A;  4IVF A;  2VIM A;  4N30 A;  3A5W A;  3BD2 A;  2H71 A;  1HQO A;  3CRT A;  1W4V A;  3DEX A;  2DJK A;  1X0R A;  4E68 A;  1S4B P;  3H8Q A;  1OC9 A;  1ZYN A;  1YEW C;  3IK7 A;  5CRD A;  4MH3 A;  3AY8 A;  2KOK A;  3TJG A;  5J4Y A;  2KLX A;  1ERU A;  2A2R A;  4L8E A;  5FT3 A;  3C1R A;  4MNN A;  2CT6 A;  2Z9S A;  3TKR A;  2CA8 A;  3DIE A;  2H76 A;  2DBC A;  2NPB A;  2A2P A;  3QCP A;  1K0B A;  1G7E A;  1NHO A;  1K0D A;  1HNC A;  5DDL A;  2L5O A;  3GRX A;  4KCE A;  1LBK A;  2CQ9 A;  4DSQ A;  5G1K A;  3A2V A;  3EUR A;  1A8Y A;  1G7O A;  4KDX A;  4ZB6 A;  1TI1 A;  2X49 A;  6GSX A;  4K1F A;  1WOU A;  4KB3 A;  1NSW A;  3O3T A;  2QC7 A;  2R4V A;  2MZC A;  4XTS A;  5DJL A;  1UA5 A;  5J9B A;  2DJJ A;  3C7M A;  2H75 A;  2L59 A;  4IS0 A;  4KA0 A;  1B9Y C;  4WR4 A;  2H01 A;  2JL4 A;  3FEU A;  2H72 A;  5AIV A;  5LD0 A;  4PUA A;  2CX3 A;  3DD3 A;  3FK8 A;  2IPA A;  2I4A A;  3FKF A;  2V1M A;  3BBY A;  4MJC A;  3VPT A;  1ZOF A;  1AAZ A;  1X9M B;  4I2U A;  3F6F A;  2MBT A;  4LLR A;  3CBU A;  1T4Y A;  5EY6 A;  2GT6 A;  2X64 A;  5IMZ A;  1IYH A;  3EWL A;  7GSS A;  2GDR A;  5DQS A;  2PER A;  1R4W A;  1J08 A;  3LG6 A;  1G6W A;  2GSR A;  2FCH A;  1FOV A;  2DKI A;  1N2A A;  4KX4 A;  5A4V A;  2LRC A;  5ELA A;  4XHM A;  2JZT A;  5ECR B;  2B5X A;  4BWS A;  4KDY A;  3P90 A;  1FO5 A;  5J40 A;  4I8B A;  3GTU B;  1PL2 A;  2BMX A;  2WCI A;  5G1L A;  2M46 A;  2VOC A;  1R5A A;  3J7Y b;  2K18 A;  3LJR A;  4ECC A;  3TDG A;  3CSH A;  1SEN A;  1U87 A;  2C4J A;  3HHV A;  2C0G A;  4XS1 A;  4X43 A;  2N5F A;  4IJ3 A;  3A5I A;  2IMI A;  5ECO B;  4ZB8 A;  2C0E A;  4PHZ C;  1X9W B;  1S3R A;  4IHU A;  2LJR A;  3CYN A;  4ZBA A;  3GIX A;  5ID2 A;  3WT2 A;  1USB A;  3IR4 A;  4K7N A;  1GL8 A;  1A0R P;  1XWK A;  4EXJ A;  2PUK C;  5EPF A;  4OD7 A;  3I69 A;  5ECM B;  5HR3 A;  1SJI A;  3IBH A;  3EIN A;  5IPH A;  1EV9 A;  5GSS A;  1NW2 A;  5IM9 A;  5DJM A;  4HJ2 A;  3KXO A;  2QKE A;  3GV1 A;  3D6I A;  4O5U A;  4A5P A;  5CO3 A;  4O5R A;  4K8M A;  2ZUP A;  1I5G A;  2RUE A;  4ECJ A;  1S3D A;  3EVI A;  3TRQ A;  5A5H A;  3UOM A;  1I1I P;  1Y25 A;  4MA9 A;  2WRT A;  1KNG A;  2IME A;  1BED A;  1R5P A;  4V2N A;  2GQL A;  3RHB A;  4EF0 A;  4L5O A;  3TRP A;  2OE1 A;  3NOF A;  5D8I A;  1HD2 A;  2FHE A;  3O6T A;  1PKZ A;  2RLI A;  3QD9 A;  3D4T A;  2H70 A;  4OWY A;  5CNW A;  4KSM A;  5CRG A;  5CYY A;  5B6M A;  4HI7 A;  5AGY A;  2WVX B;  3GMF A;  2LNS A;  1M99 A;  6GSY A;  5HFI A;  4POL A;  1XZO A;  2CAQ A;  1YF1 A;  2B7K A;  3IV4 A;  1FB0 A;  2GS3 A;  2EIR A;  1EZK A;  2IN3 A;  4W66 A;  2VD0 A;  3OR5 A;  4TKY A;  5F0G A;  2WGR A;  5CP1 A;  2H73 A;  5ECQ B;  2PGT A;  18GS A;  2KP2 A;  4BL7 A;  3CSI A;  4PUR A;  2LNT A;  3A3T A;  2HLS A;  1B4Q A;  3VWU A;  1TW9 A;  1AC1 A;  1QXH A;  3GX8 A;  1T1V A;  3KP9 A;  4I5Q A;  1GSD A;  4G01 A;  4I2T A;  5G5F A;  1MD4 A;  4ZIL A;  5D9T A;  1OE7 A;  2HSH A;  4DSS B;  1SD8 A;  1TXX A;  2I1U A;  2NDO A;  5CRE A;  3DGQ A;  2YNX A;  1M3I A;  4NV5 A;  4J2F A;  1EEJ A;  4EE0 A;  2P5Q A;  3KCM A;  2R6K A;  1H75 A;  4WXT A;  2IJY A;  3GHA A;  1VF1 A;  3TUE A;  2HRA A;  1M2D A;  3CQF A;  4K5R A;  1AQV A;  1Q98 A;  2B6M A;  3F9U A;  3LYP A;  1FG4 A;  2KUC A;  3GH6 A;  5HR2 A;  5DAK B;  3GX0 A;  2O85 A;  4MH2 A;  2GQM A;  2VKZ G;  2RUF A;  2F3M A;  2UZ8 A;  1SU9 A;  3KEB A;  3UBL A;  2EFC A;  1TRU A;  5HR1 A;  2PU9 C;  3KMO A;  3ZTL A;  1FAA A;  4X0X A;  3EPT A;  1GTA A;  3DVW A;  1GUK A;  4RI7 A;  1GNE A;  3HXS A;  1SYX A;  3BCI A;  1XVQ A;  2FNO A;  4EKZ A;  1SKW B;  2TRX A;  3HVS A;  2A4V A;  2AV4 A;  4GSS A;  1Z7P A;  3VUR A;  5D73 A;  3M9J A;  4D73 B;  3MAK A;  1YKA A;  6GST A;  1E6B A;  3HD5 A;  3HVN A;  2HT9 A;  1F2E A;  4NHW A;  4DSS A;  3KJY A;  4LA1 A;  2XBQ A;  4AF2 A;  1TRV A;  3ERW A;  1YQ1 A;  4V2L A;  2HSN B;  2BJX A;  2HSM B;  1ZMA A;  4FYU A;  4I6X A;  4MJB A;  5G5E A;  2DKH A;  4ZB7 A;  3CXG A;  2LST A;  19GS A;  4N11 A;  1M2A A;  5F8B A;  3LFL A;  3ERG A;  2V32 A;  4K2X A;  2AYT A;  1OC8 A;  3GUR A;  5GZZ B;  3BJ5 A;  4FO5 A;  1PGT A;  5D96 A;  5A34 B;  3HJO A;  5FWG A;  4XS4 B;  1BQ7 A;  3QAV A;  2LUS A;  2VL9 A;  4IJI A;  3DVX A;  3VWW A;  5BMU B;  2YJH A;  4NMU A;  1YZX A;  1GNW A;  1VRS D;  4Z2U A;  2HE3 A;  5DQY A;  3I43 A;  1C72 A;  4ZBD A;  4Z2T A;  1J0F A;  2VLT A;  5INY A;  2RM6 A;  1PSQ A;  4BPY A;  1AQX A;  1WIK A;  3IHG A;  4HEA 2;  4D73 A;  2MMZ A;  3QPM A;  3C73 A;  3O76 A;  4XS6 A;  2FUG 2;  3CTG A;  1WP0 A;  5GAN D;  3Q74 A;  2HQT A;  3ZFL A;  1THO A;  1THX A;  4PI0 C;  3BCK A;  5JCG A;  4HU9 A;  2CVD A;  1Y1U A;  1TI3 A;  3QFB C;  4EIP A;  5DBQ A;  4TR1 B;  2AJQ B;  2GST A;  4MJA A;  4MF6 A;  4TR3 A;  4F82 A;  4TXO B;  2XHF A;  1TRW A;  2EC4 A;  1XW5 A;  3BOA A;  3P7X A;  1T4Z A;  4EDZ A;  9GSS A;  1TK8 B;  13GS A;  3ZIJ A;  2LS5 A;  3KM6 A;  1XW9 A;  2F8A A;  2JSY A;  1QFN A;  3UAR A;  1A23 A;  1A8L A;  5IO2 A;  2QSI A;  3M8N A;  4MAB A;  3CMI A;  2WFC A;  2QA2 A;  4V2M A;  5ECN B;  4MZB A;  2WJU A;  1XBS A;  4HSC X;  4YH2 A;  4GXZ A;  2UV8 G;  2NBS A;  4OCE A;  5ECK B;  4IKH A;  4K0N A;  1VF3 A;  1CQH A;  1ON4 A;  5C00 A;  5A4W A;  4BIK A;  4K0G A;  1MDJ A;  3TKP A;  2B7J A;  4PQ1 A;  3SWL A;  3KIJ A;  1GUH A;  1F3A A;  4POB A;  3HKR A;  2DJ1 A;  4XRD A;  3EE2 A;  4KE3 A;  1BG5 A;  2H6X A;  4NV2 A;  3UJ1 A;  1GUL A;  1V9W A;  2C8U A;  5A4U A;  3HVX A;  1CQG A;  4ML6 A;  11GS A;  2OE3 A;  4EDY A;  2IMF A;  4X1U A;  1SD9 A;  3PGT A;  2MMO A;  3D5J A;  4IN0 A;  4K2D A;  4FIW A;  1GSE A;  4XIH A;  2VM1 A;  4KCA A;  2EFE A;  10GS A;  4NPB A;  5AN1 A;  2C80 A;  4Q5Q A;  1WRY A;  3VWX A;  4POK A;  4AKI A;  4TXO A;  3HYP A;  1Z6N A;  1Z9H A;  2LQQ A;  5D9W A;  3TU3 B;  4GDF A;  1DBY A;  5J4V A;  1GLQ A;  1FVJ A;  2YZH A;  2MYG A;  4MK3 A;  2P5R A;  1SVO A;  1K3Y A;  1HNB A;  2WW0 A;  4HU7 A;  2IFQ B;  4TR0 A;  2DML A;  4E8H A;  3DML A;  1Z5Y E;  1SK2 A;  4QL9 A;  2XBI A;  2R2J A;  4AJ8 A;  1OKT A;  5KN1 A;  4ZL9 A;  2L57 A;  4MP4 A;  2YWO A;  4Q5F A;  2K6V A;  2REM A;  5LCZ A;  1RQM A;  2XPE A;  2C3Q A;  2NTO A;  3ZRD A;  2ZCT A;  3HMJ G;  3GA4 A;  4WF4 A;  4RQR A;  4HZ2 A;  1A0F A;  2H6Z A;  2C3T A;  2R0C A;  2HZE B;  2A4H A;  1NHY A;  2YP6 A;  3FYG A;  1X5C A;  1PN9 A;  3RHC A;  3QAW A;  1YEX A;  2XC2 A;  1XPV A;  1N8J A;  5CRW A;  2O36 A;  2X8H A;  3TKQ A;  1BG1 A;  2C1Y A;  4PX1 A;  3KMN A;  5JCW A;  3WGX A;  4WBR D;  3W8S A;  2FY6 A;  1XOB A;  4TVE A;  2X99 A;  2CV4 A;  1YKC A;  2FWF A;  2V6O A;  5AIX A;  1TK0 B;  4LMW A;  4G0I A;  3FHK A;  2P0G A;  3H79 A;  3MNG A;  2VAF A;  4EC0 A;  4MPF A;  2VUP A;  3HJM A;  3I9V 2;  3G7Y A;  1OAZ A;  3F4R A;  1KEB A;  2YZU A;  8GSS A;  3IDV A;  1O85 A;  3TOU A;  1SK0 A;  3GUS A;  2AHE A;  3KTL A;  3FZ9 A;  2O87 A;  4BA7 A;  1A2J A;  5CAX A;  1SJ6 A;  1UVZ A;  4ZL8 A;  3ED3 A;  2CAI A;  1QQ2 A;  3HDC A;  4NXI A;  5H5Q A;  2ALB A;  4CW9 A;  2O3E A;  3TB2 A;  2C0D A;  2HZE A;  4OFT A;  1PRX A;  1WMJ A;  1JFU A;  3HY2 A;  2B5E A;  2JZS A;  4PNG A;  3GYK A;  3F6D A;  1X9S B;  5E4W A;  1O6J A;  2L6D A;  3TJK A;  6GSV A;  3C8E A;  1W89 A;  2VCT A;  3R2Q A;  1FVK A;  3CHX C;  4BVX B;  4IP1 A;  2YPM A;  3GTU A;  3MWH A;  1V98 A;  1RK4 A;  1GSS A;  1XIY A;  1SVL A;  2RII A;  12GS A;  3P8W A;  2JU5 A;  3DRN A;  2YV7 A;  2WDU A;  2I9H A;  3KGK A;  3GN3 A;  4L0U A;  1DE1 A;  4AJ6 A;  1B4P A;  1F3B A; 
#chains in the Genus database with same CATH homology
 4GLT A;  3VK9 A;  1OYJ A;  2PVQ A;  4Z7X A;  4ILF A;  1XOA A;  1QUW A;  2FLS A;  1M9A A;  2E7P A;  4L0W A;  5IMC A;  3GKK A;  2YJ7 A;  2X4A A;  2H30 A;  5DCG A;  1K0O A;  4WET A;  4JBB A;  4G0L A;  3VPQ A;  1U88 A;  2LTK A;  1GSQ A;  3ZVJ D;  2H6Y A;  5D93 A;  1H4O A;  5IIZ A;  2R0G A;  4PQI A;  3IPZ A;  3WD6 A;  1TU8 A;  3WGD A;  4HQZ A;  4ZL7 A;  2R5G A;  2KP1 A;  2VCV A;  14GS A;  3LYK A;  1EOH A;  4MCU A;  3KP8 A;  4YKF A;  2GSS A;  5HFG A;  3R3E A;  3VLN A;  5G2Z A;  1EGO A;  3GKN A;  2G2Q A;  4LL4 B;  4O92 A;  1MD3 A;  4KSO A;  2WZ9 A;  4ZBB A;  2EIQ A;  2DSA A;  4BVY B;  2CX4 A;  3IOS A;  5EL8 A;  5IO0 A;  1DSB A;  2HRK B;  1HNA A;  1VF2 A;  1GWC A;  3PIN A;  5DAL B;  3QFA C;  4IBP A;  5HQP A;  2LV3 A;  4DEJ A;  2VLU A;  1Z6M A;  2HXK A;  2H1G A;  4O32 A;  3IXR A;  4MF7 A;  4YQM A;  1ST9 A;  3M1G A;  4MJE A;  1ZYP A;  3FMW A;  2EIO A;  1LJR A;  1WJK A;  2HYX A;  2GZP A;  3HJP A;  1Z3E A;  1GTI A;  3FW2 A;  3PPU A;  3ZIV A;  4G9H A;  3HZ4 A;  1MDK A;  3TRX A;  1M9B A;  1NM3 A;  4XRA A;  4EVM A;  1UN2 A;  3HVV A;  3TKS C;  2LKU A;  3CSJ A;  1PX6 A;  4JZQ A;  4H86 A;  2O7K A;  3F0I A;  4YKG A;  3PH9 A;  4IP6 A;  2GVP A;  3LGC A;  3LW9 A;  5E59 A;  5ECH B;  2VLV A;  1BF5 A;  4G0K A;  6GSS A;  1BX9 A;  1OVN A;  3D22 A;  3GKX A;  1XXU A;  4QL7 A;  2OA7 A;  1AXD A;  1XFL A;  3L4N A;  2R37 A;  4FH8 A;  1EP8 A;  3LQ7 A;  3DKS A;  3UL3 A;  1MTC A;  4GF0 A;  4MZW A;  2XPD A;  2OAC A;  1UC7 A;  5IOW A;  3IRA A;  3ERF A;  3E0U A;  2H74 A;  1DE2 A;  4PNF A;  4JE1 A;  20GS A;  3G7I A;  1YJ6 A;  3E3E A;  2HI7 A;  3D21 A;  2PWJ A;  5DAK A;  2VCQ A;  3LXZ A;  4EO3 A;  1LU4 A;  2YOI A;  1T8E B;  3KZQ A;  4J57 E;  1K0A A;  4AKG A;  3UEM A;  4Z2R A;  3C1S A;  4I97 A;  1SVM A;  1XWG A;  5LNK e;  1WE0 A;  2GSQ A;  5J9C A;  1AIU A;  2GGT A;  2V6K A;  3ZZX A;  2GQK A;  3LEF A;  2FGX A;  2ON5 A;  2WB9 A;  5H5S A;  4TXV A;  2M80 A;  5G30 A;  1GTU A;  5GAP D;  2E2G A;  1GTB A;  1QK8 A;  4AJ7 A;  4E8E A;  5F05 A;  5KOX A;  2PBJ A;  3D0Z A;  1X5D A;  5ENU A;  1TK5 B;  4TN8 A;  5F07 A;  2YWM A;  2E0Q A;  1URM A;  1R26 A;  4POM A;  1R7H A;  3RPP A;  1A2L A;  2HSN A;  2HSM A;  5KN2 A;  4Q5N A;  1OC9 B;  1VF4 A;  2KHP A;  3H93 A;  1A2M A;  1EWX A;  4QQ7 A;  4ACS A;  5DVB A;  2CVK A;  2H1L A;  2LJK A;  2RM5 A;  4GQF A;  3IA1 A;  4EIQ A;  2AAW A;  3F63 A;  5A34 A;  3TJF A;  5IMV A;  4WF5 A;  4XS4 A;  4NWY A;  3UVT A;  1TU7 A;  4GQC A;  4XCS A;  3QDN A;  1GP1 A;  1TOF A;  3M0F A;  2OBI A;  5BMU A;  2J23 A;  3ZYW A;  1JZO A;  3DWV A;  1T7P B;  4KW6 A;  2MMA A;  3IC4 A;  4ZXG A;  4ECB A;  1GUM A;  3TJB A;  3EU3 A;  5JWQ B;  2F8F A;  3CWG A;  17GS A;  4OCF A;  4WKW A;  3FRC A;  1ACV A;  2LEG A;  2D2Z A;  2HRF A;  2HNL A;  1Q4J A;  3UMA A;  2IMK A;  1XWB A;  3GH9 A;  3M9K A;  5IMA A;  1U3A A;  3EMP A;  4CDO A;  1TTZ A;  2B1L A;  1RW1 A;  1SJZ A;  1XVW A;  4TR4 A;  1SL0 B;  1OE8 A;  3S9F A;  2GT5 A;  4ID0 A;  1SYR A;  1GSF A;  3FR6 A;  4HQS A;  1GSY A;  1ABA A;  3MDK A;  1PL1 A;  4TR1 A;  5A5K A;  3EMX A;  3U5R E;  2IL3 A;  1B48 A;  1V57 A;  4TOP A;  1GLP A;  1Z7R A;  2PPT A;  2V2G A;  4HOJ A;  4KUN A;  3KTB A;  1X5E A;  2PN8 A;  2O8V B;  2OT3 A;  3G7J A;  5B7C A;  4WEY A;  1S3A A;  3C71 A;  1PX7 A;  2R0P A;  2WS2 A;  3DXB A;  1B8X A;  2DIY A;  3LWA A;  3K8N A;  5C04 A;  1ZL9 A;  3E9J B;  1TRS A;  1K0C A;  3SBC A;  2TRC P;  4IW9 A;  1PN0 A;  3F4S A;  4F2I A;  2CVB A;  4O5Q A;  5JWO B;  1BAY A;  2HZF A;  2G0F A;  4ICY A;  3WGE A;  5IPG A;  4K5S A;  5ELG A;  2K8V A;  1V58 A;  3IC8 A;  5KN3 A;  1FB6 A;  4F0C A;  2F51 A;  2HRN A;  3ZVJ A;  4EL1 A;  4LMV A;  6GSW A;  3HZ8 A;  2H1B A;  4WBJ A;  1XWC A;  4V1A p;  3PR8 A;  2ON7 A;  3GL3 A;  4MF5 A;  3VI7 A;  3L9U A;  1ILO A;  3DYR A;  2JAC A;  4YQU A;  4K9Z A;  5J47 A;  4PGT A;  5ID2 B;  3L78 A;  2IMD A;  2LRT A;  3LOR A;  1QMV A;  1ERT A;  1WWJ A;  5D9X A;  3HA9 A;  2BTO T;  3RBT A;  3F4T A;  4ISD A;  3MYD A;  2B3S A;  5KEJ A;  2H8L A;  2R3X A;  4P3Y B;  4G19 A;  2YV9 A;  3WYW A;  4YAV A;  3FZ5 A;  5DCH A;  1JLW A;  4NHZ A;  2OJL A;  1PD2 1;  4AKH A;  1FW1 A;  1E2Y A;  4MLY A;  4KDU A;  1YY7 A;  3EYT A;  3RAZ A;  2IFQ A;  4OO5 A;  4K6X A;  2VL3 A;  3NZN A;  3APO A;  5ABR A;  4ML1 A;  1SK1 A;  1G0T A;  5A5H B;  1TXU A;  2L6C A;  5IMF A;  3FZ4 A;  1J9B A;  5COH A;  3QMX A;  2VO4 A;  1O8X A;  2OE0 A;  4IEL A;  4GTU A;  5EVO A;  3D4M A;  4OO4 A;  3N9J A;  5GST A;  3TOT A;  5ECS A;  5L71 A;  3GNJ A;  2CZ3 A;  1ZCP A;  1PQN A;  4MMM A;  3M3M A;  1K0M A;  1ZZY A;  1V40 A;  4G10 A;  5AIS A;  5G31 A;  4TW5 A;  5H5R A;  1MDI A;  3CRU A;  2LJA A;  1ML6 A;  2LRN A;  4O7H A;  1ZYQ B;  4OFM A;  2YAN A;  3ZL5 A;  5HFK A;  1K3L A;  2PMT A;  1M2B A;  3JCM L;  2GZZ A;  1JZD A;  3L9V A;  3TKS A;  4DVC A;  3FR3 A;  4BL7 B;  3FZA A;  3GFK A;  5F06 A;  2C3N A;  3I6A A;  2FA8 A;  1TJD A;  3W6G A;  3ZLP A;  1BJX A;  3MSZ A;  4RI6 A;  4GWR A;  5ECL B;  4HS1 A;  5J5N A;  3ZMK A;  4KGI A;  2GZY A;  3APS A;  1JZR A;  4MPG A;  1BYE A;  2VCW A;  1YF0 A;  2WUL A;  4N0Z A;  3ZRE A;  3IAM 2;  4ZB9 A;  4EUY A;  1N25 A;  1U3I A;  2FWH A;  1ZYE A;  5IQY A;  4GSN A;  3ME8 A;  2HSY A;  2QA1 A;  4LL1 B;  1TKD B;  2H1A A;  5J4U A;  3APQ A;  1JHB A;  2AUV A;  2OBK A;  2A2S A;  3F8U A;  5BRT A;  1XWA A;  4PTS A;  4K7I A;  2FWG A;  3IHQ A;  2V41 A;  3GL5 A;  2GLR A;  1ERV A;  2DLX A;  1GRX A;  2O89 A;  2OAD A;  4PQH A;  2NVL A;  4KAE A;  2J9H A;  4JRR A;  1V2A A;  4HJM A;  2F9S A;  1YDK A;  2IWT A;  3CTF A;  3H1N A;  1TP9 A;  2JAD A;  3KH9 A;  2QGV A;  2GTU A;  1IYI A;  3TCO A;  4BVX A;  4CY8 A;  5JWR B;  1KBN A;  4DSR A;  1I9D A;  3WT1 A;  3H4K A;  1AW9 A;  2VL2 A;  5A1N B;  4IGJ A;  2I3Y A;  2VD1 A;  2ZNM A;  4FYB A;  3N5O A;  2H0G A;  4N10 A;  1KTE A;  3NIV A;  1M7T A;  4CHS A;  4PUF C;  2O5V A;  1A24 A;  1GH2 A;  3ZML A;  4OMV A;  1SL2 B;  1O73 A;  2M72 A;  3MIX A;  3LSZ A;  1F37 A;  1K3O A;  4GRF A;  3RPN A;  2VM2 A;  4RQX A;  4YQV A;  1SKS B;  3UVH A;  4F03 A;  2B5Y A;  2ES7 A;  2JZR A;  3ZIT A;  3GSS A;  5J3R A;  4KND A;  1XW6 A;  4NAX A;  4F9Z A;  2DIZ A;  4J56 E;  3FR9 A;  3EU4 A;  4HUA A;  4TRX A;  5KN0 A;  3QAG A;  2DJ0 A;  3A2W A;  1PA3 A;  1G6Y A;  2H19 A;  2N5A A;  3P2A A;  1EGR A;  2N5B A;  4G2E A;  5CRH A;  4OFN A;  4JR6 A;  3TJJ A;  4L5L A;  4IQ1 A;  2VCX A;  3RDW A;  3TKS E;  4PXO A;  3ZFB A;  4X4J A;  2IIY A;  2X8G A;  2EFH A;  4YAP A;  3LXT A;  5A1N A;  4BVY A;  4Q5R A;  2K9F A;  4JED A;  3VWV A;  5J41 A;  4N3Z A;  2HRK A;  1EV4 A;  1S3C A;  2CZ2 A;  1DUG A;  2YWN A;  4HZ4 A;  5DAL A;  1QGV A;  5IOX A;  4WR5 A;  3ISO A;  3G9B A;  1M0U A;  3F3R A;  3F3Q A;  1XCC A;  3IE3 A;  3IAS 2;  4CY6 A;  2H66 A;  1F9M A;  5B8B A;  3FY7 A;  1PMT A;  1U6T A;  3L9S A;  1EP7 A;  4GST A;  5FHI A;  1YEP A;  5B6N A;  2C0F A;  1Y6E A;  2DJ3 A;  1GSU A;  4JR4 A;  2MMN A;  2L4Q A;  2DMM A;  2YWI A;  4K7O A;  4KF9 A;  3Q6O A;  2X8C A;  4BWQ A;  3UIW A;  3QR6 A;  4MZC A;  5ECI B;  3J7Y k;  3QOU A;  4F0B A;  1WPI A;  1F6M C;  1O81 A;  4ZIJ A;  1ERW A;  1PKW A;  1FOH A;  5B8A A;  2VL2 C;  5IMD A;  4GCI A;  1TDI A;  2OKA A;  1O8W A;  4IQA A;  2YN1 A;  2FD3 A;  4MDC A;  3US3 A;  4KH7 A;  4FQU A;  2DC5 A;  2PVO C;  2VCZ A;  1OKD A;  3L0H A;  1T00 A;  3ME7 A;  1K0N A;  3Q18 A;  3UBK A;  3U6V A;  1O7U A;  2L5L A;  4HDE A;  4JU5 A;  2JSZ A;  4N0V A;  3V1W A;  2B1K A;  1B9X C;  2L4C A;  1EOG A;  2H0I A;  2TIR A;  1JZW A;  2DJ2 A;  5KOW A;  4RUV A;  5D9V A;  3UAP A;  4AKX B;  1VGL A;  3GST A;  1SL1 B;  4AI6 A;  2AB6 A;  2FWE A;  1JLV A;  2YCD A;  1AUC A;  3KH7 A;  4AGS A;  1HYU A;  3KD0 A;  4USS A;  16GS A;  3GKM A;  2H0H A;  2P31 A;  3TGZ A;  4ULX A;  1YVL A;  2K8S A;  3IK9 A;  3Q19 A;  22GS A;  3HCZ A;  5JCU A;  2HFD A;  1ZGN A;  5ECP B;  2FA4 A;  2I81 A;  2E2M A;  2EFD A;  1T3B A;  4V1A g;  3W8J A;  1EEM A;  3A2X A;  2LQO A;  4FYC A;  3VFI A;  3VI5 A;  6GSU A;  2H1D A;  1SKR B;  5HR0 A;  1AQW A;  1FHE A;  4ECI A;  2MBS A;  4QMK A;  3EC3 A;  1MEK A;  1OC3 A;  4IVF A;  2VIM A;  4N30 A;  3A5W A;  3BD2 A;  2H71 A;  1HQO A;  3CRT A;  1W4V A;  3DEX A;  2DJK A;  1X0R A;  4E68 A;  3H8Q A;  1OC9 A;  1ZYN A;  3IK7 A;  5CRD A;  4MH3 A;  3AY8 A;  2KOK A;  3TJG A;  5J4Y A;  2KLX A;  1ERU A;  2A2R A;  4L8E A;  5FT3 A;  3C1R A;  4MNN A;  2CT6 A;  2Z9S A;  3TKR A;  2CA8 A;  3DIE A;  2H76 A;  2DBC A;  2NPB A;  2A2P A;  3QCP A;  1K0B A;  1G7E A;  1NHO A;  1K0D A;  1HNC A;  5DDL A;  2L5O A;  3GRX A;  4KCE A;  1LBK A;  2CQ9 A;  4DSQ A;  5G1K A;  3A2V A;  3EUR A;  1A8Y A;  1G7O A;  4KDX A;  4ZB6 A;  1TI1 A;  2X49 A;  6GSX A;  4K1F A;  1WOU A;  4KB3 A;  1NSW A;  3O3T A;  2QC7 A;  2R4V A;  2MZC A;  4XTS A;  5DJL A;  1UA5 A;  5J9B A;  2DJJ A;  3C7M A;  2H75 A;  2L59 A;  4IS0 A;  4KA0 A;  1B9Y C;  4WR4 A;  2H01 A;  2JL4 A;  3FEU A;  2H72 A;  5AIV A;  5LD0 A;  4PUA A;  2CX3 A;  3DD3 A;  3FK8 A;  2IPA A;  2I4A A;  3FKF A;  2V1M A;  3BBY A;  4MJC A;  3VPT A;  1ZOF A;  1AAZ A;  1X9M B;  4I2U A;  3F6F A;  2MBT A;  4LLR A;  3CBU A;  1T4Y A;  5EY6 A;  2GT6 A;  2X64 A;  5IMZ A;  1IYH A;  3EWL A;  7GSS A;  2GDR A;  5DQS A;  2PER A;  1R4W A;  1J08 A;  3LG6 A;  1G6W A;  2GSR A;  2FCH A;  1FOV A;  2DKI A;  1N2A A;  4KX4 A;  5A4V A;  2LRC A;  5ELA A;  4XHM A;  2JZT A;  5ECR B;  2B5X A;  4BWS A;  4KDY A;  3P90 A;  1FO5 A;  5J40 A;  4I8B A;  3GTU B;  1PL2 A;  2BMX A;  2WCI A;  5G1L A;  2M46 A;  2VOC A;  1R5A A;  3J7Y b;  2K18 A;  3LJR A;  4ECC A;  3TDG A;  3CSH A;  1SEN A;  1U87 A;  2C4J A;  3HHV A;  2C0G A;  4XS1 A;  4X43 A;  2N5F A;  4IJ3 A;  3A5I A;  2IMI A;  5ECO B;  4ZB8 A;  2C0E A;  1X9W B;  4IHU A;  2LJR A;  3CYN A;  4ZBA A;  3GIX A;  5ID2 A;  3WT2 A;  1USB A;  3IR4 A;  4K7N A;  1GL8 A;  1A0R P;  1XWK A;  4EXJ A;  2PUK C;  5EPF A;  4OD7 A;  3I69 A;  5ECM B;  5HR3 A;  1SJI A;  3IBH A;  3EIN A;  5IPH A;  1EV9 A;  5GSS A;  1NW2 A;  5IM9 A;  5DJM A;  4HJ2 A;  3KXO A;  2QKE A;  3GV1 A;  3D6I A;  4O5U A;  4A5P A;  5CO3 A;  4O5R A;  4K8M A;  2ZUP A;  1I5G A;  2RUE A;  4ECJ A;  1S3D A;  3EVI A;  3TRQ A;  5A5H A;  3UOM A;  1Y25 A;  4MA9 A;  2WRT A;  1KNG A;  2IME A;  1BED A;  1R5P A;  4V2N A;  2GQL A;  3RHB A;  4EF0 A;  4L5O A;  3TRP A;  2OE1 A;  3NOF A;  5D8I A;  1HD2 A;  2FHE A;  3O6T A;  1PKZ A;  2RLI A;  3QD9 A;  3D4T A;  2H70 A;  4OWY A;  5CNW A;  4KSM A;  5CRG A;  5CYY A;  5B6M A;  4HI7 A;  5AGY A;  3GMF A;  2LNS A;  1M99 A;  6GSY A;  5HFI A;  4POL A;  1XZO A;  2CAQ A;  1YF1 A;  2B7K A;  3IV4 A;  1FB0 A;  2GS3 A;  2EIR A;  1EZK A;  2IN3 A;  4W66 A;  2VD0 A;  3OR5 A;  4TKY A;  5F0G A;  2WGR A;  5CP1 A;  2H73 A;  5ECQ B;  2PGT A;  18GS A;  2KP2 A;  4BL7 A;  3CSI A;  4PUR A;  2LNT A;  3A3T A;  2HLS A;  1B4Q A;  3VWU A;  1TW9 A;  1AC1 A;  1QXH A;  3GX8 A;  1T1V A;  3KP9 A;  4I5Q A;  1GSD A;  4G01 A;  4I2T A;  5G5F A;  1MD4 A;  4ZIL A;  5D9T A;  1OE7 A;  2HSH A;  4DSS B;  1SD8 A;  1TXX A;  2I1U A;  2NDO A;  5CRE A;  3DGQ A;  2YNX A;  4NV5 A;  4J2F A;  1EEJ A;  4EE0 A;  2P5Q A;  3KCM A;  2R6K A;  1H75 A;  4WXT A;  2IJY A;  3GHA A;  1VF1 A;  3TUE A;  2HRA A;  1M2D A;  4K5R A;  1AQV A;  1Q98 A;  2B6M A;  3F9U A;  3LYP A;  1FG4 A;  2KUC A;  3GH6 A;  5HR2 A;  5DAK B;  3GX0 A;  2O85 A;  4MH2 A;  2GQM A;  2VKZ G;  2RUF A;  2F3M A;  2UZ8 A;  1SU9 A;  3KEB A;  3UBL A;  2EFC A;  1TRU A;  5HR1 A;  2PU9 C;  3KMO A;  3ZTL A;  1FAA A;  4X0X A;  3EPT A;  1GTA A;  3DVW A;  1GUK A;  4RI7 A;  1GNE A;  3HXS A;  1SYX A;  3BCI A;  1XVQ A;  2FNO A;  4EKZ A;  1SKW B;  2TRX A;  3HVS A;  2A4V A;  2AV4 A;  4GSS A;  1Z7P A;  3VUR A;  5D73 A;  3M9J A;  4D73 B;  3MAK A;  1YKA A;  6GST A;  1E6B A;  3HD5 A;  2HT9 A;  1F2E A;  4NHW A;  4DSS A;  3KJY A;  4LA1 A;  2XBQ A;  4AF2 A;  1TRV A;  3ERW A;  1YQ1 A;  4V2L A;  2HSN B;  2BJX A;  2HSM B;  1ZMA A;  4FYU A;  4I6X A;  4MJB A;  5G5E A;  2DKH A;  4ZB7 A;  3CXG A;  2LST A;  19GS A;  4N11 A;  1M2A A;  5F8B A;  3LFL A;  3ERG A;  2V32 A;  4K2X A;  2AYT A;  1OC8 A;  3GUR A;  5GZZ B;  3BJ5 A;  4FO5 A;  1PGT A;  5D96 A;  5A34 B;  3HJO A;  5FWG A;  4XS4 B;  1BQ7 A;  3QAV A;  2LUS A;  2VL9 A;  4IJI A;  3DVX A;  3VWW A;  5BMU B;  2YJH A;  4NMU A;  1YZX A;  1GNW A;  1VRS D;  4Z2U A;  2HE3 A;  5DQY A;  3I43 A;  1C72 A;  4ZBD A;  4Z2T A;  1J0F A;  2VLT A;  5INY A;  2RM6 A;  1PSQ A;  4BPY A;  1AQX A;  1WIK A;  3IHG A;  4HEA 2;  4D73 A;  2MMZ A;  3QPM A;  3C73 A;  3O76 A;  4XS6 A;  2FUG 2;  3CTG A;  1WP0 A;  5GAN D;  3Q74 A;  2HQT A;  3ZFL A;  1THO A;  1THX A;  3BCK A;  5JCG A;  4HU9 A;  2CVD A;  1Y1U A;  1TI3 A;  3QFB C;  4EIP A;  5DBQ A;  4TR1 B;  2AJQ B;  2GST A;  4MJA A;  4MF6 A;  4TR3 A;  4F82 A;  4TXO B;  2XHF A;  1TRW A;  2EC4 A;  1XW5 A;  3BOA A;  3P7X A;  1T4Z A;  4EDZ A;  9GSS A;  1TK8 B;  13GS A;  3ZIJ A;  2LS5 A;  3KM6 A;  1XW9 A;  2F8A A;  2JSY A;  1QFN A;  3UAR A;  1A23 A;  1A8L A;  5IO2 A;  2QSI A;  3M8N A;  4MAB A;  3CMI A;  2WFC A;  2QA2 A;  4V2M A;  5ECN B;  4MZB A;  2WJU A;  1XBS A;  4YH2 A;  4GXZ A;  2UV8 G;  2NBS A;  4OCE A;  5ECK B;  4IKH A;  4K0N A;  1VF3 A;  1CQH A;  1ON4 A;  5C00 A;  5A4W A;  4K0G A;  1MDJ A;  3TKP A;  2B7J A;  4PQ1 A;  3SWL A;  3KIJ A;  1GUH A;  1F3A A;  4POB A;  3HKR A;  2DJ1 A;  4XRD A;  3EE2 A;  4KE3 A;  1BG5 A;  2H6X A;  4NV2 A;  3UJ1 A;  1GUL A;  1V9W A;  2C8U A;  5A4U A;  3HVX A;  1CQG A;  4ML6 A;  11GS A;  2OE3 A;  4EDY A;  2IMF A;  4X1U A;  1SD9 A;  3PGT A;  2MMO A;  3D5J A;  4IN0 A;  4K2D A;  4FIW A;  1GSE A;  4XIH A;  2VM1 A;  4KCA A;  2EFE A;  10GS A;  4NPB A;  5AN1 A;  2C80 A;  4Q5Q A;  1WRY A;  3VWX A;  4POK A;  4AKI A;  4TXO A;  3HYP A;  1Z6N A;  1Z9H A;  2LQQ A;  5D9W A;  3TU3 B;  4GDF A;  1DBY A;  5J4V A;  1GLQ A;  1FVJ A;  2YZH A;  2MYG A;  4MK3 A;  2P5R A;  1SVO A;  1K3Y A;  1HNB A;  4HU7 A;  2IFQ B;  4TR0 A;  2DML A;  4E8H A;  3DML A;  1Z5Y E;  1SK2 A;  4QL9 A;  2XBI A;  2R2J A;  4AJ8 A;  1OKT A;  5KN1 A;  4ZL9 A;  2L57 A;  4MP4 A;  2YWO A;  4Q5F A;  2K6V A;  2REM A;  5LCZ A;  1RQM A;  2XPE A;  2C3Q A;  2NTO A;  3ZRD A;  2ZCT A;  3HMJ G;  3GA4 A;  4WF4 A;  4RQR A;  4HZ2 A;  1A0F A;  2H6Z A;  2C3T A;  2R0C A;  2HZE B;  2A4H A;  1NHY A;  2YP6 A;  3FYG A;  1X5C A;  1PN9 A;  3RHC A;  3QAW A;  1YEX A;  2XC2 A;  1XPV A;  1N8J A;  5CRW A;  2X8H A;  3TKQ A;  1BG1 A;  2C1Y A;  4PX1 A;  3KMN A;  5JCW A;  3WGX A;  4WBR D;  3W8S A;  2FY6 A;  1XOB A;  4TVE A;  2X99 A;  2CV4 A;  1YKC A;  2FWF A;  2V6O A;  5AIX A;  1TK0 B;  4LMW A;  4G0I A;  3FHK A;  2P0G A;  3H79 A;  3MNG A;  2VAF A;  4EC0 A;  4MPF A;  2VUP A;  3HJM A;  3I9V 2;  3G7Y A;  1OAZ A;  3F4R A;  1KEB A;  2YZU A;  8GSS A;  3IDV A;  1O85 A;  3TOU A;  1SK0 A;  3GUS A;  2AHE A;  3KTL A;  3FZ9 A;  2O87 A;  4BA7 A;  1A2J A;  5CAX A;  1SJ6 A;  1UVZ A;  4ZL8 A;  3ED3 A;  2CAI A;  1QQ2 A;  3HDC A;  4NXI A;  5H5Q A;  2ALB A;  4CW9 A;  3TB2 A;  2C0D A;  2HZE A;  4OFT A;  1PRX A;  1WMJ A;  1JFU A;  3HY2 A;  2B5E A;  2JZS A;  4PNG A;  3GYK A;  3F6D A;  1X9S B;  5E4W A;  1O6J A;  2L6D A;  3TJK A;  6GSV A;  3C8E A;  1W89 A;  2VCT A;  3R2Q A;  1FVK A;  4BVX B;  4IP1 A;  2YPM A;  3GTU A;  3MWH A;  1V98 A;  1RK4 A;  1GSS A;  1XIY A;  1SVL A;  2RII A;  12GS A;  3P8W A;  2JU5 A;  3DRN A;  2YV7 A;  2WDU A;  2I9H A;  3KGK A;  3GN3 A;  4L0U A;  1DE1 A;  4AJ6 A;  1B4P A;  1F3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...