4QQEA

Crystal structure of wdr5, wd repeat domain 5 in complex with compound sgc-ds-mt-0345
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Crystal structure of WDR5, WD repeat domain 5 in complex with compound SGC-DS-MT-0345
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 107
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4qqeA00
2UZXB 4R7AB 2CN3A 3AL8A 2TRCB 5FKTA 1SQ9A 4I79A 4ZOYA 4FA1D 4CI8A 3DXKC 1GG2B 3EU7A 2YB8B 4GGDA 2H6NA 1A0RB 4KFMB 4GMBA 1QNIA 2P9KC 4A09A 2UZYB 5CYKA 3CIKB 4J87A 4ZN4A 5IJ7E 4A11B 4JXMA 2CE9A 5H1MA 5C2VB 5CXBB 3SVWD 3SFZA 2G9AA 1R5MA 3C9CA 5FQDA 4J8GA 3EI2B 4A0AB 4AOWA 2OK4A 3KRXB 3RFGA 3L4MD 4TZ4A 3JB9L 2YBAA 4J79A 2CNXA 3SLED 3MMYA 4CZVA 1U4CA 3I7OA 2B5NA 2IWFA 2BBKH 4ZOVA 4J0XA 4ERQA 3UKRC 5HE0B 4E5ZB 4FA9D 4K3JB 3ZWLB 4FAVD 4G56B 4PSWB 1B9YA 1PI6A 3IIWA 3CFVA 3UR4A 5THAA 5HE1B 2GNQA 2B5LA 3P4FA 4CC9A 1SHYB 4ES0A 5EM2A 4EWRA 4GM9A 4A08B 4BL0A 2P9PC 3F3FA 5EALA 3SMRA 4IA9A 4NSXA 2GC4A 2MTAH 2Q7QA 4O3TB 5FA5B 3SCYA 3VH0A 2H9MA 5GXHA 4X61B 5EMJB 2YMUA 3CFSB 3VGZA 3C99A 4LGNA 3PXTD 3EI4A 3UVLA 5AFU3 1OLZA 5I5JA 4A0BB 1JMZB 4J82A 3RN1D 3K26A 2AGYA 2I3SA 1PBYB 4UI9R 4PNKB 4X60B 1NR0A 3MZLA 3IKOA 2OJYA 2O9KA 5KDOB 5A2Qg 5EARA 4FHLA 4YVDA 5CXCB 3C75H 3W15A 3AL8B 4ESGA 2XL2A 4A7JA 4GQ1A 2PM9A 3DSMA 4HDJA 4O1QD 4QQEA 4J0WA 3EI1B 5EMLB 3F3PA 4J77A 3NVXA 4J8BA 2I0TA 4A09B 2YNOA 5CYKB 3JAMg 4ZOZA 2HKRA 1YFQA 5K1CC 1OMWB 3RN0D 4GGCA 5FXYA 3NVNA 1N6FA 4OZUA 3DXMC 4O45A 5IT9g 2P9IC 3JZGA 5H14A 5TF2A 4FWWA 4JSPC 4N14A 4LG8A 4E54B 4JT5C 3V9FA 4Y7RA 3IJCA 5H17A 4GQ2P 3NVQA 5IC7A 2H9LA 1MG3A 5IGOA 2XU7A 3I8EA 2HESX 3RMZD 1PEVA 4AEZA 1K8KC 3RFHA 1XKSA 5FKSA 3ODTA 3I2NA 2CE8A 4IMMA 4BH6A 3OW8A 2IUVA 3IJ1A 4JT6C 2EBSA 2H68A 4GM3A 1RI6A 2Z2PA 3MKQA 1TYQC 3OKWA 5I5MA 4A11A 1FWXA 1GP2B 1S4UX 3U4YA 3V7DB 4J73A 3AFCA 3MKSB 3ORVD 3OTTA 5EM2B 2IAAA 3EI2A 4FA4D 3DM0A 5K19A 4JSXC 3L4OD 3EG6A 4J86A 3OL2A 2H6QA 4O3UB 3PE7A 3PVWB 3I7HA 3I7KA 5FKQA 4XEIC 2HJBA 2HYEA 3EI3B 2OK6A 4LG9A 3SN6B 3SHFA 5JWZA 1SQJA 3EI4B 5FKRA 3I7NA 3I7LA 3JPXA 5HYNB 1Q47A 4BUJC 3I7PA 4PBYA 2YNPA 1TBGA 3I89A 4PBZA 5AJAA 3N0DA 4GQBB 5C2WB 1XIPA 3C5MA 4CZYA 2IUQA 4D0KA 4U1EI 2J57G 4CY3A 2PM7B 2IURA 3SXTD 3OKYA 4A08A 4JSVC 4JD2C 5EAMA 2B4EA 3UVKA 2G99A 2H6KA 5FLXg 2I0SA 3BWSA 5EAPA 4J81A 2P9SC 5SXMA 1MDAH 4O9DA 2AH0A 3IJ0A 5TEEA 2AGZA 3PXSD 5GSAA 4CI3A 3N0EA 4QL1A 2CN2A 5GXIA 3JROA 3PSLA 2HXCA 3UVNA 1K32A 3BG0A 3GFCA 4D6VA 2AGWA 2AH1A 3RSEC 4CZXA 4ERZA 4GGAA 3IIYA 3MZKA 1JMXB 2QC5A 5B4WA 2I0RA 2CO0A 5CXCA 3OKTA 1PGUA 3K27A 4CY1A 2AQ5A 4X63B 2IUPA 3UVMA 3EMHA 4JSNC 4PC0A 2H47A 3RRMC 1GOTB 4MK0B 2XL3A 3SBPA 3EI1A 2HJ4A 3PXWD 3KRWB 4CI2A 2Z2OA 1ERJA 4QT8A 3J81g 2OVPB 5AMSA 3MXXA 5IJ8E 1MG2A 1JJUB 1NEXB 3FGBA 4ERYA 3UKUC 3UVOA 4K3ID 4A2LA 4X3EA 4CI1A 3AH8B 5HE3B 4E54A 5CXBA 3SBQA 3OL2B 5HQGA 3RLMD 2H9NA 2OVRB 3DWLC 2HKMA 2P9UC 5TDHB 4CY2A 1U2VC 5EMKB 4A0AA 5C9ZB 2P9LC 4J78A 4L1QD 2H3XA 2AGXA 4Z8LA 4ZOXA 1JOFA 2YNNA 3FM0A 4U7AA 2XYIA 2AGLA 2J56H 3PSCB 2PBIB 3E0CA 3I8CA 5HE2B 4A2MA 4H5IA 1B9XA 4H5JA 3ULEC 4PSXB 4FAND 4FB1D 3OKYB 4E5ZA 3GREA 1GXRA 2GC7A 3SJLD 2H13A 5EMMB 1P22A 3JZNA 3V5WB 1N6DA 4PXWA 3VA6A 4XYIA 3A0FA 2J55H 3AL9A 3JZHA 3HFQA 2BCJB 4L3GD 4QRJA 3PVUB 4Y5RD 3EI3A 4L3HD 5I5IA 2PM9B 3B7FA 4OWRA 3SWSD 2H14A 4J84A 2B5MA 2Z2NA 3J80g 2H9PA 4XYHA 2P9NC 2CO0C 4GZ8A 2OIZA 1N6EA 2PM6B 2QXVA 3BG1A 5IGQA 4A0BA 5TEFA 3SBRA 4FA5D 3EWEA 1XHMA 3F3GA 1VYHC 2I3TA 2OVQB 2IWKA 4CY5A 1L0QA 4L9OA 3FRXA 5GMKn 4GM8A 2W18A 3JRPA
chains in the Genus database with same CATH superfamily
2UZXB 4R7AB 2CN3A 3AL8A 2TRCB 5FKTA 4AN0A 3GD1I 3O4IA 1SQ9A 4I79A 4BCCA 4ZOYA 4FA1D 4CI8A 3DXKC 1GG2B 2VC2A 3EU7A 2YB8B 4GGDA 2H6NA 4JHPC 4JHNA 2HU5A 1A0RB 4KFMB 4GMBA 1QNIA 2P9KC 4A09A 2UZYB 5CYKA 3CIKB 4J87A 4ZN4A 5IJ7E 4A11B 4JXMA 2CE9A 5H1MA 5C2VB 5CXBB 3SVWD 2BKLA 3SFZA 2G9AA 1R5MA 4AMZA 3C9CA 5FQDA 4J8GA 3EI2B 4NAAA 4A0AB 4AOWA 1JTDB 5M5TA 2OK4A 3KRXB 3RFGA 3L4MD 4TZ4A 3JB9L 2YBAA 4J79A 1E5TA 2CNXA 3SLED 3VI4A 3MMYA 4CZVA 1U4CA 4G1EA 3I7OA 2B5NA 2IWFA 2BBKH 4ZOVA 3V4PA 4J0XA 4ERQA 4O02A 3UKRC 3IUNA 5HE0B 4E5ZB 4FA9D 2EIBA 4K3JB 3ZWLB 4FAVD 4G56B 3VI3A 4PSWB 1B9YA 3ZDZA 1PI6A 3IIWA 3CFVA 3UR4A 3FCUA 5THAA 5HE1B 2GNQA 2B5LA 3IUJA 3P4FA 5C92A 4CC9A 1SHYB 2VDPA 4ES0A 4NENA 5EM2A 4EWRA 4GM9A 2VDMA 1T2XA 4A08B 4MMYA 4BL0A 2P9PC 3F3FA 5EALA 3SMRA 1H2XA 4IA9A 4NC4A 1H2ZA 2GC4A 2MTAH 2Q7QA 3MUOA 4NSXA 4O3TB 2H9MA 5FA5B 3SCYA 3VH0A 5GXHA 4X61B 3QHYB 5EMJB 2YMUA 1UOPA 3CFSB 3VGZA 3C99A 4LGNA 3PXTD 3EI4A 3UVLA 2XDWA 5AFU3 1OLZA 3O4JA 5I5JA 4A0BB 1JMZB 4J82A 3RN1D 3K26A 2AGYA 2I3SA 1PBYB 4UI9R 4PNKB 1QFMA 4L1MA 4X60B 1NR0A 3MZLA 3IKOA 2OJYA 4QAMA 2O9KA 5KDOB 5A2Qg 5EARA 4FHLA 4YVDA 4DNUA 5CXCB 3C75H 1E8NA 3W15A 3AL8B 4ESGA 2XL2A 4A7JA 3ZE0A 4GQ1A 2PM9A 4O2WA 3DSMA 4HDJA 4O1QD 4QQEA 3EQ8A 4RE5A 4J0WA 4G1MA 3EI1B 5EMLB 3F3PA 4J77A 3NVXA 3EQ9A 2I0TA 4J8BA 2EIDA 4A09B 2YNOA 3KCIA 5CYKB 4ZOZA 3JAMg 2HKRA 1YFQA 3QI0A 5K1CC 1OMWB 3RN0D 4GGCA 5FXYA 3NVNA 1N6FA 4OZUA 3DXMC 4O45A 5IT9g 2P9IC 3JZGA 5H14A 5TF2A 4FWWA 4JSPC 4N14A 4WK2A 4LG8A 4E54B 4JT5C 2VZ1A 3V9FA 4Y7RA 3IJCA 5H17A 5M5VA 4GQ2P 3NVQA 5IC7A 2H9LA 1MG3A 5IGOA 2XU7A 3I8EA 2HESX 3V4VA 3RMZD 1PEVA 4AEZA 1K8KC 3RFHA 1UOQA 1XKSA 5FKSA 3ODTA 3IJEA 1QFSA 3I2NA 2CE8A 4IMMA 4BH6A 3OW8A 2IUVA 3IJ1A 1VZ3A 1L5GA 4JT6C 2EBSA 2H68A 4GM3A 1RI6A 2Z2PA 3MKQA 1TYQC 3OKWA 5I5MA 4A11A 4Z7QA 1FWXA 1GP2B 1S4UX 3IULA 3U4YA 3V7DB 4J73A 3AFCA 3ZE1A 3MKSB 3ORVD 3OTTA 5EM2B 2IAAA 1YR2A 3EI2A 5M5RA 3T3PA 3DM0A 4FA4D 5K19A 2HU8A 4JSXC 4WK0A 2XE4A 3L4OD 3EG6A 4J86A 3OL2A 2H6QA 3PE7A 3PVWB 4O3UB 3MVDK 3I7HA 3I7KA 5FKQA 3GC3B 5M61A 4XEIC 2HJBA 2HYEA 2JKXA 3EI3B 2OK6A 4LG9A 3SN6B 3SHFA 5JWZA 2XZGA 4RE6A 1SQJA 3EI4B 3O4GA 5FKRA 3I7NA 3I7LA 4MMXA 5M5UA 2VDNA 3JPXA 5HYNB 1Q47A 4BUJC 3I7PA 4PBYA 2YNPA 1TBGA 1I2MB 3I89A 3O4HA 4PBZA 5AJAA 1C9IA 3N0DA 4GQBB 1O6FA 5C2WB 1XIPA 3IUMA 1H2WA 3C5MA 5E6SA 4CZYA 2IUQA 4MMZA 4WJKA 4D0KA 2HU7A 4U1EI 2J57G 4CY3A 2PM7B 2IURA 3SXTD 3OKYA 3NIGA 2VDQA 4G55A 4A08A 4JSVC 4JD2C 5E6UA 5HDBA 5EAMA 2B4EA 3UVKA 2G99A 2H6KA 3IUQA 3EQ7A 5FLXg 1M1XA 2EICA 2I0SA 3BWSA 1UOOA 5EAPA 2VDRA 4J81A 2P9SC 5SXMA 1MDAH 4O9DA 2AH0A 3IJ0A 5TEEA 4UM9A 4DNWA 2AGZA 3PXSD 5GSAA 4CI3A 3N0EA 4QL1A 2CN2A 5GXIA 3JROA 3PSLA 2HXCA 3UVNA 1K32A 3BG0A 3GFCA 4D6VA 2AGWA 2AH1A 3RSEC 4CZXA 2QZPA 4ERZA 2WQ8A 4GGAA 4AN1A 3MZKA 3IIYA 3NIFA 1JMXB 2QC5A 3MUNA 5B4WA 2I0RA 2CO0A 5CXCA 1VE6A 2EIEA 2VDKA 3OKTA 1PGUA 3K27A 4Z7OA 3ZDXA 4CY1A 2VZ3A 1U8CA 3FCSA 2AQ5A 3T3MA 4UM8A 4X63B 1GOHA 2IUPA 3UVMA 3EMHA 4JSNC 4PC0A 1VZ2A 2H47A 3RRMC 3ZDYA 1GOTB 4MK0B 2XL3A 3SBPA 3K6SA 3EI1A 2HJ4A 3PXWD 3KRWB 4CI2A 1JV2A 2Z2OA 1ERJA 4QT8A 3J81g 2QR5A 2OVPB 4IRZA 5AMSA 3MXXA 5IJ8E 1MG2A 4BCDA 1JJUB 1NEXB 3FGBA 4ERYA 3UKUC 3UVOA 4BP8A 4K3ID 4A2LA 4X3EA 1H2YA 4CI1A 3AH8B 5HE3B 4E54A 5CXBA 3SBQA 3OL2B 5HQGA 3RLMD 5C86A 2H9NA 2OVRB 3DWLC 2HKMA 2P9UC 5TDHB 4CY2A 1U2VC 3DDUA 5EMKB 4AX4A 4A0AA 3K71A 1E8MA 5C9ZB 2P9LC 3NIDA 4J78A 4L1QD 2H3XA 2AGXA 4Z8LA 4DNVA 4ZOXA 1JOFA 2YNNA 3FM0A 3K72A 1TYEA 5FFGA 4U7AA 2XYIA 2AGLA 2J56H 3PSCB 2PBIB 3E0CA 3I8CA 5HE2B 1UTCA 4A2MA 4H5IA 1B9XA 4H5JA 3ULEC 4PSXB 4WK4A 4FAND 4D9SA 3ZE2A 4FB1D 3OKYB 4E5ZA 3GREA 1GXRA 2GC7A 3SJLD 2H13A 1GOGA 1O6GA 5EMMB 1P22A 3JZNA 3V5WB 1N6DA 4PXWA 3VA6A 4XYIA 3A0FA 2J55H 3AL9A 3JZHA 3HFQA 4AMYA 2VDOA 5M5SA 2BCJB 4L3GD 4QRJA 3PVUB 4Y5RD 3EI3A 4L3HD 5I5IA 1GOFA 2PM9B 3B7FA 1VE7A 4OWRA 3SWSD 2H14A 4J84A 2B5MA 1C9LA 2Z2NA 4BP9A 3J80g 2H9PA 4Z7NA 4XYHA 2P9NC 2CO0C 2VDLA 4GZ8A 2OIZA 1N6EA 2PM6B 2QXVA 3BG1A 5IGQA 4A0BA 3IVMA 5TEFA 3SBRA 1K3IA 4FA5D 1BPOA 3EWEA 1A12A 5FFOA 1XHMA 3F3GA 1VYHC 2I3TA 2OVQB 2IWKA 4BCBA 3IURA 3OF7A 5E6RA 4CY5A 1L0QA 4L9OA 4NBMA 3FRXA 5GMKn 4GM8A 2W18A 3JRPA
chains in the Genus database with same CATH topology
2UZXB 4R7AB 2CN3A 3AL8A 2TRCB 5FKTA 1SQ9A 4I79A 4ZOYA 4FA1D 4CI8A 3DXKC 1GG2B 3EU7A 2YB8B 4GGDA 2H6NA 1A0RB 4KFMB 4GMBA 1QNIA 2P9KC 4A09A 2UZYB 5CYKA 3CIKB 4J87A 4ZN4A 5IJ7E 4A11B 4JXMA 2CE9A 5H1MA 5C2VB 5CXBB 3SVWD 3SFZA 2G9AA 1R5MA 3C9CA 5FQDA 4J8GA 3EI2B 4A0AB 4AOWA 2OK4A 3KRXB 3RFGA 3L4MD 4TZ4A 3JB9L 2YBAA 4J79A 2CNXA 3SLED 3MMYA 4CZVA 1U4CA 3I7OA 2B5NA 2IWFA 2BBKH 4ZOVA 4J0XA 4ERQA 3UKRC 5HE0B 4E5ZB 4FA9D 4K3JB 3ZWLB 4FAVD 4G56B 4PSWB 1B9YA 1PI6A 3IIWA 3CFVA 3UR4A 5THAA 5HE1B 2GNQA 2B5LA 3P4FA 4CC9A 1SHYB 4ES0A 5EM2A 4EWRA 4GM9A 4A08B 4BL0A 2P9PC 3F3FA 5EALA 3SMRA 4IA9A 4NSXA 2GC4A 2MTAH 2Q7QA 4O3TB 5FA5B 3SCYA 3VH0A 2H9MA 5GXHA 4X61B 5EMJB 2YMUA 3CFSB 3VGZA 3C99A 4LGNA 3PXTD 3EI4A 3UVLA 5AFU3 1OLZA 5I5JA 4A0BB 1JMZB 4J82A 3RN1D 3K26A 2AGYA 2I3SA 1PBYB 4UI9R 4PNKB 4X60B 1NR0A 3MZLA 3IKOA 2OJYA 2O9KA 5KDOB 5A2Qg 5EARA 4FHLA 4YVDA 5CXCB 3C75H 3W15A 3AL8B 4ESGA 2XL2A 4A7JA 4GQ1A 2PM9A 3DSMA 4HDJA 4O1QD 4QQEA 4J0WA 3EI1B 5EMLB 3F3PA 4J77A 3NVXA 4J8BA 2I0TA 4A09B 2YNOA 5CYKB 3JAMg 4ZOZA 2HKRA 1YFQA 5K1CC 1OMWB 3RN0D 4GGCA 5FXYA 3NVNA 1N6FA 4OZUA 3DXMC 4O45A 5IT9g 2P9IC 3JZGA 5H14A 5TF2A 4FWWA 4JSPC 4N14A 4LG8A 4E54B 4JT5C 3V9FA 4Y7RA 3IJCA 5H17A 4GQ2P 3NVQA 5IC7A 2H9LA 1MG3A 5IGOA 2XU7A 3I8EA 2HESX 3RMZD 1PEVA 4AEZA 1K8KC 3RFHA 1XKSA 5FKSA 3ODTA 3I2NA 2CE8A 4IMMA 4BH6A 3OW8A 2IUVA 3IJ1A 4JT6C 2EBSA 2H68A 4GM3A 1RI6A 2Z2PA 3MKQA 1TYQC 3OKWA 5I5MA 4A11A 1FWXA 1GP2B 1S4UX 3U4YA 3V7DB 4J73A 3AFCA 3MKSB 3ORVD 3OTTA 5EM2B 2IAAA 3EI2A 4FA4D 3DM0A 5K19A 4JSXC 3L4OD 3EG6A 4J86A 3OL2A 2H6QA 4O3UB 3PE7A 3PVWB 3I7HA 3I7KA 5FKQA 4XEIC 2HJBA 2HYEA 3EI3B 2OK6A 4LG9A 3SN6B 3SHFA 5JWZA 1SQJA 3EI4B 5FKRA 3I7NA 3I7LA 3JPXA 5HYNB 1Q47A 4BUJC 3I7PA 4PBYA 2YNPA 1TBGA 3I89A 4PBZA 5AJAA 3N0DA 4GQBB 5C2WB 1XIPA 3C5MA 4CZYA 2IUQA 4D0KA 4U1EI 2J57G 4CY3A 2PM7B 2IURA 3SXTD 3OKYA 4A08A 4JSVC 4JD2C 5EAMA 2B4EA 3UVKA 2G99A 2H6KA 5FLXg 2I0SA 3BWSA 5EAPA 4J81A 2P9SC 5SXMA 1MDAH 4O9DA 2AH0A 3IJ0A 5TEEA 2AGZA 3PXSD 5GSAA 4CI3A 3N0EA 4QL1A 2CN2A 5GXIA 3JROA 3PSLA 2HXCA 3UVNA 1K32A 3BG0A 3GFCA 4D6VA 2AGWA 2AH1A 3RSEC 4CZXA 4ERZA 4GGAA 3IIYA 3MZKA 1JMXB 2QC5A 5B4WA 2I0RA 2CO0A 5CXCA 3OKTA 1PGUA 3K27A 4CY1A 2AQ5A 4X63B 2IUPA 3UVMA 3EMHA 4JSNC 4PC0A 2H47A 3RRMC 1GOTB 4MK0B 2XL3A 3SBPA 3EI1A 2HJ4A 3PXWD 3KRWB 4CI2A 2Z2OA 1ERJA 4QT8A 3J81g 2OVPB 5AMSA 3MXXA 5IJ8E 1MG2A 1JJUB 1NEXB 3FGBA 4ERYA 3UKUC 3UVOA 4K3ID 4A2LA 4X3EA 4CI1A 3AH8B 5HE3B 4E54A 5CXBA 3SBQA 3OL2B 5HQGA 3RLMD 2H9NA 2OVRB 3DWLC 2HKMA 2P9UC 5TDHB 4CY2A 1U2VC 5EMKB 4A0AA 5C9ZB 2P9LC 4J78A 4L1QD 2H3XA 2AGXA 4Z8LA 4ZOXA 1JOFA 2YNNA 3FM0A 4U7AA 2XYIA 2AGLA 2J56H 3PSCB 2PBIB 3E0CA 3I8CA 5HE2B 4A2MA 4H5IA 1B9XA 4H5JA 3ULEC 4PSXB 4FAND 4FB1D 3OKYB 4E5ZA 3GREA 1GXRA 2GC7A 3SJLD 2H13A 5EMMB 1P22A 3JZNA 3V5WB 1N6DA 4PXWA 3VA6A 4XYIA 3A0FA 2J55H 3AL9A 3JZHA 3HFQA 2BCJB 4L3GD 4QRJA 3PVUB 4Y5RD 3EI3A 4L3HD 5I5IA 2PM9B 3B7FA 4OWRA 3SWSD 2H14A 4J84A 2B5MA 2Z2NA 3J80g 2H9PA 4XYHA 2P9NC 2CO0C 4GZ8A 2OIZA 1N6EA 2PM6B 2QXVA 3BG1A 5IGQA 4A0BA 5TEFA 3SBRA 4FA5D 3EWEA 1XHMA 3F3GA 1VYHC 2I3TA 2OVQB 2IWKA 4CY5A 1L0QA 4L9OA 3FRXA 5GMKn 4GM8A 2W18A 3JRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZX B;  4R7A B;  2CN3 A;  3AL8 A;  2TRC B;  5FKT A;  1SQ9 A;  4I79 A;  4ZOY A;  4FA1 D;  4CI8 A;  3DXK C;  1GG2 B;  3EU7 A;  2YB8 B;  4GGD A;  2H6N A;  1A0R B;  4KFM B;  4GMB A;  1QNI A;  2P9K C;  4A09 A;  2UZY B;  5CYK A;  3CIK B;  4J87 A;  4ZN4 A;  5IJ7 E;  4A11 B;  4JXM A;  2CE9 A;  5H1M A;  5C2V B;  5CXB B;  3SVW D;  3SFZ A;  2G9A A;  1R5M A;  3C9C A;  5FQD A;  4J8G A;  3EI2 B;  4A0A B;  4AOW A;  2OK4 A;  3KRX B;  3RFG A;  3L4M D;  4TZ4 A;  3JB9 L;  2YBA A;  4J79 A;  2CNX A;  3SLE D;  3MMY A;  4CZV A;  1U4C A;  3I7O A;  2B5N A;  2IWF A;  2BBK H;  4ZOV A;  4J0X A;  4ERQ A;  3UKR C;  5HE0 B;  4E5Z B;  4FA9 D;  4K3J B;  3ZWL B;  4FAV D;  4G56 B;  4PSW B;  1B9Y A;  1PI6 A;  3IIW A;  3CFV A;  3UR4 A;  5THA A;  5HE1 B;  2GNQ A;  2B5L A;  3P4F A;  4CC9 A;  1SHY B;  4ES0 A;  5EM2 A;  4EWR A;  4GM9 A;  4A08 B;  4BL0 A;  2P9P C;  3F3F A;  5EAL A;  3SMR A;  4IA9 A;  4NSX A;  2GC4 A;  2MTA H;  2Q7Q A;  4O3T B;  5FA5 B;  3SCY A;  3VH0 A;  2H9M A;  5GXH A;  4X61 B;  5EMJ B;  2YMU A;  3CFS B;  3VGZ A;  3C99 A;  4LGN A;  3PXT D;  3EI4 A;  3UVL A;  5AFU 3;  1OLZ A;  5I5J A;  4A0B B;  1JMZ B;  4J82 A;  3RN1 D;  3K26 A;  2AGY A;  2I3S A;  1PBY B;  4UI9 R;  4PNK B;  4X60 B;  1NR0 A;  3MZL A;  3IKO A;  2OJY A;  2O9K A;  5KDO B;  5A2Q g;  5EAR A;  4FHL A;  4YVD A;  5CXC B;  3C75 H;  3W15 A;  3AL8 B;  4ESG A;  2XL2 A;  4A7J A;  4GQ1 A;  2PM9 A;  3DSM A;  4HDJ A;  4O1Q D;  4QQE A;  4J0W A;  3EI1 B;  5EML B;  3F3P A;  4J77 A;  3NVX A;  4J8B A;  2I0T A;  4A09 B;  2YNO A;  5CYK B;  3JAM g;  4ZOZ A;  2HKR A;  1YFQ A;  5K1C C;  1OMW B;  3RN0 D;  4GGC A;  5FXY A;  3NVN A;  1N6F A;  4OZU A;  3DXM C;  4O45 A;  5IT9 g;  2P9I C;  3JZG A;  5H14 A;  5TF2 A;  4FWW A;  4JSP C;  4N14 A;  4LG8 A;  4E54 B;  4JT5 C;  3V9F A;  4Y7R A;  3IJC A;  5H17 A;  4GQ2 P;  3NVQ A;  5IC7 A;  2H9L A;  1MG3 A;  5IGO A;  2XU7 A;  3I8E A;  2HES X;  3RMZ D;  1PEV A;  4AEZ A;  1K8K C;  3RFH A;  1XKS A;  5FKS A;  3ODT A;  3I2N A;  2CE8 A;  4IMM A;  4BH6 A;  3OW8 A;  2IUV A;  3IJ1 A;  4JT6 C;  2EBS A;  2H68 A;  4GM3 A;  1RI6 A;  2Z2P A;  3MKQ A;  1TYQ C;  3OKW A;  5I5M A;  4A11 A;  1FWX A;  1GP2 B;  1S4U X;  3U4Y A;  3V7D B;  4J73 A;  3AFC A;  3MKS B;  3ORV D;  3OTT A;  5EM2 B;  2IAA A;  3EI2 A;  4FA4 D;  3DM0 A;  5K19 A;  4JSX C;  3L4O D;  3EG6 A;  4J86 A;  3OL2 A;  2H6Q A;  4O3U B;  3PE7 A;  3PVW B;  3I7H A;  3I7K A;  5FKQ A;  4XEI C;  2HJB A;  2HYE A;  3EI3 B;  2OK6 A;  4LG9 A;  3SN6 B;  3SHF A;  5JWZ A;  1SQJ A;  3EI4 B;  5FKR A;  3I7N A;  3I7L A;  3JPX A;  5HYN B;  1Q47 A;  4BUJ C;  3I7P A;  4PBY A;  2YNP A;  1TBG A;  3I89 A;  4PBZ A;  5AJA A;  3N0D A;  4GQB B;  5C2W B;  1XIP A;  3C5M A;  4CZY A;  2IUQ A;  4D0K A;  4U1E I;  2J57 G;  4CY3 A;  2PM7 B;  2IUR A;  3SXT D;  3OKY A;  4A08 A;  4JSV C;  4JD2 C;  5EAM A;  2B4E A;  3UVK A;  2G99 A;  2H6K A;  5FLX g;  2I0S A;  3BWS A;  5EAP A;  4J81 A;  2P9S C;  5SXM A;  1MDA H;  4O9D A;  2AH0 A;  3IJ0 A;  5TEE A;  2AGZ A;  3PXS D;  5GSA A;  4CI3 A;  3N0E A;  4QL1 A;  2CN2 A;  5GXI A;  3JRO A;  3PSL A;  2HXC A;  3UVN A;  1K32 A;  3BG0 A;  3GFC A;  4D6V A;  2AGW A;  2AH1 A;  3RSE C;  4CZX A;  4ERZ A;  4GGA A;  3IIY A;  3MZK A;  1JMX B;  2QC5 A;  5B4W A;  2I0R A;  2CO0 A;  5CXC A;  3OKT A;  1PGU A;  3K27 A;  4CY1 A;  2AQ5 A;  4X63 B;  2IUP A;  3UVM A;  3EMH A;  4JSN C;  4PC0 A;  2H47 A;  3RRM C;  1GOT B;  4MK0 B;  2XL3 A;  3SBP A;  3EI1 A;  2HJ4 A;  3PXW D;  3KRW B;  4CI2 A;  2Z2O A;  1ERJ A;  4QT8 A;  3J81 g;  2OVP B;  5AMS A;  3MXX A;  5IJ8 E;  1MG2 A;  1JJU B;  1NEX B;  3FGB A;  4ERY A;  3UKU C;  3UVO A;  4K3I D;  4A2L A;  4X3E A;  4CI1 A;  3AH8 B;  5HE3 B;  4E54 A;  5CXB A;  3SBQ A;  3OL2 B;  5HQG A;  3RLM D;  2H9N A;  2OVR B;  3DWL C;  2HKM A;  2P9U C;  5TDH B;  4CY2 A;  1U2V C;  5EMK B;  4A0A A;  5C9Z B;  2P9L C;  4J78 A;  4L1Q D;  2H3X A;  2AGX A;  4Z8L A;  4ZOX A;  1JOF A;  2YNN A;  3FM0 A;  4U7A A;  2XYI A;  2AGL A;  2J56 H;  3PSC B;  2PBI B;  3E0C A;  3I8C A;  5HE2 B;  4A2M A;  4H5I A;  1B9X A;  4H5J A;  3ULE C;  4PSX B;  4FAN D;  4FB1 D;  3OKY B;  4E5Z A;  3GRE A;  1GXR A;  2GC7 A;  3SJL D;  2H13 A;  5EMM B;  1P22 A;  3JZN A;  3V5W B;  1N6D A;  4PXW A;  3VA6 A;  4XYI A;  3A0F A;  2J55 H;  3AL9 A;  3JZH A;  3HFQ A;  2BCJ B;  4L3G D;  4QRJ A;  3PVU B;  4Y5R D;  3EI3 A;  4L3H D;  5I5I A;  2PM9 B;  3B7F A;  4OWR A;  3SWS D;  2H14 A;  4J84 A;  2B5M A;  2Z2N A;  3J80 g;  2H9P A;  4XYH A;  2P9N C;  2CO0 C;  4GZ8 A;  2OIZ A;  1N6E A;  2PM6 B;  2QXV A;  3BG1 A;  5IGQ A;  4A0B A;  5TEF A;  3SBR A;  4FA5 D;  3EWE A;  1XHM A;  3F3G A;  1VYH C;  2I3T A;  2OVQ B;  2IWK A;  4CY5 A;  1L0Q A;  4L9O A;  3FRX A;  5GMK n;  4GM8 A;  2W18 A;  3JRP A; 
#chains in the Genus database with same CATH topology
 2UZX B;  4R7A B;  2CN3 A;  3AL8 A;  2TRC B;  5FKT A;  4AN0 A;  3GD1 I;  3O4I A;  1SQ9 A;  4I79 A;  4BCC A;  4ZOY A;  4FA1 D;  4CI8 A;  3DXK C;  1GG2 B;  2VC2 A;  3EU7 A;  2YB8 B;  4GGD A;  2H6N A;  4JHP C;  4JHN A;  2HU5 A;  1A0R B;  4KFM B;  4GMB A;  1QNI A;  2P9K C;  4A09 A;  2UZY B;  5CYK A;  3CIK B;  4J87 A;  4ZN4 A;  5IJ7 E;  4A11 B;  4JXM A;  2CE9 A;  5H1M A;  5C2V B;  5CXB B;  3SVW D;  2BKL A;  3SFZ A;  2G9A A;  1R5M A;  4AMZ A;  3C9C A;  5FQD A;  4J8G A;  3EI2 B;  4NAA A;  4A0A B;  4AOW A;  1JTD B;  5M5T A;  2OK4 A;  3KRX B;  3RFG A;  3L4M D;  4TZ4 A;  3JB9 L;  2YBA A;  4J79 A;  1E5T A;  2CNX A;  3SLE D;  3VI4 A;  3MMY A;  4CZV A;  1U4C A;  4G1E A;  3I7O A;  2B5N A;  2IWF A;  2BBK H;  4ZOV A;  3V4P A;  4J0X A;  4ERQ A;  4O02 A;  3UKR C;  3IUN A;  5HE0 B;  4E5Z B;  4FA9 D;  2EIB A;  4K3J B;  3ZWL B;  4FAV D;  4G56 B;  3VI3 A;  4PSW B;  1B9Y A;  3ZDZ A;  1PI6 A;  3IIW A;  3CFV A;  3UR4 A;  3FCU A;  5THA A;  5HE1 B;  2GNQ A;  2B5L A;  3IUJ A;  3P4F A;  5C92 A;  4CC9 A;  1SHY B;  2VDP A;  4ES0 A;  4NEN A;  5EM2 A;  4EWR A;  4GM9 A;  2VDM A;  1T2X A;  4A08 B;  4MMY A;  4BL0 A;  2P9P C;  3F3F A;  5EAL A;  3SMR A;  1H2X A;  4IA9 A;  4NC4 A;  1H2Z A;  2GC4 A;  2MTA H;  2Q7Q A;  3MUO A;  4NSX A;  4O3T B;  2H9M A;  5FA5 B;  3SCY A;  3VH0 A;  5GXH A;  4X61 B;  3QHY B;  5EMJ B;  2YMU A;  1UOP A;  3CFS B;  3VGZ A;  3C99 A;  4LGN A;  3PXT D;  3EI4 A;  3UVL A;  2XDW A;  5AFU 3;  1OLZ A;  3O4J A;  5I5J A;  4A0B B;  1JMZ B;  4J82 A;  3RN1 D;  3K26 A;  2AGY A;  2I3S A;  1PBY B;  4UI9 R;  4PNK B;  1QFM A;  4L1M A;  4X60 B;  1NR0 A;  3MZL A;  3IKO A;  2OJY A;  4QAM A;  2O9K A;  5KDO B;  5A2Q g;  5EAR A;  4FHL A;  4YVD A;  4DNU A;  5CXC B;  3C75 H;  1E8N A;  3W15 A;  3AL8 B;  4ESG A;  2XL2 A;  4A7J A;  3ZE0 A;  4GQ1 A;  2PM9 A;  4O2W A;  3DSM A;  4HDJ A;  4O1Q D;  4QQE A;  3EQ8 A;  4RE5 A;  4J0W A;  4G1M A;  3EI1 B;  5EML B;  3F3P A;  4J77 A;  3NVX A;  3EQ9 A;  2I0T A;  4J8B A;  2EID A;  4A09 B;  2YNO A;  3KCI A;  5CYK B;  4ZOZ A;  3JAM g;  2HKR A;  1YFQ A;  3QI0 A;  5K1C C;  1OMW B;  3RN0 D;  4GGC A;  5FXY A;  3NVN A;  1N6F A;  4OZU A;  3DXM C;  4O45 A;  5IT9 g;  2P9I C;  3JZG A;  5H14 A;  5TF2 A;  4FWW A;  4JSP C;  4N14 A;  4WK2 A;  4LG8 A;  4E54 B;  4JT5 C;  2VZ1 A;  3V9F A;  4Y7R A;  3IJC A;  5H17 A;  5M5V A;  4GQ2 P;  3NVQ A;  5IC7 A;  2H9L A;  1MG3 A;  5IGO A;  2XU7 A;  3I8E A;  2HES X;  3V4V A;  3RMZ D;  1PEV A;  4AEZ A;  1K8K C;  3RFH A;  1UOQ A;  1XKS A;  5FKS A;  3ODT A;  3IJE A;  1QFS A;  3I2N A;  2CE8 A;  4IMM A;  4BH6 A;  3OW8 A;  2IUV A;  3IJ1 A;  1VZ3 A;  1L5G A;  4JT6 C;  2EBS A;  2H68 A;  4GM3 A;  1RI6 A;  2Z2P A;  3MKQ A;  1TYQ C;  3OKW A;  5I5M A;  4A11 A;  4Z7Q A;  1FWX A;  1GP2 B;  1S4U X;  3IUL A;  3U4Y A;  3V7D B;  4J73 A;  3AFC A;  3ZE1 A;  3MKS B;  3ORV D;  3OTT A;  5EM2 B;  2IAA A;  1YR2 A;  3EI2 A;  5M5R A;  3T3P A;  3DM0 A;  4FA4 D;  5K19 A;  2HU8 A;  4JSX C;  4WK0 A;  2XE4 A;  3L4O D;  3EG6 A;  4J86 A;  3OL2 A;  2H6Q A;  3PE7 A;  3PVW B;  4O3U B;  3MVD K;  3I7H A;  3I7K A;  5FKQ A;  3GC3 B;  5M61 A;  4XEI C;  2HJB A;  2HYE A;  2JKX A;  3EI3 B;  2OK6 A;  4LG9 A;  3SN6 B;  3SHF A;  5JWZ A;  2XZG A;  4RE6 A;  1SQJ A;  3EI4 B;  3O4G A;  5FKR A;  3I7N A;  3I7L A;  4MMX A;  5M5U A;  2VDN A;  3JPX A;  5HYN B;  1Q47 A;  4BUJ C;  3I7P A;  4PBY A;  2YNP A;  1TBG A;  1I2M B;  3I89 A;  3O4H A;  4PBZ A;  5AJA A;  1C9I A;  3N0D A;  4GQB B;  1O6F A;  5C2W B;  1XIP A;  3IUM A;  1H2W A;  3C5M A;  5E6S A;  4CZY A;  2IUQ A;  4MMZ A;  4WJK A;  4D0K A;  2HU7 A;  4U1E I;  2J57 G;  4CY3 A;  2PM7 B;  2IUR A;  3SXT D;  3OKY A;  3NIG A;  2VDQ A;  4G55 A;  4A08 A;  4JSV C;  4JD2 C;  5E6U A;  5HDB A;  5EAM A;  2B4E A;  3UVK A;  2G99 A;  2H6K A;  3IUQ A;  3EQ7 A;  5FLX g;  1M1X A;  2EIC A;  2I0S A;  3BWS A;  1UOO A;  5EAP A;  2VDR A;  4J81 A;  2P9S C;  5SXM A;  1MDA H;  4O9D A;  2AH0 A;  3IJ0 A;  5TEE A;  4UM9 A;  4DNW A;  2AGZ A;  3PXS D;  5GSA A;  4CI3 A;  3N0E A;  4QL1 A;  2CN2 A;  5GXI A;  3JRO A;  3PSL A;  2HXC A;  3UVN A;  1K32 A;  3BG0 A;  3GFC A;  4D6V A;  2AGW A;  2AH1 A;  3RSE C;  4CZX A;  2QZP A;  4ERZ A;  2WQ8 A;  4GGA A;  4AN1 A;  3MZK A;  3IIY A;  3NIF A;  1JMX B;  2QC5 A;  3MUN A;  5B4W A;  2I0R A;  2CO0 A;  5CXC A;  1VE6 A;  2EIE A;  2VDK A;  3OKT A;  1PGU A;  3K27 A;  4Z7O A;  3ZDX A;  4CY1 A;  2VZ3 A;  1U8C A;  3FCS A;  2AQ5 A;  3T3M A;  4UM8 A;  4X63 B;  1GOH A;  2IUP A;  3UVM A;  3EMH A;  4JSN C;  4PC0 A;  1VZ2 A;  2H47 A;  3RRM C;  3ZDY A;  1GOT B;  4MK0 B;  2XL3 A;  3SBP A;  3K6S A;  3EI1 A;  2HJ4 A;  3PXW D;  3KRW B;  4CI2 A;  1JV2 A;  2Z2O A;  1ERJ A;  4QT8 A;  3J81 g;  2QR5 A;  2OVP B;  4IRZ A;  5AMS A;  3MXX A;  5IJ8 E;  1MG2 A;  4BCD A;  1JJU B;  1NEX B;  3FGB A;  4ERY A;  3UKU C;  3UVO A;  4BP8 A;  4K3I D;  4A2L A;  4X3E A;  1H2Y A;  4CI1 A;  3AH8 B;  5HE3 B;  4E54 A;  5CXB A;  3SBQ A;  3OL2 B;  5HQG A;  3RLM D;  5C86 A;  2H9N A;  2OVR B;  3DWL C;  2HKM A;  2P9U C;  5TDH B;  4CY2 A;  1U2V C;  3DDU A;  5EMK B;  4AX4 A;  4A0A A;  3K71 A;  1E8M A;  5C9Z B;  2P9L C;  3NID A;  4J78 A;  4L1Q D;  2H3X A;  2AGX A;  4Z8L A;  4DNV A;  4ZOX A;  1JOF A;  2YNN A;  3FM0 A;  3K72 A;  1TYE A;  5FFG A;  4U7A A;  2XYI A;  2AGL A;  2J56 H;  3PSC B;  2PBI B;  3E0C A;  3I8C A;  5HE2 B;  1UTC A;  4A2M A;  4H5I A;  1B9X A;  4H5J A;  3ULE C;  4PSX B;  4WK4 A;  4FAN D;  4D9S A;  3ZE2 A;  4FB1 D;  3OKY B;  4E5Z A;  3GRE A;  1GXR A;  2GC7 A;  3SJL D;  2H13 A;  1GOG A;  1O6G A;  5EMM B;  1P22 A;  3JZN A;  3V5W B;  1N6D A;  4PXW A;  3VA6 A;  4XYI A;  3A0F A;  2J55 H;  3AL9 A;  3JZH A;  3HFQ A;  4AMY A;  2VDO A;  5M5S A;  2BCJ B;  4L3G D;  4QRJ A;  3PVU B;  4Y5R D;  3EI3 A;  4L3H D;  5I5I A;  1GOF A;  2PM9 B;  3B7F A;  1VE7 A;  4OWR A;  3SWS D;  2H14 A;  4J84 A;  2B5M A;  1C9L A;  2Z2N A;  4BP9 A;  3J80 g;  2H9P A;  4Z7N A;  4XYH A;  2P9N C;  2CO0 C;  2VDL A;  4GZ8 A;  2OIZ A;  1N6E A;  2PM6 B;  2QXV A;  3BG1 A;  5IGQ A;  4A0B A;  3IVM A;  5TEF A;  3SBR A;  1K3I A;  4FA5 D;  1BPO A;  3EWE A;  1A12 A;  5FFO A;  1XHM A;  3F3G A;  1VYH C;  2I3T A;  2OVQ B;  2IWK A;  4BCB A;  3IUR A;  3OF7 A;  5E6R A;  4CY5 A;  1L0Q A;  4L9O A;  4NBM A;  3FRX A;  5GMK n;  4GM8 A;  2W18 A;  3JRP A; 
#chains in the Genus database with same CATH homology
 2UZX B;  4R7A B;  2CN3 A;  3AL8 A;  2TRC B;  5FKT A;  1SQ9 A;  4I79 A;  4ZOY A;  4FA1 D;  4CI8 A;  3DXK C;  1GG2 B;  3EU7 A;  2YB8 B;  4GGD A;  2H6N A;  1A0R B;  4KFM B;  4GMB A;  1QNI A;  2P9K C;  4A09 A;  2UZY B;  5CYK A;  3CIK B;  4J87 A;  4ZN4 A;  5IJ7 E;  4A11 B;  4JXM A;  2CE9 A;  5H1M A;  5C2V B;  5CXB B;  3SVW D;  3SFZ A;  2G9A A;  1R5M A;  3C9C A;  5FQD A;  4J8G A;  3EI2 B;  4A0A B;  4AOW A;  2OK4 A;  3KRX B;  3RFG A;  3L4M D;  4TZ4 A;  3JB9 L;  2YBA A;  4J79 A;  2CNX A;  3SLE D;  3MMY A;  4CZV A;  1U4C A;  3I7O A;  2B5N A;  2IWF A;  2BBK H;  4ZOV A;  4J0X A;  4ERQ A;  3UKR C;  5HE0 B;  4E5Z B;  4FA9 D;  4K3J B;  3ZWL B;  4FAV D;  4G56 B;  4PSW B;  1B9Y A;  1PI6 A;  3IIW A;  3CFV A;  3UR4 A;  5THA A;  5HE1 B;  2GNQ A;  2B5L A;  3P4F A;  4CC9 A;  1SHY B;  4ES0 A;  5EM2 A;  4EWR A;  4GM9 A;  4A08 B;  4BL0 A;  2P9P C;  3F3F A;  5EAL A;  3SMR A;  4IA9 A;  4NSX A;  2GC4 A;  2MTA H;  2Q7Q A;  4O3T B;  5FA5 B;  3SCY A;  3VH0 A;  2H9M A;  5GXH A;  4X61 B;  5EMJ B;  2YMU A;  3CFS B;  3VGZ A;  3C99 A;  4LGN A;  3PXT D;  3EI4 A;  3UVL A;  5AFU 3;  1OLZ A;  5I5J A;  4A0B B;  1JMZ B;  4J82 A;  3RN1 D;  3K26 A;  2AGY A;  2I3S A;  1PBY B;  4UI9 R;  4PNK B;  4X60 B;  1NR0 A;  3MZL A;  3IKO A;  2OJY A;  2O9K A;  5KDO B;  5A2Q g;  5EAR A;  4FHL A;  4YVD A;  5CXC B;  3C75 H;  3W15 A;  3AL8 B;  4ESG A;  2XL2 A;  4A7J A;  4GQ1 A;  2PM9 A;  3DSM A;  4HDJ A;  4O1Q D;  4QQE A;  4J0W A;  3EI1 B;  5EML B;  3F3P A;  4J77 A;  3NVX A;  4J8B A;  2I0T A;  4A09 B;  2YNO A;  5CYK B;  3JAM g;  4ZOZ A;  2HKR A;  1YFQ A;  5K1C C;  1OMW B;  3RN0 D;  4GGC A;  5FXY A;  3NVN A;  1N6F A;  4OZU A;  3DXM C;  4O45 A;  5IT9 g;  2P9I C;  3JZG A;  5H14 A;  5TF2 A;  4FWW A;  4JSP C;  4N14 A;  4LG8 A;  4E54 B;  4JT5 C;  3V9F A;  4Y7R A;  3IJC A;  5H17 A;  4GQ2 P;  3NVQ A;  5IC7 A;  2H9L A;  1MG3 A;  5IGO A;  2XU7 A;  3I8E A;  2HES X;  3RMZ D;  1PEV A;  4AEZ A;  1K8K C;  3RFH A;  1XKS A;  5FKS A;  3ODT A;  3I2N A;  2CE8 A;  4IMM A;  4BH6 A;  3OW8 A;  2IUV A;  3IJ1 A;  4JT6 C;  2EBS A;  2H68 A;  4GM3 A;  1RI6 A;  2Z2P A;  3MKQ A;  1TYQ C;  3OKW A;  5I5M A;  4A11 A;  1FWX A;  1GP2 B;  1S4U X;  3U4Y A;  3V7D B;  4J73 A;  3AFC A;  3MKS B;  3ORV D;  3OTT A;  5EM2 B;  2IAA A;  3EI2 A;  4FA4 D;  3DM0 A;  5K19 A;  4JSX C;  3L4O D;  3EG6 A;  4J86 A;  3OL2 A;  2H6Q A;  4O3U B;  3PE7 A;  3PVW B;  3I7H A;  3I7K A;  5FKQ A;  4XEI C;  2HJB A;  2HYE A;  3EI3 B;  2OK6 A;  4LG9 A;  3SN6 B;  3SHF A;  5JWZ A;  1SQJ A;  3EI4 B;  5FKR A;  3I7N A;  3I7L A;  3JPX A;  5HYN B;  1Q47 A;  4BUJ C;  3I7P A;  4PBY A;  2YNP A;  1TBG A;  3I89 A;  4PBZ A;  5AJA A;  3N0D A;  4GQB B;  5C2W B;  1XIP A;  3C5M A;  4CZY A;  2IUQ A;  4D0K A;  4U1E I;  2J57 G;  4CY3 A;  2PM7 B;  2IUR A;  3SXT D;  3OKY A;  4A08 A;  4JSV C;  4JD2 C;  5EAM A;  2B4E A;  3UVK A;  2G99 A;  2H6K A;  5FLX g;  2I0S A;  3BWS A;  5EAP A;  4J81 A;  2P9S C;  5SXM A;  1MDA H;  4O9D A;  2AH0 A;  3IJ0 A;  5TEE A;  2AGZ A;  3PXS D;  5GSA A;  4CI3 A;  3N0E A;  4QL1 A;  2CN2 A;  5GXI A;  3JRO A;  3PSL A;  2HXC A;  3UVN A;  1K32 A;  3BG0 A;  3GFC A;  4D6V A;  2AGW A;  2AH1 A;  3RSE C;  4CZX A;  4ERZ A;  4GGA A;  3IIY A;  3MZK A;  1JMX B;  2QC5 A;  5B4W A;  2I0R A;  2CO0 A;  5CXC A;  3OKT A;  1PGU A;  3K27 A;  4CY1 A;  2AQ5 A;  4X63 B;  2IUP A;  3UVM A;  3EMH A;  4JSN C;  4PC0 A;  2H47 A;  3RRM C;  1GOT B;  4MK0 B;  2XL3 A;  3SBP A;  3EI1 A;  2HJ4 A;  3PXW D;  3KRW B;  4CI2 A;  2Z2O A;  1ERJ A;  4QT8 A;  3J81 g;  2OVP B;  5AMS A;  3MXX A;  5IJ8 E;  1MG2 A;  1JJU B;  1NEX B;  3FGB A;  4ERY A;  3UKU C;  3UVO A;  4K3I D;  4A2L A;  4X3E A;  4CI1 A;  3AH8 B;  5HE3 B;  4E54 A;  5CXB A;  3SBQ A;  3OL2 B;  5HQG A;  3RLM D;  2H9N A;  2OVR B;  3DWL C;  2HKM A;  2P9U C;  5TDH B;  4CY2 A;  1U2V C;  5EMK B;  4A0A A;  5C9Z B;  2P9L C;  4J78 A;  4L1Q D;  2H3X A;  2AGX A;  4Z8L A;  4ZOX A;  1JOF A;  2YNN A;  3FM0 A;  4U7A A;  2XYI A;  2AGL A;  2J56 H;  3PSC B;  2PBI B;  3E0C A;  3I8C A;  5HE2 B;  4A2M A;  4H5I A;  1B9X A;  4H5J A;  3ULE C;  4PSX B;  4FAN D;  4FB1 D;  3OKY B;  4E5Z A;  3GRE A;  1GXR A;  2GC7 A;  3SJL D;  2H13 A;  5EMM B;  1P22 A;  3JZN A;  3V5W B;  1N6D A;  4PXW A;  3VA6 A;  4XYI A;  3A0F A;  2J55 H;  3AL9 A;  3JZH A;  3HFQ A;  2BCJ B;  4L3G D;  4QRJ A;  3PVU B;  4Y5R D;  3EI3 A;  4L3H D;  5I5I A;  2PM9 B;  3B7F A;  4OWR A;  3SWS D;  2H14 A;  4J84 A;  2B5M A;  2Z2N A;  3J80 g;  2H9P A;  4XYH A;  2P9N C;  2CO0 C;  4GZ8 A;  2OIZ A;  1N6E A;  2PM6 B;  2QXV A;  3BG1 A;  5IGQ A;  4A0B A;  5TEF A;  3SBR A;  4FA5 D;  3EWE A;  1XHM A;  3F3G A;  1VYH C;  2I3T A;  2OVQ B;  2IWK A;  4CY5 A;  1L0Q A;  4L9O A;  3FRX A;  5GMK n;  4GM8 A;  2W18 A;  3JRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...