4QQEA

Crystal structure of wdr5, wd repeat domain 5 in complex with compound sgc-ds-mt-0345
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
304
structure length
304
Chain Sequence
b'VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
molecule tags Transcription
source organism Homo sapiens
publication title Crystal structure of WDR5, WD repeat domain 5 in complex with compound SGC-DS-MT-0345
rcsb
total genus 107
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4qqeA00
1OMWB 3SJLD 3J80g 5HE0B 1L0QA 1JMXB 1VYHC 2B4EA 4O45A 5B4WA 2I3SA 4A7JA 4FWWA 1U4CA 1MDAH 4J0WA 2TRCB 3EI3A 2IWKA 2OIZA 2HESX 3EI4A 3JRPA 1GP2B 3PSLA 4CY2A 4PSWB 1PI6A 3F3FA 4A0AB 5FKTA 2P9KC 4GGCA 2OVPB 5EMKB 5TEFA 3GREA 2XL2A 3VH0A 4H5JA 2H47A 3FM0A 2P9SC 4ES0A 3SHFA 3C99A 4FHLA 5HYNB 4O3TB 2OK4A 4A09A 3I7LA 3RFGA 5IT9g 3E0CA 2AQ5A 4J78A 3OKYA 3RN1D 3UVLA 5EAPA 3SWSD 4JSXC 1A0RB 2AH1A 4AEZA 4E54A 3KRWB 2H14A 4X3EA 4AOWA 3K27A 3CFVA 3C9CA 3RLMD 2H6KA 4Y7RA 3MZKA 4HDJA 5C2WB 1R5MA 3OL2B 5A2Qg 5AJAA 3PXTD 2G9AA 4GM8A 4J86A 5FKSA 1JOFA 4A11B 5HE1B 2OVQB 2BBKH 1XIPA 4G56B 2XU7A 2O9KA 4CC9A 4U1EI 2QXVA 2H9NA 4YVDA 2YNNA 2EBSA 2H9LA 3EI1B 3EI2A 2J57G 4BH6A 4U7AA 5EM2A 5IJ8E 3JAMg 3I7HA 4JSVC 3OKWA 1NEXB 4PXWA 2AGZA 4JSNC 2IAAA 2CE8A 4GQBB 1B9XA 3ULEC 3I7OA 3IJ1A 4QL1A 4GGAA 3I8CA 5KDOB 3FRXA 4ZOZA 3AL9A 3EWEA 3BWSA 3MKSB 2YBAA 3PVUB 3AFCA 3CFSB 3JZGA 5CXBA 4FA1D 4L3HD 2J55H 3OL2A 5FLXg 4L1QD 3U4YA 4O9DA 5FKQA 2XYIA 3V9FA 3SBPA 3OKTA 5I5MA 4J0XA 2IUQA 1K32A 2J56H 2P9PC 5EMMB 3I7KA 3JPXA 5TDHB 3IIYA 4I79A 5SXMA 4FB1D 4Y5RD 4JSPC 5IGQA 3DXKC 4K3ID 3SVWD 5HE3B 3L4MD 2Q7QA 4BL0A 4A08A 2PBIB 4GGDA 3OW8A 5FA5B 3DXMC 4A0BB 4X60B 1QNIA 2IUPA 5I5IA 3F3GA 3JZHA 2P9NC 1TBGA 3SCYA 3DSMA 2H68A 2CNXA 2AGXA 2B5LA 4CI1A 5H1MA 2H9MA 4CY5A 3I7NA 5K19A 3RFHA 4CZVA 5K1CC 3DM0A 2H9PA 5CXBB 2IWFA 2AGWA 2HYEA 5H17A 3OTTA 3EU7A 3EMHA 2PM7B 1MG2A 1MG3A 4XYIA 4QT8A 3BG0A 4PSXB 1S4UX 4J84A 4QQEA 5EAMA 2I3TA 2I0SA 4L3GD 2MTAH 1GXRA 3I7PA 5EARA 2CN3A 5CXCB 3N0DA 2AH0A 2HXCA 1Q47A 3I89A 5GSAA 5C2VB 5GXIA 5IGOA 3MMYA 2IURA 3CIKB 3SFZA 4PNKB 5GMKn 3MZLA 4JT5C 3UKRC 5C9ZB 4FA5D 5I5JA 4J8BA 3SBQA 4Z8LA 2HKMA 3MXXA 5HE2B 4ESGA 2AGYA 4CI2A 3RRMC 1N6FA 1SHYB 3N0EA 2CE9A 2Z2PA 5CYKA 2BCJB 2CO0A 2YB8B 4GQ1A 4L9OA 2H6NA 4GZ8A 4FAND 1XHMA 3V5WB 2P9UC 4R7AB 4X61B 3RN0D 4IA9A 4ZOYA 1ERJA 2B5NA 1N6DA 5JWZA 3KRXB 3EI1A 2GC7A 2I0TA 2Z2OA 4GQ2P 4X63B 3GFCA 3JZNA 3AH8B 1P22A 2HKRA 5CYKB 5FQDA 2W18A 2IUVA 1N6EA 4A0AA 4FA9D 3ZWLB 4XEIC 4A11A 3UVOA 3IKOA 2CO0C 4XYHA 1JJUB 4J82A 4A0BA 2PM9B 3HFQA 3EI3B 3B7FA 4ZOXA 2I0RA 5TEEA 4NSXA 2YNPA 3RSEC 3EI2B 3ORVD 4J81A 3PXWD 4TZ4A 4H5IA 4CZXA 4JXMA 4J77A 4JD2C 4O1QD 2HJ4A 4LG9A 5HQGA 2HJBA 2OVRB 4PBZA 1K8KC 1PBYB 4E5ZA 4GMBA 4J79A 3EI4B 1GOTB 3A0FA 4UI9R 2GNQA 3I2NA 4CY3A 1U2VC 2H3XA 3V7DB 5FXYA 3PXSD 4GM3A 4CI3A 5H14A 4GM9A 3PE7A 4J87A 3SN6B 3I8EA 3SBRA 2G99A 3JB9L 1SQJA 3UVNA 1XKSA 3IJCA 3UR4A 1PGUA 2H6QA 3ODTA 4CI8A 5THAA 3FGBA 4A2LA 1PEVA 1RI6A 2GC4A 4LG8A 4O3UB 3AL8A 3PSCB 4FA4D 3VGZA 2YMUA 3UVKA 3NVXA 4OZUA 3OKYB 2P9LC 4E5ZB 3NVNA 3DWLC 3L4OD 5EALA 2AGLA 5EM2B 4BUJC 5GXHA 3RMZD 1JMZB 3BG1A 4D0KA 2YNOA 3JROA 4KFMB 4ZN4A 4E54B 4QRJA 1FWXA 2PM6B 4LGNA 4J73A 4N14A 4ERQA 3SXTD 5AFU3 4K3JB 1B9YA 2OJYA 5TF2A 3SMRA 2PM9A 2CN2A 5IJ7E 3EG6A 1TYQC 4ZOVA 4J8GA 4A09B 3MKQA 3J81g 3IJ0A 4D6VA 5EMLB 1YFQA 2H13A 2Z2NA 3AL8B 3P4FA 4A2MA 4OWRA 3K26A 4CY1A 3UVMA 2QC5A 3PVWB 4ERZA 2UZYB 3C75H 5EMJB 3NVQA 1GG2B 4A08B 5IC7A 4PBYA 4ERYA 2B5MA 4EWRA 4IMMA 1OLZA 5FKRA 3W15A 2OK6A 3IIWA 4PC0A 3F3PA 2UZXB 4JT6C 5CXCA 3SLED 3UKUC 4FAVD 2XL3A 3VA6A 4MK0B 1SQ9A 4CZYA 1NR0A 3C5MA 2P9IC 5AMSA
chains in the Genus database with same CATH superfamily
1OMWB 3SJLD 3J80g 5HE0B 1L0QA 1JMXB 1VYHC 2B4EA 4O45A 3K71A 5B4WA 2I3SA 4A7JA 4MMXA 4DNWA 4FWWA 1U4CA 1MDAH 4J0WA 1TYEA 2TRCB 3EI3A 2IWKA 2OIZA 2HESX 3EI4A 3IULA 3JRPA 1GP2B 3PSLA 4CY2A 4PSWB 1M1XA 5E6SA 1PI6A 4G55A 4RE5A 3F3FA 4A0AB 5FKTA 2P9KC 4GGCA 2OVPB 5EMKB 5TEFA 3EQ7A 4NENA 3GREA 4O02A 2HU7A 1VE7A 2XL2A 3VH0A 4H5JA 2H47A 3FM0A 2P9SC 4ES0A 3SHFA 4G1MA 3C99A 3IVMA 4FHLA 5HYNB 4O3TB 2OK4A 4A09A 3I7LA 3RFGA 5IT9g 3E0CA 2AQ5A 4J78A 3OKYA 3RN1D 3OF7A 3UVLA 3FCUA 5EAPA 3SWSD 4JSXC 3O4JA 1A0RB 2AH1A 3ZE2A 4AEZA 4E54A 3KRWB 2H14A 4X3EA 4AOWA 3K27A 1U8CA 3CFVA 1VZ2A 3C9CA 3QHYB 3RLMD 2H6KA 4Y7RA 3MZKA 4HDJA 5C2WB 4Z7OA 3VI3A 1R5MA 3OL2B 5A2Qg 5AJAA 3PXTD 2VZ1A 3QI0A 2G9AA 5E6UA 4GM8A 4J86A 5FKSA 1JOFA 4A11B 5HE1B 2OVQB 1UOPA 2BBKH 1XIPA 4G56B 4RE6A 3FCSA 2XU7A 2O9KA 4CC9A 1A12A 1O6FA 3IJEA 4U1EI 3NIFA 2QXVA 1H2XA 4NAAA 2H9NA 4YVDA 2YNNA 4MMYA 2EBSA 2H9LA 3EI1B 3EI2A 4O2WA 2J57G 4BH6A 2VDNA 4U7AA 5EM2A 5IJ8E 3JAMg 3I7HA 3K6SA 4JSVC 4QAMA 3OKWA 1NEXB 3ZE0A 4PXWA 2AGZA 4JSNC 2IAAA 2HU8A 2CE8A 1QFMA 4GQBB 1B9XA 1C9IA 3ULEC 3I7OA 3IJ1A 4QL1A 3EQ9A 4GGAA 1QFSA 3I8CA 5KDOB 3FRXA 4ZOZA 3AL9A 3EWEA 3BWSA 3MKSB 2YBAA 3PVUB 3AFCA 1JTDB 3CFSB 3JZGA 5CXBA 4FA1D 4L3HD 2J55H 3OL2A 4AN1A 5FLXg 4L1QD 3U4YA 5C92A 4O9DA 5FKQA 1GOFA 2XYIA 3V9FA 2VDLA 3SBPA 4L1MA 4D9SA 3OKTA 5E6RA 5I5MA 4J0XA 2IUQA 1K32A 2J56H 2P9PC 3GD1I 5EMMB 3I7KA 3IUNA 3JPXA 5TDHB 3IIYA 4I79A 5SXMA 4FB1D 1E8MA 4Y5RD 4JSPC 5FFGA 5IGQA 4Z7NA 3DXKC 4K3ID 5M5TA 1C9LA 3SVWD 5HE3B 3L4MD 2Q7QA 3NIGA 4BL0A 4A08A 2PBIB 4GGDA 3OW8A 5FA5B 1H2YA 5FFOA 3T3PA 3DXMC 4A0BB 3IUMA 3IUQA 4X60B 1QNIA 2IUPA 5I5IA 3F3GA 3JZHA 2P9NC 1TBGA 3SCYA 3DSMA 2H68A 2CNXA 3MVDK 2AGXA 2B5LA 4CI1A 4WK2A 4Z7QA 5H1MA 1GOHA 2H9MA 4CY5A 2VDKA 1UTCA 3I7NA 3RFHA 5K19A 4CZVA 2VDRA 5K1CC 3DM0A 2H9PA 5CXBB 2IWFA 2AGWA 3NIDA 2EICA 2HYEA 5H17A 1E5TA 3OTTA 4MMZA 1UOOA 3DDUA 3EU7A 3EMHA 2QR5A 2PM7B 2EIDA 2VDOA 1MG2A 1MG3A 4XYIA 4QT8A 2EIBA 3BG0A 2JKXA 4PSXB 4NC4A 1S4UX 4J84A 4QQEA 5EAMA 2I3TA 2I0SA 2HU5A 2MTAH 4L3GD 1GXRA 3I7PA 2XZGA 5EARA 4AX4A 2CN3A 1BPOA 4WK4A 5CXCB 3N0DA 1UOQA 2AH0A 2HXCA 1Q47A 4BCCA 3I89A 5GSAA 4IRZA 5C2VB 5GXIA 5IGOA 3MMYA 4JHNA 2IURA 3CIKB 2VC2A 3SFZA 2WQ8A 4PNKB 5GMKn 3MZLA 4JT5C 3UKRC 5C9ZB 5M61A 4FA5D 5I5JA 4J8BA 3SBQA 4Z8LA 2HKMA 3MXXA 3KCIA 5HE2B 4ESGA 5M5RA 2AGYA 3ZDXA 4CI2A 3RRMC 3O4GA 1N6FA 1GOGA 1SHYB 3N0EA 2CE9A 4AN0A 2Z2PA 5CYKA 1H2WA 2BCJB 2CO0A 2YB8B 4GQ1A 2H6NA 4GZ8A 4L9OA 4DNVA 4FAND 1XHMA 3V5WB 1H2ZA 2P9UC 3O4HA 4R7AB 4X61B 4WK0A 4BCBA 3RN0D 4IA9A 4ZOYA 1ERJA 4G1EA 1N6DA 2B5NA 5JWZA 1VE6A 3KRXB 3EI1A 2GC7A 1YR2A 2I0TA 2Z2OA 4GQ2P 4X63B 3GFCA 3JZNA 3AH8B 1P22A 2HKRA 5CYKB 5FQDA 2W18A 2VZ3A 3GC3B 2EIEA 2IUVA 1N6EA 4A0AA 4FA9D 4AMZA 3ZWLB 4XEIC 4A11A 2VDPA 3UVOA 3IKOA 2CO0C 4XYHA 1JJUB 4J82A 4A0BA 2PM9B 3HFQA 3EI3B 3B7FA 4ZOXA 2I0RA 3ZDZA 5TEEA 4NSXA 2YNPA 3RSEC 3EI2B 3ORVD 4J81A 3PXWD 4TZ4A 4H5IA 4CZXA 4JXMA 4J77A 4JD2C 4O1QD 2HJ4A 4LG9A 3IUJA 5HQGA 2HJBA 2OVRB 4PBZA 1K8KC 1PBYB 4E5ZA 4GMBA 4J79A 3EI4B 1GOTB 3A0FA 4UI9R 2GNQA 3I2NA 4CY3A 1U2VC 4UM8A 2H3XA 3V7DB 3V4VA 5FXYA 3PXSD 4GM3A 4CI3A 5H14A 4GM9A 3PE7A 2VDMA 4J87A 1T2XA 3K72A 3I8EA 3SN6B 3SBRA 2BKLA 2G99A 3JB9L 1SQJA 2VDQA 3UVNA 1XKSA 3IJCA 4JHPC 3UR4A 1PGUA 2H6QA 3ODTA 4CI8A 5THAA 3FGBA 4A2LA 1PEVA 1RI6A 2GC4A 4LG8A 4O3UB 3AL8A 3EQ8A 3PSCB 4FA4D 3VGZA 1O6GA 2YMUA 3UVKA 3NVXA 3ZE1A 4OZUA 3OKYB 2XE4A 2P9LC 4E5ZB 3NVNA 3DWLC 3L4OD 4AMYA 5EALA 2AGLA 4NBMA 5EM2B 4BUJC 5GXHA 3RMZD 3MUOA 5HDBA 5M5SA 1I2MB 1JMZB 3BG1A 4D0KA 2YNOA 3JROA 4KFMB 4ZN4A 4E54B 4QRJA 1FWXA 2PM6B 4LGNA 4J73A 4N14A 4ERQA 3SXTD 3O4IA 5AFU3 4K3JB 4BCDA 1B9YA 2QZPA 2OJYA 5TF2A 3SMRA 2PM9A 2CN2A 1JV2A 3EG6A 3MUNA 5IJ7E 3VI4A 3ZDYA 1TYQC 4DNUA 4ZOVA 1L5GA 2XDWA 4J8GA 4A09B 3MKQA 3J81g 3IJ0A 4D6VA 5EMLB 1YFQA 2H13A 4BP8A 2Z2NA 3AL8B 3P4FA 4A2MA 4OWRA 4BP9A 3K26A 4CY1A 3UVMA 2QC5A 3PVWB 4ERZA 2UZYB 3C75H 3V4PA 5EMJB 3NVQA 1GG2B 5C86A 5IC7A 4A08B 4PBYA 4ERYA 1K3IA 2B5MA 4EWRA 4IMMA 1OLZA 5FKRA 4UM9A 3T3MA 3W15A 5M5VA 2OK6A 3IIWA 1E8NA 4PC0A 3F3PA 2UZXB 4JT6C 5CXCA 3SLED 3UKUC 4FAVD 3IURA 2XL3A 3VA6A 4MK0B 1SQ9A 1VZ3A 4CZYA 1NR0A 3C5MA 2P9IC 5AMSA 4WJKA 5M5UA
chains in the Genus database with same CATH topology
1OMWB 3SJLD 3J80g 5HE0B 1L0QA 1JMXB 1VYHC 2B4EA 4O45A 5B4WA 2I3SA 4A7JA 4FWWA 1U4CA 1MDAH 4J0WA 2TRCB 3EI3A 2IWKA 2OIZA 2HESX 3EI4A 3JRPA 1GP2B 3PSLA 4CY2A 4PSWB 1PI6A 3F3FA 4A0AB 5FKTA 2P9KC 4GGCA 2OVPB 5EMKB 5TEFA 3GREA 2XL2A 3VH0A 4H5JA 2H47A 3FM0A 2P9SC 4ES0A 3SHFA 3C99A 4FHLA 5HYNB 4O3TB 2OK4A 4A09A 3I7LA 3RFGA 5IT9g 3E0CA 2AQ5A 4J78A 3OKYA 3RN1D 3UVLA 5EAPA 3SWSD 4JSXC 1A0RB 2AH1A 4AEZA 4E54A 3KRWB 2H14A 4X3EA 4AOWA 3K27A 3CFVA 3C9CA 3RLMD 2H6KA 4Y7RA 3MZKA 4HDJA 5C2WB 1R5MA 3OL2B 5A2Qg 5AJAA 3PXTD 2G9AA 4GM8A 4J86A 5FKSA 1JOFA 4A11B 5HE1B 2OVQB 2BBKH 1XIPA 4G56B 2XU7A 2O9KA 4CC9A 4U1EI 2QXVA 2H9NA 4YVDA 2YNNA 2EBSA 2H9LA 3EI1B 3EI2A 2J57G 4BH6A 4U7AA 5EM2A 5IJ8E 3JAMg 3I7HA 4JSVC 3OKWA 1NEXB 4PXWA 2AGZA 4JSNC 2IAAA 2CE8A 4GQBB 1B9XA 3ULEC 3I7OA 3IJ1A 4QL1A 4GGAA 3I8CA 5KDOB 3FRXA 4ZOZA 3AL9A 3EWEA 3BWSA 3MKSB 2YBAA 3PVUB 3AFCA 3CFSB 3JZGA 5CXBA 4FA1D 4L3HD 2J55H 3OL2A 5FLXg 4L1QD 3U4YA 4O9DA 5FKQA 2XYIA 3V9FA 3SBPA 3OKTA 5I5MA 4J0XA 2IUQA 1K32A 2J56H 2P9PC 5EMMB 3I7KA 3JPXA 5TDHB 3IIYA 4I79A 5SXMA 4FB1D 4Y5RD 4JSPC 5IGQA 3DXKC 4K3ID 3SVWD 5HE3B 3L4MD 2Q7QA 4BL0A 4A08A 2PBIB 4GGDA 3OW8A 5FA5B 3DXMC 4A0BB 4X60B 1QNIA 2IUPA 5I5IA 3F3GA 3JZHA 2P9NC 1TBGA 3SCYA 3DSMA 2H68A 2CNXA 2AGXA 2B5LA 4CI1A 5H1MA 2H9MA 4CY5A 3I7NA 5K19A 3RFHA 4CZVA 5K1CC 3DM0A 2H9PA 5CXBB 2IWFA 2AGWA 2HYEA 5H17A 3OTTA 3EU7A 3EMHA 2PM7B 1MG2A 1MG3A 4XYIA 4QT8A 3BG0A 4PSXB 1S4UX 4J84A 4QQEA 5EAMA 2I3TA 2I0SA 4L3GD 2MTAH 1GXRA 3I7PA 5EARA 2CN3A 5CXCB 3N0DA 2AH0A 2HXCA 1Q47A 3I89A 5GSAA 5C2VB 5GXIA 5IGOA 3MMYA 2IURA 3CIKB 3SFZA 4PNKB 5GMKn 3MZLA 4JT5C 3UKRC 5C9ZB 4FA5D 5I5JA 4J8BA 3SBQA 4Z8LA 2HKMA 3MXXA 5HE2B 4ESGA 2AGYA 4CI2A 3RRMC 1N6FA 1SHYB 3N0EA 2CE9A 2Z2PA 5CYKA 2BCJB 2CO0A 2YB8B 4GQ1A 4L9OA 2H6NA 4GZ8A 4FAND 1XHMA 3V5WB 2P9UC 4R7AB 4X61B 3RN0D 4IA9A 4ZOYA 1ERJA 2B5NA 1N6DA 5JWZA 3KRXB 3EI1A 2GC7A 2I0TA 2Z2OA 4GQ2P 4X63B 3GFCA 3JZNA 3AH8B 1P22A 2HKRA 5CYKB 5FQDA 2W18A 2IUVA 1N6EA 4A0AA 4FA9D 3ZWLB 4XEIC 4A11A 3UVOA 3IKOA 2CO0C 4XYHA 1JJUB 4J82A 4A0BA 2PM9B 3HFQA 3EI3B 3B7FA 4ZOXA 2I0RA 5TEEA 4NSXA 2YNPA 3RSEC 3EI2B 3ORVD 4J81A 3PXWD 4TZ4A 4H5IA 4CZXA 4JXMA 4J77A 4JD2C 4O1QD 2HJ4A 4LG9A 5HQGA 2HJBA 2OVRB 4PBZA 1K8KC 1PBYB 4E5ZA 4GMBA 4J79A 3EI4B 1GOTB 3A0FA 4UI9R 2GNQA 3I2NA 4CY3A 1U2VC 2H3XA 3V7DB 5FXYA 3PXSD 4GM3A 4CI3A 5H14A 4GM9A 3PE7A 4J87A 3SN6B 3I8EA 3SBRA 2G99A 3JB9L 1SQJA 3UVNA 1XKSA 3IJCA 3UR4A 1PGUA 2H6QA 3ODTA 4CI8A 5THAA 3FGBA 4A2LA 1PEVA 1RI6A 2GC4A 4LG8A 4O3UB 3AL8A 3PSCB 4FA4D 3VGZA 2YMUA 3UVKA 3NVXA 4OZUA 3OKYB 2P9LC 4E5ZB 3NVNA 3DWLC 3L4OD 5EALA 2AGLA 5EM2B 4BUJC 5GXHA 3RMZD 1JMZB 3BG1A 4D0KA 2YNOA 3JROA 4KFMB 4ZN4A 4E54B 4QRJA 1FWXA 2PM6B 4LGNA 4J73A 4N14A 4ERQA 3SXTD 5AFU3 4K3JB 1B9YA 2OJYA 5TF2A 3SMRA 2PM9A 2CN2A 5IJ7E 3EG6A 1TYQC 4ZOVA 4J8GA 4A09B 3MKQA 3J81g 3IJ0A 4D6VA 5EMLB 1YFQA 2H13A 2Z2NA 3AL8B 3P4FA 4A2MA 4OWRA 3K26A 4CY1A 3UVMA 2QC5A 3PVWB 4ERZA 2UZYB 3C75H 5EMJB 3NVQA 1GG2B 4A08B 5IC7A 4PBYA 4ERYA 2B5MA 4EWRA 4IMMA 1OLZA 5FKRA 3W15A 2OK6A 3IIWA 4PC0A 3F3PA 2UZXB 4JT6C 5CXCA 3SLED 3UKUC 4FAVD 2XL3A 3VA6A 4MK0B 1SQ9A 4CZYA 1NR0A 3C5MA 2P9IC 5AMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OMW B;  3SJL D;  3J80 g;  5HE0 B;  1L0Q A;  1JMX B;  1VYH C;  2B4E A;  4O45 A;  5B4W A;  2I3S A;  4A7J A;  4FWW A;  1U4C A;  1MDA H;  4J0W A;  2TRC B;  3EI3 A;  2IWK A;  2OIZ A;  2HES X;  3EI4 A;  3JRP A;  1GP2 B;  3PSL A;  4CY2 A;  4PSW B;  1PI6 A;  3F3F A;  4A0A B;  5FKT A;  2P9K C;  4GGC A;  2OVP B;  5EMK B;  5TEF A;  3GRE A;  2XL2 A;  3VH0 A;  4H5J A;  2H47 A;  3FM0 A;  2P9S C;  4ES0 A;  3SHF A;  3C99 A;  4FHL A;  5HYN B;  4O3T B;  2OK4 A;  4A09 A;  3I7L A;  3RFG A;  5IT9 g;  3E0C A;  2AQ5 A;  4J78 A;  3OKY A;  3RN1 D;  3UVL A;  5EAP A;  3SWS D;  4JSX C;  1A0R B;  2AH1 A;  4AEZ A;  4E54 A;  3KRW B;  2H14 A;  4X3E A;  4AOW A;  3K27 A;  3CFV A;  3C9C A;  3RLM D;  2H6K A;  4Y7R A;  3MZK A;  4HDJ A;  5C2W B;  1R5M A;  3OL2 B;  5A2Q g;  5AJA A;  3PXT D;  2G9A A;  4GM8 A;  4J86 A;  5FKS A;  1JOF A;  4A11 B;  5HE1 B;  2OVQ B;  2BBK H;  1XIP A;  4G56 B;  2XU7 A;  2O9K A;  4CC9 A;  4U1E I;  2QXV A;  2H9N A;  4YVD A;  2YNN A;  2EBS A;  2H9L A;  3EI1 B;  3EI2 A;  2J57 G;  4BH6 A;  4U7A A;  5EM2 A;  5IJ8 E;  3JAM g;  3I7H A;  4JSV C;  3OKW A;  1NEX B;  4PXW A;  2AGZ A;  4JSN C;  2IAA A;  2CE8 A;  4GQB B;  1B9X A;  3ULE C;  3I7O A;  3IJ1 A;  4QL1 A;  4GGA A;  3I8C A;  5KDO B;  3FRX A;  4ZOZ A;  3AL9 A;  3EWE A;  3BWS A;  3MKS B;  2YBA A;  3PVU B;  3AFC A;  3CFS B;  3JZG A;  5CXB A;  4FA1 D;  4L3H D;  2J55 H;  3OL2 A;  5FLX g;  4L1Q D;  3U4Y A;  4O9D A;  5FKQ A;  2XYI A;  3V9F A;  3SBP A;  3OKT A;  5I5M A;  4J0X A;  2IUQ A;  1K32 A;  2J56 H;  2P9P C;  5EMM B;  3I7K A;  3JPX A;  5TDH B;  3IIY A;  4I79 A;  5SXM A;  4FB1 D;  4Y5R D;  4JSP C;  5IGQ A;  3DXK C;  4K3I D;  3SVW D;  5HE3 B;  3L4M D;  2Q7Q A;  4BL0 A;  4A08 A;  2PBI B;  4GGD A;  3OW8 A;  5FA5 B;  3DXM C;  4A0B B;  4X60 B;  1QNI A;  2IUP A;  5I5I A;  3F3G A;  3JZH A;  2P9N C;  1TBG A;  3SCY A;  3DSM A;  2H68 A;  2CNX A;  2AGX A;  2B5L A;  4CI1 A;  5H1M A;  2H9M A;  4CY5 A;  3I7N A;  5K19 A;  3RFH A;  4CZV A;  5K1C C;  3DM0 A;  2H9P A;  5CXB B;  2IWF A;  2AGW A;  2HYE A;  5H17 A;  3OTT A;  3EU7 A;  3EMH A;  2PM7 B;  1MG2 A;  1MG3 A;  4XYI A;  4QT8 A;  3BG0 A;  4PSX B;  1S4U X;  4J84 A;  4QQE A;  5EAM A;  2I3T A;  2I0S A;  4L3G D;  2MTA H;  1GXR A;  3I7P A;  5EAR A;  2CN3 A;  5CXC B;  3N0D A;  2AH0 A;  2HXC A;  1Q47 A;  3I89 A;  5GSA A;  5C2V B;  5GXI A;  5IGO A;  3MMY A;  2IUR A;  3CIK B;  3SFZ A;  4PNK B;  5GMK n;  3MZL A;  4JT5 C;  3UKR C;  5C9Z B;  4FA5 D;  5I5J A;  4J8B A;  3SBQ A;  4Z8L A;  2HKM A;  3MXX A;  5HE2 B;  4ESG A;  2AGY A;  4CI2 A;  3RRM C;  1N6F A;  1SHY B;  3N0E A;  2CE9 A;  2Z2P A;  5CYK A;  2BCJ B;  2CO0 A;  2YB8 B;  4GQ1 A;  4L9O A;  2H6N A;  4GZ8 A;  4FAN D;  1XHM A;  3V5W B;  2P9U C;  4R7A B;  4X61 B;  3RN0 D;  4IA9 A;  4ZOY A;  1ERJ A;  2B5N A;  1N6D A;  5JWZ A;  3KRX B;  3EI1 A;  2GC7 A;  2I0T A;  2Z2O A;  4GQ2 P;  4X63 B;  3GFC A;  3JZN A;  3AH8 B;  1P22 A;  2HKR A;  5CYK B;  5FQD A;  2W18 A;  2IUV A;  1N6E A;  4A0A A;  4FA9 D;  3ZWL B;  4XEI C;  4A11 A;  3UVO A;  3IKO A;  2CO0 C;  4XYH A;  1JJU B;  4J82 A;  4A0B A;  2PM9 B;  3HFQ A;  3EI3 B;  3B7F A;  4ZOX A;  2I0R A;  5TEE A;  4NSX A;  2YNP A;  3RSE C;  3EI2 B;  3ORV D;  4J81 A;  3PXW D;  4TZ4 A;  4H5I A;  4CZX A;  4JXM A;  4J77 A;  4JD2 C;  4O1Q D;  2HJ4 A;  4LG9 A;  5HQG A;  2HJB A;  2OVR B;  4PBZ A;  1K8K C;  1PBY B;  4E5Z A;  4GMB A;  4J79 A;  3EI4 B;  1GOT B;  3A0F A;  4UI9 R;  2GNQ A;  3I2N A;  4CY3 A;  1U2V C;  2H3X A;  3V7D B;  5FXY A;  3PXS D;  4GM3 A;  4CI3 A;  5H14 A;  4GM9 A;  3PE7 A;  4J87 A;  3SN6 B;  3I8E A;  3SBR A;  2G99 A;  3JB9 L;  1SQJ A;  3UVN A;  1XKS A;  3IJC A;  3UR4 A;  1PGU A;  2H6Q A;  3ODT A;  4CI8 A;  5THA A;  3FGB A;  4A2L A;  1PEV A;  1RI6 A;  2GC4 A;  4LG8 A;  4O3U B;  3AL8 A;  3PSC B;  4FA4 D;  3VGZ A;  2YMU A;  3UVK A;  3NVX A;  4OZU A;  3OKY B;  2P9L C;  4E5Z B;  3NVN A;  3DWL C;  3L4O D;  5EAL A;  2AGL A;  5EM2 B;  4BUJ C;  5GXH A;  3RMZ D;  1JMZ B;  3BG1 A;  4D0K A;  2YNO A;  3JRO A;  4KFM B;  4ZN4 A;  4E54 B;  4QRJ A;  1FWX A;  2PM6 B;  4LGN A;  4J73 A;  4N14 A;  4ERQ A;  3SXT D;  5AFU 3;  4K3J B;  1B9Y A;  2OJY A;  5TF2 A;  3SMR A;  2PM9 A;  2CN2 A;  5IJ7 E;  3EG6 A;  1TYQ C;  4ZOV A;  4J8G A;  4A09 B;  3MKQ A;  3J81 g;  3IJ0 A;  4D6V A;  5EML B;  1YFQ A;  2H13 A;  2Z2N A;  3AL8 B;  3P4F A;  4A2M A;  4OWR A;  3K26 A;  4CY1 A;  3UVM A;  2QC5 A;  3PVW B;  4ERZ A;  2UZY B;  3C75 H;  5EMJ B;  3NVQ A;  1GG2 B;  4A08 B;  5IC7 A;  4PBY A;  4ERY A;  2B5M A;  4EWR A;  4IMM A;  1OLZ A;  5FKR A;  3W15 A;  2OK6 A;  3IIW A;  4PC0 A;  3F3P A;  2UZX B;  4JT6 C;  5CXC A;  3SLE D;  3UKU C;  4FAV D;  2XL3 A;  3VA6 A;  4MK0 B;  1SQ9 A;  4CZY A;  1NR0 A;  3C5M A;  2P9I C;  5AMS A; 
#chains in the Genus database with same CATH topology
 1OMW B;  3SJL D;  3J80 g;  5HE0 B;  1L0Q A;  1JMX B;  1VYH C;  2B4E A;  4O45 A;  3K71 A;  5B4W A;  2I3S A;  4A7J A;  4MMX A;  4DNW A;  4FWW A;  1U4C A;  1MDA H;  4J0W A;  1TYE A;  2TRC B;  3EI3 A;  2IWK A;  2OIZ A;  2HES X;  3EI4 A;  3IUL A;  3JRP A;  1GP2 B;  3PSL A;  4CY2 A;  4PSW B;  1M1X A;  5E6S A;  1PI6 A;  4G55 A;  4RE5 A;  3F3F A;  4A0A B;  5FKT A;  2P9K C;  4GGC A;  2OVP B;  5EMK B;  5TEF A;  3EQ7 A;  4NEN A;  3GRE A;  4O02 A;  2HU7 A;  1VE7 A;  2XL2 A;  3VH0 A;  4H5J A;  2H47 A;  3FM0 A;  2P9S C;  4ES0 A;  3SHF A;  4G1M A;  3C99 A;  3IVM A;  4FHL A;  5HYN B;  4O3T B;  2OK4 A;  4A09 A;  3I7L A;  3RFG A;  5IT9 g;  3E0C A;  2AQ5 A;  4J78 A;  3OKY A;  3RN1 D;  3OF7 A;  3UVL A;  3FCU A;  5EAP A;  3SWS D;  4JSX C;  3O4J A;  1A0R B;  2AH1 A;  3ZE2 A;  4AEZ A;  4E54 A;  3KRW B;  2H14 A;  4X3E A;  4AOW A;  3K27 A;  1U8C A;  3CFV A;  1VZ2 A;  3C9C A;  3QHY B;  3RLM D;  2H6K A;  4Y7R A;  3MZK A;  4HDJ A;  5C2W B;  4Z7O A;  3VI3 A;  1R5M A;  3OL2 B;  5A2Q g;  5AJA A;  3PXT D;  2VZ1 A;  3QI0 A;  2G9A A;  5E6U A;  4GM8 A;  4J86 A;  5FKS A;  1JOF A;  4A11 B;  5HE1 B;  2OVQ B;  1UOP A;  2BBK H;  1XIP A;  4G56 B;  4RE6 A;  3FCS A;  2XU7 A;  2O9K A;  4CC9 A;  1A12 A;  1O6F A;  3IJE A;  4U1E I;  3NIF A;  2QXV A;  1H2X A;  4NAA A;  2H9N A;  4YVD A;  2YNN A;  4MMY A;  2EBS A;  2H9L A;  3EI1 B;  3EI2 A;  4O2W A;  2J57 G;  4BH6 A;  2VDN A;  4U7A A;  5EM2 A;  5IJ8 E;  3JAM g;  3I7H A;  3K6S A;  4JSV C;  4QAM A;  3OKW A;  1NEX B;  3ZE0 A;  4PXW A;  2AGZ A;  4JSN C;  2IAA A;  2HU8 A;  2CE8 A;  1QFM A;  4GQB B;  1B9X A;  1C9I A;  3ULE C;  3I7O A;  3IJ1 A;  4QL1 A;  3EQ9 A;  4GGA A;  1QFS A;  3I8C A;  5KDO B;  3FRX A;  4ZOZ A;  3AL9 A;  3EWE A;  3BWS A;  3MKS B;  2YBA A;  3PVU B;  3AFC A;  1JTD B;  3CFS B;  3JZG A;  5CXB A;  4FA1 D;  4L3H D;  2J55 H;  3OL2 A;  4AN1 A;  5FLX g;  4L1Q D;  3U4Y A;  5C92 A;  4O9D A;  5FKQ A;  1GOF A;  2XYI A;  3V9F A;  2VDL A;  3SBP A;  4L1M A;  4D9S A;  3OKT A;  5E6R A;  5I5M A;  4J0X A;  2IUQ A;  1K32 A;  2J56 H;  2P9P C;  3GD1 I;  5EMM B;  3I7K A;  3IUN A;  3JPX A;  5TDH B;  3IIY A;  4I79 A;  5SXM A;  4FB1 D;  1E8M A;  4Y5R D;  4JSP C;  5FFG A;  5IGQ A;  4Z7N A;  3DXK C;  4K3I D;  5M5T A;  1C9L A;  3SVW D;  5HE3 B;  3L4M D;  2Q7Q A;  3NIG A;  4BL0 A;  4A08 A;  2PBI B;  4GGD A;  3OW8 A;  5FA5 B;  1H2Y A;  5FFO A;  3T3P A;  3DXM C;  4A0B B;  3IUM A;  3IUQ A;  4X60 B;  1QNI A;  2IUP A;  5I5I A;  3F3G A;  3JZH A;  2P9N C;  1TBG A;  3SCY A;  3DSM A;  2H68 A;  2CNX A;  3MVD K;  2AGX A;  2B5L A;  4CI1 A;  4WK2 A;  4Z7Q A;  5H1M A;  1GOH A;  2H9M A;  4CY5 A;  2VDK A;  1UTC A;  3I7N A;  3RFH A;  5K19 A;  4CZV A;  2VDR A;  5K1C C;  3DM0 A;  2H9P A;  5CXB B;  2IWF A;  2AGW A;  3NID A;  2EIC A;  2HYE A;  5H17 A;  1E5T A;  3OTT A;  4MMZ A;  1UOO A;  3DDU A;  3EU7 A;  3EMH A;  2QR5 A;  2PM7 B;  2EID A;  2VDO A;  1MG2 A;  1MG3 A;  4XYI A;  4QT8 A;  2EIB A;  3BG0 A;  2JKX A;  4PSX B;  4NC4 A;  1S4U X;  4J84 A;  4QQE A;  5EAM A;  2I3T A;  2I0S A;  2HU5 A;  2MTA H;  4L3G D;  1GXR A;  3I7P A;  2XZG A;  5EAR A;  4AX4 A;  2CN3 A;  1BPO A;  4WK4 A;  5CXC B;  3N0D A;  1UOQ A;  2AH0 A;  2HXC A;  1Q47 A;  4BCC A;  3I89 A;  5GSA A;  4IRZ A;  5C2V B;  5GXI A;  5IGO A;  3MMY A;  4JHN A;  2IUR A;  3CIK B;  2VC2 A;  3SFZ A;  2WQ8 A;  4PNK B;  5GMK n;  3MZL A;  4JT5 C;  3UKR C;  5C9Z B;  5M61 A;  4FA5 D;  5I5J A;  4J8B A;  3SBQ A;  4Z8L A;  2HKM A;  3MXX A;  3KCI A;  5HE2 B;  4ESG A;  5M5R A;  2AGY A;  3ZDX A;  4CI2 A;  3RRM C;  3O4G A;  1N6F A;  1GOG A;  1SHY B;  3N0E A;  2CE9 A;  4AN0 A;  2Z2P A;  5CYK A;  1H2W A;  2BCJ B;  2CO0 A;  2YB8 B;  4GQ1 A;  2H6N A;  4GZ8 A;  4L9O A;  4DNV A;  4FAN D;  1XHM A;  3V5W B;  1H2Z A;  2P9U C;  3O4H A;  4R7A B;  4X61 B;  4WK0 A;  4BCB A;  3RN0 D;  4IA9 A;  4ZOY A;  1ERJ A;  4G1E A;  1N6D A;  2B5N A;  5JWZ A;  1VE6 A;  3KRX B;  3EI1 A;  2GC7 A;  1YR2 A;  2I0T A;  2Z2O A;  4GQ2 P;  4X63 B;  3GFC A;  3JZN A;  3AH8 B;  1P22 A;  2HKR A;  5CYK B;  5FQD A;  2W18 A;  2VZ3 A;  3GC3 B;  2EIE A;  2IUV A;  1N6E A;  4A0A A;  4FA9 D;  4AMZ A;  3ZWL B;  4XEI C;  4A11 A;  2VDP A;  3UVO A;  3IKO A;  2CO0 C;  4XYH A;  1JJU B;  4J82 A;  4A0B A;  2PM9 B;  3HFQ A;  3EI3 B;  3B7F A;  4ZOX A;  2I0R A;  3ZDZ A;  5TEE A;  4NSX A;  2YNP A;  3RSE C;  3EI2 B;  3ORV D;  4J81 A;  3PXW D;  4TZ4 A;  4H5I A;  4CZX A;  4JXM A;  4J77 A;  4JD2 C;  4O1Q D;  2HJ4 A;  4LG9 A;  3IUJ A;  5HQG A;  2HJB A;  2OVR B;  4PBZ A;  1K8K C;  1PBY B;  4E5Z A;  4GMB A;  4J79 A;  3EI4 B;  1GOT B;  3A0F A;  4UI9 R;  2GNQ A;  3I2N A;  4CY3 A;  1U2V C;  4UM8 A;  2H3X A;  3V7D B;  3V4V A;  5FXY A;  3PXS D;  4GM3 A;  4CI3 A;  5H14 A;  4GM9 A;  3PE7 A;  2VDM A;  4J87 A;  1T2X A;  3K72 A;  3I8E A;  3SN6 B;  3SBR A;  2BKL A;  2G99 A;  3JB9 L;  1SQJ A;  2VDQ A;  3UVN A;  1XKS A;  3IJC A;  4JHP C;  3UR4 A;  1PGU A;  2H6Q A;  3ODT A;  4CI8 A;  5THA A;  3FGB A;  4A2L A;  1PEV A;  1RI6 A;  2GC4 A;  4LG8 A;  4O3U B;  3AL8 A;  3EQ8 A;  3PSC B;  4FA4 D;  3VGZ A;  1O6G A;  2YMU A;  3UVK A;  3NVX A;  3ZE1 A;  4OZU A;  3OKY B;  2XE4 A;  2P9L C;  4E5Z B;  3NVN A;  3DWL C;  3L4O D;  4AMY A;  5EAL A;  2AGL A;  4NBM A;  5EM2 B;  4BUJ C;  5GXH A;  3RMZ D;  3MUO A;  5HDB A;  5M5S A;  1I2M B;  1JMZ B;  3BG1 A;  4D0K A;  2YNO A;  3JRO A;  4KFM B;  4ZN4 A;  4E54 B;  4QRJ A;  1FWX A;  2PM6 B;  4LGN A;  4J73 A;  4N14 A;  4ERQ A;  3SXT D;  3O4I A;  5AFU 3;  4K3J B;  4BCD A;  1B9Y A;  2QZP A;  2OJY A;  5TF2 A;  3SMR A;  2PM9 A;  2CN2 A;  1JV2 A;  3EG6 A;  3MUN A;  5IJ7 E;  3VI4 A;  3ZDY A;  1TYQ C;  4DNU A;  4ZOV A;  1L5G A;  2XDW A;  4J8G A;  4A09 B;  3MKQ A;  3J81 g;  3IJ0 A;  4D6V A;  5EML B;  1YFQ A;  2H13 A;  4BP8 A;  2Z2N A;  3AL8 B;  3P4F A;  4A2M A;  4OWR A;  4BP9 A;  3K26 A;  4CY1 A;  3UVM A;  2QC5 A;  3PVW B;  4ERZ A;  2UZY B;  3C75 H;  3V4P A;  5EMJ B;  3NVQ A;  1GG2 B;  5C86 A;  5IC7 A;  4A08 B;  4PBY A;  4ERY A;  1K3I A;  2B5M A;  4EWR A;  4IMM A;  1OLZ A;  5FKR A;  4UM9 A;  3T3M A;  3W15 A;  5M5V A;  2OK6 A;  3IIW A;  1E8N A;  4PC0 A;  3F3P A;  2UZX B;  4JT6 C;  5CXC A;  3SLE D;  3UKU C;  4FAV D;  3IUR A;  2XL3 A;  3VA6 A;  4MK0 B;  1SQ9 A;  1VZ3 A;  4CZY A;  1NR0 A;  3C5M A;  2P9I C;  5AMS A;  4WJK A;  5M5U A; 
#chains in the Genus database with same CATH homology
 1OMW B;  3SJL D;  3J80 g;  5HE0 B;  1L0Q A;  1JMX B;  1VYH C;  2B4E A;  4O45 A;  5B4W A;  2I3S A;  4A7J A;  4FWW A;  1U4C A;  1MDA H;  4J0W A;  2TRC B;  3EI3 A;  2IWK A;  2OIZ A;  2HES X;  3EI4 A;  3JRP A;  1GP2 B;  3PSL A;  4CY2 A;  4PSW B;  1PI6 A;  3F3F A;  4A0A B;  5FKT A;  2P9K C;  4GGC A;  2OVP B;  5EMK B;  5TEF A;  3GRE A;  2XL2 A;  3VH0 A;  4H5J A;  2H47 A;  3FM0 A;  2P9S C;  4ES0 A;  3SHF A;  3C99 A;  4FHL A;  5HYN B;  4O3T B;  2OK4 A;  4A09 A;  3I7L A;  3RFG A;  5IT9 g;  3E0C A;  2AQ5 A;  4J78 A;  3OKY A;  3RN1 D;  3UVL A;  5EAP A;  3SWS D;  4JSX C;  1A0R B;  2AH1 A;  4AEZ A;  4E54 A;  3KRW B;  2H14 A;  4X3E A;  4AOW A;  3K27 A;  3CFV A;  3C9C A;  3RLM D;  2H6K A;  4Y7R A;  3MZK A;  4HDJ A;  5C2W B;  1R5M A;  3OL2 B;  5A2Q g;  5AJA A;  3PXT D;  2G9A A;  4GM8 A;  4J86 A;  5FKS A;  1JOF A;  4A11 B;  5HE1 B;  2OVQ B;  2BBK H;  1XIP A;  4G56 B;  2XU7 A;  2O9K A;  4CC9 A;  4U1E I;  2QXV A;  2H9N A;  4YVD A;  2YNN A;  2EBS A;  2H9L A;  3EI1 B;  3EI2 A;  2J57 G;  4BH6 A;  4U7A A;  5EM2 A;  5IJ8 E;  3JAM g;  3I7H A;  4JSV C;  3OKW A;  1NEX B;  4PXW A;  2AGZ A;  4JSN C;  2IAA A;  2CE8 A;  4GQB B;  1B9X A;  3ULE C;  3I7O A;  3IJ1 A;  4QL1 A;  4GGA A;  3I8C A;  5KDO B;  3FRX A;  4ZOZ A;  3AL9 A;  3EWE A;  3BWS A;  3MKS B;  2YBA A;  3PVU B;  3AFC A;  3CFS B;  3JZG A;  5CXB A;  4FA1 D;  4L3H D;  2J55 H;  3OL2 A;  5FLX g;  4L1Q D;  3U4Y A;  4O9D A;  5FKQ A;  2XYI A;  3V9F A;  3SBP A;  3OKT A;  5I5M A;  4J0X A;  2IUQ A;  1K32 A;  2J56 H;  2P9P C;  5EMM B;  3I7K A;  3JPX A;  5TDH B;  3IIY A;  4I79 A;  5SXM A;  4FB1 D;  4Y5R D;  4JSP C;  5IGQ A;  3DXK C;  4K3I D;  3SVW D;  5HE3 B;  3L4M D;  2Q7Q A;  4BL0 A;  4A08 A;  2PBI B;  4GGD A;  3OW8 A;  5FA5 B;  3DXM C;  4A0B B;  4X60 B;  1QNI A;  2IUP A;  5I5I A;  3F3G A;  3JZH A;  2P9N C;  1TBG A;  3SCY A;  3DSM A;  2H68 A;  2CNX A;  2AGX A;  2B5L A;  4CI1 A;  5H1M A;  2H9M A;  4CY5 A;  3I7N A;  5K19 A;  3RFH A;  4CZV A;  5K1C C;  3DM0 A;  2H9P A;  5CXB B;  2IWF A;  2AGW A;  2HYE A;  5H17 A;  3OTT A;  3EU7 A;  3EMH A;  2PM7 B;  1MG2 A;  1MG3 A;  4XYI A;  4QT8 A;  3BG0 A;  4PSX B;  1S4U X;  4J84 A;  4QQE A;  5EAM A;  2I3T A;  2I0S A;  4L3G D;  2MTA H;  1GXR A;  3I7P A;  5EAR A;  2CN3 A;  5CXC B;  3N0D A;  2AH0 A;  2HXC A;  1Q47 A;  3I89 A;  5GSA A;  5C2V B;  5GXI A;  5IGO A;  3MMY A;  2IUR A;  3CIK B;  3SFZ A;  4PNK B;  5GMK n;  3MZL A;  4JT5 C;  3UKR C;  5C9Z B;  4FA5 D;  5I5J A;  4J8B A;  3SBQ A;  4Z8L A;  2HKM A;  3MXX A;  5HE2 B;  4ESG A;  2AGY A;  4CI2 A;  3RRM C;  1N6F A;  1SHY B;  3N0E A;  2CE9 A;  2Z2P A;  5CYK A;  2BCJ B;  2CO0 A;  2YB8 B;  4GQ1 A;  4L9O A;  2H6N A;  4GZ8 A;  4FAN D;  1XHM A;  3V5W B;  2P9U C;  4R7A B;  4X61 B;  3RN0 D;  4IA9 A;  4ZOY A;  1ERJ A;  2B5N A;  1N6D A;  5JWZ A;  3KRX B;  3EI1 A;  2GC7 A;  2I0T A;  2Z2O A;  4GQ2 P;  4X63 B;  3GFC A;  3JZN A;  3AH8 B;  1P22 A;  2HKR A;  5CYK B;  5FQD A;  2W18 A;  2IUV A;  1N6E A;  4A0A A;  4FA9 D;  3ZWL B;  4XEI C;  4A11 A;  3UVO A;  3IKO A;  2CO0 C;  4XYH A;  1JJU B;  4J82 A;  4A0B A;  2PM9 B;  3HFQ A;  3EI3 B;  3B7F A;  4ZOX A;  2I0R A;  5TEE A;  4NSX A;  2YNP A;  3RSE C;  3EI2 B;  3ORV D;  4J81 A;  3PXW D;  4TZ4 A;  4H5I A;  4CZX A;  4JXM A;  4J77 A;  4JD2 C;  4O1Q D;  2HJ4 A;  4LG9 A;  5HQG A;  2HJB A;  2OVR B;  4PBZ A;  1K8K C;  1PBY B;  4E5Z A;  4GMB A;  4J79 A;  3EI4 B;  1GOT B;  3A0F A;  4UI9 R;  2GNQ A;  3I2N A;  4CY3 A;  1U2V C;  2H3X A;  3V7D B;  5FXY A;  3PXS D;  4GM3 A;  4CI3 A;  5H14 A;  4GM9 A;  3PE7 A;  4J87 A;  3SN6 B;  3I8E A;  3SBR A;  2G99 A;  3JB9 L;  1SQJ A;  3UVN A;  1XKS A;  3IJC A;  3UR4 A;  1PGU A;  2H6Q A;  3ODT A;  4CI8 A;  5THA A;  3FGB A;  4A2L A;  1PEV A;  1RI6 A;  2GC4 A;  4LG8 A;  4O3U B;  3AL8 A;  3PSC B;  4FA4 D;  3VGZ A;  2YMU A;  3UVK A;  3NVX A;  4OZU A;  3OKY B;  2P9L C;  4E5Z B;  3NVN A;  3DWL C;  3L4O D;  5EAL A;  2AGL A;  5EM2 B;  4BUJ C;  5GXH A;  3RMZ D;  1JMZ B;  3BG1 A;  4D0K A;  2YNO A;  3JRO A;  4KFM B;  4ZN4 A;  4E54 B;  4QRJ A;  1FWX A;  2PM6 B;  4LGN A;  4J73 A;  4N14 A;  4ERQ A;  3SXT D;  5AFU 3;  4K3J B;  1B9Y A;  2OJY A;  5TF2 A;  3SMR A;  2PM9 A;  2CN2 A;  5IJ7 E;  3EG6 A;  1TYQ C;  4ZOV A;  4J8G A;  4A09 B;  3MKQ A;  3J81 g;  3IJ0 A;  4D6V A;  5EML B;  1YFQ A;  2H13 A;  2Z2N A;  3AL8 B;  3P4F A;  4A2M A;  4OWR A;  3K26 A;  4CY1 A;  3UVM A;  2QC5 A;  3PVW B;  4ERZ A;  2UZY B;  3C75 H;  5EMJ B;  3NVQ A;  1GG2 B;  4A08 B;  5IC7 A;  4PBY A;  4ERY A;  2B5M A;  4EWR A;  4IMM A;  1OLZ A;  5FKR A;  3W15 A;  2OK6 A;  3IIW A;  4PC0 A;  3F3P A;  2UZX B;  4JT6 C;  5CXC A;  3SLE D;  3UKU C;  4FAV D;  2XL3 A;  3VA6 A;  4MK0 B;  1SQ9 A;  4CZY A;  1NR0 A;  3C5M A;  2P9I C;  5AMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...