4QQRA

Structural insight into nucleotide rhamnose synthase/epimerase-reductase from arabidopsis thaliana
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
284
structure length
274
Chain Sequence
SFNFLIYGKTGWIGGLLGKLCEAQGITYTYGSGRLDRQSIVADIESVKPSHVFNAAGVTGRPNVDWCESHKVETIRTNVAGTLTLADICREKGLVLINYATGCIFEYDSGHPLGSGIGFKEEDTPNFTGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLTNPRNFITKIARYEKVVDIPNSMTILDELLPISIEMAKRNLTGIYNFTNPGVVSHNEILEMYRDYIDPSFTWKNFTEPRSNNELDATKLKTEFPELMSIKESLIKFVFEPNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3,5-epimerase/4-reductase
publication title Structural insight into nucleotide rhamnose synthase/epimerase-reductase from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 96
structure length 274
sequence length 284
chains with identical sequence B
ec nomenclature ec 1.1.1.133: dTDP-4-dehydrorhamnose reductase.
pdb deposition date 2014-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4qqrA00
3CZMA 1B3BA 4IDFA 4FPXA 4GMFA 1JAYA 4MVJG 5LDHA 5C37A 5U4QA 4WPGA 4PLYA 4R4JA 3CEAA 3JQ8A 4BNUA 3JQBC 2PGDA 2EJWA 5I7FA 1HF3A 4XQEA 3WG9A 5KKCA 3PGJA 3DDNA 3FPCA 5JBIA 4CM7A 5U1PA 4RPKA 4FIZA 3GVHA 4Y6RA 3HWRA 4EEZA 1V3UA 5CEEA 1YB1A 2NVBA 1F12A 4FFPA 3ZWXA 3H65A 4XRRA 1NAIA 3DAFA 3K92A 5G4KB 3IAHA 1B8VA 1SBYA 3DBRA 4II3A 3RIHA 2B5WA 2YDXA 4DLBA 1ZNQO 2FWMX 5JY1A 2C54A 3GQVA 4J1TA 3AU9A 4WK6A 4JBIA 4WLNA 3HDHA 3MCVA 4MVJM 2VRBA 2PNFA 1TT5A 4EI2A 3WGYA 1ENZA 1GL3A 4Q3NA 1ZSNA 5A5EA 5T6BA 4GVLA 4Y6PA 2VUSA 2P9GA 2VT3A 2QZZA 3L07A 1ZVMA 3ENNA 2B83A 4P8RA 4NQZA 3BHJA 1K5HA 5EL0A 4XIYA 3SX2A 5C3MA 2BRUA 4OM8A 2JCXA 4PIVA 3AUUA 1ZJZA 3WWYA 3ZHZA 5JE8A 1IB6A 1IE3A 2LDXA 4ID9A 5KVSA 4OKNA 4FJ1A 1LDMA 2XOXA 1YDEA 2Q4EA 3JQ7B 4E5KA 4YJGA 2RHCA 3VPGA 3A4VA 1GTMA 5A3VA 4QXMA 2BKAA 2R6JA 3BAZA 4OL9A 2WWRA 4OXKA 4J7XA 4DIFA 2YV1A 4FFLA 1R0SA 2W2LD 1LA2A 4DIBA 1QV6A 1XHLA 4DYVA 1I2CA 5JYEA 3PDJA 3G0OA 4RVFA 1HT0A 1A5ZA 2GZ1A 3L6DA 4R9RA 4CLXA 1YQDA 1WW8A 3Q9UA 3NTOA 2X9GA 3FNGA 3DBRB 1KVTA 1HE4A 3GGOA 1JDJA 2TMDA 3ULKA 2HMUA 2VUTA 2BLLA 3GGPA 2V6BA 1DIBA 2DAPA 2YW9A 3WDSA 1TT5B 3QHAA 1WMBA 2EKPA 5IN4A 3V5NA 3MWEB 4R1UA 5U9CA 4L0QA 4RPHA 3S2FA 3WB9A 1KC3A 3FTNA 1SNYA 5CG2A 2EV9A 3BMNA 1NQOA 1R6DA 3QWAA 4CMCA 4NH4A 4BNFA 5F3RA 3AY7A 3I9LA 1CETA 1E0DA 2DPGA 2VNAA 1DLIA 4CM5A 1UP6A 1PL7A 1SOWA 3PVZA 2VQ3A 2DUUA 2Y05A 3PJGA 2GR9A 4INAA 3DZIA 3RBXA 1DRUA 1HDYA 2C7GA 4HP8A 1E7SA 3C7AA 2ZIZA 2AE1A 3W8EA 1I2ZA 3GOHA 2FSSA 1VKOA 4BO5A 4BNIA 4IY1A 3NYWA 2AEJA 3UKOA 3DO5A 4N5NA 1BDBA 1MXHA 3I52A 1U2DA 3IDSA 5AVOA 3FN4A 2NU7A 3L4BA 3MOGA 5C7OO 1O0SA 5TNXA 2GRAA 4K28A 3I9OA 4TZTA 1XSEA 1LEHA 1Q2XA 1O5IA 4YT5A 3SBOA 4CMJA 2JFGA 2QG4A 2OMEA 2B69A 3G1TA 4FJ0A 1A71A 1C14A 2V6FA 4WJZA 1W8DA 4PG8A 2I66A 4E2ZA 7ADHA 2QQ5A 2WD7B 5DULA 2AA3A 1Z73A 2ZATA 1V3TA 4AVYA 3WGIA 1X0VA 4CMBA 3W8DA 3ZGYA 4TKLA 1RM0A 4S1VA 5DBGA 5H81A 5TF4A 1T4BA 4DBVO 5JO9A 3HB4X 5IN5A 4ALNA 5FF9A 4C4OA 3S8MA 2ZCVA 2BD0A 3DWFA 3BMNB 4IDDA 4R41A 4DPMA 4EUHA 2X9VA 1ISJA 1BRMA 4AICA 1G1AA 4R1TA 3WWZA 1Q0LA 1ORRA 3JQ9A 3ONDA 3W4KA 1A7AA 3GEGA 4D43A 1R15A 2JD1A 2VRCA 2WSBA 3AY6A 3E5MA 1EE9A 5I7VA 1EDOA 4J43A 1U8FO 4ALJA 4DVJA 1W6UA 5GZ3A 4EUFA 1XCBA 4RORA 3IJPA 1O8CA 1WZIA 2AEMA 3AI3A 2GN6A 4FGWA 3GDGA 3C7DB 3DBHA 4I5EA 4GX0A 1Q1NA 4K9DA 4UVDA 4D46A 5H83A 4ITUA 3K30A 1YOVA 1ZXLA 4WOKA 1NPTO 2IXBA 1JWAB 2GYYA 3KTDA 1BMDA 1F8FA 3H3JA 3OICA 3DXFA 2AW5A 4WCFC 5JDCA 3VH1A 5DCYA 1LQUA 1EFLA 4PN3A 2FR1A 5BSHA 2OHXA 3UFXA 3F1KA 4TSKA 2XXBA 3ZHBA 2I76A 5HWSA 3A9WA 1E7QA 4ZN6A 1HTBA 1SMKA 1B8UA 1SEPA 2OP0A 4KQXA 5T57A 3DAGA 1N7HA 5K0ZA 4OXNA 3M1AA 2PY6A 1EZ4A 2PH3A 3HHPA 3HFGA 4R5MA 4J90A 1Y8QA 1U9JA 3F9IA 4J0FA 1PGPA 5FI5A 3KO8A 2B4RO 2GASA 3D3EA 4HBGA 2VWHA 2BI7A 3H9JA 4K26A 4NPCA 1GUZA 3TL3A 4L4XA 4AL4A 3ZU4A 1BVRA 3WQRA 3X2FA 3NT4A 4NMHA 2GO1A 2WM3A 2HMTA 1PJCA 1BXKA 3B1JA 4I8XA 2JD0A 4IGEA 1KETA 3IKTA 3E9QA 2QX7A 3AOEA 1UZNA 3AY3A 3S2IA 1E3IA 1U4OA 3WBBA 3B1FA 1NQTA 3Q2IA 1A27A 4BNZA 1YQGA 4DLLA 1FJHA 2PTGA 4MKZA 3DBHB 3FRJA 4YJFA 3WSVA 4YT4A 2CVQA 2P91A 4HV4A 2B0JA 1E3SA 1H93A 5KWEA 1P1HA 1HL3A 2JHFA 3UW3A 2PD3A 2X8LA 4FN4A 4H16A 5BQFA 1YOVB 1BWSA 1EQ2A 3VZQA 2X5KO 4AJHA 1CEQA 4CMHA 1YBMA 3MZ0A 1VL6A 3UCEA 3ZHYA 2G1UA 3NGLA 2W4QA 3NT5A 1DAOA 4PG6A 1DDOA 2EHDA 1PL8A 3ZH2A 4L75A 5JAQA 2J5KA 3SEFA 4NI5A 3LQFA 1QYCA 4DLAA 3ON5A 1GUFA 1VJ0A 4XJSA 4CJXA 5JCJD 4BS9A 4BNWA 1EUDA 4M49A 4RGBA 1HE5A 3EGOA 4R1SA 4A26A 1YWGO 4IIUA 1H6DA 1PQPA 3I4FA 1XQ6A 4AJPA 5F1PA 1Y8QB 3DBVO 5KOIA 1B3RA 1LRJA 5FWNA 2ZB8A 1E6EA 1PZEA 3CXRA 1TI7A 3AI1A 2NQTA 1PZFA 1NPDA 3L6EA 5TS3A 5IDYA 1EBFA 3OF2A 3WTCA 4E6PA 4RVGA 2P5UA 4E33A 4L4SA 4MP3A 4RDHA 5TT1A 3A28A 2FN7A 1XU9A 2DKNA 5GZ6A 4OH1A 1I32A 2DFVA 2X0NA 3WICA 4U0KA 4HWKA 3VHRA 4AJ1A 1WP4A 4BKQA 2YHUA 4Z3KA 1HWYA 4GMGA 1YVEI 5JAZA 4J9UE 3R0IA 4FR5A 4YT8A 3JQEA 3GH3A 1RPNA 5A9SA 1PIWA 4EEXA 4YJFB 2PH5A 5F5LA 3PXXA 4YAGA 2Y0DA 1K6XA 4B4OA 4NFYA 5CAEA 3AU8A 2H5LA 2Q2WA 3NDJA 3PZRA 2DM6A 3RBVA 3PPIA 1ZMOA 3PIDA 5C7LO 8ADHA 1UDBA 1D3AA 3G17A 3I9KA 4RQTA 3TN7A 3WMXA 4ALMA 2NVWA 1NVTA 4KQWA 4MVJF 2J3JA 1R16A 3RFVA 1WLYA 4A03A 4JP2A 3TRIA 1X7HA 2GZ3A 3R3SA 4W6ZA 3RC7A 2PKRA 5T8KA 2WTBA 3ST7A 1PQUA 3G79A 3DR3A 4ZD6A 2VHVA 4IDGA 3QVTA 4XDZA 1H2HA 4TROA 2IDZA 2RH4A 2VYVA 1XLTA 2DLDA 4CQMD 3RC9A 2DBZA 2GERA 2HU2A 4B4UA 3QV1A 4WECA 3KM0A 4NJMA 4YRAA 1DB3A 1Y1PA 3IL2A 2GDZA 2JKVA 3NX4A 3QVWA 1R4NA 3S2GA 2SCUA 3FBGA 5ICSA 3SLGA 1Y5MA 5CDYA 1YL6A 2GN9A 3CH6A 4CV0A 3BMQA 4JCOA 1GDHA 2G17A 4EYEA 1UDCA 3JQGA 1TEHA 3FR7A 1ENOA 1LRKA 1E7RA 2HAEA 5ENDA 3IKVA 4RF5A 4A27A 1RM3A 3HQ4O 2AQ8A 1QORA 4ZRNA 5A04A 2I3AA 1P77A 4WKGA 5FI3A 2HK7A 3LT1A 4UVIA 5A9SB 3FHLA 1XELA 1H9AA 5F5NA 3KSZO 4E2YA 4YR9A 4UUNA 4YCAA 3NRCA 4JK3A 1PWXA 4L73A 3GY0A 3D4OA 1X13A 2YHIA 3KUXA 4O59O 4UREA 4RF4A 1K0UA 2I3GA 4BKUA 3LSYA 1KS9A 1BDMA 1MUUA 3INGA 4BNKA 2F00A 2VOJA 2AE2A 1ZO8A 2ZK7A 3OEYA 3DEYX 1ZZEA 4D3FA 5CDGA 3M6IA 1E1KA 3JSAA 5DOZA 2VHYA 2JD2A 4WLFA 4TQGA 5LCXA 3HB5X 4IZHA 1GV1A 1Q0QA 3IOYA 3OP4A 3H6KA 1DRWA 4IZIA 3QY9A 3AM5A 5I9MA 3HADA 4DUPA 1AHHA 1R4NB 1EUCA 1B14A 3RUFA 3IC5A 4XYBA 2YFQA 2LDBA 1M66A 4CR8A 5CG1A 1A4UA 2JAPA 1PJ2A 3AFMA 1A72A 2H1SA 3QIVA 2JJYA 5DF1A 4C7JA 2V65A 4CV1A 3ZWCA 5CEFA 3DHNA 2O3RA 1U5AA 4WGGA 3ZWWA 4B8ZA 2C20A 1ZK2A 4KP7A 4N7RA 3I9MA 1DHRA 2RBEA 4LW8A 1V8BA 1X0XA 4O6VA 2NV6A 1ISGA 2AQKA 3ONFA 1YDWA 1XG5A 4MVJD 5ER9A 3GPIA 3EC7A 1SCUA 1HDCA 3QW2A 4RPLA 1IL0A 4JJIA 5JC1A 3JQAA 1JKFA 1N8KA 2FRDA 4UAGA 3TOXA 1LC0A 1J6UA 3AK4A 5L7WA 2Q4BA 4RPJA 2BGLA 2CDCA 4YVFA 5KVCA 2AHRA 2YHIB 4AFNA 3D4NA 1S6YA 1PS8A 9LDTA 1O89A 1KVQA 1WDLA 3ADOA 4R3NA 3QWIA 4W99A 4K6FA 4B79A 2D5AA 1JKIA 4O63O 4OOFA 2VZ9A 3WQSB 2EGGA 2X9NA 4DMMA 5JLAA 1HYHA 2OOSA 3B70A 3E9NA 1LRLA 3ZV3A 3KVOA 4YXFA 3RFXA 3NDRA 1T2EA 1Y9EA 4FFNA 4DBZA 4WNIA 4LN1A 3H7AA 1PJTA 3PDUA 3PHHA 3U4DA 1NPYA 3UN1A 1EEHA 1SZJG 4GI2A 3PWSA 3Q9NA 1TLTA 2YV3A 2ZTVA 4GGPA 1CQIA 1KEPA 5G0VA 2ILTA 4NJOA 5JMPA 1T1RA 3VAZA 1YO6A 4WLVA 5DCWA 4PG5A 3G49A 4JXKA 5T64A 4LRTB 2ZKLA 4DPLA 1ID1A 3UAGA 3WGOA 4LCJA 1NHGA 4N5MA 3AUSA 1GZ6A 2QYTA 2GSDA 5KJFA 4ND2A 4B7CA 4YACA 3GNSA 3UCFA 3NTQA 4B3HA 2NU9A 1PGNA 5AXDA 3C3XA 1BGVA 2CUKA 3RVDA 4OJNA 1T4DA 4P4GA 3IS3A 5MGBA 1U3WA 4GBJA 2OGUA 1ZUD1 1YRLA 3F6YA 1E3WB 2C5AA 1EVIA 5L4NA 4BO1A 3PQEA 4AJ2A 1Y5RA 1NFRA 2O4UX 4HY3A 1UAGA 3HDQA 1SO8A 3JYQA 4G81A 4IJUA 1AN9A 4L76A 5BR7A 1UXHA 3PHLA 4X54A 2WD8A 4J3FA 3RSHA 3RUEA 2V7PA 4Y6SA 4E21A 3DBLB 1HDRA 1NQAO 2A9FA 3JQAB 2HMWA 2HRBA 1IZ9A 2NSDA 2UAGA 2Z5LA 6ADHA 1KEVA 1V0JA 5JSFA 1NWCA 3WLFA 1FDVA 2J3HA 4UULA 2JHGA 4OKIA 3UOGA 3ZWYA 1U5CA 4D7AA 4BGIA 5HA5A 5COQA 1QYDA 4WOJA 3AFNA 1I3KA 3F4LA 1I10A 4PVCA 4CUKA 4W7IA 3RCBA 5EQFA 3N7UA 2NU8A 3LC2O 2FPGA 3PJFA 2Y99A 3L9XA 3GG9A 4HFRA 4M8SA 5ADHA 2ZTLA 2Q2QA 3GGGA 3L4BC 3IP1A 5AQ1A 3NT2A 3FNHA 4R51A 5IXSA 1PJBA 2ZJ1A 2P9CA 3LLVA 1V9LA 2P4HX 4G2NA 5IFLA 4OAQA 3TL2A 5IG2A 1F06A 1B0AA 3ANMA 4E3ZA 2WE8A 4N54A 5TSDA 4PZEA 5G0TA 4QECA 3JTMA 2DVMA 4F6CA 3W6ZA 1I2BA 1BW9A 3DMTA 4Z6KA 1SB8A 3SVTA 3IMFA 2Z1NA 3ANLA 4RZIA 3QJ5A 3VDRA 1TA4A 3R6DA 5HTOA 4QUKA 4IQ8A 3NDIA 4U0JA 4CM8A 3GRPA 3W8FA 1IZ0A 1DC4A 3DZJA 1ULUA 3GR6A 1HLPA 2D2IA 1SAYA 2NQ8A 4KUHA 4CMIA 5L7TA 1NM5A 5CEJA 5JPIA 2PFGA 3LYLA 4WLUA 3IUSA 1PWZA 2AG5A 1EMDA 1GFSA 3T4EA 1ZK3A 3RUIA 5KJCA 4NHEA 1GU7A 2Q99A 4TMFA 4Z0HO 2W90A 1KEUA 1D7OA 4DL9A 3JQ9C 2PZJA 1LLUA 2V6GA 2IZ1A 2QRJA 2WYVA 3MJEA 4D44A 3S1LA 5BSGA 2BMAA 2J8ZA 1FDWA 5K9ZA 5L95A 4XB2A 2G82A 3DFUA 3FSRA 1D1SA 1VRWA 1QLJA 2EEZA 3IJRA 3Q1LA 4MIEA 5C7IO 3JQ8B 3KYBA 5K6AA 2O7SA 4W9NA 4BNLA 3P7MA 3VPHA 4OOEA 3D7LA 2XF8A 2NACA 4I9NA 1JTVA 1QSGA 3FCOA 3NKLA 5BNIA 3GFBA 1H94A 4E4YA 5HRUA 5CDSA 4OO3A 1MFPA 4CLOA 4N5LA 2Y0CA 4A10A 5JDCC 4L9RA 1XGKA 4EJMA 1P0CA 1CDOA 2VTEA 4GX5A 4OSOA 4NZ9A 4JJGA 4UVGA 4J7UA 1DAPA 3P2OA 2E4AA 1BW9B 4GSKA 4GAEA 1KY4A 4NBWA 1VL0A 2GGSA 2I99A 1GYRA 3MJTA 1G6KA 4XYGA 5HS4A 1R4MA 2VOEA 5G2OA 1V35A 4WEOA 4LRSB 1VLLA 1NBOA 1ONPA 3PWZA 1P1KA 1KVRA 4RVDA 4YWJA 4CM8B 3ENKA 2Q45A 4AJIA 1GZ3A 4PG4A 3WX0A 3HZZA 2AEFA 2O2SA 1GD1O 1LDBA 4CMIB 3RAJA 1JQBA 5EN4A 4LMPA 3K9QO 3GHYA 1NTOA 1ZJYA 2O3QA 1LNQA 5JCJA 3RU9A 2I5PO 3QRWA 4D3DA 3E8XA 3H5NA 3JYPA 4KUGA 2OP1A 1PEDA 4IMRA 1TB4A 4MDHA 1A9ZA 3ZW8A 2C0CA 4M86A 1XQ1A 1ISIA 2D8AA 4YJGB 1PTJA 4AJEA 1GYPA 1WAMA 4Q3EA 2X4GA 3AOEC 4XGKA 4BGEA 3OJOA 3WGZA 2P5YA 5JO0A 3I3OA 4IJKA 2UDPA 3KHUA 4Q3AA 4EW6A 1VKNA 1ZFNA 1PJ3A 4BKOA 1YL7A 1OZAA 3KLMX 4FOOA 3WYBA 3ONEA 4MIYA 2Y0EA 4BVAA 3I23A 4IUYA 3C1TA 1UUFA 3TZ6A 1X15A 2Q3EA 5GMOA 4CLOB 1ZEJA 4BKPA 2Y67A 4BGUA 1QV7A 3MJ4A 3Q3CA 3OA2A 4J16A 4DC0A 1Z82A 2CNBA 3JQBA 3GK3A 3RC1A 4XQCA 5DDIP 3BTVA 1SEVA 3D5QA 4H3VA 2Q49A 2VHXA 2QRLA 1YB5A 3MEQA 1XWFA 1NVGA 4RCVA 4I08A 3LT4A 4MP6A 2BELA 1E3LA 3LT2A 3LVFO 4PLTA 1R4MB 4U6SA 3VH4A 2DUWA 3ZDFA 5IZ4A 1J4AA 4PVDA 4RJTA 4BNVA 3GLQA 4F6LA 3WBFA 1YL5A 4TWRA 2EP5A 2IZZA 4IDCA 4ZQBA 1DBVO 2X5JO 4BUCA 3TFOA 1ULSA 1XYGA 1XR3A 5ICMA 3PIIA 2VTDA 1ZSYA 3KYDA 3QVXA 2CF5A 1HLDA 2NNLD 3O03A 4J2OA 2GPTA 2NTNA 2QW8A 2Q46A 1EDZA 1VE9A 4PLCA 4PLFA 1MG5A 2Y93A 1K6IA 2Q50A 5G0WA 1X14A 4BNGA 1L1FA 3KBOA 4WLEA 4Z9YA 1LDEA 4FJ2A 1C0PA 4CMGA 5I9NA 1MC4A 2D0IA 4Q3BA 3VDQA 4MIOA 3ORFA 4MVJI 3JQCA 4PLGA 1JA9A 5I9LA 4WASA 1H6BA 2PD6A 1R0LA 3AI2A 4H15A 4E0BA 1NAHA 3GHHA 1M2WA 2HMVA 4IPTA 4XX0A 1QP8A 2O4CA 3WS7A 1U7HA 2R00A 4J1QA 1U3VA 5A05A 3EVNA 2Y68A 3JD0A 4ILKA 3OIFA 1EVZA 5F1KA 3WOHA 1JWBB 1VC2A 4IDBA 4BO7A 2X1HA 3ZN2A 2BI8A 2DQ4A 1R37A 5ES3A 2AXQA 1XIVA 2O3UA 4HKTA 1M76A 2VWQA 1PGJA 3DQPA 1PS0A 3IP3A 5J23A 3ETDA 1IHXA 4PLVA 2VN8A 5JCXA 4RVUA 3ZV5A 3GZNA 4CLDA 1GADO 1U28A 1ZIDA 4XEHA 4JGBA 1WMAA 4KOAA 3HG7A 4GLOA 5B12A 3E03A 3BIOA 4Y67A 5T8KC 4ESOA 2AQIA 1EVYA 4NBTA 5COBA 4Z3DA 5JDIA 5TLSA 4J91A 4J4BA 5A9TA 1ZSVA 1AGNA 2POQX 2B37A 3D0OA 1RYDA 1I0ZA 1KVSA 4ZICA 2HRZA 1NP3A 4KTTE 3U62A 1L7EA 1QRRA 1C0LA 1E7MA 3PEFA 3MOIA 3KYDB 4AJOA 3P5SA 4DQVA 4QT0A 1GPJA 3ZZNA 4BV9A 4GKBA 3TOZA 5TX7A 5L53A 4R68A 4DC1A 5AOVA 3WR5A 2RHRA 1JKJA 4B7UA 3PYMA 3OEWA 1T24A 4FC6A 3EW7A 3PLNA 3L0DA 3ETGA 4OSPA 3RUHA 3BXXA 3KSUA 4IDEA 3QWBA 1TT7A 4XZ3A 1U2GA 4AG3A 2EF1A 3PFFA 3VOSA 4F46A 4OQZA 5A1TA 4TRJA 1C1XA 3OSUA 5TC4A 3EZLA 1SC6A 3TQHA 1QG6A 1PL6A 3JD2A 4J2HA 2EKQA 3DOOA 5I7SA 3MJVA 5KJ1A 3EY4A 4XCVA 3MTGA 2R2GA 1UXKA 4CMEC 1VL8A 1P31A 3ZU5A 4BNNA 3ITDA 4PGFA 4ZJUA 1NWHA 3PLRA 4RVSA 4OYRA 4BNXA 1E7YA 5A02A 1SB9A 1LSSA 3AUAA 2QIOA 4MVJA 3H9GA 3OJLA 4BB6A 3EAGA 3PHGA 5CFZA 2VNSA 2E48A 2VCYA 5EMHA 3WYEA 2CFCA 4CL8A 4DWVA 2FMUA 2RIRA 4CODB 2D5CA 1HEUA 4QO8A 3ROPA 1DC6A 3X2EA 3V2GA 5KJ6A 1A7KA 2E37A 1D1TA 5G4LA 4QEDA 3Q0EA 2EXXA 4FW8A 4YAKA 1JVSA 4QQRA 5ENVA 4NK5A 1DRVA 1C0KA 1HE3A 4URFA 4FSHA 3GFGA 4DGSA 4R3WA 3GVCA 3VZRA 4E5YA 4HFMA 1DIRA 4CQLA 5TRTA 3OM9A 3ZWPA 1KYQA 4A5OA 1GQYA 1UH5A 3TFQA 2ZB4A 1I30A 1UR5A 1BG6A 2DC1A 2VYNA 1NNUA 3KLPX 3HE3A 4YDRA 3WFJA 1LDYA 2UVDA 5KVVA 4KDFA 1LI4A 1C1XB 3I6QA 2ZTMA 1F0YA 1RJWA 4BNYA 3JYNA 4CUZA 3V2UA 3Q11A 3HN2A 5G0UA 1I36A 2DPHA 4XRGA 3ZV6A 3B1KA 1MB4A 4DREA 1MXFA 2D3TA 3EZYA 2JAHA 1DIHA 2GD1O 1RWBA 3WJAA 4XR9A 1I3NA 3V2HA 4O1MA 4CLEA 2X7HA 1W73A 3ITKA 4XYEA 1OMOA 2EGHA 2W98A 4M87A 4RO0A 4WLOA 1HDOA 4YQZA 4YJHA 4UEKA 2OBYA 1LSUA 1WDKA 2H63A 2C2YA 4M54A 1EVJA 3F1LA 4BV8A 1IUKA 4FDAA 4MJLA 3VTFA 1QYWA 4IS3A 3F46A 3C8MA 1WNTA 4D0RA 1Q7CA 3FWZA 4XGIA 6LDHA 1HKUA 2QYSA 1E5QA 2J6IA 5A3JA 4JIGA 4P4LA 1RKXA 3RASA 3RKRA 3SC4A 1U1IA 4DQXA 5L7YA 2IXAA 4OIMA 3TJRA 1YJQA 4HXYA 3WFIA 1EE2A 3ASUA 3PQDA 3HJAA 4Z0TA 5CDTA 3WGTA 2VRCD 4HNGA 2NLOA 4MVJE 5BNFA 5DCUA 5KKAA 4CLRA 4MO2A 4FGSA 4RVHA 4CR6A 1DPGA 3F47A 5THKA 2PWZA 3WTBA 4CQLB 1CF2O 5DT9A 1DFIA 3D1LA 1YXMA 3JCZA 5A9RA 5JMWA 2W2KA 4WE3A 4GWKA 8LDHA 1YBVA 3WIEA 3OMLA 3V1YA 2O2YA 3GN1A 4ND1A 1NFFA 2Q1WA 3PFWO 4I9UA 1IPFA 4F3YA 5CPFA 3DTTA 3P19A 4L8VA 3E5RA 1U7TA 3H8VA 4CUJA 1AE1A 4D79A 4BL5A 4QFCA 1I33A 4CV3A 3DOJA 1YH3A 4E30A 1S7CA 2WJPA 3U0BA 4TRNA 4Z0PA 1F14A 3FD8A 4UUPA 3IUPA 3L9WA 2O7QA 1AHIA 4RLSA 1PR3A 3IIEA 1Y81A 4Y98A 1E1MA 3N74A 5EIOA 2C29D 2YFHA 2G76A 3DB2A 3V1UA 4RPGA 4BQRA 4C7KA 2X0IA 3RJ5A 4R01A 1GUYA 2B36A 3GDFA 1JAXA 4XB1A 3TZCA 4LGVA 4U5QA 2UYYA 2EW8A 2PGLA 5IF3A 1M6HA 2CZCA 3SXPA 2HDHA 1BVUA 1QKIA 1PSDA 4FOSA 4I5GA 3GA0A 4J49A 1KY5A 4YQYA 4J7CA 3OQBA 3JYOA 4MPDA 3ZNQA 1CIVA 1FDUA 2OBNA 3WNQA 1W4ZA 4NJMB 3QE3A 1P45A 2NUAA 2W2LA 1FDTA 3DMTC 4D0SA 4J0EA 3GAZA 2C7VA 1GQQA 4EDFA 4TRRA 3BTSA 4NIMA 2FSVA 4Z9XA 2QHXA 1R66A 2CVZA 1LLQA 2HK9A 2DT5A 3BMQB 3BTOA 4II2A 1NASA 5LDGA 3L4SO 1Q7BA 3JQGB 4CLRB 3JD4A 2A4KA 5IZCA 1DC5A 1LBEA 5AYVA 4K6CA 3TF5A 2IZ0A 2CF6A 2PK3A 1PJLA 1T26A 4BO2A 4B4VA 2W2KB 3AM3A 4ZA2A 3GVIA 2AMFA 1Z75A 4LK3A 1Q0HA 2CY0A 3GEDA 1EBUA 3RBZA 1EK5A 3DHEA 4W4TA 3E9MA 4PFJA 2OUIA 2EERA 3I9JA 5DP1A 4A2CA 5L4LA 5BSEA 1HSOA 1U3UA 2Y1FA 3PI7A 4GLLA 3HDJA 1GZ4A 1QLHA 2O3SA 1B15A 4GX2A 3ICPA 2Y66A 2HMSA 3NEPX 1I01A 3WGGA 5K6AC 4LSMA 4W9NC 1KBZA 2O48X 3U49A 2EG9A 2ZYDA 2WDZA 2HSDA 4E12A 3OFSA 2YQ5A 5FFFA 1I8TA 3GRKA 3H3FA 1EFKA 4ZHSA 3M2TA 2X86A 4K1LA 3UICA 2CDAA 4XYMA 1V3VA 1J49A 5HS6A 2ZJ0A 3C7CB 3JQ6A 4Q39A 1OOEA 2P2SA 5T5QA 3AW9A 1CWUA 3HDYA 4GWGA 1PJQA 4ZU3A 1IHYA 2JFHA 2Y1OA 5KJEA 3JQFA 3W4IA 4PZDA 1Y6JA 2O3JA 2Q1UA 4WUVA 1A4IA 1GY8A 2CSUA 1E1LA 1NR1A 1PZHA 4PG7A 3TDKA 3H5AA 4YYZA 4R54A 3K8ZA 3DZFA 1J5PA 2GUGA 4J6FA 1BXGA 3A06A 1ZK4A 3PQFA 5DP2A 3GT0A 1QXSA 1GQ2A 4U6QA 5CHEA 2G5CA 1X7DA 3K31A 1ENPA 5GZ1A 4AJ4A 1YE3A 3D5TA 3RC2A 1DIGA 2OXIA 2BGMA 4XIJA 3ZWMA 5CP8A 3INTA 1T2AA 3KSDO 3WQQA 3O9ZA 4QX6A 3PGXA 2P68A 5TQVA 3JV7A 5B1YA 3ZV4A 3OH8A 1T2FA 1YGYA 1B2LA 1P33A 4BO6A 1ML3A 3VZSA 3GEMA 4J1SA 2PLAA 3NJ8A 2J3IA 2VYVD 3QSGA 4M55A 3U09A 1UXIA 4ZQEA 4BKRA 4BOYA 3RFTA 3F5QA 4CR7A 1P0FA 2WMDA 2Y1GA 3ZNOA 5TJ9A 3LDHA 2HKIA 1Y9AA 2PA3A 4GQAA 3NAQA 4I5FA 5G0SA 3QLJA 2JCYA 3R3JA 2GNAA 3CZRA 2C82A 3F3SA 3A1NA 3PHIA 1T25A 4GL4A 3AUTA 4XDYA 1DO8A 3O26A 3C1AA 2YDYA 1PGOA 2A92A 2CMDA 3VKUA 4TKMA 4EJ6A 4D45A 3WYCA 1ZEMA 3QVSA 3CTMA 1U3TA 1C0IA 5EPOA 1HZJA 4EBFA 1WVGA 1YONA 3GAFA 3ICCA 2ZCUA 4BMVA 4NR0A 4NFSA 3EHEA 2JCVA 3G1UA 4BIIA 4E5NA 3DZKA 3NUGA 3UXYA 3NTRA 1BXGB 3ROMA 3E18A 4NFHA 2YUTA 1K3TA 1PS9A 1LX6A 2FZEA 1P1JA 4AJNA 3GUCA 1IPEA 1JLLA 3S2EA 3K2EA 1GYQA 4CM4A 4J4HA 2B4TO 3INRA 4IQ0A 3HNPA 3R1IA 4WCDA 1JN0A 2UV8A 3DHYA 3LZ6A 4MVJH 4OMUA 5FEUA 4NBRA 2DBQA 3DTYA 5AXAA 1ZBQA 1N7GA 4JX8A 3DOCA 3UCXA 4AJKA 1I3MA 1KIFA 5JAMA 1GCUA 2C2XA 4XGNA 1ISMA 2EP7A 1PQWA 5KCZA 4U8GA 2ET6A 2R00C 3WNVA 5IXYA 3LU1A 1H9BA 1N1EA 3UUWA 2E49A 3PTZA 1N92A 3RI3A 4B8WA 4D3SA 1LDNA 1K2WA 2HUNA 3RWBA 1P1RA 4IM7A 3QA9A 1N5DA 1DJQA 2PZKA 5ITVA 5IDQA 2ZB3A 1DFHA 1RYEA 4QTZA 1ISFA 4JJFA 3U4HA 4FCCA 4PLWA 3G3EA 2GF2A 1LDGA 3NGXA 1NQ5A 2WYWA 4HX5A 4BGVA 4CMAA 4DYDA 1FMCA 9LDBA 3QVOA 4ALIA 5JDIC 4KTVE 3VTZA 3FPLA 1E1NA 4DQUA 3LC1O 2X0JA 2D1YA 2WD7A 3EDMA 4CM9D 5A06A 3NV9A 1ADCA 4R1NA 4LCEA 3I1JA 4KZPA 3LF2A 2FOIA 4S3MA 1LU9A 1SOVA 3ZNNA 1GV0A 1WDMA 2AG8A 3ZNPA 4LSWA 3GN2A 4YRDA 1ARZA 2ZQYA 4KMSA 3JQAD 1NYTA 4QO7A 1HRDA 5B4VA 5KNLA 1O94A 3QWFA 2OORA 2NWQA 4BMNA 1NFQA 3ZU3A 2H9IA 2IE0A 5DOVA 4MINA 4CM4B 4BB5A 1ONOA 2C07A 4J9VA 4P22A 4A0SA 1DJNA 4NNJA 3OIDA 1FDSA 4TVOA 5A5FA 1NX6A 1G0OA 3ANNA 2NM0A 2X0RA 3OQ1A 2VUUA 4Y9DA 3SJUA 2HLPA 4D41A 3KXDA 2Y1EA 1ZW1A 1FK8A 4PZCA 2C5EA 2BGKA 4RLHA 1LSOA 3OIGA 4E5MA 4Q9NA 4WNCA 4YBZA 4MOWA 4KWIA 3LC7O 3WSWA 1JU9A 1R12A 2X58A 4JBGA 4KWHA 1HDXA 1KEWA 3ASVA 1UDAA 3BYZA 3E6AA 1EK6A 5DBIA 1ZCJA 1T2CA 4FD3A 1BXZA 1OC2A 4FFRA 4JNKA 4GSLA 5TJHA 3ROKA 4ALKA 4EITA 1LTHR 2BHLA 2YYYA 1UJMA 1DC3A 3QP9A 3VPFA 1YS4A 7MDHA 3UH1A 3OQ6A 2BFOA 3EVTA 4GX1A 5BNTA 1P74A 4XQ9A 4TZKA 1MLDA 4NBUA 4P38A 4E13A 4IIVA 2PZLA 1MFZA 3VVCA 4B7XA 1Y8RA 2ZTUA 3QQPA 3VZPA 3H9UA 3T7EA 3PJDA 3UVEA 1MA0A 3GMDA 2YY7A 4IINA 5BSFA 1V6AA 2QRKA 1E77A 1NR7A 1N1GA 1U8XX 1X1EA 3FTPA 1B26A 1GR0A 1PU2A 4RF2A 5KVQA 4PRKA 3RUAA 5ER6A 3GNQA 4LVCA 4PLPA 1J0XO 4YRBA 1ZMTA 3U5TA 3ROQA 2OFPA 4RV9A 4EJ0A 3OBBA 2ZYGA 4LVUA 4OQYA 4BNMA 4CMKA 1ADGA 4GKVA 1E6WA 4ND4A 2X22A 3DFZA 1Z6ZA 4CQMA 2E82A 4HFJA 2VT2A 1R0KA 1WZEA 4IS2A 4NU5A 3KOUA 3OJEA 4FBGA 2IYPA 3C24A 2FR8A 1BSVA 4TVBA 1ADFA 1PR9A 3HN7A 2Y1CA 2A35A 5DBFA 1CJCA 5JNLA 2NTJA 5F21A 5EERA 1EQUA 3C85A 3DZHA 1WWKA 3NJ4A 3Q2KA 3KZVA 3HUDA 3D4PA 3ZWNA 2BF7A 3KB6A 3WGQA 1NVMB 4RL6A 4TRMA 4ZRMA 2HK8A 5TT0A 3AJRA 5JS6A 1YB4A 2FP4A 2IODA 4GH5A 4BO0A 4R9SA 3BMCA 3GNTA 4IQGA 1B7GO 3LT0A 4KUEA 1DOHA 3I6IA 1H5QA 1F17A 2GZ2A 5IAAA 3LF1A 3VC7A 3ZHXA 2RH8A 4RDIA 4E2WA 5GY7A 2FPIA 2X23A 3ZWAA 5L4SA 3ADPA 1O9BA 3RUDA 1Y8RB 2JFFA 2DU8A 3AM4A 3GUYA 1EUZA 1PGQA 3I9NA 1N9GA 4MVJP 3DZBA 4JP3A 3DMYA 3EK2A 5A4DA 1DFGA 1QYVA 3DC2A 2I6TA 5KIAA 2OO5A 3L6OO 4JN6B 4QFDA 2XXJA 4MKXA 5L9AA 2X6TA 5ITWA 2VHZA 1HE2A 1X7GA 1JW9B 1YQXA 3KEOA 3MTJA 4JBHA 4PCVA 4XJTA 4BO9A 2I67A 3RKUA 1H6AA 4BNHA 4CM3A 1IOLA 3GC6A 2I65A 3OJ0A 1PJSA 3DAPA 1G0NA 3PRJA 4J1NA 3GVXA 1MX3A 4NDNE 4UEOA 2CDBA 1ENYA 3VH2A 4CQMB 4DTIA 4YAEA 1W0CA 3EUWA 4ALLA 2UUOA 4Y8VA 3RROA 4UUOA 1FXSA 4I9HA 1GAEO 1M6WA 1VSVA 4LMRA 4NG5A 5EINA 1MC5A 4I5DA 4EGFA 3WJ7A 3UGKA 1DSSG 1OC4A 3ABIA 3PWKA 2AQHA 3PYXA 2GN8A 5MDHA 3GMSA 1DEHA 1Z7BA 3GF4A 3S55A 4XQGA 4ZVVA 2FHSA 3GDOA 4IBOA 3RD5A 3IQDB 1LXCA 2IRWA 2J5RA 3BTUA 2J3KA 3FI9A 3TWOA 2P4QA 1U4SA 5ILGA 3F5SA 3GZNB 4YEDA 1D8AA 2NVUA 1KC1A 3BMCB 2ZB7A 3ZWVA 3CE6A 2Y1DA 1VI2A 5AXCA 2BFMA 1JVBA 3QWHA 2FPPA 4ZGWA 4GVXA 2Q1SA 4O0LA 4AJJA 1HDGO 1XA0A 1DLJA 1L7DA 1E3EA 1T2DA 2PKQO 1QR6A 3CMCO 4G5HA 4A73A 1GCOA 4BMSA 5IJZA 3BA1A 2PGJA 4RZHA 1ZK0A 1N9GB 3KV3O 3O38A 2OL4A 4XYLA 3AWDA 1F8GA 1P9LA 5B4UA 4PLZA 2X5OA 3K2BA 4U7WA 1UZLA 3JYLA 1Q7GA 3U9LA 1QMGA 2A94A 3TPCA 4L4RA 1DIAA 4ZQHA 3W1VA 1VJ1A 3BMOA 5L45A 4JROA 1OFGA 3GG2A 4GGOA 5JY6A 3BHMA 3ETEA 3W4JA 1KOLA 2GN4A 1P1IA 3I4CA 1DXYA 1CQJA 2DTEA 2RAFA 1XU7A 1HYEA 3H2SA 3JQDA 3ZWOA 5IZCC 5FYDA 1LSJA 3OA0A 3VKVA 5HBRA 4GPD1 2B4QA 3I83A 3M1LA 3BZUA 5B37A 1OAAA 2GLXA 3H5RA 4UUMA 1N2SA 1Z7EA 4RQUA 1ZH8A 3U4CA 2FZWA 1I3LA 3OECA 2Z1MA 1BHSA 2WYUA 3TNLA 4JQCA 4R5HA 1CERA 4EZBA 2YV2A 1MP0A 3JD3A 2O3TA 5L3ZA 3CIFA 3COSA 3WMWA 5JW6A 3UF0A 1VSUA 2OZPA 1HETA 1DHTA 3GVPA 4FFMA 3TSCA 4BNJA 1KVUA 4MKRA 1M75A 4IJVA 2NVUB 4M1QA 4BNTA 5JYDA 1NXQA 1H2BA 1ZKMA 3T4XA 4WCFA 4F45A 3STHA 4W82A 3KYCA 2NTVA 3CKYA 4YTEA 5EJ2A 4KDEA 2IEBA 4HFNA 4JLWA 1OI7A 3ZCXA 2YZ7A 3RUCA 1ZK1A 3UHAA 4CPDA 1YJ8A 1WXDA 4L74A 2FY8A 3KETA 4XD2A 1VM6A 1XEAA 1MG0A 4E31A 1ZXBA 3ZU2A 1TVEA 3OETA 3PZBA 1LLCA 4BO3A 4HUJA 1IY8A 5H82A 3VPXA 3C1OA 3DL2A 4UVHA 4NK4A 3FF4A 4XWYA 1LC3A 3MJCA 1KERA 3K73O 3BMOB 3WLEA 4DA9A 4W7HA 5DZSA 4YA6A 4IXTA 1AUPA 3JQFC 4BQPA 2EIHA 4XR4A 3E1KA 3CSDA 4B4WA 4MP8A 4CLHA 4DMLA 1B8PA 1PJ4A 1UP7A 1Y7TA 3MJSA 5L51A 2Q1TA 2TMGA 1MV8A 1FF9A 1E3JA 2HCTA 3Q6IA 1P1FA 5COAA 2YJZA 5IDXA 2VHWA 2VZ0A 3B6ZA 1O6ZA 3FNEA 4CL3A 4QSMA 2WEKA 5CPBA 5EESA 1SPXA 3U3XA 1C3VA 1C1DA 2CD9A 1IYZA 2H6EA 1HDZA 1PZGA 3H2ZA 3N58A 3PP8A 2DTXA 2PKQP 4G65A 2D4AA 5C5IA 3KRTA 2O50A 1QYXA 4R16A 3LLSA 5T67A 2EW2A 5JFOA 3V1TC 3E48A 4ROSA 4CV2A 1XDWA 3B20A 4LISA 4A7PA 2PV7A 3WGHA 1UXJA 4YAIA 4YJHB 1HSZA 1X1TA 3DONA 2C59A 4IXWA 4UEJA 4WCFB 3H9EO 3KYCB 4HADA 4DIOA 3GPDG 4OGWA 5JAIA 4CMEA 3FBTA 2J5QA 1RM5A 3K96A 4YT2A 1D4FA 1T1SA 3D64A 3VPSA 3W6UA 1CYDA 3O4RA 1M67A 3F4BA 1GPDG 1UP4A 3RJ9A 3MWDB 5HM8A 3SJ7A 5I8WA 2JL1A 4XKJA 2CVOA 4I1IA 4P4NA 4PRLA 4OHUA 4H7PA 4UVEA 4BHTA 2VZ8A 1YKFA 1NHWA 1XKQA 1WPQA 5EQDA 3K6JA 4DPKA 4BO8A 5DNAA 2HJRA 3CUKA 4AJLA 2NU6A 1HYGA 1LUAA 1A9YA 2BH9A 5I8ZA 5F1OA 2QZ9A 1E7WA 4O5OA 1O95A 3OJFA 4E2XA 1ADBA 4YPOA 2ZYAA 1E92A 3PHJA 2NADA 5L40A 3JD1A 3BHIA 2WE7A 1H0KA 4ONEA 3E82A 2EKLA 2XPCA 2IEDA 4XA8A 3RU7A 4B3JA 2PD4A 2B5VA 5TGDA 5KTKA 4FFOA 4YB8A 1C1DB 4RF3A 3D3WA 3O8QA 2EJVA 4HNHA 2VWGA 4N18A 5THQA 2XAAA 1E3WA 2VWPA 5B4TA 4CM6A 1LLDA 3CINA 3OHSX 3T7CA 4CM9A 1PX0A 5CDUA 2RCYA 2PZMA 4B3IA 5A03A 4E5PA 3A14A 4M89A 1RM4A 1BTOA 3FWNA 4Z9FA 5BT9A 2DFDA 4J4TA 3VVBA 3VH3A 3EMKA 3DBLA 3U4IA 2YQ4A 4FC7A 1P44A 4DRYA 4WEQA 5DN9A 2V6MA 3PK0A 5LC1A 3WIDA 2BFPA 1H6CA 1ISHA 1ONNA 5TIIA 1E5LA 1HZZA 4IJWA 2PR2A 2GCGA 4Q3DA 3H4VA 2O23A 1IULA 2D59A 4IDAA 1OBFO 4E32A 1YBAA 4NBVA 4R69A 3KEQA 2F1KA 3L77A 3LK7A 2ZQZA 2DBRA 2DTDA 1CRWG 1MGOA 1AXGA 3CPSA 3HFSA 3P2YA 4Q3CA 1GEGA 1UAYA 2W8ZA 2E6UX 1K89A 3HSKA 3FR8A 5G4KA 4IMPA 1E6UA 1HXHA 2HQ1A 1UXGA 2I9PA 5ILOA 3K5PA 4IGFA 3TZHA 3ZI0A 2Q2VA 4CM1A 1I24A 2EWMA 4ZQGA 4OXYA 5JXWA 1LQTA 3CMMA 2UUPA 3RQSA 2VYND 5IDWA 1VJTA 1P3DA 1AXEA 4FB5A 2DBVO 1LJ8A 4PLHA 4EUEA 2Z95A 3AOGA 1B16A 3FNFA 4D42A 2BFAA 2P9EA 3EYWA 4ND5A 1GEEA 3DZGA 3SC6A 3TZKA 4BO4A 1VPDA 3D3WB 3SLKA 3O8QB 3PJEA 5JC8A 2HO5A 3ZW9A 5I7EA 1Z45A 3GZ4A 3H9QA 3ZWBA 1K6JA 4YAJA 4YJDA 1TXGA 3TZQA 1UZMA 3PYLA 1I5RA 4ZQFA 3I5MA 4DXHA 2B35A 2G0TA 2HJSA 4NU6A 3V8BA 2IYOA 3WXBA 4FQ8A 4FS3A 4ND3A 1Z74A 3JQ7A 2FR0A 3M2PA 5AXBA
chains in the Genus database with same CATH superfamily
2VKTA 2GBIA 3CZMA 3ZS9A 1CJUC 1J70A 2ODAA 4BNDA 1PQYA 4C3ZA 4MW1A 5DTJA 1PBTA 1WDWB 3ES9A 3NATA 4MVJG 2B1QA 2EQ5A 1POWA 1TD9A 5U4QA 4PLYA 4MKIA 3CEAA 1XTSA 2H52A 2J9FB 1FFHA 1FJXA 3CLRD 3P9KA 3QGMA 1D8TA 1A8HA 3OZTA 1DKNA 1SKUA 1V11A 1F9EA 2JIZA 4QG7A 1J00A 4V2IA 1F51E 1N9KA 3RVSA 5JBIA 1CULC 3ZZMA 3ED1A 4RPKA 4FIZA 1GKYA 4Y6RA 4GR5A 4G85A 1V3UA 2ZDHA 3NC1C 1P72A 2JVIA 1F12A 1WU7A 2J45A 1H4TA 2NVBA 3HWSA 4FFPA 4UD6A 5AW9A 3TNDA 4GBMA 4YGXB 4DY6A 1SBHA 3DBRA 1G3MA 2W2OA 2HLDA 1K68A 2CW5A 2B5WA 1I1OA 5CIYA 1OH5A 4RKQA 4DLBA 4ARAA 3EG9B 4I66A 3GQVA 3T1HB 3VTAA 3FKSA 1GCGA 2BMJA 1OI3A 3O3NB 2GM3A 4GXNA 3OZCA 4RE5A 3ZVRA 4YV7A 3FHTA 2WIKA 3FHJA 5LP6F 4MVJM 1MQ9A 4KQIA 4ZTZB 2PNFA 2Q3DA 3ZDZB 5FX2A 2ZYWX 1GL3A 3VR5H 4DZRA 2EJUA 3MWEA 4GPIB 3Q8KA 1GPUA 3OT5A 4GVLA 3D7NA 4UTPA 1Z39A 2X2EA 5A6VA 1PZNA 3ENNA 4O2BA 3CCCA 2IYVA 5DN6A 3HXMA 5EZSA 3TPZA 1R64A 3MQ2A 4QQNA 5I01A 1C9MA 2CFOA 1CY8A 3ZDAA 1E6MA 2VDUE 3VR4D 5CA0B 4ER5A 1RTKA 1Q84A 1MHTA 2BRUA 5EP1A 2FLKA 4PIVA 1XCGB 3AUUA 4WW0A 5A3SA 3SG0A 4UDOA 4BN5A 1IE3A 2LDXA 3OFND 4FXOA 4XWGA 5KVSA 4ND8B 4OKNA 2HRQA 1TUIA 1HUQA 5GOZA 4K5QA 3WKBA 1NDHA 4DCGA 4YUYA 2ORED 2Q4EA 3R5XA 4E5KA 3VPGA 5A3VA 1A3CA 4JXXA 4QXMA 1MA3A 2BKAA 1WB6A 1TTQB 4CKBB 1IXKA 3FYUB 4P86A 2X1LA 4CW7A 4QEZA 2ZRIA 3D81A 4DKXA 1S89A 2XB6A 4HL6A 2Z9BA 1E2HA 3THYB 3A1WA 5CRIA 2W2LD 4P7BA 4WXMA 3VYRB 4JLVA 1LA2A 1B73A 1E5DA 3G0IA 4DMHA 2O0KA 1L5NA 5F9FA 5JYEA 3SICE 3L0PA 3KLNA 4HT3B 2C83A 4Q9DA 1QZZA 5E95A 3HXPA 1QFJA 3GJ3A 4MRMB 4PRZA 1J1UA 4RVFA 2C9BA 4J0GA 3UMGA 4FFBA 2REQB 1GKLA 3ER8A 3LPAA 5J9FA 2OA0A 5AKGA 1S3SA 3U40A 3P9NA 2P90A 1VHTA 2OLEA 3AHFA 1J99A 5LMUB 3DE5X 2UYGA 5ELLA 2X9GA 3KQUA 2XAUA 4IRXA 2WJ6A 3A10A 3PTLA 2F1HA 3BWBA 3WQBA 4J0CA 3UWDA 3VU9A 2X1VA 2HMUA 2Z4TA 2VUTA 2BLLA 3GGPA 3ILHA 1AZLA 1TJ4A 2OBMA 1DIBA 2FWPA 2ZR0A 4D92A 4TQ9A 3OQIA 2XNJA 1OBOA 3KQLA 1EXNA 4TSFA 4EVSA 3RR2A 5AI6A 2BEWA 5A4AA 3V4RA 3V5NA 3DVAB 4R1UA 2RE8A 1B43A 4ZOAA 1QZXA 3OURA 1FRFS 3WB9A 1YDMA 3FTNA 2QD2A 5HP4A 5CG2A 4GMHA 2WZQA 3BMNA 5LBTA 1H05A 1OZFA 1RAIA 4MYSA 3ESCA 1LF5A 1S0UA 3HXLA 1GTG1 3HC7A 3V00A 4Y2HA 3BJRA 5F3RA 4F04A 3JAWB 2KBEA 2JW5A 5IVIA 2G77B 3EQ7A 1LWOA 3L0BA 1VP3A 2H9AA 2VNAA 1DLIA 1JTEA 2JLQA 2M9MA 2YXEA 2ZVPX 4MKFA 2GEBA 1O9GA 1O5TA 2BBOA 3PVZA 4INAA 2DUUA 1M83A 1IN8A 1CLUA 3K5IA 4JI3B 4EMBA 2Q2OA 2XOKD 5FOQA 4CZ2A 4J76A 1IFXA 4TTVA 2ZIZA 2PHZA 1OFHA 3T94A 4FYHA 3V46A 3GLFE 4IY1A 3NYWA 3HVJA 2V58A 2UKDA 2ZE6A 3DEHA 3WKCA 2AI1A 3DF9A 3HZRA 1BDBA 1BN7A 1VIMA 3I52A 5HKLA 5KC9A 2VAMA 4LI0A 2FGJA 2L0XA 1BXRB 2W37A 3HCFA 3BILA 5AO9A 1ZH4A 2XE4A 1ETUA 1M0EA 2JLVA 2HDWA 3MOGA 5C7OO 1XDGA 2G6BA 3CLSD 3F3YA 3G1WA 1QB7A 1O5IA 1O4VA 5EHQA 2RAPA 4V02A 4XM0A 2V9PA 3UAZA 3SBOA 3LDAA 2X7JA 2QG4A 2DH5A 1M2NA 1R8QA 2IYNA 4BX9A 2B69A 3W3AA 2ZJZA 3RVOA 1C8VB 1PX2A 1U3DA 1EX6A 1WZNA 2JJ2D 3NHRA 3I92A 3CEHA 3RJZA 4P0QB 3ETCA 2QQ5A 3AF1A 4LXYA 3VM6A 3CVJA 1HDIA 5DULA 2AA3A 4FZVA 2EZTA 4B3JA 2ZATA 3C16C 5D1HA 4C4ZA 3OE5A 1JLRA 3V7WA 4RYDA 2APJA 3H86A 2W2VA 1G8FA 3EGXA 1W0KA 3JTEA 2IS2A 1GRCA 2WSIA 1S4QA 1ULHA 1ACLA 5JRZA 1OLUA 3D6FA 4R9VA 4Q4JB 1F60A 4XJVA 1CUSA 2QVZX 5DBGA 4JBWA 3VSBA 3HB4X 5BN5B 4WJKB 1H4SA 3ZE1B 5C7YA 4ZTUB 2BD0A 4A8PA 2X9VA 1QH1A 1EQAA 5TQ2A 5KB3A 1JEYB 3LCCA 1DS6A 4GRIA 3G89A 4Y3UA 3UC5A 3WWZA 3JZAA 2BIFA 1I4EB 1LV7A 3KU1A 4PBTA 4J29A 4Y30A 1SBCA 4B6SA 3FGNA 2ON6A 2BYTA 3JQ9A 1A7AA 2HMAA 5BR8B 2GAFA 1ECJA 4YJ3B 3OLXA 4UBKA 1XEXB 1NJ8A 1OW3B 3KTOA 3W5BA 2AYXA 2ZG6A 2Z57A 2IBSA 4WN3A 3VA7A 1G6OA 5LQJA 3H3XA 4KG7A 4RORA 3I9V6 1JEAA 1E8DA 1K98A 3QPDA 5FBVB 3AL2A 2AEMA 3MF4A 5CM2Z 2IHVA 3CURA 4IIYA 4L5BA 4KW7A 3KD3A 4Z2AA 3QELA 1ODIA 1Q1NA 1JLSA 1XOIA 2AFRA 2JATA 2OCPA 4LE0A 4UHBA 2V6IA 1NP6A 1LPPA 4UBOA 4YUVA 4D46A 4TKUA 4P33A 2J0SA 4V1CB 1W5SA 3CE9A 4MQFB 2VA9A 2PXCA 1JHDA 3I61A 1NV8A 4XI9A 1CY7A 4M0UA 2AW5A 2YHBA 5JDCA 3HEMA 4HNSA 5JSUA 1T8WA 2I1QA 2Z5GA 3VZBA 3GJ4A 4RIGA 2G08A 1DX6A 2WY2D 3LA8A 3UFXA 3UKJA 1XNGA 3EA0A 3MS2A 3F1KA 4TSKA 4ENUA 3PTAA 3O4VA 1VHWA 4URZR 4A8JC 1E7QA 1SCJA 1T8YA 2CNNA 2JHPA 2XUHA 1H2XA 1IUOA 3R0XA 4HATA 4V0KA 3QBEA 5I4KA 5HBGA 5DJ5A 2VC2B 1FFBA 2GBLC 3C8DA 3FMOB 1PEKE 4FK8A 4O0MA 2PY6A 2YWXA 4PZAA 1HMPA 3BH6A 4AW9A 4JJ6A 3PQ7A 1W76A 1PGPA 4H60A 2GEJA 4RCZA 3VPAA 4BX8A 3RKSA 4FMDB 3D3EA 1NN3A 1J25A 4GSYA 3KFXA 5IJAA 4DNXA 4K26A 3FRHA 3AONB 4NPCA 5DTEA 1PSWA 4YP5A 2P11A 4DABA 2IUEA 5B3AA 3UMCA 2G5PA 1G8PA 1DKLA 4AL4A 4BZZA 4B3DA 2Q0SA 3QE4A 3RV3A 3WQRA 2HCJB 2ID9A 2EC5A 1J0BA 3RFFA 5KWVA 5DHUA 5TMBA 4EYSA 1NSTA 4PFQA 1F2UB 5KNCD 3B1JA 1Z18A 2HU8A 2JD0A 4G9BA 4IGEA 2BGRA 5AJYA 2HLNA 2Q9UA 4IQFA 1FSFA 1UZNA 5D86A 4TMTA 4H1VA 3K5HA 5B55A 1NQTA 2IUSA 1GGEA 1SCIA 4I4TB 3TD9A 1E2EA 3V1LA 1OXXK 2VFAA 4WVLA 1YQGA 4DLLA 3IR7A 1FJHA 2PTGA 3AP3A 5AKZA 5FBWB 3DBHB 1WY5A 3MA0A 2CVQA 1DBIA 1K75A 3HJRA 3DEJA 1ZXXA 4EPWA 5KWEA 3KK0A 3NHAA 1KMNA 4PHFA 4H16A 2X8LA 4FN4A 5AM4A 5JS2A 3VV3A 2CJWB 4X97A 2ECQA 1C30A 1G1MA 4BPRA 4DG9A 2FPIB 2OV6A 1T34A 5T3UA 3GRVA 4LVNA 3MZ0A 4O1HA 4LNUB 2MYPA 1S2GA 2REOA 1G5RA 1A1SA 2V96A 2RGDA 2YC2C 3KBBA 3AY0A 2F62A 1V47A 5CK5A 4F92B 3RHZA 1PL8A 3TVDA 3T0GA 4NJEB 5EIBD 4D98A 1HR0B 1YRYE 4DLAA 1QYCA 3NRJA 2YJGA 5IKEA 1GUFA 1I94B 4DSZA 1XVVA 2B94A 3S28A 1ORVA 5JUWA 4RGBA 1J90A 2Z6AA 4RA6A 2B4AA 5HQTA 3ROFA 1VSBA 3I4FA 1OU0A 4MB6A 2BTEA 2G1KA 2GD0A 3HM2A 4XPZA 4MKHA 4XXHA 4EG5A 4LX0A 2JDIA 2NZJA 1B3RA 1LRJA 2XMZA 4HZUB 5KOIA 1T9DA 2ZB8A 1VB5A 3CXRA 1TI7A 2YXNA 1OWNA 2BTQB 3ICQB 3L6EA 4CT5A 5CD9A 3L93A 3QQ5A 3HA3A 1Z6PA 4E6PA 5CB0A 4E33A 4HS4A 1TAQA 5ESXA 5J2TB 5TT1A 3GJ5A 3HCPA 1OZGA 1XU9A 4MS3A 3O0TA 4HDNA 2B4YA 3AHIA 1X77A 2JGAA 4LGCA 2ZSEA 4RHXA 2PXXA 4OHPA 4JJEA 3R7SA 2Q0HA 2YHUA 5DHSA 4DR4B 3A6GA 3PE3A 2XGGA 4BX2A 5LU9A 1CYEA 3F9CA 4TYQA 4YASA 5EP3A 1VLVA 3BCHA 3C5EA 3CYFA 4O4LF 3N2YA 1OASA 1U94A 1UT8A 3R0IA 1JPNA 3KXLA 4KE8A 4YT8A 1GA6A 2H06A 1RQ2A 2VSXA 1PIWA 2ZWAA 4LK2A 5F5LA 2FUKA 1PUIA 3CRZA 3PNBA 2JJMA 4B4OA 2E5LB 4KBGA 2ZJOA 1ESEA 4Q1CA 3PZRA 5CB4F 2FDXA 2DM6A 2ZRKA 4G89A 3CX7A 3D6HA 1ZMOA 1GRNA 4PO3X 2CMGA 4RJ2A 3RBVA 1UJ6A 1TZJA 4Q7JB 3ABQB 3RSGA 3V6MA 3WMXA 1IVYA 1E3QA 4ALMA 1SVMA 2CXUA 1OV6A 2I4IA 2NVWA 4TTPA 1KK1A 4MVJF 2TSYB 2YIVX 1U1FA 1FZQA 3ZBTA 4Y1EA 3RJTA 3RFVA 4JP2A 1A2KC 4P82A 3TRIA 1X7HA 2GZ3A 4C76A 5BMVA 1NLMA 3KKKA 5LOVA 1DKOA 3S40A 3ZEAA 3BZWA 4WK4B 4XGRA 1A69A 1PQUA 2AW3A 2XBUA 4IDGA 1JWLA 1EUDB 3PLAE 3MWJA 2HIAA 1H2HA 5LMZA 4Z53A 1IM8A 1CB7A 2IOFA 1M2EA 4I6GA 2IDZA 3H19A 1V95A 4UQPA 3SHOA 4G5SA 3RT7A 4EF6A 3W1EA 4FE3A 3KJHA 4FEGA 1XRJA 4ZAXA 1US8A 1H8HA 2HU2A 5LZ4A 3EUEA 2BFFA 1Y1TA 1V45E 4O5AA 4NJMA 3ZIDA 2AXEA 3IXQA 4QVKA 3TLZA 1Y1PA 4B74A 4YRAA 3T3EA 1QTRA 4JEIA 1R4NA 2WJ4A 3QZUA 3QUTA 2GN9A 3T9EA 1EFPB 3AL3A 4QYWA 3IIMA 3JARA 5C1PA 3THYA 3QJYA 1E3DA 3FX2A 3K0CA 3FGPA 3IERA 3T5DA 1ZD8A 1TJ3A 2G17A 2G70A 2W4IA 3MOSA 3KZCA 1UDCA 3JQGA 4I46A 5CYPA 1UEJA 2ZBEA 4EYEA 1KZ1A 5JZOA 4MHOA 1XZEA 3TIIA 5JYCA 5GTDA 1WETA 3X1MA 1NMXA 4NMLA 1NW6A 3IKVA 1QUEA 5LYYA 3ONWA 2W2NA 4XLTA 2I8AA 1M3SA 4HZGA 3UJHA 1QH8A 1QORA 1YR6A 4WOJA 2CCKA 4RD3A 1CDDA 4ZRNA 4CRWB 5A04A 1P77A 2WWHA 2YN2A 1EP9A 4FYJA 3C48A 1AUVA 4Q0MA 2HK7A 1NVAA 4OA5A 4ZOEA 5FI3A 5A9SB 2QBYA 1XELA 4ZT2A 2PMBA 2IP2A 2JJ1A 2QAJA 1E0KA 4E2YA 3ASYA 4WOPA 4Y1RB 4DGQA 1CQXA 5JQGF 1TLFA 2J46A 1F1BA 4BLOA 5HQJA 3WRXC 2QE7A 3ZGVA 5ES4B 4TXJA 1PWXA 3SHVA 2FMTA 4C5CA 1K86A 1P0QA 2GPYA 2PO5A 3R09A 4WH0A 4B82A 4EB6B 3TDMA 3KQMA 4FMCF 3T7DA 2H5IA 4QTXA 3DT9A 4UREA 3VR3A 3SGLA 4LYEA 4S2EA 1BJTA 1TUGA 1OWMA 1ZCBA 3NTXA 2P78A 1UDWA 3GLHA 2YVKA 5KOYA 2QRVA 3K0HA 1FYWA 1O54A 2C4HA 3ITNA 3FGZA 1NSFA 4JBYA 1BMFD 3TIGA 5BORA 2VOJA 4MTLA 4RPCA 2NSJA 2DHEA 2WHXA 2XUZA 5DNWA 4QPPA 4O1IA 1Y4ZA 5CDGA 3ZUPA 3M6IA 1E1KA 1PV4A 1PR4A 1CQWA 5AK6A 3H5OA 2Q4OA 2R6FA 4I1SA 4ZYXA 3A0UA 5DOZA 3PNSA 2A0WA 5FV7A 2QF7A 3L8FA 4RSMA 3LSTA 3R9XA 2F3QA 2YMQA 1I7DA 1ATIA 2PX0A 3MRXA 1JU3A 1CY2A 3KSAC 2EKBA 3OP4A 1KJ8A 3H6KA 2AYZA 3HV2A 4LSZA 5D3ZA 2VTBA 1U4NA 4GNRA 3QY9A 1NATA 5I9MA 1L5KA 2FK8A 2VJKA 2Y9MB 2PYDA 4R8LA 4DUPA 2Z09A 1LPNA 4WBXC 3INYA 2SCUB 1BX0A 4YR7A 4CQJA 5LB2A 2VYFA 3DE3X 3IQXA 2PVSA 2YW2A 3RUFA 3P71T 1XROA 4ETWA 1YR3A 4B6FA 1MRZA 4BP1A 3BWEA 4CR8A 2HSZA 2W0MA 2WHPB 2CLFB 2XUFA 4F56A 1LNSA 4CV1A 4PPFA 3TTSA 4FDMA 2V65A 1G6HA 4G26A 3ZWCA 3G5LA 2WAMA 4QLAA 4EKDA 5CB8A 3DM9B 4B8ZA 2J31A 4LQ4A 3FVVA 4ZU6X 4LV6A 1MO4A 4N7RA 2GLUA 4S35A 1V8BA 1VMKA 2VDQB 3QUBA 1X0XA 4O6VA 4U7PB 2K7FA 4IMJB 1ISGA 4N5DA 4G07A 1M1NB 2YJ5A 1YDWA 5IUNC 3EZGA 1XG5A 3HI6A 1DG1G 4I99A 1G64A 2PVPA 3EC7A 3HGTA 2VNIA 4RPLA 3WGMA 1IL0A 4JJIA 3JQAA 3U19A 4ZZIA 1JKFA 1TVCA 2FRDA 4UAGA 3KQYA 2FMXA 4Y0NA 3TOXA 1BMQA 5B6PA 5I51A 3RB8A 1M74A 2HNAA 3AHCA 4RPJA 3MRTA 2ISSD 3WDLA 5KC8A 5KVCA 4LHXA 2YHIB 3FRIA 2WZDA 4UU1A 2OCKA 4NAVA 3RTCA 4MUXA 5IULC 1D0VA 2ZULA 4L5YA 4REQA 1ZUHA 2Z3WA 2I7VA 4B79A 1IQ0A 2OHVA 2DB3A 3NIGB 1JKIA 2DLNA 2YUIA 1M1YA 4O63O 1XMSA 2X2PA 4OOFA 3ODGA 5CURA 2EGGA 3J81k 1GL9B 2OCIA 2X9NA 5KNDD 4U9UA 1HYHA 1W4BA 2XB9A 3ZV3A 4YXFA 2LE0A 2O8FB 4H08A 1JR3D 3DW3X 4AZ3B 1M0SA 2F3SA 3PDUA 3PHHA 5K3FB 1NPYA 3HHEA 2PVCA 1SZJG 3SIPA 3GUZA 4KMOA 3VC1A 1Z5VA 3Q9NA 4XWTA 4GGPA 5G0VA 4NJOA 3TOSA 4JB0A 4B2YA 2FSIA 3B9PA 1EFVA 3O21A 4GKJB 5DNDA 1L6RA 3C3KA 3DQZA 4GBED 8MHTA 1A82A 3LP8A 5T64A 5BVHA 4JSTA 2ZITA 3K0EA 4PCUA 4RANA 3I53A 3RBAA 3SVZA 3ER6A 1SRQA 4JOQA 4LFBB 3WGOA 4C04A 3I39X 4OK6A 4EY3A 3AUSA 2GN2A 3OO0A 4MITA 4TL8A 1XLWA 2GSDA 4JLUA 3VQTA 4AT1A 3UJ3X 5IWAB 3IDFA 5JNVA 4YWHA 1A7JA 1RYNA 1FBNA 3LUAA 4A5SA 3RV4A 2A1TR 4TQUS 1NXXA 3Q72A 3V34A 1BGVA 1PE0A 4WXPA 5LP6A 3C6YA 2VLIA 5MGBA 4M22A 4ZK2A 2RAVA 1U3WA 5HUHA 4GBJA 1EP3B 4I4IA 1E3WB 4FOPA 4LZWA 4URWR 2OM6A 1C4WA 1DQNA 2DOKA 2WLTA 5H4GA 1M7GA 4KEAA 1PFGA 3BXEA 4ZCQA 1FC0A 2D74A 3JZIA 3KJIA 3EGCA 2G0AA 3PR3A 3CEPB 4L76A 1M2VA 3PHLA 3AR8A 3LQRA 3MT0A 1KNXA 1ULAA 3L0ZA 4QBIA 4X54A 2W6OA 1T0HB 1FMJA 4E21A 1JHXA 4QJ3A 3IAS6 2WMNB 3AYZB 4ZWNA 2NSDA 1Z2PX 2Z5LA 5E2AA 2QL7A 1G7TA 1KEVA 1IBRA 4QXAA 3VYUB 5EJ6A 4JJZA 3FTFA 1J8YF 4UULA 2J3HA 1VMIA 3A4NA 1JFFB 4NEGA 3MUEA 1N5RA 5H59A 1G63A 1GPH1 4N8SA 4YONB 3DLBA 4RAOA 3QPAA 1COWD 1QYDA 1FJ2A 3AEUB 3MSXA 4PVCA 1XQWA 1JEOA 1ZGJA 2IIPA 4H6VA 4PNZA 3RCBA 4DIUA 3TEMA 3N7UA 2FPGA 4Q9IA 3AETA 2Y4OA 2Y99A 3L9XA 2VAWA 2OGZA 4KSCA 4XD7A 4UTZA 1G4UR 4HFRA 3KR2A 3ZE2B 5KPDA 1SRRA 3RQIA 2O59A 5I4IA 3FNHA 4R51A 1D2RA 3GUUA 3LLVA 3RYIB 1HBJA 1G9SA 2HLHA 1QV9A 3EXHA 4G2NA 1HTTA 4H7KA 3GXBA 1JDPA 1CQIB 3JVIA 4FINA 4UFOA 2JAXA 2PEYA 2PXAA 3A1TA 4KE6A 4KKXB 2LGJA 4LJKA 4N54A 4NCIA 4PZEA 4E3ZA 2W6IA 5FA6A 2DVMA 3BIJA 3FJYA 5FKJA 3W6ZA 1I2BA 1NRXA 4F11A 3LO8A 3KAPA 4DR1B 4Z6KA 1KY3A 3PDCA 3RC3A 4ZO4A 3J81A 5ELXA 3IMFA 2CL6X 2Z1NA 4HEHA 4LY0A 3ANLA 4FONA 6REQB 5DM4A 1GZDA 1I13A 3NNSA 1TA4A 1NTRA 1UPBA 5TVKA 1OD6A 5LVAA 4NDZA 2CB0A 1EPUA 4HDQB 5IT5A 3NDIA 3K20A 3QLVC 3VKWA 2CFTA 1C29B 4TMXA 2BZ1A 3I2IA 4O2LA 3E3NA 1SAYA 4O8CA 4BMOB 1PQ4A 3HR8A 4CMIA 2AB0A 4Q7LA 1ECFA 4TT3D 5DXFA 1D5WA 5JPIA 3IUSA 3HXQA 1PWZA 2I03A 3T4EA 4RVNA 4BWGA 3WLIA 5KYNA 2WWXA 1QIKA 4KAXA 3RUIA 5KJCA 4NHEA 4U6NA 3FUCA 3H1EA 2JIQA 1II8B 4CNBA 1D7OA 1PAUA 3IOMA 721PA 2PZJA 2IZ1A 2QRJA 2BEUA 2WYVA 2C78A 3EDYA 3GAAA 3MJEA 4Q47A 5K3AA 5TPZA 1N9ZA 3DE1X 3CG0A 3TBFA 1GR1A 1NYQA 1M6YA 3WWOA 5K9ZA 1VIYA 4WGFA 1WXWA 1PSZA 3L7OA 1DWPA 1PW5A 1OFUA 2GEKA 2VF5X 1Y9ZA 4TXMA 4M9XA 2G82A 1E4VA 5JT1A 3T52A 3ZX4A 2E5WA 2MWMA 5E3HA 1D1SA 1JEJA 1K97A 1VRWA 3IJRA 3Q1LA 4J0JA 2A5LA 4NBKA 5DYTA 4W9NA 4BNLA 5K6AA 5KU1A 4A2WA 4UQLA 2D2EA 3HEAA 2J0UB 3BWXA 5AMXA 3D7LA 4MLDA 1Q21A 2XF8A 1J9EA 1PV1A 3VNQA 1XZ8A 3G0CA 1U7WA 4CLOA 4JR1A 2WOOA 1Z4OA 2RHBA 4N5LA 4YCJA 4G0WA 2CE7A 1XGKA 4MW6A 3R9IA 2DMRA 1P0CA 2GYUA 2WSYB 4HO1X 5CLLA 1AUXA 3QVGA 3T06B 4IH9A 1ZCZA 2Q21A 1W34A 4UVGA 1S4MA 4JJGA 3Q3IA 4J7UA 1DAPA 2ZIWB 3P2OA 2E4AA 4MGYR 4O4IB 1BW9B 4X61A 4GAEA 4I4CA 2R751 2W11A 1GZSA 2D5IA 2GGSA 5IAGA 5CCEA 4PYLA 3B7WA 1GYRA 1P7CA 4HLCA 2IYYA 3EZ6A 5DVZA 4G01B 4M0PA 3F49S 3GEBA 4PIMA 4XYGA 2ZBDA 5G2OA 5BUZA 1V35A 4MV9A 4WEOA 3QBTA 1NBOA 1RMTA 2B1RA 1NXWA 1WSAA 2ISQA 2YWFA 3S44A 4BVLA 5HQ3B 3PWZA 2GM4A 2XJ4A 1RRPA 3ZI4A 3EWSA 2FMFA 4YWJA 1PV2A 3ENKA 3I30X 2Q45A 3HKCA 1DAHA 4FE7A 1GZ3A 3WX0A 2PX2A 5A4KA 5FWXA 1PJ8A 3EMDA 3H2IA 2O2SA 4L4UA 3SXUB 4AP5A 4ASUA 4DV2B 1R0CA 1KMHB 3EAQA 5EN4A 4ZVSA 3QOWA 1GTVA 1ZJYA 2CHEA 2GKSA 4EZEA 1SOUA 3TXYA 5JCJA 2I5PO 4MB0A 1W30A 3Q6NA 1WRBA 2PIDA 2AN3A 2OP1A 1PEDA 3AF0A 1NDQA 3NH6A 4HJRA 2MMCA 3HB0A 4IMRA 4MUMA 1DIOB 5FOWA 1VL2A 3BL5A 4HAXA 3RE1A 2NZVG 5DNYB 1U3FA 4HVCA 1BE1A 3P9ZA 4ZV7A 5KDOA 4H77A 1E5XA 3IQEA 3OT4A 4Y1GA 4PAQA 5AW1A 3WLLA 3SU8A 4YUXA 3TINA 3M89A 1ITZA 2Z2KA 1M5TA 4XGKA 1AKRA 1Q74A 1Z26A 4BLQA 4Q37A 2BBTA 3BDVA 4Q4HA 3WGZA 4A6EA 2IUYA 5G3YA 4JHXA 4QXRA 4Q3AA 2X7XA 2PM8A 5CX4A 1E63A 2RGNA 3GEIA 3PXGA 2BHSA 1V96A 2QL9A 2ZANA 4NU0A 3LOUA 2QMEA 1YL7A 5DYYA 4D9JA 1OZAA 4FOOA 1UJ2A 4MIYA 1KU6A 2AOUA 2Y0EA 4JP8A 1ZESA 2ZYSA 1XTVA 4DS3A 1MO2A 5EE3A 3TZ6A 2C0PA 1Z16A 1DO0A 1ZEJA 2CC2A 4BKPA 5EHZA 4BGUA 1QV7A 1KFJB 5JNSA 2PMDA 3Q3CA 2EGUA 1Z82A 2BI4A 3JQBA 4E1VA 3RC1A 4YS6A 3WYNA 1A9XA 3AC0A 2H1OA 1R6UA 3R6TA 4G1CA 2K6GA 3BTVA 4F2HA 1ZD3A 2PUAA 2Q49A 1C3JA 1TZCA 1EHIA 2EVWX 2QRLA 3PC6A 1X80A 2M6KA 4RXMA 5LMCA 4I08A 2WUEA 3IUBA 3ONNA 4XWOA 4PLTA 2HXGA 2RB5A 3Q1KA 1RP7A 4M1EA 2VJNA 3E84A 2AFHE 4ENVA 4YXWD 5LM3A 4BPBA 2DUWA 2AC7A 1GQFA 2W6ZA 4EK9A 5FDFA 1YU6A 5IZ4A 1J4AA 2XCIA 5JD5A 3FFAA 4HSEA 4PVDA 3B2QA 1ODJA 2J07A 3GLQA 1SCKA 4F3NA 5B3JC 1YL5A 4LQDA 5IHPA 2NPOA 2EP5A 4IDCA 5JXJA 3TFOA 4IR7A 2D7CA 5DMHA 1XYGA 3DBOB 1MTZA 2ATXA 2VQ6A 3I58A 3PIIA 3L8HA 2P9HA 4YP7A 2CF5A 1HLDA 1T0JB 5EE5B 4ZVMA 4AF6A 4DCVA 4WZAB 4KBFA 4QXOA 1KA9H 1FU8A 1M5UA 4LZAA 5CNJA 1QQAA 4R1MA 5INTA 2WT9A 4PSKA 5KEIA 1BD3A 3KBOA 4WLEA 3K70B 4Z9YA 1XXLA 2ZR7A 3ESAA 1JKMA 4FJ2A 5IW8A 4MI9A 1R7RA 1NN1A 4Q3BA 3VDQA 3STWA 4MVJI 4YJ3F 2JGNA 2WKSA 4PLGA 5K0EA 2ZBGA 4WASA 1SN7A 5DPMA 3AI2A 4MYHA 3ABOB 2IDJA 4HDAA 4Y6LA 1VI6A 1V5FA 3I34X 4M60A 5LLDA 4EENA 1Y9DA 3K0SA 2ATIA 2QEQA 2O4CA 1BVHA 2DFKB 3M4YA 3WIUA 4BFLA 1I4TD 4HX2A 1TVKB 4KE9A 5F1KA 5BPFA 3CPHA 1KR5A 2ZI7A 1G20E 2BZ0A 3LKZA 5TB5A 2BI8A 2OOKA 5LQRA 3T3OA 1FFXB 4GLFA 1Z4NA 2DQ4A 1XLVA 1I7PA 3E05A 1E89A 4EMUA 3V8EA 1EZ1A 1U9IA 1NX9A 2ZVJA 1O57A 3JVVA 5FD8A 4EUKA 3IP3A 3S5UA 3HKBB 1IHXA 3OKCA 1U11A 3DPIA 4FHGA 4RVUA 4P5EA 1GQOA 1MVNA 1QGYA 2J59A 1RC1A 3NXSA 4MRRA 1ZIDA 5BOSA 4XEHA 2RGUA 4MMXB 5L3SB 5DBOA 3JAKB 1TOAA 1HLFA 1R0RE 2YJNA 2ZIVB 3AVQA 3VRHA 1XPJA 1M54A 3BIOA 2C7PA 3NVKI 3SDZA 5T8KC 1BWQA 3S0JA 4ZCTA 2AQIA 1U0RA 2RG7A 4Z8XA 4A23A 4BAGA 4DYHA 4YRGA 2PUEA 4RTJA 1KTIA 3ZOKA 1CR0A 4DC9A 1ZSVA 4GPAA 2POQX 4CNQA 5C5CA 2HHLA 5ED4A 2FFHA 2GKGA 3R40A 1CUWA 4QPNA 3WLKX 2XVZA 4WA8A 4DBLC 1XLTC 4UBIA 1TQ2A 4HEJA 1E9EA 3SSNA 2XLCA 3U62A 4F97A 5DWQA 4HRYA 4IIJF 4G09A 1Q1GA 4NATA 1KI6A 4JI7B 2NTEA 4NSNA 3N2KB 3C4VA 3PEFA 1SR8A 3MOIA 4AJOA 4QT0A 3DCYA 3IIIA 5NLLA 3OAAD 4GKBA 1N77A 4CEIB 4JQZA 4R68A 4IIDA 3NWPA 1P75A 3ITEA 2P6OA 3ZQ4A 1DCFA 2GPBA 3KALA 3MMXA 2DWPA 3IJEB 3KOYA 5A7HA 4EF5A 1T24A 4RHCA 2EW1A 3NNNA 2V54A 4KPUA 3L0DA 3V7UA 4MH0R 3OZGA 3SKVA 2BFEB 3BXXA 1UMDB 2CCJA 3O83A 2FN8A 2M2IA 3HKEB 4GP9A 2DQKA 4JELA 4ZMBA 1S2DA 4GQBA 2OZLB 4MZDA 3M4XA 4OJKA 5LN1A 1LVUA 3EEFA 4XX0B 1FP4A 3U9TA 2ACEA 3L8CA 1OLXB 4TRJA 5EIXA 3GT7A 4FZRA 2O06A 4AWAA 4YQFA 5HFJA 5DX0A 1GA4A 2AL7A 5LQAA 4O4LA 1T0UA 2Q41A 1Q1EA 3TQHA 1I9GA 3SC3A 1JBKA 3H99A 1J39A 4HAWA 1Q0SA 2AG1A 3FLAA 4E4RA 2BMDA 4EYGA 1DE0A 3QNMA 4X91A 4S05A 2OPHA 5FLXA 1E0AA 1ZRSA 2J1LA 3GNLA 2H5JA 3VU1A 3ZU5A 5CB4A 1UBMS 3MTBA 1AG9A 2XNDD 4BNNA 4ZJUA 1SVIA 3PLRA 4BNXA 5A02A 3LCUA 5D2CA 4US2R 3AFHA 3QFRA 1A76A 1AU9A 1LSSA 3AUAA 4MVJA 1N4AA 1B6RA 3DMHA 3EAGA 2R7KA 2VNSA 3FLBA 4Z7QB 5JY6A 1J7JA 2XQJA 1Z6TA 3CW9A 4C0SA 4PICA 5KSZA 1O08A 1T9GS 2V7TA 1PNQA 3T7IA 3B5JA 5K4HA 4TL6A 1VLMA 2R87A 2WM2A 2RIRA 3IBFA 4AN4A 1YCFA 2HXYA 2NTYC 4CF6A 1HEUA 2PCJA 4CFYA 5BSKA 1UF9A 2QAIA 3E58A 5IJWA 2PGOA 3WNBA 4FW8A 4HUQB 2GYVA 5BN4A 4FI3C 3ZLBA 5ENVA 4AMGA 1XTKA 3DZ8A 3WO1A 4NK5A 2IV7A 1ULZA 3F7TA 1AURA 1NMZA 4C4XA 1M6VB 3IXMA 2PBRA 4ISBA 1GSAA 1UK8A 1HE3A 4M0EA 3D3NA 3G2QA 4FYIA 2Y1XA 3VZRA 1Z17A 4MR9B 4E5YA 4E22A 5JI3E 4HH3C 5E7IA 5J2TF 2WBLC 1QVVA 4MCJA 4AY4A 2BM8A 5TRTA 1GG5A 2XMSA 3GQBA 2IHBA 2LV8A 5ALLA 4M21A 3K6SB 5BUSA 1N7IA 1GQYA 2FV8A 1O1YA 1TCCA 1T5LA 2ZB4A 2CLKB 3KL2A 5JS1A 1Z2AA 2R1TB 5TGZA 1MF7A 1ZD2P 1A8UA 1T4MA 1P39A 5EJ5A 4R2JA 4UM5A 5JZMA 1VFPA 1SK9A 3WFJA 1JFVA 2O7RA 4KDFA 3ERCA 1T5OA 2B8NA 4IFBA 5IASA 3CUSA 4PNPA 2O2XA 1BGWA 5FUYA 1LBHA 1CUFA 2ZTMA 3RH0A 2DETA 1RJWA 2QP3A 4QYXA 2J3QA 3HFJA 5DGHA 1W88B 3JYNA 1ISPA 2EAUA 1W5TA 4HLUA 2QLTA 3HN2A 3Q11A 5G0UA 1I36A 5IUJC 3DMNA 1HC7A 4XRGA 4LGMA 1KYZA 3B1KA 3L1KA 4PZUA 4AMYA 2BUAA 5JQGA 4H3KB 4JLSA 5E1DA 3VNRA 1PT9A 3URMA 4K9LA 1N7JA 3HUTA 1D5CA 1BS9A 4UZSA 1BQ3A 3V2HA 2X7HA 2H65A 5K45A 4WBSA 2UVQA 2EGHA 3EFEA 4PSDA 1RYZA 3K9LA 2P6PA 4YQZA 2V8OA 3EPRA 3N2IA 1TFUA 3TKLA 4AKEA 2OBYA 4RMGA 2ZRQA 4WOCA 4BZWA 5AW6A 1KO8A 1KKLA 1KEKA 1JI0A 2WIDA 4DN6A 1TFRA 1QYWA 1ULTA 3Q5DA 3C8MA 1WNTA 2RC6A 4O29A 2AH5A 1ZGZA 5AJZA 4F5ZA 4XGIA 6LDHA 1E5QA 2VA8A 1ATZA 2PUCA 3SC4A 1L7PA 1CPYA 5L7YA 2FZ4A 4OIMA 3OIYA 4MIKA 2G4CA 3A9VA 5AK5A 1EE2A 3GZTB 4B76A 1X7YA 4YLEA 4BJHB 1IZ8A 4DIMA 1IUPA 3JX9A 2EZ4A 5D1NA 3HJAA 4V03A 5CDTA 2WSLA 2FDRA 1NP7A 1IY2A 4QAJA 4EHBA 2NLOA 3FOBA 3IMKA 1Y4DE 3SYNA 1U8CB 3Q87B 4B43A 4RTOA 4FGSA 1UBNA 4FFWA 3F47A 4H27A 5JYBA 3IUQA 2QTFA 1B4DA 5EWMB 4DHWA 3WTBA 2BM1A 2D54A 2J4DA 1SVUA 1ZJ4A 3VBEA 1GZVA 1EAMA 3EVBA 1Y6GA 1EWRA 2RG1A 4JLJA 1R0XA 1YXMA 3JCZA 5JMWA 5IM4F 3OUUA 1DMRA 1QIEA 2P27A 1BEUB 2P40A 3GI1A 4XPIB 4DZZA 4BGDA 5F9HA 4TUYB 4XSGA 5JARA 3WIEA 3PCXA 5FPHA 4QU5A 2WNHA 1NUQA 4GPBA 4QOGA 3FFBA 1K2VN 3EVAA 1OLSA 4B17A 3OZUA 4X3CA 3MINA 4R7ZA 3MN1A 2A57A 3DWGA 3NASA 3TIVA 1JECA 1IPFA 3MWYW 1RDFA 1M1XB 2DHRA 5AVXA 1VZ3A 5KUTA 3GLTA 2IWRA 1F7UA 1P60A 4E30A 2YRFA 2YV5A 1SQ5A 2PRZA 5GONB 1F14A 3LXXA 1Z33A 5JAUA 3ILVA 2PV0A 4IIXA 3VR4A 3ZH9B 4RLSA 4HVLA 4TT8A 2H11A 4LHZA 3AZQA 4NXMB 4IDNA 3RARA 1ABBA 4Y98A 1MX5A 3N74A 4I7EA 2A9PA 4GG1A 3UGJA 3CNLA 1THMA 4OFBA 3FDZA 3OFNA 3V1UA 3ZQUA 3O8OB 5KREA 1K5PA 2AG6A 5T4EA 1GUYA 3K2IA 4LGVA 4U5QA 5DLEA 3TSZA 2WWTA 4J3JA 1W75A 3O6VA 1YQEA 3PX3A 1RR6A 2VTVA 1B1AA 1QKIA 1STOA 4J49A 3VSAA 1H3FA 4J7CA 4DDWA 4MPDA 2VNHA 3H2YA 3M3PA 3E9RA 1XMQB 1P91A 2OBNA 4K0RA 1W4ZA 4PZPA 3QE3A 4YROA 2W2LA 1FDTA 3DMTC 4AU1A 4J1TC 1JDBB 2C7VA 4BX3A 5HMLA 4TRRA 5C18A 4NIMA 2FSVA 4Z9XA 5EUQB 5FEMA 3RANA 9ABPA 3UMRA 2YWGA 3DE4X 1XF1A 1Y63A 3ZK9A 1X8XA 4AUMA 3T3GA 3OMXA 1DV2A 3BSFA 3IE1A 1LS1A 1U8AA 2IUUA 4RQAA 4B2LA 2QE6A 3R5JA 4CLRB 3JD4A 3LFUA 4LG1A 4D8YA 2V3CC 5IZCA 4G0YA 4M1OA 1LBEA 3PRKE 1AS0A 3SC2A 4DJAA 1W96A 2H17A 4K6CA 2V9CA 3I2KA 2O5RA 2PK3A 1PJLA 1H5UA 2OGTA 4MV0A 2W2KB 4MWCA 3CJQA 4BO2A 4ZA2A 5BWBA 2P2CA 2Z2ZA 1O4WA 1SCAA 2AMFA 4YCBA 1XAHA 4GDMA 1Q0HA 2CY0A 2E0IA 1Z4KA 3AI7A 5DXAA 2JLYA 3KYIB 4RFSA 4E70A 3IVMA 1NVBA 3E9MA 4YRSA 2A9JA 2VSFA 3EC2A 3KS9A 4PFJA 3QKSA 1L7RA 4EGCB 5JZSA 2OQRA 1XXHA 5L4LA 1RJEA 3BFVA 3IFSA 3KKZA 4YP6A 5FWYA 2RJ3A 3FBWA 1EBBA 3GLRA 1U3UA 3PEWA 3PI7A 4ZYVA 3MHTA 3K72B 4TXNA 3BEOA 3G88A 3A3YA 1BQEA 3MCUA 1J2EA 1XMOB