4QQRA

Structural insight into nucleotide rhamnose synthase/epimerase-reductase from arabidopsis thaliana
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
284
structure length
274
Chain Sequence
SFNFLIYGKTGWIGGLLGKLCEAQGITYTYGSGRLDRQSIVADIESVKPSHVFNAAGVTGRPNVDWCESHKVETIRTNVAGTLTLADICREKGLVLINYATGCIFEYDSGHPLGSGIGFKEEDTPNFTGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLTNPRNFITKIARYEKVVDIPNSMTILDELLPISIEMAKRNLTGIYNFTNPGVVSHNEILEMYRDYIDPSFTWKNFTEPRSNNELDATKLKTEFPELMSIKESLIKFVFEPNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3,5-epimerase/4-reductase
publication title Structural insight into nucleotide rhamnose synthase/epimerase-reductase from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 96
structure length 274
sequence length 284
chains with identical sequence B
ec nomenclature ec 1.1.1.133: dTDP-4-dehydrorhamnose reductase.
pdb deposition date 2014-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4qqrA00
1YL5A 1DJQA 1O5IA 2WE7A 1ZH8A 3H3JA 4FBGA 1P31A 4ALKA 4I9UA 2VZ0A 2WYWA 5JC1A 3UAGA 2IYPA 1NR1A 2IZ1A 3VDQA 3LYLA 3WFIA 2NTNA 1FMCA 1ZXBA 1R4MB 4L73A 3JQ9C 1YL7A 1HZJA 3PYMA 4FSHA 3AOGA 3T7EA 3CMMA 4ZU3A 1IZ0A 4DPKA 2A35A 5JMPA 4Q3NA 3PDUA 1CDOA 3PXXA 3G3EA 3GLQA 3L4BC 1PQUA 3NKLA 2EXXA 4WLOA 2PNFA 4HNHA 4KWIA 5U1PA 1IL0A 2AW5A 2BFMA 3WYCA 3HDYA 5FFFA 4OXNA 4PZEA 4J2HA 4ND1A 3TFQA 5JY6A 3VH1A 4RF2A 4EJMA 2Z1MA 5IN5A 3I9JA 3GF4A 5L7WA 5LDHA 2I76A 3GNTA 4E13A 1D1SA 3W6UA 1GADO 4AVYA 5CDSA 2Q99A 1VL8A 4TKLA 5CDGA 1FK8A 5A9TA 1UP6A 5I7EA 4WLEA 1VLLA 4I5GA 5ITWA 3TZHA 2HMVA 4E33A 2PGLA 5EJ2A 4ND4A 3QW2A 2QZZA 4OSOA 4ZA2A 1C1XA 3PPIA 4YJHA 4YJGB 3LF1A 3E48A 1EEHA 4J90A 5DULA 4CQMB 3CH6A 2I67A 2VYND 1PIWA 1QMGA 3QQPA 5IF3A 1KETA 3HHPA 2DTXA 1E92A 1BDBA 1XU7A 2WE8A 1T2DA 3H9JA 1TT5A 1JVSA 3L4SO 5BNFA 1U2GA 3WX0A 4CM9D 5CG1A 1JW9B 5A1TA 4RF5A 1UXJA 2TMGA 1A27A 1ADGA 1QV7A 2OORA 1TEHA 1L7DA 4UVGA 1BXGB 3KYCB 3CSDA 5KJ6A 3ZWVA 1A9ZA 3JYPA 3JD1A 1ARZA 3QWBA 1QORA 2H9IA 4KOAA 4LN1A 2X4GA 2O3QA 4J7CA 4R9RA 1MFZA 5T6BA 1O89A 3QVTA 1E5QA 4ZN6A 1DBVO 3PTZA 4E21A 3HDHA 2P68A 2DKNA 5MDHA 2ZK7A 4LMRA 4E5KA 3ONDA 1MC4A 4NK4A 3WMXA 1GYRA 5TIIA 4AJOA 1E0DA 2NUAA 3GY0A 5J23A 1AHHA 3A14A 4D3DA 3UCFA 4NBVA 2JL1A 4ZQBA 2PGJA 4LVUA 2G0TA 1YQGA 2NACA 5CHEA 3L4BA 1D7OA 1YOVB 4BO5A 3K92A 3ASVA 2W2LD 5GY7A 2EW8A 1HDGO 4O0LA 1DAPA 1M75A 1YGYA 2XF8A 1I33A 1KEPA 3FI9A 4BO0A 2DTEA 4N54A 3GOHA 3ASUA 4MVJG 1N1GA 1QLHA 4WLUA 3F5SA 4GWGA 1PJBA 3C7AA 1E7QA 1KVUA 5IZCC 4Z0PA 3IAHA 3TF5A 3LF2A 3GNQA 2BH9A 4W7IA 5IXSA 4EZBA 1RYDA 2HAEA 2C5AA 3WGTA 3PDJA 2ZYDA 3QVOA 1NVMB 2W2KB 3WGQA 3DBRA 1ULSA 3LDHA 3SC6A 1ZO8A 1GCUA 1YBVA 1UXGA 2RH4A 3I4FA 1G0NA 1F17A 3W8EA 1VL6A 1FF9A 1DOHA 2VOEA 3I1JA 5A3VA 3DOJA 4RL6A 3JD4A 3BYZA 4Y8VA 4ZQHA 2D2IA 4RLSA 3VTZA 4E2YA 4QEDA 3RUCA 2WD7B 3KBOA 3ENKA 1JVBA 2D5CA 4R4JA 1I0ZA 5KTKA 4BMVA 4KUHA 1VPDA 2IE0A 2E4AA 4GAEA 4JJGA 3E1KA 1Y8QA 3KYBA 3PVZA 3DZHA 1U8XX 1F8GA 3JQ8A 1HDRA 2QIOA 3HADA 4OXYA 4R68A 5ER9A 1PZFA 3U49A 4GMFA 4AJNA 1TXGA 1ID1A 2YUTA 4NMHA 3C7DB 4NFYA 5DDIP 2V65A 1BRMA 5I7SA 1MGOA 1PS9A 3V1UA 1HE3A 1IPFA 4WCFC 2CDCA 1VSVA 4YXFA 4BNYA 3HN2A 4LSMA 4TRJA 4PRKA 4IS2A 2F1KA 4NZ9A 1J0XO 1VE9A 1L1FA 3GR6A 4G5HA 2GD1O 4GX5A 1HTBA 5HS4A 1DDOA 3IUSA 1TVEA 3DAFA 3ZNOA 3DBHA 4NDNE 4XIJA 5DBFA 3MEQA 5JDIA 4PLZA 1ADFA 4DREA 4IMPA 4Y6SA 3M1LA 3MJSA 2H5LA 4Z0TA 1N2SA 1JN0A 3S2GA 1P44A 1T2FA 4JP3A 3PI7A 4K9DA 3D1LA 1P1JA 3LLSA 4J16A 4E2XA 4BKOA 3H65A 3LC7O 4KUGA 1GPJA 4P4GA 3MTJA 3VPHA 1N7GA 4WNCA 4L4XA 5EL0A 1DLJA 5L7YA 1UAGA 4LCEA 1ZK2A 4I08A 4CL3A 5ICMA 3FD8A 2Y1OA 4ZQFA 2YV3A 3RSHA 2DC1A 2RCYA 3D4NA 3HJAA 3JQGB 1Z73A 4NHEA 4JBIA 4UUOA 3MCVA 1A71A 2EJVA 3R6DA 4JNKA 5CP8A 3D5QA 1ML3A 2JCVA 4O6VA 4R5HA 4WJZA 4RZHA 3ST7A 3U4HA 4AJ2A 4EW6A 5HTOA 1BMDA 4Q3DA 4FFLA 2D0IA 4P4NA 1P0FA 5A04A 2VWGA 3OJEA 1GZ4A 1ONNA 3RUDA 1QXSA 3EW7A 3K73O 3RC1A 2VHXA 3DXFA 1I3LA 2CY0A 2J5KA 3ANLA 4YT4A 3NAQA 1WMAA 2P9EA 1JAYA 3UCEA 1PJLA 3QVWA 3OIGA 3LC1O 5JO9A 3B6ZA 3WIEA 4HFNA 4L9RA 4BNHA 3V2HA 2Y67A 4MP3A 1EK6A 1QV6A 5AYVA 4CM1A 2VTDA 4MVJE 4QTZA 4J1SA 4UAGA 2OXIA 1Y7TA 1Y1PA 1E1KA 3HN7A 4CQMD 1T4DA 2CF6A 1D3AA 2WYVA 2E6UX 1WZIA 3WLEA 3I6QA 4QX6A 3H2SA 3LZ6A 3AY6A 4IUYA 3ZDFA 3I9LA 1H6DA 4P4LA 4E4YA 5AQ1A 1BTOA 4B8ZA 3R3JA 1LSSA 1SEVA 1MV8A 2ZB4A 1E1LA 1V0JA 1RM3A 4J7XA 3GGPA 2NADA 2B4TO 1E3WB 2FWMX 3NGXA 1R4NB 3FTPA 1HDZA 3AM5A 1XHLA 3ZWWA 4D0RA 4YAJA 1GYPA 3FPCA 1YB4A 1GUZA 4PLFA 5ENDA 2EIHA 3ZU2A 4J0FA 2GCGA 5L51A 2ZYGA 2EJWA 3B70A 4CV2A 2WD8A 4AG3A 3GEGA 5KWEA 2JFFA 4OH1A 1YO6A 4K28A 1C3VA 1YB1A 1LDYA 1YB5A 2IEDA 2P5YA 3AUAA 4XKJA 4IQGA 5KCZA 2FSVA 1RJWA 1N8KA 3H9QA 4S3MA 1PGPA 4H15A 2B5WA 3CE6A 4U0JA 4YPOA 2YFQA 4OKNA 4XGKA 1CETA 2HK8A 3PQEA 5LCXA 4BO9A 3GPDG 1T2AA 1TT7A 1WMBA 3DBLA 1HLPA 1ISHA 1RPNA 1X15A 1X7HA 2PV7A 5JBIA 1ZK4A 1LC0A 3JD2A 3KZVA 4IPTA 5FI5A 3GZ4A 1T4BA 4M1QA 5KVVA 3UH1A 1E3EA 1EBUA 4DL9A 5JW6A 4BNMA 2G82A 1ONOA 5THKA 4OXKA 2FY8A 4FW8A 3VPSA 1LSOA 2AQKA 4CM7A 1H6AA 4A7PA 1ZBQA 2P5UA 4CQLA 3JV7A 4DIBA 4UUMA 2Q3EA 2VNSA 3OH8A 3QWAA 1EUDA 5KJEA 3UGKA 4J1NA 3MJ4A 3BHJA 2A9FA 2OBYA 1DEHA 1D4FA 4HFMA 1X0XA 3RKUA 4CLHA 5C7IO 4BNJA 1ZFNA 1OI7A 3K5PA 3JTMA 2SCUA 1I10A 4ALMA 1A72A 4WLFA 3GAFA 4XJSA 4AL4A 2XOXA 3GRPA 4XR4A 2Y0DA 4PGFA 1H0KA 4OHUA 1T2CA 1E3IA 4PZCA 1E7WA 1YJQA 2NVUB 4IJUA 5HRUA 1ZVMA 3DBVO 3WB9A 4XIYA 1E6EA 1UZLA 1M6HA 1FDVA 1PJ3A 2BHLA 1DHTA 4R1TA 1FDSA 1NAHA 1LQUA 1ZMOA 2HMSA 4B4WA 3SVTA 4O59O 1HETA 2Q4BA 3JCZA 3O03A 5K6AA 5AXDA 4MVJD 2JHGA 2ZB8A 4Z9XA 1VKNA 4BNFA 4D0SA 1NHWA 2V6MA 3WSVA 4MP6A 1U3WA 1CQIA 4FFOA 3JYQA 3ZZNA 4QUKA 2O50A 4FD3A 2YHUA 1YDWA 2NSDA 3BHMA 3ANNA 3C8MA 2QRKA 3QHAA 5G0VA 6LDHA 4L4RA 1IPEA 4TZKA 5TF4A 1CERA 4IXWA 1QSGA 5G0UA 5KKAA 1NM5A 4ND5A 1GQYA 3M2PA 5IDYA 1Y5RA 4GLOA 2GZ3A 2JCYA 3H9GA 4PG8A 3U4DA 1DIRA 3E5MA 2HKIA 2ZIZA 5EQFA 1BGVA 4D7AA 1NPTO 4RDIA 2I3AA 4QO7A 3PHIA 4GWKA 1E3LA 1IHXA 3DMYA 3FSRA 3G1TA 3WYEA 3TZKA 5DBIA 1DJNA 3NDJA 3I4CA 3FF4A 4BS9A 5JNLA 1SOVA 2WWRA 2GLXA 2UYYA 1A7AA 3RFXA 3WGYA 4R1SA 3D64A 2AEFA 5B1YA 3VZQA 1T24A 3C1TA 4Y6PA 5CEJA 4U8GA 4GMGA 4RVHA 5ADHA 2VN8A 5HS6A 3PEFA 1QP8A 1EQ2A 3CINA 2FPPA 3JD3A 4WLNA 3MJVA 3X2EA 1N92A 3D7LA 2NVWA 5TJHA 1C0PA 1CF2O 3A9WA 3KB6A 2O3RA 3HFGA 3WQSB 3KSUA 1QLJA 4R1UA 2O7SA 3JQFC 4YJDA 1U1IA 1EMDA 3RC2A 4YJGA 2B4RO 3JYLA 4KUEA 2J3IA 3MJTA 5DT9A 2HMWA 3QRWA 4I8XA 3H4VA 1ZKMA 2AQHA 1SB8A 4WCFB 3DMTA 2BFOA 3WYBA 4I9NA 4DBVO 4UEOA 4YAKA 2X9GA 3LQFA 4GL4A 2NU7A 4D3SA 4XYMA 2ET6A 1W0CA 4JXKA 4PLHA 4IJKA 3GVIA 1FJHA 1WVGA 5TC4A 2OOSA 2AQIA 4E5NA 2GDZA 1HEUA 2DU8A 3Q3CA 1G0OA 1E6WA 1U4OA 3PYXA 3F6YA 4GBJA 4CUKA 3KYCA 5BNIA 4FB5A 2Q46A 3TJRA 3ZNPA 1DAOA 1ZSVA 3H6KA 2UVDA 4J2OA 1QYWA 4JBGA 2CVOA 5EPOA 1DRUA 3AU8A 4YTEA 3KYDA 3WSWA 4W9NA 4I5FA 1SZJG 3GGOA 4QSMA 2GERA 2UAGA 3EC7A 1B3RA 4URFA 2B37A 3H2ZA 5G4KB 1BW9B 3AWDA 4U5QA 1H2BA 5TSDA 3IKVA 2DPHA 1AXEA 1H93A 3COSA 4QFDA 5A5EA 3AUSA 3JQAB 1QYDA 3S8MA 4OKIA 5JPIA 5L53A 4GSLA 1JWBB 4C7JA 4ONEA 1D1TA 1Q7CA 1LDGA 1V6AA 3PGXA 2GO1A 1EVZA 1JKJA 2XPCA 2HMTA 2O3TA 4CV3A 4CMBA 1QYVA 2WJPA 5KVCA 3GZNA 3ULKA 3WTCA 4ZRMA 1BSVA 3NRCA 4FQ8A 4EJ6A 2BGKA 3D5TA 3ZU5A 5DN9A 1CRWG 1LUAA 4J0EA 4FN4A 5KVSA 2HMUA 2B36A 4IY1A 3ZHXA 4MINA 7ADHA 1DRVA 3UUWA 5B4UA 4HV4A 2Q50A 3JSAA 4EUHA 1EUCA 1ZXLA 2XAAA 3DZFA 2V6FA 1A7KA 3GA0A 3JQ7B 3ZH2A 3VKVA 3BIOA 3NUGA 4QO8A 4XQGA 4RPLA 5H82A 3AOEA 5A3JA 3GFBA 3RCBA 2YHIB 2DBVO 4PLCA 4J43A 4L74A 4U6QA 1HLDA 1NFQA 3DWFA 1GUYA 2WSBA 3KLPX 5BSGA 1YQXA 4JX8A 5ER6A 2JD1A 3UW3A 2GN4A 3IJPA 3L0DA 4EBFA 5BQFA 4CM4B 1ENPA 1JKIA 2E49A 1CYDA 3ROQA 2X5KO 3RUHA 3GNSA 2DTDA 5F1OA 4GKVA 2VHZA 4FOSA 2NVBA 3RKRA 1ZK3A 4FS3A 4BO8A 3BHIA 4ITUA 4W4TA 1GCOA 4XYBA 1MFPA 1UAYA 1P1KA 3QVSA 2D59A 3TL3A 5F5NA 3NEPX 3ROMA 3Q0EA 4WUVA 3KEOA 4BB5A 3RU9A 4BO2A 2VT2A 3ROKA 4MVJA 1SB9A 2GUGA 1WW8A 1QKIA 4DC1A 4NPCA 3VOSA 4XRRA 4XCVA 1D8AA 4B79A 4DA9A 2PGDA 5H83A 2GYYA 1PJTA 4WPGA 3G1UA 1N7HA 2GASA 2FMUA 3JYOA 1PZEA 4BB6A 5ILOA 3DR3A 4IS3A 4RPKA 1BDMA 5GMOA 4NJMB 3DHEA 1XGKA 4NQZA 4NFHA 1Y81A 4NU6A 5EN4A 2EF1A 4GVLA 2JFHA 4CLRA 3PQFA 3BAZA 4O5OA 3AM4A 4XZ3A 1O8CA 3KM0A 3E82A 2PY6A 1CWUA 3A4VA 3CXRA 4E5MA 1PJSA 2JCXA 1PGNA 1PGOA 2RAFA 1WAMA 4R41A 1NFRA 3WGGA 2C07A 4XB1A 3VAZA 1AXGA 4WNIA 3FNFA 5TLSA 1PGQA 1K6IA 3UXYA 3DZJA 4KZPA 3SX2A 3E5RA 3A28A 5A9SA 2VYVD 4TMFA 1B3BA 3OA0A 5I8WA 2DFVA 3WLFA 1YDEA 3NYWA 3VH3A 3RWBA 3RROA 2DFDA 2DQ4A 3PJGA 1NWCA 2FSSA 5COBA 1YQDA 2Y93A 4RGBA 1U5AA 4B7UA 1PZGA 3VH2A 1B7GO 1MA0A 1O94A 3W6ZA 3MTGA 1TI7A 2FR8A 2IZZA 2C2YA 2GSDA 2EP7A 1C1DA 1N9GB 3ZWPA 5FWNA 2J5QA 3JYNA 5JY1A 4J1TA 4MKRA 4YR9A 3AI2A 3INRA 3IQDB 3WQRA 4NNJA 1HWYA 2EHDA 1ZJZA 3ZV5A 1C0LA 3S2EA 1EDOA 5AXAA 2C7GA 2AHRA 4M54A 4F46A 5EERA 3E9MA 1X0VA 4QXMA 1NHGA 3P7MA 1IOLA 2G5CA 3TN7A 2D1YA 4G81A 5EMHA 3GVCA 4L4SA 1HE4A 1WP4A 1O0SA 3WNQA 3WTBA 1YBMA 1AHIA 2BF7A 4PRLA 4KDFA 3U9LA 1ZMTA 5DCWA 2X22A 4EUFA 5U4QA 4GX0A 1V3VA 2E48A 2CNBA 1U8FO 2H1SA 4FCCA 3N7UA 5F21A 1HRDA 1QYCA 3ITKA 4Y9DA 3K2EA 3GHHA 4ZVVA 1R4NA 3JD0A 2QRJA 1LC3A 3L6OO 5ICSA 1YL6A 2B69A 3MOGA 4YRDA 5JDIC 4BKQA 1P1HA 3ZWAA 1LDEA 4PN3A 5JLAA 5A9RA 3OIFA 1GAEO 1HDXA 2EEZA 4HUJA 1K3TA 1KERA 3ICPA 3WOHA 3JQAD 4L76A 4BNIA 3GMSA 1E5LA 1H5QA 1LLQA 1ISIA 3INGA 4PFJA 1UXHA 4IDGA 2C59A 4PG7A 3WGOA 1P1RA 3F1LA 2FP4A 5BNTA 5JCJD 3EZLA 4NIMA 5U9CA 3K30A 4OSPA 5CPFA 4FIZA 4E6PA 1GQQA 3D3EA 2QYSA 3U4IA 3RBVA 4WOJA 3ETDA 4MKZA 4M89A 1CQJA 4FJ1A 2C5EA 1RWBA 2VT3A 1YVEI 1W4ZA 4G65A 1K0UA 1NP3A 5G2OA 5KJCA 1P77A 1G6KA 4YRAA 2HSDA 2H6EA 4J4BA 2EGGA 3EGOA 3W4JA 1BXKA 4ALIA 4BO7A 1LX6A 2VUSA 3HB5X 1C14A 1P1FA 2VRCA 4ZGWA 1T1SA 3MWEB 1P33A 3LC2O 4DTIA 3WIDA 1AGNA 1XIVA 3I9MA 3FR7A 1LU9A 2AE1A 5A05A 1QG6A 5F1PA 4ZJUA 3EVNA 2FPGA 4IDDA 2P4QA 4LVCA 3PWZA 1FXSA 1O6ZA 2YJZA 4WASA 5KNLA 4R9SA 1ENZA 2PA3A 5CFZA 4DYVA 3MJEA 4RV9A 3V5NA 3I3OA 4YAEA 4U0KA 5JMWA 4J91A 2HJSA 3E8XA 3KXDA 3OETA 5IFLA 1JLLA 3GMDA 3UCXA 5K9ZA 3H5AA 2FR1A 3H5NA 2AG8A 4NFSA 2H63A 4Z6KA 4DQVA 3FNEA 4J49A 1VJTA 1I24A 2ZQZA 4UULA 2P4HX 4OO3A 3LU1A 2DUUA 1E1NA 3ADOA 4IDFA 2ZTUA 2X7HA 3SC4A 3D3WA 4TVOA 1OOEA 2C54A 3RAJA 3C85A 4HADA 4AJ4A 4R1NA 1B8VA 1A4IA 1I36A 4AJKA 4RQTA 1B14A 3NTQA 2Q1TA 4J4HA 4EDFA 2PZJA 4E0BA 3HFSA 1Z75A 1FDWA 4DPMA 3IP3A 5IDXA 2Y0CA 1EUZA 2IZ0A 1J4AA 2Q45A 3WBFA 1GYQA 2X58A 1OMOA 4HY3A 3V2GA 4D43A 4ALJA 1GR0A 2YV2A 1IB6A 2GZ2A 5L4NA 4OQYA 3AI1A 1TLTA 1DIBA 3LK7A 3QE3A 4AFNA 3PRJA 3VZSA 1OAAA 3GDGA 1PX0A 3OFSA 4M87A 3PGJA 1XQ6A 1NTOA 1ZEMA 3S2IA 4CMJA 1GY8A 3RUFA 2Y99A 2HCTA 1SAYA 3CEAA 1KC3A 2B0JA 1B2LA 3GRKA 4BMNA 5A4DA 1EQUA 5F1KA 1DRWA 3H7AA 3N58A 4AJLA 2X0IA 4GKBA 5L95A 4N5LA 4XGIA 3Q11A 2OGUA 2HRBA 5C3MA 1XYGA 2NV6A 2VNAA 2RH8A 2NTJA 4CLDA 2ZJ1A 4A10A 1NBOA 1C1XB 1RYEA 2Q2QA 2VYNA 2W8ZA 4RVSA 2IYOA 5TNXA 4YBZA 3WR5A 5C7OO 1NXQA 2WYUA 1ISJA 3OJLA 3PHHA 4K6FA 5BT9A 1IE3A 1T26A 4DWVA 5A5FA 3IJRA 2OO5A 3OQ6A 5JSFA 1U3VA 1R0KA 3TSCA 4CM9A 4BNWA 2HDHA 1Z7BA 4CJXA 1TT5B 2GF2A 4LISA 1I8TA 4IQ0A 4AJ1A 3TOXA 4ILKA 1ZNQO 3ZW8A 4EEZA 3AJRA 3OJ0A 1JA9A 4PIVA 3MJCA 1XG5A 4XDYA 4CMKA 2J3KA 2GN9A 2V7PA 3QA9A 3HUDA 2GR9A 2ZTVA 1KOLA 2NNLD 4UREA 1I2ZA 5G0TA 1U9JA 2JFGA 4IDAA 3EDMA 4B4OA 3UFXA 3WGZA 2JHFA 1LI4A 5HBRA 4INAA 4K26A 2NU8A 5CEEA 4JROA 5K6AC 4CR6A 1GEGA 1Z82A 4XJTA 4LSWA 5AXCA 3F47A 4BO4A 5CEFA 3OA2A 2PD6A 4OOFA 1HKUA 1Y8RA 1Q0QA 2WM3A 4U6SA 2E37A 1R37A 3I5MA 1HT0A 2Q2WA 4MKXA 4PVDA 2O48X 4JBHA 3IUPA 2FN7A 3BA1A 5F5LA 2NU6A 3FBTA 5COQA 5AVOA 3IIEA 2W2LA 4CM8A 3VPGA 2FZEA 4WGGA 1ZUD1 4RDHA 3U3XA 3M1AA 3P5SA 3OQ1A 3F4BA 3FNGA 3ZWBA 4WEQA 2BFAA 1VL0A 4M8SA 4XQ9A 2CVQA 3WGIA 3PFFA 3ETGA 4TKMA 3KEQA 5C5IA 3R1IA 4XWYA 1ZCJA 1UDBA 4RVDA 4UVHA 2QQ5A 2ZJ0A 3AM3A 4GX2A 1CEQA 3BMNA 1ZW1A 2VRBA 3ZV3A 4XDZA 5JYDA 5DCYA 4XRGA 3K9QO 5H81A 3ZHZA 4A03A 2BELA 3DBRB 4C4OA 2ZCVA 1PQWA 4O63O 1C0KA 4NI5A 2R2GA 4BIIA 1MG0A 1GV0A 1PJQA 4DMMA 2PR2A 4BQRA 1P1IA 3JQBA 2HO5A 4UVEA 1VM6A 1XDWA 2QX7A 3DTYA 2I99A 5DCUA 2HU2A 5IDWA 2FR0A 2QRLA 3S55A 1IUKA 3VVBA 3ADPA 2ZKLA 3HWRA 4XYEA 1KVQA 4IBOA 4IJWA 2AE2A 4HP8A 4MVJP 1Y8QB 4JCOA 5JAZA 3TFOA 1IULA 3Q2KA 3WQQA 4JQCA 1EVIA 1VJ1A 1LQTA 3SLGA 4D79A 2ZATA 4CMIA 3FN4A 2X6TA 5ILGA 2OBNA 4AJJA 5TT1A 3GHYA 1M2WA 3WXBA 2X9VA 1OC2A 3DMTC 2IXBA 4IGEA 3A1NA 1H2HA 3E9QA 3JQDA 3P2YA 4PG6A 3LVFO 3O8QA 2YDYA 3E6AA 4BO1A 3C7CB 2J5RA 2BGMA 1YWGO 2Q1UA 3AY7A 1H9AA 4ND3A 2Q1WA 3DBHB 2OP0A 3IKTA 1X14A 4Z3KA 1SCUA 1U28A 4C7KA 4GVXA 4B8WA 3ZHYA 4W9NC 4TRRA 1I3NA 2YV1A 5TS3A 3RU7A 4BGEA 1U4SA 2YQ4A 4EI2A 5BSEA 3GG2A 1PS8A 4Q3BA 4D3FA 2RIRA 4DVJA 3UF0A 4FFMA 1R4MA 2E82A 1E7YA 3GUYA 4GQAA 6ADHA 1GV1A 3FPLA 4A0SA 2BRUA 5C7LO 4WKGA 4PLYA 1LDNA 1H94A 3DOOA 1UR5A 1HE2A 3GQVA 3VDRA 1DIAA 1I3KA 1PL7A 1ZJYA 3QLJA 4TQGA 1ZZEA 4IXTA 3RC7A 2G76A 3PZRA 1LXCA 3SXPA 5CDUA 5LDGA 3U4CA 1JWAB 2EGHA 3CKYA 2LDBA 2J3JA 5G0SA 5EESA 4BNZA 2RHCA 2AXQA 1W8DA 1U7TA 2DBQA 3I6IA 2IEBA 4DQUA 4MVJI 4YACA 2Y1GA 3NT2A 3KV3O 2EP5A 2X9NA 3AOEC 1YS4A 4BV9A 3KSZO 3QWIA 1GZ3A 4JK3A 1I5RA 4TRNA 3QY9A 2AEMA 4PLWA 4CPDA 2VHYA 5DNAA 3D4PA 4CQMA 3LT1A 3TWOA 1IY8A 1WDLA 4XYLA 2AMFA 4HFJA 4MOWA 1ZIDA 4E12A 3K96A 4LCJA 4ALNA 3L6EA 4HXYA 1I2BA 3D0OA 3NGLA 2Q4EA 4Q9NA 1R66A 1TA4A 1Q0LA 5B4TA 4EEXA 4BNXA 4KMSA 5GZ6A 2O4UX 3X2FA 3L9XA 3TOZA 4HKTA 5AXBA 2Q2VA 3ETEA 4NBUA 4K1LA 3QWHA 1KEVA 3RQSA 1BXGA 1LRKA 1EBFA 2V6BA 1DC6A 3ENNA 3HDQA 1EZ4A 4MVJH 3GDOA 2P2SA 5FF9A 2QW8A 3B1KA 3PYLA 5I9MA 1DLIA 4N5MA 1EFLA 4R54A 3V8BA 3PK0A 1M6WA 3ZHBA 4DXHA 4E2ZA 3DZKA 3G0OA 4FFNA 1B8UA 3T4XA 5L40A 2PD4A 3O4RA 4WECA 3KO8A 4YJFB 3OEWA 5GZ1A 3IL2A 1XWFA 3KTDA 4DPLA 2Y1EA 3CIFA 2PFGA 3DTTA 3Q6IA 2CVZA 4KQXA 1I3MA 1Y9AA 3IP1A 4G2NA 5DOZA 4KTVE 4E3ZA 3EVTA 1NASA 4R16A 1U3UA 1PGJA 1V3TA 3LSYA 1PQPA 3GUCA 4RCVA 2YQ5A 3DHYA 3Q9NA 3I9KA 4I5DA 4D41A 4X54A 2C20A 1EVJA 2P9CA 3F1KA 4WEOA 4L8VA 2OMEA 3VZRA 1NQTA 3TPCA 3WG9A 2AG5A 1YOVA 4ZQGA 1J6UA 4CM3A 3K8ZA 2UDPA 4R3WA 1YJ8A 5JAIA 9LDTA 3FRJA 3FTNA 1HYHA 1XU9A 1K89A 3H9EO 4B7XA 3L6DA 3DZBA 1F14A 1R12A 3E18A 1A4UA 1IYZA 1OZAA 5MGBA 3GVHA 3Q9UA 4PZDA 1CJCA 2VCYA 2PKQP 2FPIA 2Y1CA 3CZRA 1HE5A 1O95A 4ALLA 2ZYAA 1LJ8A 3TNLA 3ZU4A 4CQLB 2W2KA 3EUWA 1UJMA 1DC4A 1XELA 5T8KA 3PHJA 4BNGA 3HNPA 4ND2A 3WGHA 4CM6A 3BTSA 5B12A 1MXFA 2EERA 5BR7A 1NAIA 4ZD6A 4CM5A 1AUPA 3QP9A 2DPGA 2WD7A 2X86A 1F0YA 1KY5A 4EITA 1E3JA 2EW2A 2Y1FA 5IAAA 3ICCA 3O38A 4OM8A 4Q3CA 4YT5A 1MLDA 1MUUA 2JJYA 2A4KA 4CLOB 4IDCA 1QYXA 4CMGA 1GQ2A 4WE3A 1X1EA 1YONA 5COAA 4F6CA 3WS7A 3NDIA 1PJCA 1NQ5A 3ZW9A 2JKVA 1E77A 4FJ2A 4DIFA 4F45A 4U7WA 4UVDA 1JQBA 2FZWA 3GAZA 1YKFA 3TZ6A 1M67A 3OEYA 4RPHA 1DC3A 4BQPA 4PCVA 3VHRA 2Z5LA 2ZTMA 4OOEA 4NBTA 3AW9A 4II3A 2VWPA 4Z9FA 2X8LA 5G0WA 5CPBA 2GRAA 4QECA 3HQ4O 3RUAA 1DSSG 1MB4A 3I52A 3L77A 1LBEA 4CMHA 2XXBA 3MOIA 5F3RA 2XXJA 4J7UA 8ADHA 1OC4A 1ENOA 1ADCA 3GG9A 1K6XA 1X1TA 1Y9EA 2NTVA 1S7CA 3NT4A 4OQZA 1QR6A 3SJUA 4ROSA 1V35A 1WPQA 3WFJA 3CTMA 4RVFA 1KIFA 3U0BA 5JC8A 4CMEA 4EYEA 1VI2A 1G1AA 4I1IA 5JAQA 4RPJA 3H3FA 5EINA 1P74A 4AJEA 4BKRA 5BSFA 2NWQA 5I9NA 4R69A 2Y68A 1GFSA 1YBAA 3JQGA 4BHTA 3PJEA 1DPGA 1PR3A 3ZGYA 5JDCA 4RVUA 4TVBA 1ONPA 4B3IA 1PJ2A 2EWMA 1UZMA 2PZLA 4CR7A 5JYEA 3JQCA 2VWQA 4CV0A 1OBFO 5HWSA 3O9ZA 4YA6A 1I32A 1Q7BA 1UUFA 2GN8A 3GVPA 4GLLA 3OMLA 1R15A 3QSGA 2EKLA 4PVCA 4BMSA 1PWZA 1Z7EA 2BGLA 1XR3A 3R0IA 2ZB3A 3RFTA 3KSDO 1PR9A 4NH4A 3GN2A 1C0IA 2FHSA 2QZ9A 2VHWA 1NWHA 5KJFA 2PWZA 4BKPA 2IRWA 5TGDA 1R6DA 2ZQYA 3ZI0A 1DHRA 2F00A 3PJFA 4UVIA 5CG2A 4IJVA 1NYTA 1KVTA 2R00A 4M49A 4F3YA 1E7SA 1U2DA 4FOOA 1XQ1A 1V8BA 4TSKA 1ZK0A 1PS0A 2J8ZA 2DT5A 1EFKA 4DIOA 1SOWA 1NPYA 4NU5A 3G17A 1VC2A 4H3VA 3ZV4A 5KJ1A 4XQCA 3EY4A 3BMOB 3TZQA 1DC5A 3ZWXA 4A26A 1WZEA 5IG2A 3P19A 1B0AA 1HXHA 3BMCB 1LTHR 2CDAA 4H7PA 1PJ4A 1SC6A 4HFRA 2X5OA 5KKCA 4FPXA 4MPDA 1E3WA 1LDMA 3F46A 4IIVA 3VPXA 3OF2A 4TWRA 2HQ1A 3ABIA 1GEEA 2BFPA 3KYDB 2DM6A 1KYQA 3IS3A 4E30A 5TX7A 4IGFA 1W6UA 4XQEA 2JAPA 1LDBA 4Q39A 2UUOA 3IDSA 3JQEA 4A27A 3W4KA 4CL8A 3WWZA 1SBYA 1CIVA 3JQ9A 4UEJA 1NVGA 4YYZA 4IDBA 1RM0A 1BHSA 1ADBA 4DLBA 1VRWA 3GZNB 2DBRA 2O2SA 3MWDB 4FR5A 4XEHA 5I9LA 2ZTLA 2UV8A 3DO5A 4BGUA 3HB4X 3P2OA 4MVJM 3OBBA 4P38A 4PG5A 1X7GA 3RVDA 3W8FA 2B5VA 3GGGA 1B15A 4CV1A 4MIEA 2EV9A 4JJFA 2VQ3A 4PLGA 1E7RA 2POQX 3PFWO 1JDJA 5TT0A 3E9NA 2O3SA 2OP1A 1B26A 3OSUA 3ZCXA 1Y5MA 3RC9A 2HJRA 3DQPA 1HSOA 1RKXA 5DBGA 1EDZA 3DZIA 3BMQB 3OJOA 2GZ1A 4KQWA 3T4EA 3G49A 4M86A 4N18A 4A73A 3NV9A 7MDHA 2VZ8A 4MIOA 1Q1NA 3FBGA 1WNTA 4CMCA 2JD2A 4IQ8A 1NX6A 2X5JO 3DHNA 4BKUA 4O1MA 5A06A 4RQUA 2W98A 3K2BA 4CR8A 4K6CA 3VTFA 2VZ9A 1HZZA 2YDXA 2Z1NA 2P9GA 4BUCA 4D45A 1LSJA 2NVUA 3NTOA 4BO3A 3PJDA 3QV1A 4IZHA 2OHXA 3EHEA 3ZWOA 2PLAA 4R5MA 2FRDA 3HE3A 3E03A 1LA2A 1LLUA 3KOUA 2Q49A 3OM9A 1ZK1A 1DIHA 3QWFA 4OJNA 4AJPA 3PLRA 2V6GA 3WWYA 4DYDA 4ZHSA 4Z3DA 3WNVA 2D3TA 1R16A 4A5OA 3V1YA 1JKFA 3ON5A 1PZHA 4YB8A 3HG7A 1SNYA 4FDAA 3B1FA 2GGSA 4LW8A 4WOKA 1WWKA 2QYTA 4FFRA 2Y0EA 4E5YA 3AFMA 4FJ0A 5T64A 4ZQEA 1Y6JA 3W1VA 2C29D 2D5AA 5T5QA 1BVRA 3ONEA 4ZICA 3SEFA 3S1LA 3VVCA 2VTEA 3EMKA 4LRTB 4DC0A 3BXXA 4RPGA 4NJOA 4D42A 5IZ4A 1KC1A 4UUNA 4AICA 3LLVA 1Q7GA 3OIDA 1GL3A 4IM7A 4LRSB 4CLRB 1E7MA 1BVUA 2PD3A 2D8AA 3I83A 1W73A 3I9NA 4KWHA 1UDAA 4HWKA 3W8DA 2VUUA 3BTOA 1KEWA 4PLTA 3DB2A 3DDNA 3LT4A 4GX1A 3DZGA 1R0SA 1LRJA 3RI3A 1IZ9A 4KP7A 3MZ0A 4HBGA 1KBZA 4LK3A 4Q3AA 4Y98A 1E3SA 5IZCA 3ANMA 4GGOA 4RLHA 3C24A 4RZIA 2VYVA 5HA5A 2VHVA 4B4UA 1LEHA 1B8PA 2C0CA 3INTA 1KEUA 3PIIA 5A9SB 3D4OA 1HDYA 3BTVA 1XEAA 5GZ3A 2VWHA 4N5NA 3NJ4A 1F06A 4B3JA 3F9IA 4GPD1 4UUPA 1PSDA 3H8VA 1UH5A 3L9WA 4GI2A 1DO8A 2GNAA 2IXAA 4P22A 1ZEJA 4L0QA 4YJHB 3ROPA 5JAMA 1UXIA 1JAXA 3SJ7A 1YE3A 2R6JA 4HX5A 1DIGA 3RFVA 4OAQA 4CUJA 2Q1SA 1PL8A 5L45A 2YFHA 3NX4A 3BTUA 3ZU3A 3JQBC 4D46A 3CMCO 2ILTA 4NK5A 1C1DB 2JD0A 5EIOA 1E6UA 1J49A 2A94A 4A2CA 3DFZA 4RORA 3PIDA 5G4LA 3GK3A 5CDYA 5JXWA 4DLAA 3TDKA 2O2YA 1XA0A 4BNLA 3KUXA 2C82A 1OFGA 1ZSYA 4FGSA 1PU2A 5C37A 2NQ8A 1F8FA 3V1TC 3M2TA 5IXYA 3DL2A 2O3JA 4BGIA 3ZNQA 4TZTA 2RHRA 4WCFA 2AEJA 3A06A 1L7EA 2AA3A 4H16A 4W99A 2PTGA 1GTMA 4OL9A 1Q0HA 4EUEA 4FC6A 3LT0A 4MO2A 5T57A 4QQRA 1UZNA 3RUIA 5T67A 4DLLA 1MX3A 1EE9A 1XLTA 3KHUA 4J3FA 4AJIA 1N5DA 3O26A 2CD9A 1XSEA 2D4AA 3C1OA 4Y67A 1BXZA 1X13A 3FHLA 3RJ9A 3B1JA 1DXYA 1PTJA 4YQYA 3STHA 1UXKA 5JS6A 2I66A 4JP2A 5ES3A 2O4CA 2I3GA 3U5TA 3K31A 1XKQA 4DGSA 2X23A 2HUNA 4YJFA 5K0ZA 1VSUA 5G4KA 1BW9A 3EAGA 2OUIA 4LMPA 4MIYA 1P9LA 4XD2A 2X0RA 2WMDA 3JQAA 5L4SA 3H9UA 3RBXA 5L7TA 3DONA 1ENYA 2EKPA 3F4LA 5JCJA 3NJ8A 4E2WA 1GU7A 4NR0A 2VOJA 5TJ9A 2OFPA 2CSUA 2NM0A 3WDSA 2DBZA 4EJ0A 1A5ZA 1U7HA 5JE8A 3PWSA 4TRMA 1T25A 3RD5A 4R01A 3HDJA 4UEKA 3DAPA 3GH3A 1NPDA 4B3HA 5DF1A 4B4VA 4QFCA 9LDBA 1HYEA 2I65A 2Y05A 3IC5A 1NR7A 4IZIA 3WBBA 2BMAA 2JAHA 3SBOA 3JQ7A 1MP0A 1Z45A 4YRBA 3ZWNA 2Z95A 2WTBA 4II2A 3EZYA 1SEPA 4HNGA 4J1QA 3TRIA 2YHIA 2QG4A 1Z6ZA 5TRTA 1NFFA 3HZZA 3PHLA 4J4TA 2IODA 5I7FA 4XA8A 3ZNNA 3ITDA 4BVAA 1J5PA 3V2UA 4BNVA 3ONFA 3JQ8B 4JN6B 4JGBA 1VKOA 1H6BA 4OIMA 1GZ6A 3OHSX 3QIVA 4CM4A 5L3ZA 1P3DA 3VKUA 2NLOA 3TQHA 3OECA 1IHYA 2WEKA 4BGVA 1NQAO 1V3UA 1KVRA 5KIAA 4JIGA 3BZUA 3EYWA 1B16A 2P91A 4YQZA 1WXDA 2BI8A 1U5CA 3W4IA 5THQA 1DB3A 1QRRA 3EK2A 3AY3A 4CLXA 4IIUA 2BI7A 3GT0A 2PZMA 4W82A 4CLOA 1DFIA 3NDRA 3Q2IA 4RF4A 1E1MA 3UOGA 3ZWMA 4Q3EA 4RO0A 1K5HA 5B4VA 2PH3A 2QHXA 3WMWA 2I9PA 3M6IA 1Q2XA 4IINA 1EK5A 1LLDA 1P45A 3AI3A 2A92A 3RASA 3D3WB 4XYGA 4YT8A 3CUKA 3PHGA 3ORFA 4R51A 1WLYA 4BNKA 1LNQA 4Y6RA 3UN1A 4MJLA 3PZBA 4WK6A 3RIHA 2BLLA 3WJ7A 3ZWCA 4NBWA 4IDEA 4S1VA 2GPTA 4R3NA 3QJ5A 4CMAA 3Q1LA 1Z74A 2DUWA 4CLEA 2G1UA 2CMDA 4NJMA 2PK3A 5IN4A 1RM4A 1KS9A 2BKAA 1AN9A 3GPIA 4Z9YA 4YWJA 1HDCA 4DQXA 2TMDA 3GEDA 3PLNA 4M55A 2DVMA 1MXHA 2PH5A 1O9BA 4OYRA 1FDUA 2VUTA 5JCXA 3UHAA 4RVGA 4OMUA 4YT2A 3I23A 3ZV6A 1EE2A 4ESOA 1ISFA 1DFHA 4W6ZA 4J9VA 5HM8A 1JU9A 3FR8A 2X0NA 4OGWA 4EGFA 4XB2A 4N7RA 2CDBA 2BD0A 4CODB 2YW9A 3GVXA 1S6YA 3DAGA 1M66A 5EQDA 1JTVA 5CAEA 4FC7A 4XGNA 2J3HA 4DBZA 4E32A 3SLKA 1HYGA 1WDKA 2Y66A 1U3TA 1NQOA 5ENVA 3T7CA 2GN6A 3GFGA 2I5PO 4BOYA 2HK9A 2UUPA 5AOVA 2HRZA 2B4QA 3G79A 5T8KC 5L4LA 5A02A 3AFNA 1XCBA 1HL3A 3KRTA 2DLDA 5IDQA 3F3SA 4YAGA 1N9GA 3FWZA 4FGWA 5L9AA 2I6TA 4P8RA 3AUUA 3UICA 3RUEA 3IMFA 1H9BA 2NQTA 4D44A 1SMKA 3HSKA 1H6CA 3RBZA 3L07A 3PWKA 2PKRA 1EVYA 2IDZA 2X0JA 4FFPA 4BNNA 4DMLA 1KY4A 3I9OA 1FDTA 1K6JA 3QVXA 1M76A 4WLVA 2EG9A 1AE1A 2ZCUA 3N74A 5DOVA 2O23A 2X1HA 2AQ8A 4TROA 3U09A 3BMOA 5FI3A 1HSZA 1YH3A 4GH5A 1SO8A 1ISGA 1MC5A 3BMCA 4I5EA 2EKQA 2O7QA 8LDHA 2ZB7A 2NU9A 4CUZA 3H5RA 1HDOA 4LGVA 2HLPA 3GN1A 1BWSA 1ZSNA 1Y8RB 2YYYA 3GDFA 3OP4A 3FCOA 3PP8A 1X7DA 3NT5A 5TQVA 4BL5A 5DP2A 3F5QA 2G17A 1VJ0A 3ZN2A 5BSHA 1ULUA 1HF3A 5I8ZA 3UVEA 3KETA 4CM8B 4B7CA 4RJTA 3B20A 4MVJF 4YDRA 1TB4A 1UP7A 3DBLB 4L75A 4PLPA 1PL6A 1F12A 5ITVA 1A9YA 4CMEC 2DAPA 3KLMX 3OQBA 2W90A 4NBRA 3GEMA 2W4QA 4BV8A 3C1AA 4QT0A 5A03A 1SPXA 3FNHA 3AUTA 3OJFA 4BNUA 1T2EA 5CDTA 5JO0A 4MDHA 2OZPA 1UDCA 3BMNB 4XR9A 4F6LA 3R3SA 4MP8A 3FWNA 3PQDA 2CF5A 5JDCC 5KOIA 1K2WA 4ID9A 1NVTA 1I01A 4Z0HO 2PKQO 5LC1A 2C7VA 4KDEA 2CFCA 4W7HA 5IJZA 3UKOA 4JJIA 3CZMA 1GDHA 3RJ5A 3K6JA 1PEDA 3AU9A 2Y1DA 5FEUA 1UP4A 3JQ6A 2FOIA 4YVFA 3DEYX 4I9HA 4NG5A 4ZRNA 4E31A 2C2XA 3AK4A 1DFGA 2VRCD 1GPDG 2B35A 1GUFA 1T1RA 1N1EA 4AJHA 5JFOA 3BMQA 2RBEA 3GC6A 1ISMA 2B83A 3JQFA 4PG4A 1I30A 4XX0A 1R0LA 3U62A 1GD1O 2R00C 3DFUA 4DUPA 3ZWYA 4DRYA 1LRLA 4GGPA 3CPSA 4BO6A 3TZCA 4CMIB 4E5PA 3DC2A 3KVOA 2LDXA 2OL4A 4GSKA 3TL2A 2PZKA 3WJAA 3VH4A 4PLVA 4KTTE 1YXMA 4BNTA 5I7VA 2YZ7A 3S2FA 2WDZA 4IMRA 1V9LA 1WDMA 1MG5A 4J9UE 4YAIA 5DZSA 3LT2A 3VZPA 5KVQA 5B37A 5DP1A 4JLWA 2O3UA 3NTRA 3O8QB 2CUKA 4J6FA 4RF3A 4YEDA 4WCDA 1LLCA 3WICA 4YCAA 1I2CA 1NNUA 5FYDA 1P0CA 3C3XA 1RM5A 3VPFA 3DOCA 2J6IA 3OICA 1BG6A 1PWXA 3IOYA 2YY7A 1LSUA 2HK7A 2CZCA 3VC7A 1YRLA 1ORRA 1KVSA
chains in the Genus database with same CATH superfamily
3VM6A 1DWQA 1Z2PX 3VDXA 4XW2A 4GHWA 3PFBA 3E0QA 1GR1A 1XU4A 1P31A 4FBGA 2WYHA 1QAOA 3EQ6A 1OLSA 1DEKA 1NI3A 2CFOA 3AG5A 3M6XA 4W5HA 2ZXUA 4DIMA 3CVWA 3UV7A 5K4AA 3CLTD 3LMKA 1KYVA 3LYLA 1VA5A 5JT1A 3WFIA 1YQ9A 2K7ZA 2CKDA 3CN9A 3I0MA 3CV3A 3GUUA 3IOEA 3W5DA 5HR5A 5D5QA 1W4BA 4MWBA 3B3FA 2HF7A 4H35A 3VR6H 2AMLA 1AS2A 2CL7X 2GTPA 3AOGA 5ALDA 3T7EA 1CQZA 4DPKA 3IT3A 4X6LA 3HA3A 2FWAA 4Q3NA 3PDUA 4PO1A 4CDNA 2OY0A 2A0UA 4DCCA 1P1CA 1XO1A 1PV2A 1E4OA 1ACMA 2X8BA 3L4BC 2Z6QA 2EXXA 3HACA 3UB4A 1L7QA 4UFPA 2Q3DA 4HNHA 4ZVLA 5U1PA 1G8PA 5HF5A 3WYCA 2CT8A 2GRJA 3LQQA 3TXYA 5JY6A 1XDBA 1SKMA 4P7KA 2Z1MA 4MITA 2I3ZA 3E7XA 1A95A 1NMZA 4XCQA 4BECA 1OI3A 4OX9B 1XZMA 2P2ZA 3K1ZA 5F1YA 4AVYA 3Q1KA 5CDSA 5DBHX 4TKLA 2BDTA 1DINA 4UU1A 1UP6A 1V3QE 3EY9A 1YS6A 3BDIA 3M5PA 3HGMA 2FK7A 5IC5A 1VLLA 1YZHA 2HMVA 3TZHA 4E33A 5BSEA 4AMVA 1BKDR 2PGLA 2Q3HA 2ZUDA 3A36A 3OLZA 3R4CA 4PAOA 4YP7A 2QZZA 4EO4A 2KSQA 1C1XA 4C5AA 2RD2A 3E48A 3QG1A 1KQGA 1U0OC 5FAXA 2QR5A 4LOHA 2XMBA 4XWWA 5IF3A 3CZ4A 3HBMA 4PANA 5FIUA 4BMOB 1ZLXA 1OFIA 1E92A 1PR0A 4BMYA 2WE8A 4CWAA 1J1IA 1HA3A 1D8TA 2HYIC 4LOLA 3JAMA 5BW8A 1JVSA 1HZZC 1P3Y1 5BN3A 4QATA 5B1SA 4TV8A 3UJ7A 3K2IA 4RTJA 3EIOA 1BE8A 4KXWA 4M0FA 4P3XA 4B5KA 5A1TA 4RF5A 2XB2A 1T9HA 1UXJA 5DI3B 1FNSA 4FTWA 3OMXA 1HQKA 1SZPA 3QUBA 4P36A 5KQGA 3TRDA 3V4PB 4K8OA 5LA6B 1BXGB 3KYCB 3CSDA 2Q2OA 1WBDA 3RKSA 4OJKA 2I7XA 4DMGA 1R5BA 1RLMA 4YCNA 4QHSA 1KDOA 2ZRAA 3IBCA 5F76A 3WIBA 4UTRA 4XFDA 4KOAA 4GPBA 2LXNA 2XT9A 1GUAA 3AEQA 2X4GA 1ESNA 4ENQA 4O8ZA 1MFZA 2UZAA 1O89A 1EP2B 3CQ9A 3LX6A 4PEVA 3FOAA 3CZCA 1GN9A 4G37A 3M4JA 2JHPA 4LY9A 3RVKA 5LPNA 5MDHA 4LMRA 4JYZA 2H4WA 4YUVA 2XWPA 3R0VA 3LIIA 4A1OA 2WJ6A 3NU1A 3QKIA 5KX5A 2LV8A 3G5TA 4AJOA 1TLLA 1J22A 3NTUA 5ARDA 4CT4B 3WRXC 1AHHA 4UM9B 5KTTA 4BEJA 1WV0A 3CRRA 4NBVA 2C04A 2JL1A 2Q3FA 1VMAA 4ZQBA 5HGJA 4ZKEA 4BJ1A 2FQQA 2XZDA 3QNWA 5E38A 1VRCA 2J9RA 3IUBA 2BDEA 4UD2A 5LZ8A 4RX1A 5CD9A 2PSHA 5JCZA 2NV0A 4H0FA 4GC9A 3M6AA 3F0TA 3T5DA 4CQJA 3A1DA 1RVV1 1JG2A 3CBGA 3FI9A 3QENA 1RXEA 1MA3A 4V3CA 2DTEA 5BXYA 1N1GA 1X80A 1EVLA 1PJBA 4UHFA 3AETB 1T1GA 2I7CA 1Z5OA 4GI3A 3W7BA 2C2BA 3PDIB 4NY1A 2YZMA 3IAHA 2ETVA 2V96A 3NHJA 4Y2SA 3TF5A 4W7IA 3OOSA 3IO3A 3WGUA 4ZAWA 3LPLA 1RYDA 1FTSA 1ST3A 2MT9A 1U3FA 1XN4A 3B9PA 3CX8A 2FE4A 3QVOA 2AC2A 4UNSA 5ESWA 3WGQA 3LDHA 1FDRA 2WWVD 1GCUA 2XB6A 1MMFB 3IESA 4R98A 3L8YA 4IZOA 1F17A 2FTKE 1VL6A 1ZVKA 3DAYA 5PGMA 3UT5A 3UJNA 3FTEA 4E94A 2RK3A 4FYIA 4XFJA 5FLXA 5LNK6 3DOJA 4RL6A 1FFEA 4E2YA 4Y8VA 4AX8A 4QEDA 3RUCA 1KP2A 5D7NA 4C6RA 1XTTA 1A2QA 1OKKA 4BMVA 1LGYA 1VPDA 3F73A 2IH2A 4UTPA 3TKYA 1TQHA 4KMOA 4WINA 3B5JA 2ZRDA 3A3PA 3E1KA 4C0WA 2W5UA 4KRFA 3WOVA 3KYBA 3ZI4A 1U11A 2FEPA 3DZHA 3EAQA 4OATA 1YQTA 4Z4CA 2IE8A 3L7OA 1O3YA 1T13A 4GQIA 2IS1A 3FPFA 4YMLA 4AJNA 5ER9A 3IULA 3L2OB 1SY7A 4GMFA 4ZMRA 1N2OA 3H11A 4FFVA 1NE2A 4NMHA 4OGFA 4QDZA 4DS3A 5BNZA 2V65A 6NULA 5I7SA 1WG8A 1HE3A 3KQHA 1XMQB 3T9DA 1XRRA 3L4EA 1TU0A 1Q16A 8GPBA 1VSVA 1B6SA 2CNNA 4QOFA 4BNYA 4YAWA 4TRJA 3A2MA 1U8YA 4LSMA 4X1OA 3G8AA 4IS2A 1X39A 1ZH4A 3NH9A 1HMPA 1L1FA 2V7QA 3FYCA 1AKEA 4GX5A 5CJJA 1GTG1 4GXRA 1SA0A 1EHCA 3CLSC 4K46A 1Z33A 1PEAA 2FEKA 1S2OA 3MIZA 1TVEA 4IP0A 5FADA 4TL7A 4JBYA 3R6GA 2BSQA 3F90A 1OXSC 3C8UA 5DBFA 3QEBZ 5JDIA 4ARAA 4DANA 3EWSA 3M1LA 3E23A 4GZMA 4O02B 2YZKA 3S3TA 3B12A 9ATCA 3S2GA 1E3QA 2VLBA 3DPIA 3TBFA 3ORSA 4K9DA 3D1LA 2QGFA 3QUCA 4MR9B 4ER5A 2BFDA 1GPJA 4F93B 2NXCA 1G6HA 2AOTA 3VPHA 2A84A 2YJNA 1T9GR 3WL8A 2H8KA 3F49S 5JSKA 2X5XA 4PYNA 1E8NA 5GM2A 1UAGA 2JIQA 1UBFA 4I08A 3SQOA 3QEMB 2HLHA 5AHKA 2IIPA 3T9CA 3W2FA 4RDCA 5DWDA 5K0NA 3HJAA 3QOYA 2F3UA 3NTLA 4HMOA 3T3NA 1JHZA 1N0IA 1WZNA 4CDGA 1DXOA 4FGJA 2CSXA 1OXXK 5CP8A 1N77A 2FEOA 1UOOA 1CFZA 4O6VA 4R5HA 3RADC 1Y7LA 2FSGA 3U4HA 2BEWB 4Q19A 3GJ4A 2L0XA 4Q3DA 5D84A 4AJ2A 4DT1B 4UZFA 3U26A 3C48A 2WABA 1P0FA 1S8OA 5LBUA 2XNHA 1CUHA 5IMSA 3A7DA 3RS3A 4DV2B 4DV7B 1GZ4A 4NATA 1MX1A 2P8SA 3LYAA 3K73O 4ATNA 4GKJB 3RC1A 2VHXA 1W5EA 3CT4A 3OCCA 1YD7A 1KJ9A 2WVAA 2P9EA 3X43A 5JWHA 1PJLA 1NBMD 2HIAA 3GMIA 2IJGX 5J5VA 1STOA 4XJXA 1IQPA 2G1AA 1D2HA 1XEWY 2Q6OA 3PL1A 4JP5A 4RZ3A 5ALXA 4DAEA 3JWIA 4ZAYA 4JITA 1QV6A 3EFHA 5AYVA 3T7SA 3RRZA 3T5GA 3CX7A 2JK0A 4J1SA 2OXIA 2FWRA 2VHCA 2X19A 1UPCA 1E1KA 2H51A 4BLTA 3HCBA 1T4DA 2BCGY 4MB0A 3ZZ0A 4GNRA 4LRXA 1IJFA 1JIUA 4FDMA 2OV4A 4IUYA 5GWXA 1RZUA 4ND8B 3ZDFA 2O2HA 5HIMA 2HFJA 4IFTA 1Q3HA 3DMHA 1SKAA 2B8NA 1MV8A 3Q0IA 1Y6GA 4UASA 4S1TA 4M9ZA 2XV1A 5JIBA 2JLYA 3WHLA 3WLJA 1BA2A 2FWMX 2QVCA 2YV4A 5HEKA 3RTAA 1R4NB 3FTPA 3AEKA 1CV2A 3AM5A 3VR2A 3IAAA 1TTPB 3PD0A 4C4SA 4MAAA 2GCIA 1GYPA 2RJNA 4TYYA 1SUBA 5EJ5A 2CWDA 1GPYA 3DOFA 1N2XA 4HVAA 2NO4A 5CLGA 4CHGA 4CKZA 1QHYA 2GAOA 2R4TA 3B70A 5KWEA 2XWQA 3LIPA 5LP6B 4IMIB 3UHJA 4AKGA 1C3VA 3GUZA 4AN1A 4YO8A 1FW8A 4RHYA 1VBMA 2R8XA 2X40A 2VTBB 1AQYA 4CI0B 2PIAA 2BCJQ 1XAHA 4Y2PA 4I1SA 4HN4B 2M9MA 1UPFA 2V8OA 4MKIA 4H15A 2A33A 2B5WA 2QZPA 5EJAA 5BSVA 4YPOA 2YFQA 4KK4A 1XEXB 1ZOIA 4RK4A 4TMZA 1CETA 4GP6A 4XGKA 5I9SA 2BC9A 3PQEA 3OQJA 4L9SA 4WZBB 4AJ9A 3M83A 3KPUA 5F9HA 1T2AA 1OIWA 3UJBA 1BE1A 2YNMD 3TUZC 3ETCA 3R7DA 3EXFB 4NS4A 3BJMA 2ZPTX 5EZYF 1USKA 2W48A 3G0IA 1ZK4A 2GYVA 2AMYA 2IYNA 3U7QB 3VR3A 4CF5A 1FU8A 5CLJA 4G1MB 1P7PA 4D99A 3Q7RA 4MV8A 3E1GA 4P0PB 1KFKB 1TF7A 3KV1A 4ABYA 1EBUA 4DL9A 5DH9A 4FGZA 5THKA 4FCTA 2EX4A 1P72A 4N0DA 4OXKA 3VSEA 2QUAA 4UKDA 2AQKA 3RHFA 1V4VA 1V5WA 2YX1A 3D4LA 3ETHA 4EK9A 1HNZB 2GJ8A 4CQLA 1BJKA 1QDEA 3ZHUA 1O95D 3CUSA 4LNHA 1P62B 4QIHA 4DIBA 5CFQA 2IBTA 1SFRA 3QF4B 1WB5A 4JEIA 5DM60 1IEXA 3KJHA 1EUDA 2C2WA 3S1SA 5K8TA 3GLUA 1TQDA 3MJ4A 3RYFA 3FBWA 4FVTA 1NZJA 1JXAA 3TJZA 3QPWA 2OD2A 3ESDA 1FNNA 1YA6A 4L7QA 1X0XA 4HD8A 5C7IO 2FQ1A 1UL1X 4I3GA 1LWNA 3MK31 1NIJA 3B7WA 5BN4B 2O2ZA 3KD2A 4U7FA 4Q1AA 4HDNB 1J8QA 3W3AD 1COWD 4BFYA 4B46A 3GRPA 3ISVA 4M0CA 1TZJA 2QTLA 1XWIA 4D3ZA 3GRVA 2PX3A 1T2CA 2QTRA 3BH6A 1HFJA 4PZCA 3G5MA 2NVUB 5CFLA 2CHEA 1NF9A 2PN1A 4IIFA 1CU1A 2ZJ6A 4GRIA 5IAGA 4AK9A 1E6EA 4UMVA 4DMCA 3NNNA 3A26A 3PQ6A 3T3HA 4K40A 1HOXA 2BHLA 3KJQA 4R1TA 4B4WA 5DHSA 4WKNA 1IPHA 1THTA 4Z4IA 3P4YA 1OFHA 5C8YF 2FN8A 4MYDA 5K6AA 1JJVA 2ZB8A 3M49A 1I6LA 4UDOA 2GK6A 3K2QA 4GXNA 1BFDA 1VKNA 5T4EA 4D0SA 4E46A 3WSVA 4MP6A 4O3MA 1DBWA 4KNWA 2GXQA 1CQIA 3PUYA 4Y2VA 2G40A 2QSUA 3DG9A 3G2IA 4F5DA 4BMZA 4QYTA 4URVR 1QAMA 2K7FA 1ECCA 3O83A 1RLUA 1YDWA 4PNPA 3FJYA 4QU9A 4G8BA 4JU8A 3F9RA 5TMBA 1V1MB 1P9RA 1YDMA 3JZAA 4LE0A 4L4RA 1IPEA 2PLWA 2UZ1B 4TZKA 5HDQA 5M3BA 4BVJA 2I4RA 3K09C 5EMKA 5G0UA 3T0GA 3AW8A 3OU6A 5EJ6A 4PIPA 1FFWA 2WKQA 2C7OA 1W4LA 1SIOA 2NUBA 4GLOA 4J0CA 4FFBA 1RLOA 2FPOA 3KKKA 3OKPA 1K7FB 3GD7A 3ZE0B 3E5MA 3KU4A 2ZIZA 4JR1A 5JNRA 2Q6TA 1JR3E 1H65A 3GXOA 1I5EA 2QLMA 4FXPA 2G0AA 1E66A 4GWKA 4YALA 5FUBA 2WIGA 3G1TA 4HHEA 4P4TA 1U8TA 2HSWA 2J4DA 5AJZA 1DJNA 1QF7A 1ZH0A 3DM9B 4LECA 1VIMA 3H2JA 4MI6A 4BS9A 5DISB 5JNLA 2GJ9A 3ZYZA 3A1FA 1OGIA 1OWOA 4R1SA 2BBTA 1GITA 5B1YA 1KOJA 4EF5A 1F2TA 1SN7A 5CEJA 1PFUA 3V42A 2G06A 2RB5A 2Q1XA 1SK8A 1L6IA 1J0AA 2YIVX 3IIJA 4L0DA 3JY6A 3EARA 1LV7A 4C6SA 1QP8A 3CINA 1ZESA 3P0JA 3JD3A 2YMLA 1XZFA 3AR2A 3TM5A 2LNDA 3LCMA 4Z54A 2X9QA 5AT1A 3GLGE 5F9FA 4LHZA 2AVDA 4PHTA 2Y1KA 1CF2O 4OI1A 4BVBA 4ZV9A 5KOHA 1QLJA 3DGFC 4R1UA 3JQFC 3WLLA 5CH5A 1I1NA 5HIJA 1U1IA 1EMDA 3O2QB 5EXTA 5FWYA 4MVWA 4RW0A 2J3IA 4HBZA 2B4KA 1P18A 2ZSKA 2ZSUA 2QR2A 2HU7A 1B42A 1ZKMA 4KJZA 2AQHA 2D00A 4LXHA 2LIVA 4HEHA 4O4HB 3OKAA 4YAKA 2QF7A 3O1HB 4IGKA 2OCAA 1TTHA 5KNBH 3I2YX 4AUEA 4N6OA 2PXCA 5TC4A 2XNDD 1KYWA 3GRCA 2WKPA 3D6VA 1FTYA 1MH9A 1T5LA 3GXBA 3I1FA 4X60A 4US1R 4E5NA 2YRFA 4BCCA 2C8LA 4B17A 4YJKA 1MRZA 2O05A 2R2AA 3PYXA 3V4ZA 1MQSA 3KE8A 1I2DA 4M98A 4GBJA 4CUKA 5BNIA 3QPBA 1P2TA 5B3AA 2JJQA 2KQUA 2R85A 2UVDA 4TTQA 3L7NA 4RFSB 1HY3A 1RJGA 4JBGA 4ZZ2A 2CVOA 1V5FA 3T1QA 1DRUA 4ZGGA 1L8XA 5C3UA 5IKMA 4BQSA 5LQMA 3WSWA 1G3IA 2GH1A 2YXBA 1YCHA 2ZYHA 4Q6WA 5LSAA 4DR5B 2UAGA 4FD2A 1MZPA 1B3RA 2OV3A 2HF9A 3TI9A 3T5AA 4U5QA 5AM1A 1AIPA 3CZQA 4V0OA 2VHEA 3IKVA 2A5GA 5NULA 2KHZA 3CH5A 2GCOA 3E9EA 3JQAB 5JSUA 4OKIA 2GAJA 2SKEA 3A37A 4ZVRA 5MGNA 4KQGA 4J03A 4YV1A 5AW6A 1Y4AE 3E3MA 1PKXA 4L1KA 4ONEA 3QXXA 2G5PA 3P9SA 1EVZA 2O3TA 2A1TS 2XE4A 5IVIA 1QO0D 2CGEA 5KVCA 1MNQA 2BP7B 3ULKA 1YF3A 2POCA 4ZRMA 3V3TA 4ENTA 2QQEA 2NQ2C 5GOZA 2R3SA 4DQLA 1OH7A 1H5UA 4FQ8A 5M04A 3SICE 3W5AA 1AK9A 4EJ6A 3ZU5A 3D5TA 3QY0A 4ABTA 1CRWG 1UBUS 3WHPA 3A1SA 5KYVA 5BYKA 1N3LA 2J9XB 5D3ZA 2ZJBA 3OC0A 1AD2A 5TY0A 1FVHA 1NVAA 1E61A 1L8LA 1VKHA 4JDUA 3RDPA 1SHZA 3TSZA 3ZDEA 5HKOA 4UCWA 4YAUA 1IN1A 2Q50A 2OB2A 3VXKA 3KB2A 2WM9B 4WBNF 5KTYA 3TMKA 3M0EA 4J29A 1A5AB 1EB8A 2Q5HA 1ID8A 2AOWA 2XB9A 3KKOA 4XVHA 3ZH2A 4KPGA 4W5QA 3NUGA 4QO8A 1CTQA 4V3BA 3LHKA 4RPLA 2O8VA 1UODA 4A8HA 2H7XA 3L0ZA 4KK3A 4KE6A 1BKYA 5FHRA 2P9QA 2DBVO 4HRYA 5KSOA 2AK3A 3VRHA 1N33B 5EE0A 4MVCA 5FKJA 2OO3A 3E8SA 3O2NA 5DT2A 4U6QA 2G7ZA 3QKSA 1DDIA 2FYTA 4WBNB 5HOQA 1F5SA 5BSGA 1YTUA 3I04A 5SYMA 2IA5A 3M6LA 2JD1A 4IOJA 1B6RA 5ER6A 3FOBA 3S4YA 3ZE9A 3IJPA 2XYRA 3V8BA 5BQFA 1C9KA 4CEIB 1A8UA 3CB2A 3BX1A 3U7QA 5KYXA 1JKIA 2E49A 4WESB 1YI1A 2NO6A 3D8NA 4IX9A 3QK7A 4F21A 4UOEA 2P75A 2X41A 5G3ZA 2AV6A 3JAKA 5F1OA 3RKRA 2NVBA 4FS3A 4ZI7F 3BHIA 5L3RA 1FQKA 1U2GC 3EVEA 1VJCA 3SJCA 1TKRA 4PTYA 4XYBA 5IFKA 3Q8LA 3CEJA 4RFVA 3EF0A 2GEKA 2D59A 2I34A 1VSTA 4EGAA 3NEPX 3ONWA 3ND9A 3O92A 4GOOD 3NM5A 5K0BA 4X93A 4WUVA 4NNOA 2Z58A 3NWPA 4F4FA 2XUJA 2ZIVB 3CSSA 4JOBA 3HS3A 3KEOA 4JVSB 4D4MA 1H23A 4DUYB 5H8WA 2C03A 3I73A 1XFAA 4B3RB 4M7PA 1DAEA 4ZEOA 1N2HA 2CV2A 2V7UA 1TDJA 2H9YA 4O8CA 4GEGA 2DFTA 2ZLBA 5DM2A 1QKIA 4AYWA 2H29A 4A91A 2DFKB 4IOLA 4XCVA 1M2VB 4YHHB 2UYCA 3LG2A 1D8AA 1ORWA 1Z17A 2OZLA 1XZ8A 2C7BA 3MTEA 3W04A 5H83A 5DNYB 4WZAE 4IICA 3RRJA 3CGGA 4LDZA 4JNCA 1M83A 1M5UA 1CX9B 1N5RA 2MYNA 4H6XA 4PZYA 2BGGA 3C1UA 3ER6A 3KQVA 1XNQB 5IEJA 2N42A 5ENZA 4QDTA 1KDRA 4RPKA 4C2TA 5HILA 4NJMB 3MMZA 3DHEA 1ZN7A 2PLFA 3EGIA 3L6UA 4JEMA 3ESRA 4LKOA 1TO1E 1XGKA 4NU6A 1Y81A 3LWBA 2I6UA 4CLRA 4C4RA 3BAZA 1TA9A 4PGHA 1E9AA 3JVUA 4O5OA 2ZJAA 3AM4A 4RY0A 4JYBA 1KAQA 1O8CA 3KM0A 4HXFB 3E82A 2J0UB 3G02A 3U7IA 1RDFA 5JNTA 2Q5IA 2V3VA 5FQNA 3N7AA 4RE5A 4DJ5X 4PS1A 1PGOA 2RAFA 3ZEIA 1PG5A 3NRJA 5EJEA 4R41A 1PI3A 2B2NA 1ZA2A 2CXUA 2NZ8A 2OQ2A 2C07A 2ISQA 2BOVA 1NJ8A 3QHQA 4XB1A 1AXGA 3ND6A 1PWEA 3FNFA 4HB0A 1PGQA 5GONF 1TKBA 2BGNA 3DP9A 3DZJA 5A6SB 4BC1A 4EATA 3T1TA 1J0BA 3O95A 2Y27A 1A8HA 6REQA 2XXAA 3D0KA 1JFVA 2C7QA 1B3BA 3EULA 4B74A 4F0JA 2KI5A 4YCBA 1Z18A 3R9IA 3NYWA 4DZZA 5KQRA 4W63A 1DUIA 4V39A 1IXRC 5F77A 3M1YA 3D81A 3RROA 1ODJA 4ZOBA 4BWVA 5COBA 1YQDA 5F98A 2EZ4A 2ODPA 4RGBA 1QG2A 1G9SA 1PZGA 3EQ9A 3M6FA 1NRWA 2JJ1A 3IYLW 2BFCA 3ZIAD 3MTGA 1XQYA 1E0JA 1U8ZA 2FR8A 3P0IA 1EFVA 1ESEA 2P27A 2VSOA 2WJWA 4AS1A 2C2YA 3NGMA 2CLMB 3IMKA 3SE0A 3OJCA 4LY0A 3MILA 5CT9A 3ZWPA 2KB0A 4D9JA 3LBHA 3ZCSA 1Z38A 5A4MS 2NAFA 1GRVA 4J1TA 2JA1A 4MKRA 1EWKA 1SU4A 4ZK2A 1MB0A 1USGA 5FEMA 5K51A 4PU0A 1T0HB 4M83A 3R2JA 2PA0A 3ZV5A 2ONKA 2OHHA 2QMUA 2QXYA 3DYVA 3LP6A 4L27A 3S2EA 2C7GA 4BEVA 3ZDXB 4F46A 1NT2A 5JD5A 4KRGA 4TMYA 5C4MA 2ZT5A 4YS6A 5ESDA 3AERB 1NHGA 1AZSC 3LW7A 3P7MA 2OXFA 2GETA 3M9LA 2HQBA 3WVNA 3NASA 3PGKA 1V48A 2PQ0A 4L4SA 1HE4A 2H1LA 4UBJA 5LD2C 4L0MA 1O0SA 4B34A 1FFAA 3V1NA 3NCHA 2F67A 2BF7A 1J21A 4KDFA 5DCWA 3RRYA 1HQDA 3CUVA 4DLZA 4EUFA 1G60A 4GX0A 5IANA 2E48A 2CNBA 4X3PA 3UAXA 1R9JA 2Z8ZA 3IT2A 2VBGA 3AL2A 1XC7A 1XD8A 3LKDA 1KF0A 2LE0A 1HRDA 1MHPA 1QYCA 4HNUA 4Y9DA 2OGTA 3K2EA 1TD1A 3PIRA 3DW3X 3SDSA 3FPGA 5DLYA 4ZVVA 5BO5A 3JD0A 1V96A 3I04M 3MGAA 3L6OO 1NIPA 3KTAA 3TTXA 2QRNA 3ZWAA 2KMLA 1IUPA 2WJVA 4POAA 4ZO4A 1B6TA 1RXUA 1JIKA 2XEDA 5FV7A 3U7EB 4L2IA 2GJAA 1QB7A 2XQIA 3C6ZA 4DXDA 1GAEO 1HDXA 2EEZA 2QW0X 3NIGB 4HUJA 4OP3A 4R8SA 5FBWB 3ICPA 3WOHA 3WKAA 1XZKA 1I5OA 4JHXA 1XFDA 3LSTA 1VJ5A 3LUCA 4ZIRB 1H5QA 3A9CA 4PFJA 2BGIA 4PG7A 3K70C 3C8HA 2L18A 2ZWAA 1NW9B 3H04A 2WWTA 5DW3A 5EXXA 1U7UA 1A8SA 3O4GA 3PNKA 2AN5A 2PAAA 2A5FA 2NPIA 3A04A 3PGMA 3Q98A 2J31A 3N8DA 4KL8S 3ZLBA 4FIZA 5LZ4A 1L7NA 3D3EA 1Q77A 4O4LA 3U4AA 3Q3IA 5IBCA 4WOJA 4DG5A 2HNKA 3KSBC 2P4EA 4JJEA 4OBXA 1WULS 4M89A 2C1ZA 2EDAA 3SE7A 2R44A 1CQJA 4FJ1A 3SR3A 3FXAA 5JMOA 2VT3A 3DTVA 1P39A 3O0TA 4K6KA 3FHCB 4WJKB 1QIMA 2HWYA 3TLBA 2HSDA 1A5SB 2ZRHA 4J4BA 1M8JA 2HJGA 2PX2A 3P20A 4BO7A 1V47A 3WKEA 3WV5A 1TTTA 4O25A 3I2HA 2HBQA 2F8TA 4YCCA 2ORYA 4L28A 4RHTA 2BMJA 1U3CA 3SLRA 2X2PA 5F4ZA 1NLFA 1LU9A 2DSTA 2AE1A 2GPJA 4M53A 5A05A 4YX9A 1W29A 3I61A 5REQB 2YJZA 4EMUA 1YNSA 4BUJA 5A5DA 1U8EA 4H7JA 5DO9A 5H80A 3L84A 1C3OB 3HCWA 4E70A 1M8KA 1ENZA 1XBTA 2BONA 3NR2A 4DYVA 2XUIA 3TUJC 2WU1A 4KV7A 1EP3B 2JFPA 1USUA 4U0KA 5EG5A 3TECE 3KKNA 2A1UA 3EZGA 3MT0A 5IFLA 2WAXA 3ZZ1A 1RXIA 3O94A 3IEIA 3KR2A 3KX2A 2Z4SA 4NFSA 4DIUA 2H63A 5AJUA 3PFNA 6GPBA 3A4YA 4QDOA 5FB3A 2JZCA 2G1JA 1YI0A 4TMWA 2P2DA 2ZJZA 4RD2A 5E6SA 4QPNA 1PT5A 3W05A 3AHCA 3GEHA 4GKKB 4OO3A 4Q1VA 3LU1A 3A9TA 2DUUA 3KUDA 1XJWA 1CUCA 4IDFA 2ZTUA 1S5PA 3D3WA 4US2R 4LHEA 2NSYA 2JBAA 3DVAA 3KP1A 3NOVA 5G1OA 5HXAA 1L7OA 1VMEA 1HKHA 3HU5A 5F7JA 3C85A 4HADA 4RJJA 4AJ4A 1JFRA 5DRTA 4WXMA 2ONCA 4ENVA 4B3BA 5EY5B 3H83A 5IBRA 1OLSB 1LS6A 1GNLA 3EOZA 4EDFA 4JGGA 1XRJA 2JW5A 5IDXA 2QX8A 1MGPA 1SUIA 2HJWA 2Y0CA 3AV3A 4PY2A 5HIAA 5JAPA 4ZREA 4A6DA 4DJTA 5CDFE 2HNBA 1OMOA 4XX1A 3V2GA 4BQNA 4ALJA 3LOQA 5E1BA 2FSVC 2J6HA 5HDBB 2QI9F 2A2ZA 1DAIA 1LJUA 3IQFA 3LI2A 3R23A 4OVKA 2EX0A 3K0CA 4BVGA 3LK7A 4B7ZA 4LRUA 3ENZA 3VZSA 1MO6A 4EZEA 1WXIA 2ZDGA 3HL0A 4N8EA 4CGZA 2D5BA 3NIDB 2GPNA 2WB4A 3OFSA 3PGJA 1XQ6A 4C03A 1NTOA 3QZUA 1ZEMA 4YI5A 3A2KA 4CMJA 3D5EA 2O8NA 1ZJWA 3VISA 2HCTA 3O0DA 3P96A 1SAYA 1RQPA 4UUQA 4XUEA 3TGLA 1AQIA 2P2LA 3DJYA 2XUFA 3ZYCA 3C3CA 4MLPA 1JP7A 1DCKA 3MUNA 1RZRD 4ARUA 5FORA 1AY0A 3DR5A 2IIVA 5F1KA 4MUGA 2DWOA 2K2QB 4TL6A 4QXQA 4XOUA 1XCGB 3FPEA 4BVLA 1R10A 4UOZA 4JY7A 3QVLA 2YCLA 3Q11A 4RTSA 3K15A 3OTIA 4YNBA 2B82A 2B21A 3LRXA 5BSTA 3EIQA 5DWQA 2QB5A 2RH8A 3UFBA 3EAFA 1VE7A 4G23A 4A10A 2VDRB 1NBOA 1C1XB 2VJCA 2IQ5A 3GRZA 4RVSA 1UKZA 5TNXA 3VJMA 1PT7A 4YBZA 1NXQA 1O6GA 3RYHA 1YFLA 4YRJA 3OJLA 4PZLA 5BT9A 1C4WA 4GQBA 4DWVA 3OQ6A 2CV0A 1Y6FA 3EQ7A 4OUKX 5AKEA 2TMKA 3ETJA 4JR2A 4LOKA 3AF2A 4RELA 4BFTA 1JDUA 1Z28A 1V7CA 5BN3B 4LISA 1K92A 4TV8B 3KWMA 2GJKA 3R8XA 4DM3A 221PA 1GNTA 1PHRA 3IHLA 4MV4A 4TT3D 3NP7A 4G41A 4RSHA 2QM0A 5DRYA 3SQDA 1KEKA 1UFKA 4P6VF 1KHTA 4XDYA 4XM2A 4Y0VA 4FI3C 3B1VA 4HQOA 2FKAA 3TTTA 2O6HA 2X2EA 4A9AA 4CF6A 2GN9A 2GR9A 3FGNA 1OVMA 2ZTVA 1KOLA 3T1OA 3WK9A 1N2JA 1V2HE 1IWPB 2WF8A 1I2ZA 5ERGB 4IDAA 2JFGA 4KI0A 1Q7TA 4D74A 3ZDDA 5ELXA 3SS9X 3WGZA 5AVWA 3Q3GE 3AEQB 3ICVA 2VP5A 1JPJA 4INAA 5BQPA 4JROA 1YHZA 3TQFA 5BPHA 1SU8A 2HXGA 2E4WA 5KTSA 4PYRA 1DMRA 4ISCA 4XJTA 1AS3A 3TFWA 1YRBA 1UQTA 3F47A 4BO4A 5CEFA 1GKKA 2EZTA 1R6BX 3AHHA 4EHDA 4TX1A 2Z2KA 2H06A 4LYYA 1WTCA 5E3IA 3KVNA 3UM9A 5KX5B 5U4XA 3CBQA 5C5DA 4U39A 4U6SA 5BXQC 1C30A 1R37A 3BBPA 2ZAYA 2Q2WA 3AI7A 4KXUA 4MKXA 1N8TA 4AECA 4IHAA 1SCKA 4JBHA 2YN4A 3IUPA 5F5LA 1IOWA 5IAJA 1OU4A 3QYAA 3SYNA 4JLDA 4EFDA 4I66A 1QZ3A 3TTVA 3N7TA 2W2LA 2VDPB 4CM8A 2CFTA 3OZFA 2VP9A 2FZEA 3B5EA 4EF4A 1ZUD1 1QTQA 3U3XA 3C16C 2W6PA 2ZR9A 3P5SA 2C94A 1A9OA 3AY0A 1FJXA 3F4BA 1S89A 3VO2A 3ZWBA 4QDXA 3H0KA 1NM5C 1H5NA 1VL0A 1XTJA 2CVQA 4M8SA 3PFFA 3ETGA 2W6JD 3PX3A 4FFWA 3EQZA 4PX9A 4TKMA 4N7JA 4UMFA 3I5XA 5C5IA 4F72A 3J81A 1KZ7B 1X80B 4G07A 4UPDA 1N6LA 3KQUA 1F3LA 3Q3VA 3MPUA 4UVHA 1YZKA 2ZETA 3AM3A 3GMTA 1II8A 1ZD8A 4JXZA 1CEQA 2H4HA 2HHCA 3B52X 1Z6TA 5KPDA 5LWHA 2FSHA 2QX4A 3HVHA 3MOSA 4YLYA 1DZIA 4R8LA 1W49A 1R88A 2OPHA 3ZHZA 3B1XA 4A03A 3NMUF 2C3UA 2WLTA 4W9MC 5C8ZA 2NYAA 3CNBA 5IZCA 2ZR8A 1WQ4A 3KQPA 2X77A 2PR2A 1IAQA 3UT5B 2WG1A 3ZE7A 1DZ3A 2G07A 3F3YA 3PKJA 1G7SA 3BB3A 2JEZA 1M8FA 4RNCA 5D1NA 1RLJA 2QX7A 2HFKA 3NPMA 2I99A 4JFAA 4P82A 1OB5A 2HA3A 4Q9JA 2HU2A 4BJ3A 8OHMA 5F3WB 2QRLA 1ECPA 4HNRA 2W6MA 1JL3A 2ONJA 4MW5A 3ITNA 1TCUA 2I22A 2COEA 4B3GA 5B36A 1UPXA 3TNJA 1V25A 1U90A 4WUTA 3L0YA 4GBMA 2JGNA 5JAZA 3TFOA 1NQUA 1R50A 2D13A 3WQQA 5MN6A 2AYYA 4Q7LA 2ZATA 3MWYW 4D9BA 3HJRA 1YHNA 2JAUA 3O93A 2A9KA 4BQQA 2OEPA 2I8AA 3WXBA 4OF4A 2VEDA 1OC2A 3QUQA 3RS5A 1I3OA 1Q57A 4QPDA 4IGEA 1O0BA 2JGEA 2PQ6A 2H00A 1B74A 2NYRA 1XRSB 1SQ5A 4KMRA 1CCWA 3CYFA 4Y6LA 3D8UA 2PJZA 1AQLA 3E6AA 4DG9A 2PZBA 5LQCA 3AGPA 3C7CB 3IURA 3GNLA 4EHLA 2J5RA 2P6UA 3AY7A 2A5DA 3MYYA 4GI7A 1TC1A 4F5EA 1I4EB 3LC0A 4ND3A 3V8QA 1QIEA 2OP0A 2OECA 2F64A 3LP5A 4B81A 5HQTA 2DPMA 5BR1A 2G25A 3FNQA 2F1OA 4Q48A 4B8WA 1U6KA 1CY7A 3V7FA 4H31A 1LNZA 4C6TA 1WABA 2APJA 2CBGA 2QTNA 2YV1A 4FFSA 1IBRA 2CLEB 4G9GA 5TS3A 3RU7A 4JXXA 3ZY2A 2YQ4A 2C4UA 5B53A 3ILXA 4HK4A 1Q11A 1WD5A 2BFDB 2HWXA 3U7HB 2Q28A 2XMZA 1P5ZB 1CY0A 1SVOA 1UKYA 2HEIA 3T54A 1O97D 4OIFA 3SHFA 1MKYA 2AOTB 1IZZA 2F9LA 2QRPA 4FFMA 4F4DA 2P9HA 3O9VA 4OHMA 1Z15A 4N5IX 4QTTB 2WJGA 3B51X 5LB2A 4MQMA 3IHTA 1R8XA 3GO4A 5HZHA 2WUVA 4S04A 1R0CA 1RVDA 2WVHA 3DOOA 2B4YA 3G2LA 1UR5A 4R1LA 3BEDA 1HE2A 2I6XA 1JIIA 4W8OA 1OPRA 1PL7A 1YU9A 1ZZEA 1QGUA 2GD6A 4KXVA 1TZBA 5LDGA 2JFNA 4UCFA 5GIOE 5KO2A 1PK7A 1U6IA 2LDBA 2OO7A 2GM5A 2QJTA 3LDAA 4PRZA 3ZK7A 1RIFA 2XX3A 3KU1A 4MTLA 4R2MA 4JQSA 5EESA 1R6VA 4AWXA 2IF0A 3DJFA 3GBPA 2Y1GA 4YACA 3NT2A 4HTFB 3KV3O 1VCNA 4QXPA 4BX2A 5ECYA 3VOTA 4BV9A 3QWIA 1GZ3A 3GJTA 1NMYA 2ECQA 4JK3A 5EIBC 3HZRA 5K8VA 2ID7A 3GUHA 3KB1A 3KQSA 3MS4A 4PLWA 4CPDA 1SC3A 3H2IA 4N03A 2LUOA 3WXMA 5HFAA 3RNOA 3JX9A 4HWSA 1IY8A 3TWOA 4YIHA 1E32A 1WDLA 1EFAA 1O57A 1N7IA 4YN3A 2AMFA 4B3TB 3BGDA 1ZM3A 3EWAA 4HDOB 5EJFA 1RQ7A 5EZ6B 4E5DA 2O8FA 4ZC8A 4E12A 3K96A 4LCJA 4WXYB 1C4KA 2JGRA 5F2OA 3ZTYA 3L6EA 4H7DA 3IPCA 5TF0A 3U3MA 4ALNA 1LFAA 1MRSA 2Q4EA 1E0KA 2X5NA 1P5JA 2BF4A 1V4NA 3CZPA 1Q0LA 3SD7A 1ODCA 3TDMA 1MAWA 1N2CB 2JATA 3VPDA 2VO1A 3FNBA 3KZMA 5GZ6A 4A82A 3EJ6A 5ALVA 4BZQA 1WZ2A 1XCMA 5AXBA 4NBUA 4YK7A 5AK4A 4K1LA 1KEVA 5FF9A 4ARSA 5I9MA 4DDWA 3GDOA 2P2SA 3DMDA 3PYLA 3B1KA 4NCAA 4J0JA 4N5MA 1XMXA 4PSUA 1R7RA 4TQUS 3AEKB 2H0RA 2FQYA 4A8JA 4Z49A 3G0OA 4FFNA 1B8UA 2J30A 1SOMA 2PHZA 3OIWA 4OREX 1DEAA 4XWGA 3O4RA 5L40A 3IL2A 1M2HA 5GZ1A 1Z5ZA 1JE0A 1T35A 1XWFA 2VATA 2GUWA 3A1CA 3CIFA 3FWPA 3KTDA 4OHKA 3I53A 2XH8A 1Z0KA 4IJ6A 3LUFA 4TUYA 1ORVA 4ZYZA 3EGWA 3E9RA 4G2NA 5LN1A 3LXXA 1UBJS 2BW0A 3UPUA 2ZI4A 1TIPA 1RTKA 2BJVA 1PGJA 2OWDA 3HBJA 1V3TA 4OTZA 4LXIA 4UUAA 3BSWA 1WW2A 4LHXA 2E5WA 3HUUA 2ZR7A 4A8PA 3EC2A 4ZYXA 3H5TA 3EGVA 4B6QA 3Q9NA 3I9KA 1E5DA 4H1UA 4KQJA 4Y18A 2C97A 4D41A 4X54A 1EVJA 3F1KA 3G0DA 2EJCA 3VZRA 1NQTA 1IQRA 1JYFA 3RTGA 1V7QA 3H97A 5C1BA 3ACCA 3ZE2B 1YOVA 621PA 4URWR 2QBYA 3GFTA 1A88A 3VR6D 1ESCA 2LPMA 1B76A 1WUKS 2R86A 1L3IA 3FRJA 3KKMA 4E11A 2G63A 2WP8J 2VF5X 3H9EO 3P27A 4IOKA 4N76A 2PKEA 1R12A 3CEMA 1LI5A 1A4UA 2NXWA 3AC0A 1E9CA 3D1VA 4Q24A 4RZQA 4QUIA 3W9YA 5IVKA 2XY4A 1IHUA 1ZCBA 1G66A 3ZVNA 1ZUNA 3HV0A 2VCYA 1ECBA 3VJKA 2FPIA 2FCAA 3WGKA 2Y1CA 1SBZA 2QAGC 1DBIA 2F9FA 2RHDA 1AMOA 1LZKA 3UUGA 3TNLA 3EF3A 1P17A 1CY6A 4CQLB 4RK6A 1KTIA 1IN4A 4D9FA 1PDOA 2F17A 3FRHA 3HWWA 3NEJA 1EUDB 4INPA 4TTRA 2ST1A 3NANA 4BNGA 1SVLA 3K53A 5A1JA 1KKLA 3RYFB 2VPPA 1DX9A 1PE0A 3CM0A 3EIFA 4B73A 5BR7A 2FF5A 4M8NE 3LWDA 5DHFA 4CM5A 3U7GA 3GRAA 2O06A 4TWZA 2AYXA 4L51A 4NEGA 4NABA 1F0YA 3SBEA 1KY5A 2EJUA 1RR6A 2H08A 4EITA 2JF0A