4QQRA

Structural insight into nucleotide rhamnose synthase/epimerase-reductase from arabidopsis thaliana
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
284
structure length
274
Chain Sequence
SFNFLIYGKTGWIGGLLGKLCEAQGITYTYGSGRLDRQSIVADIESVKPSHVFNAAGVTGRPNVDWCESHKVETIRTNVAGTLTLADICREKGLVLINYATGCIFEYDSGHPLGSGIGFKEEDTPNFTGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLTNPRNFITKIARYEKVVDIPNSMTILDELLPISIEMAKRNLTGIYNFTNPGVVSHNEILEMYRDYIDPSFTWKNFTEPRSNNELDATKLKTEFPELMSIKESLIKFVFEPNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into nucleotide rhamnose synthase/epimerase-reductase from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
molecule keywords 3,5-epimerase/4-reductase
total genus 96
structure length 274
sequence length 284
chains with identical sequence B
ec nomenclature ec 1.1.1.133: dTDP-4-dehydrorhamnose reductase.
pdb deposition date 2014-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4qqrA00
1AXGA 2HK7A 2QG4A 3OF2A 4OSOA 4I5FA 5GZ3A 4GI2A 1N7GA 2WDZA 3COSA 2PTGA 3D4PA 2JAPA 2PZKA 4W99A 1YQXA 4BGEA 3WGYA 1K89A 4OXYA 3CH6A 3I6IA 4YAGA 3PVZA 4R9RA 3D0OA 1B2LA 3DBLB 2PNFA 5AXDA 4AFNA 1VJ0A 1UZNA 4NQZA 3VKVA 4BMVA 1YJ8A 3PYXA 3JQFA 5T67A 3SXPA 3LU1A 4B8ZA 3K6JA 2Y0EA 3E9QA 4OOEA 4KTTE 3B70A 4AJNA 1U8FO 4MJLA 4FCCA 2HMTA 3A1NA 4BO5A 2O3RA 4NJMA 5IDXA 4AJ2A 1I0ZA 2VRCD 4LRSB 1EUDA 3RVDA 2EW2A 3DAGA 3FHLA 1EDOA 5A3VA 2AEFA 1YJQA 2GUGA 5DNAA 3O8QA 2EJWA 1ISMA 5A04A 1N9GA 4CL3A 4FSHA 2O4UX 2VHVA 1IPEA 2PGLA 4EUEA 5A05A 4IPTA 4WK6A 4N18A 2GO1A 2P4QA 4BNKA 2VYNA 1A72A 1YB4A 2WD7B 1NAHA 1T25A 2Q4BA 5CHEA 3ZWVA 4YAJA 4ALNA 5JO0A 1XCBA 1UDBA 2NLOA 2J3HA 5DULA 3MTJA 1DLJA 2PZJA 3WMXA 1E3IA 3RUCA 3D64A 4D0SA 4NG5A 2DU8A 4YR9A 4L9RA 3WWYA 1LJ8A 1GADO 3BMCA 3IJPA 1W73A 4A7PA 4WEQA 2VCYA 3RQSA 5L53A 1T1RA 3FR7A 4EEZA 4DMMA 3DBHA 5A9TA 4DIBA 1ML3A 4EBFA 1PJSA 3GFGA 3GN2A 2X22A 1J4AA 3AOEA 3NT4A 1X0XA 4A03A 3MTGA 2G0TA 5IZCA 3PHJA 3U4IA 4AJIA 2GCGA 4IJWA 3VAZA 3VKUA 1O89A 2ZB7A 4WKGA 1AUPA 1F0YA 4MKRA 3GGGA 5GY7A 4F46A 3ENNA 2NTVA 1U7TA 2WEKA 2BHLA 1EFLA 1A4IA 2NVBA 3GT0A 3ZN2A 5TJ9A 4YT4A 4R4JA 7ADHA 1RYDA 3NX4A 3PPIA 2D1YA 3H8VA 2EGGA 2E48A 1XKQA 5BSFA 4CUJA 3GVCA 4JP3A 1VL8A 3MJSA 3QLJA 4YQZA 3SEFA 3ZW8A 4B7UA 2B4QA 5TIIA 2D5AA 2FPPA 3UXYA 2GN4A 5IXYA 3DBVO 3DZIA 4CLOB 2Y93A 3UUWA 1HE5A 3GHHA 4EUHA 3ICPA 5T8KA 4DA9A 1DRUA 1P1IA 3F1LA 1NWCA 2CDBA 1VJ1A 4FBGA 1HT0A 4J43A 4K6CA 3K2BA 3UAGA 1B26A 2Y1GA 2NTNA 3MJEA 3TJRA 5U9CA 3IC5A 3GFBA 1SOVA 3PRJA 3STHA 2C07A 3ZWYA 1NX6A 1ZJYA 3C1OA 4BO8A 4JIGA 2OORA 1EVIA 3D4OA 1NR7A 2GNAA 4HNGA 2HK9A 5A06A 2Z1MA 3RWBA 4CLRB 4XR9A 3ADOA 4W6ZA 4AJEA 3LC1O 2DPHA 2HQ1A 3DTTA 4CUKA 4BOYA 4B4VA 1MG5A 3QW2A 4JJFA 1ISIA 4J2HA 1X1EA 1DC4A 2GF2A 4BNWA 1EEHA 2BGLA 2Y05A 1U9JA 2C59A 1MC5A 2X9NA 1JWAB 5I7FA 1H6BA 3JQGB 4JJGA 2VUSA 2O7QA 3W8FA 1F06A 1BXZA 3GA0A 3GQVA 4WASA 5JCXA 3SLGA 1K3TA 2ZIZA 4EI2A 1D3AA 1E3SA 3NKLA 4DBVO 3CTMA 1UP6A 3MCVA 3GG9A 3WSWA 4BGIA 4DMLA 4GBJA 3DMTA 4QEDA 4CM1A 1D1TA 2EP5A 2TMDA 1DJNA 2QZZA 3UGKA 3ZU3A 3JD1A 3AK4A 1E3EA 4C4OA 4YBZA 1F8GA 3RBXA 3QWAA 3KSUA 3S2GA 2DTDA 3OQBA 4YRDA 3OJEA 4EJ6A 4Z3DA 4N7RA 3MJVA 2IXAA 2EHDA 3NEPX 1H2BA 4YCAA 2Q1UA 3D3WA 5I9LA 1IHYA 4NJOA 4WLOA 2E49A 4R5HA 4KP7A 3DZGA 4L4SA 3BMOA 3I4CA 1P77A 1QLHA 3LF1A 1YDEA 4GX2A 4XJTA 4FOOA 1GV1A 1WZEA 4OKNA 4WLVA 3IS3A 4IQ0A 1I3KA 2Q2QA 3ZI0A 5JNLA 3MOGA 5B37A 2OP1A 5CFZA 1GAEO 3RJ5A 1ZVMA 3RI3A 5L7YA 3NTRA 4AJ4A 2NVUA 4MKXA 1NTOA 3NT5A 1ENYA 4Q39A 1EBFA 4J2OA 1X15A 4ZHSA 1Y9AA 3DZJA 3H5RA 4CMIB 3U09A 3ZNPA 1RPNA 3DEYX 1U2GA 2VHYA 5KVCA 2O4CA 1VSUA 3GF4A 2IZZA 2DC1A 2FZWA 1C0KA 3A28A 2G5CA 4XYGA 4IDDA 1ZK0A 4BNGA 3C7CB 1XU9A 1NWHA 1WWKA 4HFNA 1H2HA 1UZLA 3H2ZA 4B8WA 4XRGA 1FXSA 1YQGA 3ITKA 3VPSA 4A26A 3KEOA 1Y8RB 4DUPA 4E5PA 4CM3A 3I1JA 1I2ZA 3C85A 1I3NA 5U1PA 1HETA 2CF5A 2PKRA 2BLLA 2ZKLA 4BVAA 4QT0A 2BGMA 2Q49A 3CSDA 3GY0A 4YJHA 1BDBA 3AW9A 4Y67A 4CQMD 4CR8A 1JVBA 3PLNA 1YQDA 1XHLA 2BGKA 4ONEA 4WE3A 2NACA 4BNXA 5JS6A 3FD8A 4ALLA 4XZ3A 1JKIA 1WDKA 1Y5RA 2YUTA 4J4BA 4NU6A 2IRWA 1N1EA 1E1MA 3KB6A 4R1SA 4BL5A 3BTSA 2WD8A 1Z7EA 5MDHA 1HRDA 3ZV3A 3GHYA 4U0KA 1MXHA 2G17A 4I9HA 3DDNA 3U49A 2EIHA 4GLOA 4IDFA 4MVJA 2ZYAA 3NJ4A 3U62A 1GUFA 2JCVA 2JL1A 3MJ4A 1BVRA 3O38A 3EW7A 4U6QA 3BYZA 3QQPA 4BMSA 4Y98A 1HE2A 3ZWWA 4YTEA 5JMWA 4RL6A 4BNFA 4ZN6A 2V7PA 1QYCA 3DOOA 3ETEA 4FC6A 2ET6A 4E5NA 5JCJD 2YZ7A 2YFHA 4YJDA 4ALIA 1E6UA 4D3SA 2P2SA 2CZCA 2V65A 3JYLA 3OIGA 1AXEA 3F6YA 4CMKA 5COQA 2C20A 2X5JO 3PJEA 5EQFA 3GN1A 2FR8A 2EKPA 3JQBC 3FTNA 4RZHA 4WUVA 2OP0A 4I5EA 3UHAA 1WDLA 1PJQA 3IMFA 3WTBA 3QE3A 2FZEA 1U4OA 3LSYA 2VYND 3HDJA 4KZPA 1PR9A 1T4DA 5L4LA 3NRCA 1GUYA 3GZNA 3TFOA 2Q99A 3AU8A 1QV6A 2O3TA 3PJGA 4D45A 3G0OA 3RC1A 2B4RO 5KVVA 3QWFA 2JAHA 4PN3A 1W4ZA 3PZRA 5CEEA 4BGVA 4E2WA 2TMGA 2DM6A 3F4LA 1LNQA 2IODA 2NVUB 3KM0A 1WZIA 2Q1SA 5BNTA 2X1HA 3LC2O 5LC1A 4JK3A 3TRIA 3D5QA 1N1GA 2HMSA 4E2XA 4JN6B 4M8SA 4CV0A 4EJ0A 1YRLA 4M86A 4LVCA 5F5LA 5L4SA 2O3QA 4N5MA 1C1DB 2OUIA 4YA6A 2C2XA 3T7EA 2CY0A 1YXMA 3I5MA 4YJFA 4MVJG 3DFZA 2JD2A 4CM4B 3C3XA 4RPJA 5K0ZA 4RVGA 1QMGA 3ONDA 2ZQYA 3AY3A 3PJFA 1I32A 4BNYA 4E5KA 4LCEA 4FJ1A 3JQ7B 1DC5A 2AXQA 3IKTA 1JW9B 3BMQA 3LT4A 1GEGA 4GAEA 3RUAA 2FY8A 2HAEA 2P5UA 5IN5A 3C1AA 4RVHA 3FSRA 4D42A 3ORFA 2QRKA 1Y9EA 1ADCA 3PFWO 2I76A 2ZTLA 3OJOA 2WSBA 2JFFA 2AG5A 2C0CA 3VVBA 3ZHYA 1G6KA 4ND4A 1WW8A 4Z3KA 3TN7A 4WLNA 1GQYA 4J9VA 2YQ5A 1VE9A 4IJUA 4N5LA 3W6ZA 4YWJA 4MVJP 1PTJA 4F6CA 3RROA 1BHSA 5JMPA 3EZLA 3N58A 3LZ6A 1T24A 2CDCA 5FF9A 5F1KA 4CLRA 2GN9A 4YXFA 5L51A 4BO6A 4BNIA 1BGVA 1EVJA 3INRA 4NZ9A 4DIOA 4BQRA 4DTIA 3ST7A 1GEEA 3SJUA 1P9LA 1XG5A 3E9NA 4UVIA 5AVOA 1TVEA 5H83A 4J0FA 1MGOA 3I9NA 1XDWA 4J1QA 5COAA 1P3DA 4JBHA 2Y0CA 1ZK2A 1A7AA 3JQFC 2DBRA 4CM5A 1P1FA 1LLCA 3PDJA 4CMIA 2HU2A 5TLSA 3GVXA 4BNMA 1HZJA 2B36A 3DL2A 3KRTA 1SAYA 4OL9A 2D5CA 3JQ6A 1Q0QA 4Q3CA 3AFMA 3ENKA 3V1TC 4BUCA 4Q3DA 2X5KO 1ONPA 4XQGA 1DSSG 3A14A 4LMPA 2I5PO 2P9GA 1U5CA 4MDHA 4Q3BA 2JCYA 3HHPA 3SC4A 3GRPA 1PSDA 4LSWA 4EUFA 1WP4A 4JLWA 3G79A 3LVFO 4BS9A 1X14A 3PHIA 5B4VA 2UAGA 1VSVA 2CD9A 1LDBA 2PR2A 3OBBA 4W7HA 3S2IA 5ITVA 2RAFA 4BNZA 4KWIA 5CDSA 2HMWA 3BTOA 1Q0LA 1PJBA 4JX8A 6ADHA 4R16A 5JFOA 3C7AA 4RF3A 2H6EA 5C3MA 2EXXA 3WBFA 1P1HA 2I67A 1HDYA 4CMEC 1BRMA 2Y1FA 2O2SA 1GZ3A 3M1LA 4BB5A 3VZRA 3I52A 8LDHA 2NU7A 3M1AA 1C1XB 2OL4A 3QY9A 3UICA 4Z9FA 4OM8A 3GNQA 3GPIA 2YW9A 3KO8A 3V1YA 1Q7CA 2QRJA 1MB4A 4NIMA 1CQIA 2RH8A 2P91A 1LSUA 5DCWA 5HBRA 1FF9A 3O9ZA 4W9NA 5F5NA 3PWKA 1O5IA 5F3RA 2DTXA 1R4NB 1E1LA 1R6DA 2W8ZA 3KYBA 3GAZA 3LQFA 1ZXBA 4UUMA 1DIRA 1UR5A 4NBRA 3OJFA 1H6AA 1PJCA 1LSJA 4LW8A 3PIIA 1I8TA 1WPQA 1HDXA 1A27A 3MEQA 4I1IA 2HCTA 2ZCVA 3DBRA 2PV7A 3G17A 1M75A 3PEFA 3VVCA 5DN9A 4ALJA 4AJJA 4E3ZA 3KV3O 3AOEC 3OQ1A 5IF3A 3AWDA 1EE2A 4Z0PA 1BSVA 1QSGA 2RBEA 4WECA 4CQMA 1RKXA 2DKNA 2WYUA 1NP3A 2VWPA 2V6GA 4M49A 4O1MA 3TOZA 1PL8A 5DBFA 2R00C 3QWHA 4A2CA 4B7XA 1YE3A 1DB3A 3L6OO 1J6UA 1HDOA 4M55A 4FIZA 1OC4A 2C7VA 3TZQA 1ENOA 4Y9DA 5MGBA 3I9KA 3MOIA 4XGKA 3KXDA 3Q3CA 1I3MA 4XDYA 4NBUA 1LBEA 1GYPA 2P9EA 2BFOA 2HKIA 3RKRA 4FFLA 3S2EA 3B1JA 2X6TA 2NQ8A 3D1LA 2C54A 2VWHA 2Q1TA 3PHGA 4TSKA 5F1PA 5LDGA 2RH4A 4PGFA 7MDHA 4GVXA 1BVUA 4DRYA 2X9GA 3JCZA 3OEYA 3R1IA 5ENVA 3QVOA 2I65A 3RC2A 3AFNA 1E7YA 3LK7A 3ZU5A 2DBVO 1K6IA 4XGNA 3TPCA 2BFPA 1AGNA 1NXQA 4MP3A 3A4VA 2OMEA 2OO5A 2J6IA 4BNUA 1PGNA 3PQFA 1HE3A 3QHAA 1DEHA 2FSVA 3RD5A 1DXYA 2CMDA 1MC4A 1PJ4A 1UDAA 2PKQO 4YJGB 4BV9A 1HE4A 1ONOA 1S7CA 1J49A 1T1SA 5B4TA 1GYQA 5ILOA 1I01A 4II3A 4YT8A 3S55A 4PLTA 1KEPA 3K96A 2Q50A 4Y6PA 1JKFA 3TZKA 2HSDA 2VUTA 2VYVD 4FFNA 4IS3A 4OGWA 4BV8A 3JQ8A 4E0BA 3HB4X 3TFQA 4IY1A 1K2WA 5ES3A 5CEFA 4ROSA 1M76A 1U7HA 1X0VA 1ZSVA 4HADA 6LDHA 3JTMA 3VH3A 5BSHA 3TF5A 4IDCA 4ZQGA 2NUAA 5IG2A 4DLBA 3FTPA 4BNHA 1YOVA 3BTVA 4GMGA 4D79A 3R3JA 1KVQA 3ZV4A 2Q4EA 3GEDA 2PH3A 1F8FA 3WGHA 4BGUA 1PIWA 2F00A 1R4MB 4MKZA 4XA8A 3JQAB 2HRZA 2W90A 5JAQA 3P2YA 1KVTA 2GYYA 1PGJA 3K2EA 4BNJA 4RJTA 4J6FA 4IMRA 3RKUA 3V5NA 2BKAA 4HFRA 3NYWA 3WSVA 2CDAA 3HWRA 4UAGA 4XQCA 4HUJA 3FF4A 3OJLA 5JLAA 5CDGA 1KVUA 3VPXA 4A27A 1FMCA 2XF8A 1G1AA 3VH1A 2YJZA 4IJVA 3EUWA 3SBOA 3L9XA 4F45A 3HG7A 3OP4A 4FS3A 2V6FA 5T5QA 4IXTA 3H5AA 2D2IA 1V6AA 3MWEB 5TNXA 2B4TO 3QJ5A 2VNSA 2VTDA 3GZNB 4XB2A 4AJHA 5EIOA 3L6EA 5JC8A 2HRBA 4KOAA 1IL0A 1OMOA 1QR6A 3S1LA 1TI7A 2FOIA 3QVXA 4LSMA 1BW9A 3AI1A 3TWOA 3CINA 1HDZA 5BSGA 3DZKA 4EDFA 4CR6A 4GGPA 4PLWA 3R0IA 4XYLA 4AL4A 1EK6A 3ICCA 5A4DA 3GEMA 3U9LA 2GZ3A 4LCJA 4WCFA 1NHGA 2E82A 4HFJA 4OSPA 3RUIA 4HNHA 3UW3A 3P7MA 5A9RA 4IINA 4HX5A 4J4HA 3E5MA 2CFCA 1VKOA 1SCUA 1U28A 5JE8A 2Q1WA 3WR5A 3ZHBA 1HXHA 1VM6A 1CJCA 2WJPA 2OHXA 3L07A 5KKCA 4QX6A 3D3WB 1JDJA 1KVRA 1N2SA 4HP8A 4YJFB 3RBZA 1MP0A 1Q1NA 2BFMA 3ROPA 2DAPA 4TMFA 1SPXA 1R66A 4EYEA 2DVMA 1I3LA 4N54A 1GY8A 1PWXA 3KLPX 3OFSA 3HZZA 3QWBA 2IEBA 3PDUA 4RDHA 2VWQA 4XQEA 3WOHA 2ZYDA 4IZIA 3WNVA 4B7CA 1O0SA 1T2CA 2J5RA 3AUSA 1XLTA 3ONEA 5TC4A 2QHXA 1XU7A 3ZWAA 5L95A 1TLTA 5C5IA 1KETA 1P44A 4WOKA 5L45A 3Q9NA 3V1UA 4XRRA 4OHUA 3UOGA 1UXKA 3M2PA 2V6MA 5IDQA 1PX0A 4WCFB 5DT9A 3LT0A 2YFQA 2NU6A 2PD6A 3VPGA 1PZFA 1C0LA 1WMAA 2ZYGA 5L9AA 1YBVA 3H9UA 5I7EA 3RASA 2B5VA 2J3KA 3ITDA 2JCXA 5L40A 2R6JA 3HDHA 5AQ1A 4DQUA 1XEAA 5L4NA 3JD3A 3QVTA 9LDBA 2EERA 4R9SA 4KUHA 1E3JA 3AM4A 2ZTMA 2Y1EA 3F46A 4U8GA 3WGIA 3A06A 4LVUA 1AHIA 1D8AA 4N5NA 5H82A 1WXDA 1KEUA 3N74A 4D46A 3BHMA 1V8BA 3ROKA 1GCOA 1K5HA 2HO5A 3SJ7A 2I9PA 3W8EA 5HA5A 3PWZA 3PP8A 2PH5A 1OOEA 2OGUA 2B69A 2X86A 5JYDA 2GZ1A 3KBOA 3R6DA 4PVCA 2D8AA 4IIVA 3AUAA 2YY7A 4NR0A 3DB2A 2A92A 3CEAA 2B0JA 4P4NA 4MVJH 2EW8A 2O23A 4YAIA 4KWHA 4D0RA 3ROMA 4OOFA 3P2OA 2VYVA 4AJKA 3B1KA 1GU7A 2J5KA 1GD1O 1NYTA 3KYCA 4CM9D 3BMQB 3VZSA 3QRWA 3FWZA 2PZLA 3KEQA 5TGDA 4DBZA 3WLFA 3INGA 2OXIA 3AU9A 3PGJA 3CMMA 2B35A 4PLHA 2PKQP 3WGTA 4MVJF 4AJOA 3EDMA 1BXGA 3PQEA 5TS3A 1LTHR 1R0KA 4PZDA 1K6XA 1LRLA 5T57A 4DLLA 1UH5A 3DBHB 3RUFA 5B12A 2X9VA 5EQDA 3K5PA 2YDYA 2PZMA 2C2YA 4YPOA 3NT2A 1X7HA 1MFZA 3KSZO 3SX2A 3RJ9A 2PGDA 1DIGA 1HLPA 3DBLA 4D43A 3KYDA 1MA0A 2G1UA 4NFYA 1B16A 4BKPA 1PGOA 2WMDA 3ZWBA 2H5LA 3CKYA 4OQZA 4QO8A 3K30A 2ZB3A 4Z0TA 3JQ7A 5C37A 1E7MA 1DRWA 1N5DA 4FFOA 1U5AA 2EV9A 4OYRA 4BNNA 3WGOA 2FHSA 1RM5A 3ULKA 1YOVB 5CDUA 4IGFA 2OBYA 3WICA 1FDVA 4BKUA 3RBVA 3H2SA 3TL3A 2GGSA 3FR8A 4CM8A 4IJKA 1PGPA 1NHWA 1Y8QA 1M67A 4G81A 1LDMA 3O4RA 1U3UA 2A4KA 2DFDA 1A7KA 2E37A 1GV0A 3B1FA 5IN4A 2HJRA 2VNAA 1PS8A 2Y99A 3JQAA 4AG3A 4GQAA 5KNLA 2CF6A 1BDMA 3UKOA 3L4SO 4IUYA 1JQBA 4WLUA 1U8XX 1XELA 4ZD6A 1O94A 1EUZA 1J0XO 1NAIA 3E5RA 5CG2A 4YAKA 1YL7A 3UCXA 4IXWA 1P33A 5A9SB 3GNTA 1A9ZA 1BG6A 1UDCA 3OHSX 5FI3A 1SZJG 1QKIA 4J0EA 4WLFA 4DPKA 2QZ9A 4DQVA 5C7IO 3DZFA 3U3XA 3ANNA 4FC7A 3R3SA 2VUUA 1YBMA 3QA9A 2G82A 4NFHA 1IZ0A 2V6BA 2CUKA 4U5QA 1JLLA 2QQ5A 4R54A 4ALMA 3H3JA 4TRRA 3AI3A 3PJDA 2EKLA 1CQJA 1VRWA 2F1KA 2FMUA 3KZVA 4WLEA 4ZA2A 1P1KA 4E2ZA 1YL5A 4WGGA 1V0JA 1OBFO 2VQ3A 4JNKA 3AY6A 1PU2A 1KIFA 3H3FA 1DOHA 3WLEA 2NTJA 3GGOA 4IDGA 3F1KA 4TRJA 3IUSA 4PLPA 1KOLA 4DL9A 5IDWA 5KKAA 5FEUA 2HLPA 3TQHA 1X1TA 4URFA 5EN4A 1P0CA 5AXBA 1LU9A 2AEMA 1AE1A 4P8RA 1MV8A 3HQ4O 2GSDA 2VOJA 3UCFA 4CMEA 3GNSA 4PLZA 5TT0A 1ZKMA 1HDGO 1VC2A 1YGYA 3INTA 2YDXA 2O3JA 2YQ4A 3I83A 5I7SA 5TX7A 3NGXA 1BXGB 3TZCA 1HSOA 2AE1A 4GL4A 4W9NC 1CDOA 3O8QB 2XXJA 1NVGA 3JD0A 2JFHA 3WX0A 3RCBA 4RZIA 5EL0A 5KOIA 5JPIA 1LX6A 1O8CA 3H9QA 3GOHA 3BHJA 2UV8A 4Q3EA 4XWYA 4W4TA 2W2LD 3E9MA 3JYOA 2Y1OA 4EEXA 2I99A 3CPSA 3OMLA 1UXJA 4IQ8A 2A94A 4CM7A 3BAZA 1WDMA 3ZGYA 1PJ2A 3BMNB 2NV6A 4O5OA 1P45A 5C7LO 3EVTA 4BKQA 4RQUA 2RHRA 1P1JA 3SLKA 2PWZA 3GZ4A 3H4VA 1NFFA 5KJFA 1IULA 1ZBQA 3QVWA 1C0IA 1GZ6A 1YWGO 1DLIA 1JAYA 2J5QA 2JD1A 3F4BA 1W0CA 1S6YA 5F21A 3L4BC 3D7LA 4J90A 2Y67A 1ZO8A 1LLUA 4RO0A 1QYVA 4Y8VA 3FPCA 1KVSA 1MFPA 9LDTA 5HWSA 1B8VA 1KYQA 3WDSA 3K92A 1UP4A 3NDRA 1HDCA 4B4UA 2JKVA 3VC7A 1L1FA 3ZNOA 1ZZEA 5EINA 5I7VA 4FPXA 5JW6A 2BH9A 4RPGA 1XYGA 3EMKA 4WEOA 1GR0A 2Q46A 1KEVA 4WCFC 4PLVA 2RHCA 4IZHA 1EZ4A 1NVTA 5I8WA 5JDCA 3ETGA 2WYWA 4UEOA 2FPGA 1LDNA 2CSUA 4FDAA 2DPGA 3EY4A 4U7WA 5JSFA 1UXGA 4NBVA 4RQTA 5ILGA 5A5EA 5A03A 4UVDA 1PEDA 4FB5A 5JY6A 4INAA 4J1NA 5IXSA 4IQGA 2BI8A 3NDIA 4OKIA 4PFJA 4TKMA 4CMGA 1AHHA 1BW9B 5KJ6A 5K9ZA 1YS4A 4BO2A 1EQUA 2O7SA 3ZWMA 3PYMA 4JJIA 4E12A 4U6SA 4CPDA 1I33A 4GMFA 5ICMA 4L4XA 1E1KA 2VTEA 1IZ9A 2J3JA 4XYMA 2HMUA 3VZPA 5JC1A 4DIFA 2UVDA 1H93A 5I9MA 5TRTA 2GRAA 3UN1A 5CPFA 4Z0HO 4TRMA 4TQGA 1DBVO 1B15A 1Z6ZA 4J7CA 2AQ8A 3ZWPA 4S1VA 4BO0A 4CMHA 2JHGA 3Q9UA 2CVOA 1TXGA 3U4DA 4DXHA 3JV7A 5C7OO 4BO3A 4XR4A 4I9NA 2ZCUA 1E7SA 2ZQZA 3IKVA 2I3AA 1PR3A 4P38A 1ZK1A 2VRCA 1HSZA 3WQQA 1ZXLA 2X8LA 4B3JA 2WYVA 2GPTA 3G49A 3DMTC 3OQ6A 1HEUA 3IJRA 4NFSA 1HYGA 1ZSNA 2FN7A 4DC0A 1NQ5A 2IZ0A 4FW8A 3C8MA 3DTYA 3PLRA 4HBGA 3QV1A 5CAEA 4FGWA 2HUNA 4GPD1 3RSHA 2PLAA 2BI7A 5FWNA 2DLDA 1U3VA 3I4FA 3WIEA 5JAZA 3I3OA 3FCOA 3E48A 2IEDA 1HZZA 4GSKA 4L4RA 2Y1DA 4K6FA 1E5QA 1UXIA 1V3UA 3Q6IA 3VPHA 5FYDA 5A9SA 4NNJA 2IYPA 4UEJA 5IJZA 4ITUA 1ZW1A 3X2EA 1ZNQO 3I9MA 4OXKA 4WCDA 2EWMA 3ON5A 2ZTUA 2OZPA 4BO1A 1K6JA 1BXKA 1GZ4A 4R3NA 3BHIA 1XQ1A 1E3WB 2IYOA 4Z9XA 2QW8A 3I6QA 4ILKA 5THQA 1E3WA 4WOJA 2NQTA 4DPMA 4NI5A 4EW6A 4PRLA 3GVHA 1E1NA 1EFKA 4XIJA 1E3LA 5BNFA 4K26A 5L7WA 3ANLA 3DZBA 3HFGA 3T4EA 4E31A 1SC6A 1LSOA 1QXSA 3FI9A 1JTVA 5CDTA 5BR7A 4E2YA 4BO7A 1Y5MA 1QG6A 2RIRA 1E6WA 4R51A 3AOGA 3LDHA 2FSSA 2C7GA 3IUPA 3U4HA 2J3IA 2DUUA 1LQUA 5CPBA 1DHRA 5T64A 2OOSA 1EVYA 3K8ZA 5DCYA 3RU7A 3PHHA 2EEZA 4UVEA 5DZSA 4F3YA 5B1YA 1QLJA 1GDHA 3WG9A 1P31A 1Z7BA 4PLYA 5JAMA 4G65A 4B3IA 1PZEA 5ER9A 4NPCA 5A02A 3OICA 3K73O 4QO7A 4MP8A 5HM8A 4MOWA 1V3VA 2X4GA 3WIDA 1LQTA 1R0SA 4YJHB 5COBA 3JYPA 1NPTO 1TB4A 5JDCC 1R4MA 3HJAA 1HF3A 2R2GA 1R37A 3UH1A 5DF1A 1N7HA 1E92A 4E33A 2AA3A 3GR6A 1LRKA 1I10A 4CLHA 4CJXA 2DTEA 4GX0A 1IPFA 1WVGA 2EF1A 2PD4A 3NTQA 4GH5A 5DOZA 1HYHA 4OAQA 5J23A 1LSSA 2ZJ1A 1RWBA 3NV9A 3I9OA 4ALKA 2W2LA 2UYYA 3F9IA 4A73A 4EGFA 4ZQEA 1Q0HA 3RUEA 4UREA 1YL6A 1R0LA 3I9JA 3CUKA 3TDKA 5IFLA 4ZQBA 2W2KB 1LRJA 2FPIA 4RF4A 4FQ8A 1IY8A 2GDZA 4PG6A 4R3WA 4H7PA 4TZKA 2Z1NA 4YAEA 2X0JA 1PZGA 1ORRA 1EMDA 3D4NA 3JQ9A 3BMCB 1DO8A 3GC6A 3MZ0A 1PQWA 5HTOA 3PK0A 1VI2A 4OH1A 3FBTA 1DAPA 3AI2A 1PJTA 1ZMTA 1TEHA 2IZ1A 1C1XA 1YB1A 4ZGWA 3IDSA 5G0TA 2QYTA 2VHXA 2EKQA 1LA2A 3OEWA 4RPLA 1DFGA 4OO3A 1FDUA 3GG2A 4QECA 5HRUA 1H6DA 3OIFA 2BD0A 1H94A 4XGIA 3ZW9A 1U1IA 3GDFA 4J49A 4RCVA 1H0KA 3FN4A 3OA0A 4BO9A 2XPCA 1BMDA 3F5SA 2P4HX 5A1TA 3BIOA 1SEVA 4C7JA 1V9LA 4CQLB 3L6DA 3JQEA 2DT5A 3KSDO 1YKFA 3C24A 1QP8A 4MO2A 5GMOA 4ZRNA 4BO4A 4CM4A 1LDEA 3OM9A 2SCUA 5DBIA 3AY7A 4Z9YA 3CZMA 1CIVA 2Y68A 2JJYA 4BNVA 4E21A 4CLEA 1B3RA 2ZB4A 4L74A 1XSEA 1XQ6A 5IZ4A 4YRAA 1ISHA 3JQGA 1ISJA 3OH8A 1U3WA 3ZH2A 2O48X 3Q2IA 2FR0A 4HKTA 3I23A 5H81A 1M2WA 1ADFA 4EZBA 3E1KA 4WPGA 4JP2A 1PWZA 1U3TA 2C5EA 4DLAA 3NGLA 2R00A 4PIVA 1ZH8A 2PGJA 3RFVA 1NPYA 4XB1A 3Q2KA 4CQMB 1IOLA 1T2EA 1QORA 1CWUA 1A5ZA 1GPDG 3VH2A 3FWNA 1X13A 4L76A 5DBGA 3PWSA 1OAAA 4RF5A 5G4KB 2C82A 3Q0EA 2X58A 4ZQFA 1LUAA 1O95A 4BNTA 2H9IA 3P5SA 4F6LA 2OFPA 2DBZA 3QSGA 1EDZA 4XKJA 3KTDA 4CV3A 4CUZA 1ARZA 4QTZA 5A3JA 1T26A 2AEJA 4D7AA 1IHXA 3OA2A 3OETA 3WQSB 4RDIA 1Z82A 4D41A 1Z45A 5JDIC 1FDTA 3HFSA 3TOXA 2JHFA 4WNCA 4BIIA 2AMFA 4FR5A 4YEDA 5EPOA 5IDYA 2FWMX 1LEHA 2Y66A 2RCYA 1ZEMA 4M54A 3MJTA 3LF2A 4JBIA 1TT7A 2ZATA 2AQIA 4J1SA 1PL6A 4E5YA 4CODB 3H9JA 2VWGA 2DQ4A 3PXXA 1NQAO 2BELA 3GUCA 3IP3A 5AXAA 2P5YA 1EUCA 4HXYA 4I08A 2CVQA 1R15A 3TZHA 4XD2A 2VN8A 3HN2A 3E03A 3GDOA 3KVOA 4PCVA 5AXCA 1KEWA 3BTUA 3ZNQA 3HDQA 4Y6SA 2XXBA 3DZHA 3ONFA 4KMSA 5ICSA 1ZFNA 1N9GB 3DAPA 4FOSA 2BMAA 3RUDA 1ENPA 5BSEA 3NJ8A 4CMBA 1JN0A 3WGGA 5FFFA 5KJEA 3W4KA 4CLOA 3JQDA 4QUKA 4ZU3A 1KY5A 1HTBA 3GVPA 2BFAA 3FNEA 1SEPA 4G2NA 1NQOA 4J7XA 1FJHA 4XCVA 1KY4A 3IIEA 4L73A 4R69A 2FRDA 5DDIP 3JD2A 5TT1A 2NM0A 3VPFA 4GX5A 5DP2A 2X0NA 3O03A 3JQ9C 4NDNE 2YYYA 2JFGA 3QP9A 4IS2A 1B0AA 3H9GA 2WTBA 5KVSA 4BKRA 1I36A 1YH3A 4A0SA 4CV2A 4MPDA 5KTKA 2VHWA 1C0PA 2WWRA 3ANMA 4Y6RA 2LDBA 3ZU2A 1IYZA 3RC9A 1PS0A 4OXNA 1BWSA 4LGVA 4WNIA 4J9UE 3ABIA 4E13A 1ZMOA 1JU9A 1NNUA 4RPKA 3V2HA 3TL2A 2DFVA 1I30A 1DIHA 3DC2A 4AJPA 3GDGA 4NHEA 3E8XA 1GUZA 4J16A 3KUXA 2CNBA 4JBGA 1LC3A 1NR1A 1TT5A 4JXKA 5CG1A 2W4QA 4BMNA 4CMAA 3ZWXA 4XYEA 3W1VA 3KYCB 1E5LA 4LMRA 1D1SA 4XX0A 1P1RA 3L0DA 4GKBA 4O6VA 4KDEA 3SVTA 3IP1A 4PG5A 4X54A 4TKLA 1UAGA 1JAXA 3O26A 4ND2A 1DJQA 2NU9A 3GRKA 4G5HA 3JD4A 3IOYA 1SOWA 4IIUA 3AUUA 1IB6A 4PLGA 1U2DA 1O9BA 5AYVA 1HLDA 5LDHA 3ZHZA 3GUYA 2A35A 3NTOA 4KDFA 2W2KA 3S2FA 2POQX 4E5MA 4LN1A 1QYXA 4YT5A 4E32A 5FI5A 4B4OA 5THKA 1UXHA 1YONA 3MWDB 3AM5A 3PQDA 4CMCA 1Q7BA 3L4BA 2Z95A 4D3FA 3UVEA 3WXBA 3HUDA 4I5DA 2EGHA 2PY6A 1E7RA 4UUOA 2OBNA 1VJTA 3ZWOA 1Q2XA 2GASA 3K9QO 5TQVA 1LDYA 4W82A 4B4WA 3ASVA 5JDIA 3EHEA 4H16A 3LYLA 4BQPA 1ZK4A 5BQFA 3G1TA 1XR3A 3WGZA 2O3UA 4FFRA 4Z6KA 1A9YA 1H5QA 4A10A 3CXRA 1A4UA 4GX1A 3WJAA 3T7CA 4RVFA 2C29D 3BMOB 3RAJA 1CEQA 4P22A 3WQRA 1EK5A 4YQYA 1LXCA 1QV7A 1XIVA 2FR1A 1HWYA 3KOUA 3OECA 1O6ZA 3DHEA 3LT2A 1E0DA 4FGSA 1N8KA 3AJRA 1M66A 3WMWA 4ID9A 2H1SA 2IE0A 1FDWA 2EG9A 4H3VA 4IGEA 4HFMA 2ZJ0A 4MVJE 1YDWA 4XJSA 3QVSA 1Y7TA 5KVQA 2LDXA 1RM3A 1PS9A 1PQPA 3EAGA 1G0OA 1T2FA 1JA9A 4FD3A 4Q3AA 1PL7A 1DRVA 1SBYA 5KJCA 5EMHA 2EJVA 4QXMA 3M2TA 3WTCA 3BMNA 3W8DA 4KUGA 1GQ2A 2HMVA 3LLSA 3GPDG 4R68A 3C1TA 3ZWNA 3JQBA 4KQWA 3QWIA 4PLFA 3FNGA 5GZ1A 3GH3A 5CEJA 4NMHA 3ETDA 3EZYA 3B20A 2X0IA 4RPHA 8ADHA 5K6AC 3VDQA 4RV9A 2XAAA 3G3EA 4KTVE 1Y81A 1NASA 4M89A 1TT5B 4MVJM 5JBIA 4QSMA 4AJLA 4O63O 3W4JA 3T4XA 2NWQA 3NDJA 2Q2WA 3S8MA 2GZ2A 3RFTA 4RLSA 1ONNA 3RU9A 1DC6A 1VL0A 3PFFA 3TSCA 4DWVA 4RVDA 4R41A 3IAHA 2GD1O 4D3DA 1NVMB 3H65A 3TZ6A 1XWFA 1FDSA 3PYLA 4ZQHA 5KCZA 3ZWCA 3ZZNA 5ITWA 1Z73A 3ZNNA 4BB6A 4CLXA 5EESA 3ZCXA 1PGQA 5ENDA 1AN9A 1C3VA 2B37A 5DCUA 4M1QA 5IZCC 1ZJZA 3SC6A 3ASUA 2O50A 3JSAA 2O2YA 2WE7A 5HS6A 4R01A 3ZU4A 1JVSA 5G0UA 3U4CA 3KHUA 1PJ3A 1UP7A 4TRNA 3GAFA 1SNYA 1UJMA 3WJ7A 3D3EA 1PQUA 5F1OA 5EERA 4TZTA 2A9FA 2J8ZA 4DYVA 1ADGA 3NAQA 4L8VA 4BHTA 1QRRA 5KWEA 1HL3A 1EQ2A 4DPLA 1MG0A 5TJHA 1V3TA 3CMCO 3WWZA 3IQDB 1F17A 1H6CA 4MIEA 3ZV6A 4AICA 1B8UA 5CP8A 1X7GA 1CRWG 4IDEA 2NNLD 1ISFA 3ADPA 3DFUA 5A5FA 3F5QA 4BNLA 4EITA 3DHYA 3G1UA 3GK3A 2XOXA 3D5TA 4LISA 1RJWA 3HDYA 4FFMA 3UF0A 1YO6A 2UUPA 4GKVA 1M6HA 3M6IA 1D7OA 5GZ6A 3RUHA 4PLCA 1MX3A 3HE3A 3BZUA 2I66A 1VLLA 3DOCA 3DWFA 2VZ8A 2NADA 3RIHA 3AUTA 1H9BA 3CIFA 4ND5A 4C7KA 4J4TA 5CDYA 4O59O 2Q2VA 1EBUA 4GLLA 5I8ZA 5ER6A 2GN6A 3DBRB 1SMKA 3JQ8B 1D4FA 4NK4A 3VOSA 1MUUA 3GGPA 5IAAA 4K9DA 4K1LA 4W7IA 3V2UA 1LI4A 2AHRA 1JKJA 1X7DA 2HK8A 2W98A 3WBBA 3UFXA 2Y0DA 4L75A 3OIDA 4JCOA 4FFPA 4IMPA 3Q11A 4OJNA 3BXXA 1KC1A 4HWKA 1N92A 1ZCJA 4B79A 4QFDA 1G0NA 4QQRA 1GQQA 1QYWA 4CM9A 1YVEI 2AQHA 4P4LA 3EVNA 4NH4A 3DONA 4AJ1A 1B8PA 2GLXA 4OQYA 4UVGA 1ZSYA 2FP4A 3FNHA 3GMSA 4PVDA 1BTOA 4R1UA 4XQ9A 4E30A 3UCEA 4HV4A 1Y8RA 1B7GO 2BRUA 4A5OA 3GMDA 2I6TA 4GVLA 5T6BA 2ZK7A 2UDPA 2ZTVA 4E4YA 3DXFA 4MINA 2WD7A 4WJZA 4O0LA 1ULSA 2WE8A 1WLYA 4IBOA 3WNQA 1C1DA 2GERA 4YRBA 2AQKA 3TNLA 3NUGA 4LK3A 2PK3A 1YB5A 1DIAA 1M6WA 3JYNA 3HSKA 1OI7A 4KQXA 3DO5A 4NBTA 5JXWA 1NBOA 2X0RA 5B4UA 1DC3A 4ZVVA 5K6AA 3VZQA 2PD3A 3HN7A 5JO9A 1E77A 4MIOA 4RVUA 2QRLA 2HJSA 3ZDFA 1P74A 1PJLA 1Y1PA 1EE9A 4IM7A 1DAOA 3FBGA 4MP6A 3RFXA 4IDBA 2BF7A 3H5NA 2NU8A 4KUEA 4YB8A 4Q3NA 1QYDA 1ZK3A 4MVJI 1R4NA 5L7TA 2PA3A 1UUFA 4UULA 3GVIA 4J3FA 5G2OA 2D59A 3LT1A 2GR9A 1DPGA 3E6AA 3FNFA 3FPLA 1KERA 4P4GA 2YHIB 1H9AA 3ZV5A 4YDRA 1JWBB 5HS4A 3W6UA 2X5OA 4XIYA 1VKNA 4HY3A 3OSUA 2UUOA 4J7UA 1DFHA 3DR3A 1XGKA 3WYEA 3WYBA 4JGBA 3JYQA 2I3GA 5BNIA 3Q1LA 1UZMA 1WMBA 2D0IA 3EYWA 2VHZA 3HNPA 1ZIDA 1I2CA 1MLDA 5G0VA 4CR7A 3E82A 2QX7A 4PG7A 4U0JA 3F3SA 3JQCA 2YV2A 1ADBA 4I9UA 4XYBA 2Y1CA 1RM4A 3VHRA 1CETA 1XA0A 5G4KA 4RLHA 2ZB8A 1CYDA 5LCXA 3F47A 1J5PA 4YVFA 3WYCA 1IE3A 1WAMA 2YHIA 1P0FA 4CLDA 2WM3A 2D4AA 3RC7A 2HDHA 2PFGA 4QFCA 1ISGA 2G76A 1HDRA 2VOEA 4NBWA 4YYZA 4RF2A 5ADHA 2AG8A 2NVWA 3HADA 4GWGA 1ZEJA 3VTZA 4OMUA 4DREA 1MXFA 1IUKA 3B6ZA 1KS9A 3WS7A 1I5RA 1GTMA 1SB8A 4K28A 4YT2A 4CMJA 4Q9NA 1KBZA 4YACA 4DYDA 3WB9A 4XEHA 1K0UA 1Q7GA 3W4IA 1GL3A 1VL6A 2DUWA 5U4QA 4DQXA 1LLDA 5AOVA 1LC0A 1LDGA 5DP1A 2P68A 4II2A 2X7HA 3EGOA 4FJ0A 1W8DA 5JY1A 3PTZA 2D3TA 4FN4A 2E4AA 3A9WA 1HYEA 3KLMX 1YBAA 4JQCA 3L9WA 3FRJA 5JAIA 1NPDA 5BT9A 4UUPA 3IL2A 1NQTA 1E7WA 3KYDB 4M87A 1SO8A 4PG4A 3PHLA 4ZICA 1C14A 4NK5A 1NM5A 1R16A 4UUNA 4ZJUA 4CM6A 5G4LA 2QIOA 3OJ0A 4GWKA 4B3HA 4ND1A 4LRTB 1W6UA 2Q3EA 4H15A 4ND3A 1Z74A 3PI7A 2EP7A 2VZ0A 3DHNA 1V35A 1E6EA 3EC7A 4DVJA 4PRKA 1GYRA 4TVOA 2IDZA 2VT2A 1DHTA 1L7EA 3P19A 3PGXA 4J1TA 1B14A 1LLQA 4PZEA 1T4BA 3AM3A 2AE2A 4EJMA 3WFJA 4NU5A 4UVHA 1RYEA 3C7DB 2GN8A 4I8XA 3V8BA 1DDOA 5G0SA 2VRBA 1ENZA 4DGSA 3CE6A 4L0QA 4OIMA 3H9EO 4TROA 1I2BA 3K31A 3ROQA 1DFIA 1OC2A 3ZHXA 2YV1A 4GSLA 1ULUA 4R1TA 2JD0A 2CVZA 5I9NA 2DBQA 1KC3A 1GCUA 3DMYA 4CV1A 1WNTA 3VTFA 1RM0A 1DIBA 1L7DA 3E18A 3VH4A 5JYEA 4MIYA 2IXBA 3V2GA 2Z5LA 3H6KA 3MJCA 3VDRA 1Y6JA 3WFIA 4JROA 1HKUA 1CF2O 3CZRA 1NFRA 3U0BA 5TSDA 5JCJA 1ID1A 3U5TA 1T2AA 3LC7O 3EK2A 5L3ZA 4BKOA 4TWRA 1NFQA 1Y8QB 1CERA 1I24A 4DC1A 3I9LA 1OFGA 3PZBA 1OZAA 2C5AA 1SB9A 5TF4A 1EVZA 2QYSA 4RORA 4FJ2A 4CL8A 4NJMB 4CQLA 5KIAA 2VT3A 2P9CA 4ZRMA 1A71A 4MVJD 1F12A 4E6PA 4D44A 5DOVA 4R1NA 4UEKA 1F14A 1B3BA 4PZCA 4RVSA 1U4SA 3WGQA 3KETA 5KJ1A 1GPJA 4GGOA 3QIVA 4I5GA 1R12A 2O3SA 1FK8A 2H63A 3GEGA 1Z75A 4R5MA 3BA1A 3DOJA 2B83A 5G0WA 2VZ9A 4J91A 1VPDA 2E6UX 3L77A 5T8KC 1PZHA 4YJGA 4ESOA 2AW5A 3N7UA 4IDAA 3DAFA 3PIDA 4PG8A 2ILTA 3X2FA 4TVBA 2NSDA 1GFSA 2YV3A 1UAYA 2Q45A 2YHUA 3DQPA 3JQAD 4RGBA 1T2DA 2X23A 2B5WA 1E7QA 4XDZA 4CM8B 3HB5X 4S3MA 4AVYA 5EJ2A 1TA4A 3H7AA 1ZUD1 3LLVA 3GLQA
chains in the Genus database with same CATH superfamily
2HX1A 3IDFA 3B1XA 5KYXB 2VBFA 3OF2A 1KQNA 2L19A 3NUZA 4I5FA 3NB0A 1VG1A 3K9BA 2XV1A 3IKJA 1O57A 3HZOA 1XXLA 4DKXA 5E95A 2J3QA 4K6MA 1X80B 1HBJA 1V8DA 2GBGA 2RI0A 3D4PA 3SWWA 1XNJA 2IEZA 2E85A 2JGJA 4IFIA 1Q16A 2V59A 4JEMA 4W99A 1YQXA 4PYLA 2XOKA 4IUCS 1LJUA 3K16A 3M6VA 2SBTA 2WC1A 3WGYA 3QU7A 4BGEA 4BQOA 3DWIA 4OGGA 3FKJA 1YQUA 1Y6GA 5GIPE 3DEIA 2V3CC 2R6DA 3WA7A 2QL7A 3DBLB 1Y1RA 4NMWA 3GB9A 4H0CA 1UZNA 4B8YA 2VDPB 3GRAA 1KZHA 1GDTA 3C6YA 1YJ8A 1FP2A 3PYXA 3K0EA 3O84A 1A04A 4EY7A 2E89A 3I3SR 4QDUA 5E8RA 2B6NA 4D4KA 1CPYA 3E0QA 1E99A 3H5WA 1ABFA 1U8ZA 3R2JA 4Q4HB 1U0HC 2GEDA 2MU1A 3LU1A 4Q93A 3K6JA 4QWWA 3UJBA 4C0QC 4MRSA 2Y0EA 4OOEA 4QRIA 1N32B 4AJNA 5KMGA 5TB5A 3BFKA 1IEWA 5HX7A 4F1KA 3T9EA 1NONA 2VDNB 2XYPA 4O2AF 4FCCA 3S3TA 3A1NA 1XJCA 2H59A 1QZZA 3BRCA 3D8SA 2ODNA 3C1UA 3E5NA 3ETJA 1ODFA 3R0XA 2EZUA 4NJMA 1MQ9A 2R1VB 3CCFA 4J3NA 2VJKA 1G8FA 1EUDA 1N7JA 1JDPA 3E3LA 3L7NA 4YRSA 2VPQA 1TK9A 1KH2A 2HNBA 4YHHB 2Q29A 3FHLA 4MUGA 2E4YA 5A3VA 1K75A 4U2EA 4FIDA 2J30A 3IR5A 1E5VA 1EI9A 4HVTA 1AKWA 2GARA 3FYCA 1N9GA 3D8TA 2PLRA 4FSHA 2XVMA 1CJSA 2VHVA 1NP7A 1PI3A 3WJ1A 1AMOA 2J08A 4IF4A 3B8HA 3RH0A 3KFLA 1G3MA 1CJTC 1WZUA 4WIAA 4KQGA 3SEQA 5BV2P 1XZAA 1YB4A 3OEED 3ABOB 3AR4A 4PZYA 3ZWVA 3TDNA 2X3UA 1O94D 3I45A 3U4MA 5A0VA 2J3HA 4FYPA 2PZJA 1K97A 3RUCA 2V6IA 4RVOA 4D0SA 2CLCX 3TNFA 2DU8A 2CHEA 3BF8A 1LJ8A 5GOTA 3KR1A 1GADO 3GH1A 3IJPA 4U7HA 3RK0A 3RQSA 5L53A 3EIWA 4BX2A 1NSYA 1E60A 3CLHA 2A57A 3DBHA 4LG1A 2VF4X 3GFGA 3GN2A 3RVOA 3MTGA 3EWAA 1PNOA 3ESDA 4B83A 3U4IA 2QSJA 1Z16A 4AJIA 4W5TA 1O3YA 1KRHA 6CHYA 1QDEA 4ZK6A 4WKGA 3OZIA 3ENNA 2G67A 5FOXA 2JFBA 1UT6A 1FDIA 1G2PA 2NTVA 2XVZA 3R74A 4BZPA 3RFFA 1WB5A 1S8NA 3SC2A 4D57A 2XUJA 2PKCA 3ICVA 4KWCA 1OPXA 2FOXA 2JEOA 4R4JA 5JNUA 1RYDA 1ZQ9A 3QE9Y 2V5UA 2YWGA 1DDIA 1E18A 3AHHA 5KUTA 5EJ7A 5JZMA 3FLAA 3GVCA 3MJSA 4H0FA 1SVLA 3U7IA 3SEFA 4YRZA 2WM9B 3KQYA 1T4CB 2Q8NA 4CDNA 3W6OA 2JLRA 2QNRA 3T9CA 3W5SA 1XCGB 5CM2Z 3WZMA 1PT7A 5EZ6B 3UXYA 3E5HA 5IXYA 5IM4F 3DZIA 1DAEA 1ZI6A 4CLOB 2Y93A 1L5FA 3DQQA 3H0CA 5TE9A 3REOA 5MFZA 1HE5A 3GHHA 4EUHA 3ICPA 2H8GA 5T8KA 1BYIA 1DRUA 3F1LA 2Y27A 4K6CA 4J43A 4OHRA 5FWDA 2C5BA 4FWBA 4LBYA 1DQZA 4O25A 2Y1GA 4YRNA 2QRVB 2R6HA 4AZSA 4DUZB 1ZH4A 1WB6A 2NTNA 3FZYA 4HNTA 3ITNA 2KE5A 2GS9A 3GFBA 3IC5A 3PRJA 2GM5A 4FCWA 3STHA 4BFWA 3A27A 4BN0A 3NOQA 1Z5GA 4BO8A 3BSSA 2ZR7A 2WF7A 3CW9A 3ORQA 1KI7A 1UANA 2GNAA 1H4QA 5E1BA 4U7JA 1TJ3A 4R2LA 4B48A 3SKXA 3WNZA 5ALTA 3OMWA 4RMGA 4CLRB 4B33A 1QK5A 4OP1A 4XR9A 4W6ZA 5EWLB 1XDZA 4AJEA 1PT5A 2CHUA 4JJFA 2C0QA 1DC4A 1FFXA 2GF2A 3B48A 3LVQE 3VI4B 1EEHA 4MDEA 4DW8A 1BX0A 3KWFA 4PO9A 1NW6A 5DEIA 5LZ8A 4AY5A 2VUSA 2EQ5A 1RZRD 1F06A 2OFOA 2Y1LA 3AR5A 3VYVA 2HZ7A 1NVDA 1K3TA 2PZ8A 2XRFA 2PZGA 2ZIZA 4M0KA 4W1RA 3T1VA 4PWYA 2Z2IA 1JS1X 4DBVO 2ZJ8A 3CTMA 1FVXA 1Y1LA 3MCVA 1ZA2A 3CA8A 3WSWA 5KNBD 3RFUA 3A3OA 4GBJA 4I4CA 2QVGA 4CM1A 4Z7JA 4NCAA 3A2MA 3ZU3A 3NFRA 3HLKA 2WICA 5JCPA 3JD1A 4G0MA 2JIDA 3L5KA 1F8GA 3RBXA 4HNSA 4JHLA 1S3GA 4HGRA 5EGNA 4DV0B 1HLGA 2V6JA 3JAMA 2DTDA 3OQBA 1X94A 4EJ6A 3A3PA 4KIJA 4RCYA 2YWXA 5TPZD 5I9LA 2PUTA 2J31A 1WMFA 1CUVA 4KP7A 5KWVA 1LF5A 3I4CA 1TL7C 1R6BX 4GX2A 4Q02A 2JAOA 3BK2A 4GEKA 4EQZA 5HQTA 2J4CA 3NHPA 4IQ0A 1GOTA 1XN1A 5AKEA 1TYBE 4JLVA 3UIEA 4D99A 3SC3A 1G9SA 4L5YA 3U3JA 3MN1A 2E9SA 4TTPA 4DCGA 2P9QA 3E70C 4UD2A 5AK5A 1RWOA 2YWFA 1M8GA 1UBGA 3SHQA 1ZVMA 3AVYA 2XDQB 3QFRA 4JVSB 4BFXA 5DM4A 5KNCA 1Y4UA 2FH5B 4LDZA 4KRGA 3ZHCA 1OGIA 2V4ZA 4U2FA 1SXJD 5DGDA 1EBFA 1TW2A 4J2OA 2G6BA 1Y9AA 2R7LA 2FSPA 2H1CA 1PR5A 4HQRA 4Y30A 3QBEA 5BYJA 2RGCA 1VSQA 4HMPA 1UJ5A 5CM9C 1RPNA 4KQ6A 4C88A 2NPOA 2IZZA 2W71A 2QL9A 1U8AA 4RKWA 3OWHA 3PF8A 4J7AA 1Z2OX 2FPKA 2HCBA 1DT5A 3PV0A 4OK3A 3SBDA 4OXRA 1U2DC 3FUCA 4XYGA 3TI9A 4EBBA 1N34B 3FUTA 3SIXA 1O03A 3C7CB 2PAFA 3FTQA 1XU9A 4MQLA 1WULS 3X1DA 4LY6A 4B85A 1Z15A 1N1MA 1DWPA 3ETNA 4XRGA 1FXSA 1DAHA 1XXHA 1X2EA 1YQGA 2CXHA 3ITKA 4TS9A 3ZBQA 3KEOA 3TTSA 1Y8RB 1Z6GA 2ZBGA 3ZE6A 3PE6A 5JQGA 4CM3A 4PEVA 3AJDA 3QBJA 1D2AA 3OM1A 4EFDA 3ENWA 3SMVA 2BLLA 4ABYA 5IC4A 1J21A 3MA0A 3Q3GE 3CSDA 4YJHA 4CHGA 3CBGA 3KUKA 3ONWA 4M9CA 4NC9A 4LX8A 3UMGA 4BJ6A 2MT9A 2OG1A 2QUHA 3PLNA 4CR8A 3IEVA 4PYRA 1XHLA 3RW9A 1EXMA 3K09A 4WE3A 5JS6A 1N2XA 2BPOA 5B57C 1L5QA 1XZNA 2VSQA 2AX3A 4ALLA 3D4IA 1IWBB 1Y5RA 1XRJA 1EG2A 3D7KA 4NU6A 1SHZA 2JZCA 3B9QA 2HJGA 3OPNA 4JZYA 4EO9A 1RADA 3U7GA 3FCSB 3K70D 4KIWA 4UARA 2WD8A 4R0MA 2EL9A 1HRDA 4MITA 3ZV3A 4DILA 3GHYA 4Q00A 3D4BA 1MXHA 3GD7A 2G17A 3OJWA 4MZDA 3IEIA 3U49A 5DYYA 2EIHA 3DNMA 4IDFA 3ZH9B 3L3BA 1Q0SA 3NJ4A 2GHQA 5E0OA 1L3IA 2EJUA 2FA9A 3KHSA 4FBMA 3SXUB 3WNCA 4OD0A 1MABB 2D7CA 2JCVA 3C48A 3TBFA 3WLTA 4V2UA 4OP3A 3EW7A 2B20A 3QQPA 3I32A 3CUYA 1DQRA 1J9ZA 1FC0A 1PK7A 1LK7A 4V0KA 3MCWA 4Y98A 4KW7A 3OOSA 2GKSA 2Y3IA 1NOIA 3E8SA 3TRHA 2BUBA 2JRLA 3S70A 1GNSA 2I1LA 3ZI4A 3Q8KA 3MELA 4Y2JA 3N7AA 1UDRA 4G5YA 2RG7A 3DJYA 4ZYZA 1WY7A 1EK1A 3FPAA 4UTPA 1EVKA 2CLLB 1YZYA 3R3UA 4DZTA 2P2SA 3A1SA 1NBEA 2V65A 3WBJA 2KBFA 5F2NA 2X5JO 4F4JA 3AIOA 2H1FA 4GMXA 4HSGA 4MA4A 2VZLA 2G3YA 3JQBC 1MNQA 5AKLA 2MSCB 2IDJA 4I5EA 1RCUA 3PPWA 1IEVA 3CT6A 4MV6A 4WJLA 2QN3A 4LHWA 1JEYB 2FZEA 1WV1A 3LSYA 3HDJA 2VXBA 3RBAA 2IZ5A 3KZNA 5KPJA 2Z43A 3I8SA 1T4DA 5L4LA 2XDWA 5EWMA 4ER5A 1Z5PA 3MYYA 1QV6A 3G0OA 1L5NA 4CYMA 3ND7A 4HZUA 3RIXA 4DV6B 4C89A 2BBWA 2CNDA 2NTYC 3QWFA 4YUYA 1W4ZA 3GEPA 4LY3A 5EHGA 4LMBA 3PZRA 5CEEA 3I6MA 3E4CA 5K3DA 4JR0A 3WKCA 4JLNA 4DR6B 2GX6A 3IR7A 2TMGA 2DM6A 3ZCQA 4YN3A 3F4LA 5BORA 4ZTZB 4A82A 1FW6A 1U9YA 2IODA 3DEHA 2NVUB 2ZBPA 1ZVQA 2BGRA 2P8SA 2Q1SA 2H2IA 4MMYB 2X0KA 5EKXA 2OENG 5HCIA 3AXSA 4AO7A 4WXRA 5C52B 5E6UA 3NXKA 3LUGA 4RZ2A 5LC1A 2AR0A 3I1YA 4RXTA 1E2UA 1K1EA 3UJNA 2CXNA 5LQDA 3KTAB 1XTBA 5DTEA 5K01A 4OJTA 3P0EA 1C9JA 4G0OA 4JN6B 1FLNA 4O2LA 2QP3A 4ARBA 4N12A 4B0OA 1QTNA 1JG6A 3FDJA 4ZYXA 3VC2A 5L4SA 2NUPB 4D3YA 2WTMA 1C1DB 2OCBA 2PRIA 1YXMA 3CVJA 3AL0C 1JMVA 1OX6A 1XRPA 2JD2A 3N2YA 4URWR 4F3NA 4MYSA 1KFKB 5K0ZA 3ID6C 4ZTBA 1QMGA 2J45A 1YQQA 3ZJVA 2WHRA 3PJFA 4Y6OA 4EYSA 4XFKA 1CUEA 3BCRA 3CZ4A 1PQ4A 3EQ9A 4Y9SA 4LCEA 4DLYA 2HCFA 1N77A 3N2KB 1S3IA 3CH5A 3MUOA 4B75A 4EB0A 4GM4A 4BVKA 5C5DA 2CVFA 3AW8A 3H4IA 5CVJA 3RYHA 4N7JA 4IDHA 4W5OA 1XTVA 3FSRA 3FW1A 3ORFA 2PSHA 1RWPA 1H05A 3QEBZ 3NEAA 1D2RA 2I76A 3KT6A 2ZTLA 3OJOA 3OT4A 2XRYA 1YZVA 1W2WB 2AG5A 4LBZA 5FJJA 4CL2A 3VVBA 5ITZB 3VKFA 3X0DA 4Z7QB 4KMRA 2C98A 2NG1A 4J9VA 2MSEB 5HG0A 1SC9A 1MJNA 4MVJP 4P2GA 5FV4A 1PTJA 4JI8B 3RROA 2QPTA 4JB0A 5DASA 5JMPA 3LZ6A 1T24A 4I1PA 3KOOA 1IG0A 3T3OA 2P6OA 3HBFA 4CFZA 4S2UA 1XNRB 2XITA 2M6KA 1USGA 4ZZ1A 1WEKA 2VF7A 4I3FA 4BO6A 2XUIA 1JIXA 2Z5GA 1FXWA 3GX1A 4LZOA 1AKVA 1YRWA 4P54A 4PQEA 3LNCA 4UBNA 3RPEA 4DTIA 3ST7A 3SJUA 1P9LA 3RF7A 5AVOA 5FL3A 1QUEA 4J0FA 1MGOA 1NUUA 1T9GS 4KV7A 1P3DA 1WKBA 5A3RA 4XCXA 4CG0A 1WTAA 1Y3HA 1ZBDA 2JHPA 2WZCA 1U8TA 1U3FA 4CM5A 4F11A 3F98A 4M7PA 2ZPTX 1LLCA 3NWBA 2NYVA 3K1JA 4KVAA 3VX4A 1RAHA 1HGXA 4EW2A 4GE3A 1YUBA 2E7ZA 3DW1X 3GVXA 4AURA 4PIPA 3I9FA 4OL9A 2BCJQ 4U6NA 1RJFA 2FOLA 3JQ6A 1Q0QA 1SULA 3NHFA 2QVYX 4NENA 4BUCA 2HFKA 4KAAA 4AB1A 1ONPA 1V8OA 2E1RA 2GAJA 3L7IA 4ZQIA 4QT4A 3IQFA 2IOFK 4KR9A 1AA6A 1ZJ5A 1QP4A 1KPGA 2Z2KA 2GBCA 3OCCA 3HHPA 3SC4A 5HIJA 4EH1A 1MGPA 4FFDA 4EUFA 5L8VA 4CRWB 2I2WA 2PUDA 1ZONA 2FP4B 5J2UF 3QA3E 3IQIX 4KLCA 4PFSA 4GI5A 2REXB 1XAGA 3E7FA 3QE2A 3WLJA 1YR8A 3KZMA 4X20B 5IULC 4DBLE 5JADA 3DV2A 1KHHA 3H5IA 3O4FA 4X7MA 1LJLA 5DHAA 3RVJA 3HY3A 4X61A 5CIWA 4W7HA 1Q3TA 2GZDA 1YC2A 2WOJA 4JLBA 3M3DA 3USZA 3BTOA 5C3UA 1Q0LA 5ECGC 3CUSA 1PJBA 2VYQA 4GXTA 3RRFA 1NW9B 2XUOA 4OQPA 1W35A 4R16A 4OV6B 5JFOA 1NVKA 2UZ4A 1PEKE 2QYOA 4FZ5A 1BO6A 3IA2A 4QBTA 3WBFA 1JLSA 4BQFA 3PUZA 2OQVA 1P1HA 2ZGVA 4WT7A 1TJ4A 2P30A 1CF9A 4PO1A 2Y1FA 2WB4A 1PR4A 3UWDA 3I52A 8LDHA 3O83A 1C1XB 2OL4A 3HYRA 4RIEA 4YY3B 1TF2A 4OM8A 1YQ9A 2JDID 3GNQA 4GBGA 3GPIA 4NYIR 2E2WA 3PEUA 4ACBA 4G1VA 1EFUA 4F06A 1Q7CA 1JKMA 1TM5E 3EUAA 4NIMA 1ZS9A 3L04A 1TRHA 2ZYIA 3MJFA 3SNHA 4JJ8A 3BRQA 3QJGA 2XZLA 5DCWA 1PYGA 1FF9A 5HF6A 4B82A 4W9NA 1H69A 4ZVRA 5B58C 3I8OA 1AGPA 5H8WA 4EZEA 4ZYYA 1CVLA 1ZM4A 3M4NA 2ZJYA 2I22A 4O4LF 1K27A 3KBBA 4D56A 2XCLA 4FGUA 4NDZA 4UU1A 4HGZA 3GMIA 1WBJB 4MO9A 2W8ZA 3PLAE 1Z34A 4U5XA 3O91A 4UUMA 1U31A 3OJFA 1D2CA 1LSJA 5LR6A 1KWGA 1NU6A 4FSDA 1D6NA 1WX1A 3A04A 3PIIA 4EAAA 3SVZA 2FPOA 1N4DA 2CL7X 2CLMB 2H5JA 1A27A 4AK9A 4MQEA 4O4HB 1E5TA 1LPBB 5AD1A 2ZCVA 3ZBPA 4IOMA 4B76A 2IU4A 4D4MA 1OV6A 5LWQA 1Z22A 1X7YB 1ZMBA 3H5TA 2ANBA 4H1HA 4JKYA 4YMHA 3KV3O 3OQ1A 5IF3A 3GLIE 3ZDDA 1W75A 4M0PA 4PHHA 2GRJA 3HJRA 2IPAB 3ISJA 3UUEA 2A9JA 2AUNA 2XQVA 5F64A 1UBTS 4CIXA 1K7SN 3I5UA 1OYVA 3PQ6A 4M49A 1F6BA 5GTDA 2C58A 1QCDA 2XB9A 1XZFA 4O1MA 5JAHA 5TMPA 1LS6A 5JG7A 5DBFA 2QB5A 4HLDA 4A2CA 1CY1A 1DB3A 1C7ZA 3FJOA 3QY0A 3L6OO 3J80A 4M3NA 1HDOA 1YCFA 2X3FA 4F93B 1JEQB 2PUJA 3L8HA 4X6YA 4JJEA 4XGKA 3KXDA 1KMHB 1L8XA 2GBPA 1URPA 2RH5A 1H66A 1WXIA 3OU7A 4NBUA 1IPHA 3F0TA 4JS0A 1O7JA 1LBEA 3H4TA 2N46A 1Y4DE 2BFOA 3EH1A 4BN5A 4NYMR 3RKRA 5EE9A 1OVMA 1PV4A 3MW8A 3X44A 2PRSA 4Z9BA 2X6TA 2NQ8A 3MUEA 4EHKA 2NAFA 4G25A 1G7CA 1JQEA 2RH4A 3QELB 4Y2XA 4F9TA 7MDHA 4KO8A 5DFAA 1C7RA 2D5IA 5H16A 1IBCA 2XGOA 2I65A 3QVOA 2X5NA 3RC2A 2DFKB 4WKNA 4MQ6A 3ZU5A 4LYGA 3L18A 3WWOA 1T3TA 4YIKA 4HWPA 3L6RA 1P2FA 2WHXA 3NC4A 2ZITA 3PQFA 4EMUA 2I91A 3QHAA 1RI1A 2FSVA 3V8MA 1DC8A 2CMDA 1TYZA 4UHDA 3GCDA 5HKKA 2XADA 4WNAA 3QM1A 1MC8A 1IY9A 1Q91A 4B84A 3CNQS 1W59A 1CIJA 3KJHA 4P32A 3VYUB 4DIEA 2ZI5A 1J49A 2R1TB 2FEXA 3DCYA 1OFTA 3IILA 5B4TA 1I01A 2B99A 2YX1A 5DXAA 3SIRA 2JI9A 3IT2A 5LZ9A 2AVDA 2O1WA 2OC9A 3P94A 3ZWDA 1PFVA 1V45E 4ZHQA 2ZJZA 3QVGA 3CU5A 1NN5A 4LE2A 4LF9B 4M6WB 4Y6PA 1JKFA 3TZKA 2HSDA 1GQFA 2PL1A 3MIZA 1ODCA 3K1ZA 4GI1A 1MAUA 1D7AA 4BV8A 2IYXA 2D4HA 1P6UA 4RHXA 2XD4A 3AG6A 3N2LA 3R5FA 4YRRA 4BJ1A 1K2WA 5CEFA 1G5HA 3COYA 1X0VA 1XOIA 2FW0A 1OLXB 1ZH2A 1ICEA 1FMJA 3KCNA 4MI6A 5FWXA 1CUIA 2HPAA 4H60A 3O2NA 4HWSA 4LYYA 3IB3A 4REQB 2CXTA 2NUAA 2QDKA 4A16A 3FTPA 3UJHA 4EJ2A 3W1EA 2GPAA 2ODAA 1W87A 3VQTA 3DQZA 3GJ5A 2VF5X 2BV3A 2F17A 2PH3A 5CD9A 4JGIA 2QM8A 2ZSBA 4LNUA 1VMAA 1KK2A 2FUKA 2OECA 5JWHA 1P8JA 3WGHA 4BGUA 1L5RA 2F00A 10MHA 1KQPA 2G83A 4A0QA 2HSWA 4MKZA 2P3OA 4OU4A 4DMUB 4XA8A 3JQAB 3C43A 3RADC 3DPUA 2B92A 2Q27A 2GYYA 3P2YA 4OU5A 3AIMA 1I7SB 4UD6A 4XQ0A 1DT3A 3OZWA 5T4FA 5JHHB 1WMSA 1FYWA 2H1VA 4HFRA 3UYLA 1QE5A 3RYIA 3PVSA 5M7EA 1DWQA 2CDAA 1UPAA 1XMPA 3HWRA 4XQCA 5E2BA 1UAAA 1WETA 2GM4A 4HNAA 4WXHA 3G2QA 2C78A 1MAVA 3AZPA 2ZRLA 3FPHA 1CKEA 3LBIA 4H7FA 4IVPA 2IY7A 4OMCA 4TYPA 1PHPA 2XF8A 4JUFA 5EI5A 4A27A 1G1AA 5GVSA 3EUWA 4NX2A 3FSJX 2XDAA 3LKZA 1SOUA 4HAYA 3DV9A 3VR6D 1L3CA 4FS3A 4LYHA 2YN0A 2CJWB 5ALFA 1J8DA 1V6AA 2DWQA 5HPYB 5A7HA 4H7IA 3PDCA 4BX9A 1TNDA 2VNSA 3PA8A 3CWQA 3MTEA 1I13A 1NN3A 4U1RA 2WSLA 2NZUG 2V97A 3K5WA 1QGAA 2OK8A 2HRBA 4KOAA 1OV4A 4MJ7A 4KFSA 4ED9A 2Q8PA 4DT1B 2J7KA 5IT5A 4ZVLA 5EIHA 5J2TA 2HM7A 2Q3JA 5CRIA 4JUBA 5TPWB 2X77A 1KO7A 1BEZA 5DGIA 5BSGA 1EWVA 4LXHA 5MHTA 1RYBA 2H92A 2OA0A 3ICCA 4YALA 5EWLA 1JFFB 3GEMA 4LCJA 4XOIA 4C87A 3ACDA 2MSDB 2ZAMA 1R8JA 3HRKA 3OP1A 4HFJA 2DE0X 4OSPA 4Q7KA 5C18A 1NNEA 3MS4A 1RWKA 3D6VA 4Q7MB 3O1HB 1DWUA 1OXSC 3AQIA 3QE0A 4HX5A 2CFCA 3RHSA 4D82A 1VKOA 1SCUA 2E5FA 1Y9JA 5JE8A 4DSUA 5JTUA 1P1CA 2BR3A 3ACBA 4UU8A 4P5EA 3GLHB 3WR5A 4YIHA 5C9ZA 1VM6A 1CJCA 2AYXA 4TQUS 2OHJA 2Y71A 1A98A 3JAWB 4XM0A 5KKCA 2QI9F 3DMPA 1Q1ZA 4FFBA 3ZHQA 3D3WB 3ET4A 2YJ6A 4J0JA 4R1PA 1ITZA 3BWDD 4NQRA 2ZM6B 3ROPA 4ZVUA 2F3UA 3UV6A 4TMFA 3VOBA 4KYUA 4P86A 4EYEA 3FBWA 2HHCA 3HZZA 5IXJA 4F8YA 4ZO7A 1QFZA 3THYB 3WOHA 4KN9S 3OF3A 1BA2A 4NOLA 1DUVG 4BTLA 1RDFA 1Y33E 2IOHA 4Q7LA 2HBQA 1O0SA 4B3TB 3TSYA 1XLTA 2ZJ6A 2YHAA 5FFMA 1KJQA 2QHXA 4LPKA 5TC4A 3UT5A 1XU7A 1AQ6A 2HCJB 1ULTA 1IN7A 1IUOA 2J09A 1IN4A 1DEXA 1NVVQ 4C5AA 4E11A 3OKFA 4TT3D 1OF1A 5B1IA 4PXAA 3W2GA 3EXHB 5L45A 3Q9NA 2X8BA 3OFKA 1XPUA 3V1UA 3O3OB 3DXZA 3UOGA 4Z49A 1K92A 1WKCA 4MZXA 3T41A 1PX0A 1SKAA 1PDVA 2PDAA 4TTIA 5LQMA 4UMEA 1W93A 4EG1A 3VPGA 1CJKC 2R86A 1PZFA 3DPIA 5BVHA 5CM8B 4LFAB 3UB4A 1L0BA 4O4JA 3LLCA 1Z8FA 3N8GA 3AG5A 4KV9A 1YBVA 4H0NA 1LB1B 1CZLA 5I7EA 3RASA 2J3KA 1SQ5A 2MSNA 4KR3A 3N0WA 4Z53A 3CW8X 3SOZA 4PAOA 3PQ7A 1GZUA 2R6JA 3HDHA 3Q7TA 3JD3A 4R9SA 1RHUA 2V5VA 2W6NA 2Y1EA 3TLCA 2MINA 3ZDCA 3ZY2A 4DLPA 3TIFA 1T6ZA 2YVKA 1KEUA 1OW3B 2MJLA 3AYXB 3BHMA 4TV9F 1JMYA 1V8BA 2I29A 4YUAA 3QPAA 3DLPX 1GPKA 4ZP1A 5C80A 4N3CA 1A7JA 3GFRA 5KYNA 1Z9BA 1MO3A 4D5EA 1AGXA 5JYDA 1JEOA 2X86A 1U9IC 1V26A 3LP5A 4PVCA 4DJDC 4GPAA 3T38A 4R0NA 4YONB 4IIVA 3T54A 2Q5EA 3TMYA 1ULAA 2GM3A 4BIMA 2A92A 2JBAB 4P35A 1Y89A 4TKVB 1Y3FE 4BAUA 4P4NA 1PR1A 5FPSA 3UK0A 2TS1A 4M1YA 4ZK2A 4Y18A 4KLRA 3X1WA 4NKRA 3GFPA 1DC7A 4TV8F 4DB4A 2WUFA 3FOWA 3N3AC 2RKWA 2VYVA 3B1KA 2EKBA 4Z5XA 3K0SA 2J5KA 3DLTA 5I4IA 3RS7A 5AT1A 2Q5HA 4MS3B 4P7GA 3VU1A 4CM9D 3U6KA 3BMQB 2BHRA 5HF8A 2WTAA 4TPKA 4OXIA 3NXSA 1RPJA 5GJWC 4Z99A 3CNOA 3H99A 1K6MA 1IBSA 2ZLBA 3KKPA 4P53A 3VHLB 3HKEB 4BVGA 1Z83A 2I8AA 2Z9CA 2ODQA 4LPSA 4MVJF 4BZQA 1W6RA 4AXBA 1KAOA 3EDMA 3EPLA 3PQEA 2QTZA 2VEDA 1LTHR 1OXKB 3B53X 1UPBA 5TS3A 3CVVA 2C5LA 5CUQA 5T57A 5KCMA 4DLLA 4QPNA 1UH5A 2V7XA 3CLKA 4Q19A 4U2CA 1U65A 2PQMA 5DLQC 3TW8B 3VR4A 1I1NA 3C6MA 5JT1A 3TLMA 2X9VA 3Q0IA 4KWEA 3DS8A 4UUAA 1G1MA 1KQGA 3RYIB 4URUR 3UANA 4YPOA 1ZD2P 3TM5A 1MFZA 3KSZO 1HLPA 3DBLA 5K3AA 2B8EA 2V74B 3N8IA 3Q3JB 4BKPA 2ARKA 4D43A 5LQJA 4DRXB 3ZWBA 3CKYA 3F71A 4QO8A 4PXYA 2NZ2A 1RXYA 4GRIA 1XYYA 4EFKA 1ZD5A 3T7TA 2CXOA 2BKEA 2OV3A 3K35A 1V6CA 4IYJA 4LWOA 2UZ1A 1U5AA 1JPUA 2EV9A 1ISRA 1J0AA 3C7KA 1CE8A 1DWOA 3FOCA 3FZEA 4BFTA 3WGOA 3ZDZB 4I2NA 4WXMA 4ZDKA 4CIDA 2MSWA 3IP5A 2V45A 4N3NA 5A4IS 2P8JA 1TE2A 3DEKA 2CCGA 2WG1A 2XMPA 4D8YA 4Y6GB 1SVMA 3QOFA 4U02A 4YUVA 4CM8A 5TGZA 5KDOA 3JXEA 1YACA 5EXEA 2HA0A 1AD2A 1IHPA 3KZ1E 4GBED 2ZBVA 3NDPA 3QLVC 4XVCA 1M67A 3QUCA 3K4PA 2QJTA 3O4RA 4Z4CA 3UJ7A 2MIIA 4QGHA 4RTRA 1A7KA 2E37A 3B1FA 1C81A 2GHTA 5FBQB 3LW8A 5BWOA 1KOFA 4V0ME 1GQSA 2VNAA 4HWGA 2P2ZA 2IPNA 4D8XA 2W58A 2DPMA 4P7JA 1OGYA 3K9WA 2P4EA 4PC7A 4PW0A 5D00A 3L4SO 5FNVF 1JQBA 2XCIA 3FUWA 3NIWA 4PHGA 1U8XX 4WLUA 4ZD6A 2ZXEA 4B3RB 2BKXA 2GAAA 1TO2E 1KIAA 3SS7X 2AYYA 2H52A 3DOUA 4DM4A 1RPZA 2VT7A 3ABSB 2Q9UA 2QBYA 1XMOB 5AM5A 4KIGA 1HPLA 1PUJA 3GNTA 2TMKA 1UDCA 4YJ2B 2H4ZA 1PG0A 1X7ZB 3I05A 3EOAI 1QKIA 4TTQA 4XSGA 2KJQA 4DPKA 4EI8A 2R85A 5H68A 3HKDB 5M34A 1Z0AA 1NJSA 4ZAWA 4KI7A 4TXLA 4RY2A 5DKFA 1QYRA 2GAIA 4FC7A 3WB0A 3GELA 1A5SB 4AUMA 2IC5A 1DKLA 2VUUA 4N5IX 4BTVA 1U3CA 5F3DA 5FP0A 1Q22A 3NIGB 2V6BA 1BMTA 1SQ6A 1XAJA 1X3SA 5AI4A 5D87A 1XHEA 3FYUB 1RZRA 3DT9A 4JNCA 2GYVA 2Q3BA 4YV7A 1YZUA 3T5GA 1D8TA 2HA5A 4QASA 2FFRA 2FSVC 2HA2A 1SCUB 4FHDA 4NBKA 3LQKA 1OBVA 4H6WA 1JDZA 4C6RA 2MSLA 3A9VA 3AERA 4GICA 1RLMA 2HD4A 3S81A 1M5UA 1TK3A 2V8OA 4FQ7A 3L0PA 2ZRPA 4P3YA 2VP0A 2NTJA 3EZXA 4Q1CA 3H1AA 4YC7A 4IDGA 2C04A 1QAOA 3QYFA 4CIWA 3GLHA 3W5CA 2UUBB 2BVNA 5HHTA 3B3GA 4URFA 5EN4A 3VU8A 1P7PA 5AXBA 2GCNA 2UZ3A 1IQRA 3R9XB 1QU3A 4QVKA 2BTEA 1IJKA 2Q5JA 4LZWA 1Q1EA 1WUYA 2VOJA 4TGLA 1N36B 1X7YA 4PSAA 1HDGO 2X13A 3MT8A 3M49A 4GT1A 3LM8A 3QXHA 1FNSA 2CV1A 3QUAA 3R5XA 2JFPA 4WN3A 3R9IA 4QEKA 1FPMA 1AKQA 4CEJB 3EUFA 5FWYA 2NO5A 1Z6TA 5JXIA 2CXRA 1BXGB 2HHLA 3TKYA 2AE1A 2V3WA 1CDOA 3O8QB 3SGLA 1CS4C 3S8EA 2I7VA 4HRYA 3KUDA 3WX0A 1Z2NX 3UYKA 5JPIA 5JS7A 4HO1X 5CU7A 4DXAA 3EGCA 1KARA 1T43A 2P9FA 3CPSA 4F84A 1F38A 1UXJA 1T8RA 3ZGYA 2VP9A 1KOJA 2B7CA 2CWWA 1D5WA 4TMZA 1XMXA 2NV6A 1GNVA 4MYDA 3SX0A 3ZE0B 3W3AH 4U8HA 3KJFA 1RWVA 3A9RA 2WFLA 3AR8A 5P21A 2RHRA 1P1JA 4MDFA 1IQUA 3DVSX 3SLKA 5TVKA 2R68A 2C77A 1A88A 4C4XA 4L51A 2J5QA 3KD2A 1W0CA 1S6YA 2FE1A 2QPAA 1SCDA 3TE7A 1S4MA 5DJ5A 2Y67A 4HTFA 1KS2A 1NZFA 4BGDA 2OESA 2QTWB 4KBYA 1Q1BA 5CFRA 1Q0ZA 1MFPA 2O2HA 1B8VA 1AXRA 1KYQA 1I1QB 1YB2A 1YD7A 3K92A 6REQA 2IYNA 4ENUA 5BQ3A 1KEEB 3EPKA 1ZZEA 3W5HA 5C81A 3OCYA 4FPXA 3N9IA 4IUDS 4KQKA 4WVFA 4TMTA 4PF1A 4QGFA 3F7MA 1UK7A 2L0XA 2UZIR 4RPGA 3UT0A 2J9RA 1NXVA 1OTHA 1EWQA 1USUA 1XVLA 3W3ZB 1KEVA 3O8OA 3BFPA 3MNFA 2Z04A 1X86B 4O2AB 2QRMA 2FSFA 3M5PA 3HXTA 2AF3C 4RTLA 1NVTA 2FPGB 3H6HA 4L5IA 5AVRA 1EFHA 3DP7A 4R9NA 1VKJA 3FA2A 3OPQA 4D0NA 1OB5A 3W9UA 3PGVA 3QX7A 3AR3A 2I6QA 4NBVA 1GJRA 2XR1A 2P2NA 3O3MB 2FXIA 1PEDA 4FB5A 1FLDA 1GIAA 1GR1A 2C57A 5IXSA 1WQ4A 4OKIA 4TKMA 1NYQA 3OEHD 1AHHA 3K9NA 1VBKA 4DLZA 3A1WA 4PZZA 2QU8A 3M9XA 4FGJA 4MTCA 2IGTA 3PYMA 3FWKA 4E12A 4U6SA 3KVYA 2ON6A 2AZ4A 2F3RA 4BC1A 2K2WA 4D4LA 5ICMA 4F5DA 4D92A 1M2VB 4UCXA 1IZ9A 1P61B 5H3LA 4YP0A 4XYMA 5K3BA 4V0OA 3WLMA 1YA4A 2FVYA 3GDWA 2UVDA 4I55B 3PX2A 4X44A 1OX4A 3C16C 1P1BA 2NW6A 2G1AA 4HB3A 1FQWA 1YZ3A 4I4TA 3SDSA 4I6GA 5BMVA 4TQGA 1DBVO 1Z6ZA 4JVLA 5DM1A 4BP1A 4S1VA 4CMHA 2AB0A 2CVOA 1K0FA 4MQUA 3JV7A 3PKIA 1K2VN 4L7VA 1TFUA 2BKVA 1VRVA 5TMDA 1E7SA 4PAMA 2PQ6A 4OM7A 4PFKA 1ISPA 5FPQA 4O3FA 3SF8A 1EGAA 2VRCA 2BFCA 2BFDB 3O8LA 1PLJA 1PYDA 2X8LA 3PDWA 4B3JA 2WYVA 3DW3X 3G49A 4WW0A 2BCGY 4JT8A 5IS2A 3OQ6A 1FYXA 2B21A 4H77A 2FN7A 1HYGA 1QKJA 3E9ZA 4Z7OB 4URYR 3C15C 3BEOA 2IZ0A 1PDWA 4E70A 1X2BA 2JZNA 1K8YB 1I14A 3C8MA 3N2KA 4TYWA 2ZT8A 3ZXXA 3G0DA 3EAQA 5CAEA 2HUNA 3SFZA 4TKUB 1D2HA 2PLAA 2ATXA 2ODEA 1D0SA 1JJAA 2XKAA 4O4IF 4C0KA 2DLDA 2WDPA 4EOGA 3I4FA 3ZG6A 3I3OA 4MWOA 4GSKA 1GITA 3TEMA 3VYWA 1GDDA 3D31A 1E5QA 2W2TA 3OE4A 4P34A 3WA6A 3OZGA 4FX2A 2PMCA 4XFDA 3W78A 1S0UA 3BH7A 1SIWA 2X2EA 3KWMA 1Q1QA 3CWZA 5CVDA 4ITUA 3WL4A 3I9MA 3OJCA 3BJMA 1JMKC 4B40A 2Z5VA 4C20A 5BWLA 4ANFA 2CBGA 1YB6A 4LYDA 1BXKA 4YMLA 1GZ4A 1SU6A 4MR9B 4R05A 3BHIA 1PZXA 4K88A 4CU5A 4DPMA 2QF7A 2ZBRA 1GILA 1L9XA 2F4NA 2GK7A 3QF4B 4NI5A 4WOJA 2SHKA 3LUFA 1LK5A 1OHHD 3DLIA 1QVWA 4XIJA 1YDMA 1YR2A 2FWPA 1QCZA 5L7WA 2I1QA 2W6IA 4F4FA 4GL2A 1JQKA 4LIPD 3T4EA 3UO8B 3ZD6A 1QXSA 3C14C 2N1MA 2XB4A 2XNJA 4ID3A 3H5LA 1OFUX 2XZDA 4OREX 3CE9A 2Q3MA 1SD2A 1XL1A 2C4HA 1QG6A 1UIRA 1E6WA 2Q0XA 2RIRA 3O9VA 3WIVA 5JJCA 1K5DA 1EKXA 3L7LA 3IUPA 1GTG1 3FMGA 4J03A 2J3IA 4XGQA 5CPBA 3AGPA 1CF4A 2UYOA 4FI3F 4MW7A 2OOSA 2X6QA 4MYRA 1BXRA 3TW6A 5BVGA 1X3LA 3RU7A 2FPRA 3LBHA 1SIBE 4HPXB 1LZLA 3L1KA 5DZSA 5AW9A 1QLJA 5J58A 3ESCA 2NP7A 5TVGA 3OM8A 3R8FA 4G65A 1P6XA 4HRAA 1CZOA 2MYTA 5C8DA 2JGKA 2NO7A 2YY5A 1CEXA 3AWIA 1XRQA 1AA9A 1V3VA 4FDUA 3WIDA 3ZCPA 3GBPA 1RRFA 2IYAA 1XEWX 3P0FA 4C3ZA 3CGGA 4ERXA 5KU1A 1PLLA 4TN1A 4GRAA 4IIHA 2QGZA 4JLDA 1V1JA 3I5AA 2VPPA 4KVFA 4ZOLA 1DJMA 1YR9A 5DM70 3AONB 3UH1A 5DF1A 1N7HA 1YASA 1YIAA 3A9TA 4OX9B 2JVKA 3GR6A 4UM9B 3F6RA 1LRKA 2FQWA 1TVKB 3U3DA 1UOOA 3ODGA 1JE1A 1SHLA 4B6SA 4CLHA 4OQQA 3HXMA 4YAOA 2ECKA 3RRBA 2PD4A 5DOZA 4ZC1A 4WA8A 3X1ZA 5J23A 2ZJ1A 1RWBA 1F60A 3I9OA 3KPYA 2SKDA 4OBEA 2FG7C 2JI8A 2UYYA 2W2LA 4A73A 4ALKA 2GBFA 2HHJA 4OJMX 1ZQ1A 3W5JA 1Q0HA 1FUUA 1THTA 5DIZA 4IDNA 4ZAXA 3I9JA 3TDKA 2FPIA 2WD9A 3MT0A 3U0VA 1D4ZA 4PYJA 1X6VA 5AUOB 4NONA 1T9ZA 5AJVB 1GAJA 4Q4HA 4JLSA 2QX6A 4LDAA 4B6PA 3USCS 3C6XA 1KZ7B 1RC1A 3C5EA 4KAXA 2X0JA 4NEHB 4QPCA 4QXOA 1ABBA 2XQJA 4DSZA 1QP0A 1ORRA 4HWTA 3D4NA 3PD0A 4C6SA 1L5ZA 3JQ9A 1DO8A 1F48A 1NXWA 1U7DA 3LGAA 4QPDA 1M0EA 1NQVA 4I50B 3CEHA 2ZIFA 5BR4A 1OU4A 1K9SA 1VI2A 4OH1A 4IUBS 2FTKE 2R2AA 2ZB2A 3G23A 2NN3C 1TEHA 4ZGWA 1RYFA 1IXYA 1RBYA 3MQFA 4BMCA 1PJRA 3A6ZA 2BP7A 2QYTA 2PJRA 4EELA 2E0IA