4QQRA

Structural insight into nucleotide rhamnose synthase/epimerase-reductase from arabidopsis thaliana
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
284
structure length
274
Chain Sequence
SFNFLIYGKTGWIGGLLGKLCEAQGITYTYGSGRLDRQSIVADIESVKPSHVFNAAGVTGRPNVDWCESHKVETIRTNVAGTLTLADICREKGLVLINYATGCIFEYDSGHPLGSGIGFKEEDTPNFTGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLTNPRNFITKIARYEKVVDIPNSMTILDELLPISIEMAKRNLTGIYNFTNPGVVSHNEILEMYRDYIDPSFTWKNFTEPRSNNELDATKLKTEFPELMSIKESLIKFVFEPNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into nucleotide rhamnose synthase/epimerase-reductase from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
molecule keywords 3,5-epimerase/4-reductase
total genus 96
structure length 274
sequence length 284
chains with identical sequence B
ec nomenclature ec 1.1.1.133: dTDP-4-dehydrorhamnose reductase.
pdb deposition date 2014-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4qqrA00
5BNFA 3PYXA 2PZKA 3B70A 4JQCA 3BTSA 3KYBA 2W2KA 2B5WA 1GY8A 1Y81A 4GVLA 4H7PA 4GL4A 1W73A 3PWSA 4W7HA 3WGGA 1L7EA 2P4HX 3OQBA 1A72A 1VJTA 2BFOA 3HZZA 3VH2A 3AWDA 3TSCA 3NV9A 2HU2A 4CUKA 1EVYA 1NWCA 4EGFA 2DLDA 4IM7A 4MVJH 4DPLA 1PX0A 3ETEA 3ZNNA 1UZMA 3GR6A 4DQXA 1NQ5A 3T7CA 2X7HA 5B4TA 3E82A 4YYZA 4BO8A 2YQ5A 3JQFA 2W4QA 4J1QA 4OSOA 5TT1A 1FDUA 1YQGA 1MFPA 3RCBA 4E2ZA 2ZTVA 1T2CA 3QQPA 1VKOA 2IRWA 1YGYA 3VPFA 4U5QA 1PJ4A 3UCFA 4BKQA 4NH4A 4RLHA 5A9RA 1NWHA 1LC0A 1U5CA 3T4EA 1BVRA 3PLNA 4B4VA 3EAGA 4RDIA 3VH4A 2P9EA 4GSLA 2X6TA 3FNHA 4PG7A 1UXKA 2EXXA 3WFJA 1SCUA 3OETA 2EW2A 2ZB7A 3JQ6A 4BNMA 4IIUA 4ILKA 2A4KA 2EEZA 3L6DA 3X2EA 2BH9A 3V1TC 1UJMA 2RH4A 3GFBA 3ONFA 2C5EA 4O59O 4DGSA 4FC7A 1H9AA 5CFZA 2NQ8A 1VM6A 4GH5A 1GZ6A 1P74A 2VZ0A 2WD7A 3RJ9A 5IDQA 1B2LA 4RF2A 2P5YA 1YS4A 1IULA 3GGGA 4D44A 3I5MA 4Y67A 1NAHA 1XELA 4EUFA 3HDJA 3UUWA 1GADO 3HN7A 4Z9FA 3H5NA 4OMUA 5JDIC 1XIVA 1WAMA 3HNPA 5FI5A 3G17A 3DAGA 1YOVA 4FCCA 4IDEA 1NQOA 1SAYA 3F4BA 1SEVA 2QG4A 1U2GA 3JQBC 2C29D 3OH8A 4IUYA 4QEDA 5AYVA 1XWFA 3HFSA 3DTTA 3SX2A 1YQXA 3TFQA 4CM5A 4BS9A 3IL2A 1AGNA 1DIBA 3I9KA 4C4OA 5A5EA 4KTVE 4L73A 2H5LA 3D1LA 1DOHA 1OZAA 2VWQA 3PDJA 1X7DA 5B4VA 1P44A 4Y8VA 1SOWA 4ALIA 4RVUA 5EQDA 1GYPA 1Y8RB 4JJIA 4XRRA 3UF0A 4AJHA 4YPOA 1EEHA 1GFSA 4MOWA 1ONPA 4CLDA 3F1LA 1H2HA 4WGGA 2B69A 2Q4EA 1SBYA 2D59A 4D46A 4BNIA 4D43A 1EE2A 3GHYA 1CWUA 2F1KA 4CR8A 1PU2A 4L0QA 4E2XA 1S7CA 4BQRA 3ZU3A 1E6EA 1N1EA 5GMOA 3SJ7A 3V2UA 4ALMA 4GGOA 1OBFO 5A9SA 2P68A 3TZ6A 1PZEA 1FDVA 5BSFA 3DFZA 3KV3O 4OSPA 1DFHA 2OHXA 4MJLA 3CKYA 4HY3A 4E30A 4KP7A 3S2IA 5JAMA 2DBQA 3D4OA 2I65A 4OO3A 4HFJA 4J4BA 4EEXA 4W4TA 3WFIA 5L40A 4YJHA 1JAXA 1T1RA 3M2TA 4BHTA 2JD0A 4MVJM 4JBHA 1DAPA 1Q7BA 2OFPA 3GQVA 1UXIA 4LN1A 4YRDA 5T8KA 2BHLA 4O5OA 5I9NA 3PHLA 4ND1A 3QWHA 3WJ7A 4GX1A 2EGGA 1LLDA 4YAEA 5CDUA 2YHUA 4CMIA 5JLAA 1GR0A 3TZKA 1NX6A 3OJ0A 3SC6A 3PTZA 1PGPA 2C54A 3W8FA 1P1JA 4B8WA 2AA3A 3U4DA 1DHRA 4YEDA 1P9LA 5HRUA 4WLEA 1VSUA 2X5OA 4MKXA 3WQSB 1LLQA 4BMNA 2OUIA 1VE9A 1HSZA 3QSGA 2Y1GA 1T2DA 2E49A 5ENDA 2VHZA 4BKOA 4JK3A 4XIJA 1FDWA 2WSBA 3RBZA 1K89A 1PWXA 3GG2A 1NVTA 5L4LA 1A7KA 4ZHSA 4P4LA 4BNNA 4HV4A 3RAJA 3EC7A 4KMSA 3ZWOA 3BMQB 4XQEA 3AY3A 4PVDA 5JYEA 3WMXA 3H9JA 2BGMA 1BWSA 2LDBA 2DBRA 1LDYA 4F6LA 2BI8A 3C1OA 3ENKA 5C5IA 3V8BA 3WWZA 1FF9A 3PPIA 1Z74A 3DBRA 5L7WA 5H83A 1IB6A 3PI7A 3FNEA 1BSVA 1OMOA 3AI1A 1EFKA 1WDLA 1KVRA 4NZ9A 4AJ2A 4CM7A 4G65A 1YOVB 3QWBA 5C3MA 1DIAA 4GLOA 4IDCA 1B14A 3ZNQA 4AJLA 3L07A 3Q6IA 4PZDA 3UAGA 3ZWBA 5I8WA 3CMCO 4EJ0A 4RV9A 1TLTA 4R51A 5L4NA 1F14A 2JKVA 1PQWA 3W4IA 5T64A 1PQPA 1DJQA 5G4KA 2NU8A 1UXHA 4HWKA 5AXBA 5C7IO 2EJWA 2NTJA 1O94A 2B0JA 3ZNPA 5CPFA 4FJ0A 5JCJA 1TXGA 2DAPA 2Y67A 4MPDA 3BHJA 3TZHA 4WOJA 1P1IA 4A26A 4ALNA 3ABIA 1H0KA 2HMTA 3UW3A 4YBZA 3KOUA 4XB2A 3M6IA 4CMJA 2Q2QA 1AHHA 2A92A 1PL7A 2B4QA 2V6GA 4XJTA 4FS3A 4CQLA 4NK5A 4XA8A 2UAGA 5EQFA 1NPYA 1YWGO 4BNFA 4BNGA 4DRYA 4MVJA 4YJFB 5COBA 3MTJA 3INTA 4CM6A 1ZK2A 4BUCA 4DMMA 2YFHA 2DTXA 1JA9A 1ZH8A 4XZ3A 4AVYA 1HLDA 1ZSNA 4WECA 4NBVA 5ICSA 1K0UA 2O7SA 1E7QA 5JNLA 4WLFA 2EJVA 1H6DA 5T5QA 2AQ8A 3B20A 4ND4A 1KOLA 2VUSA 1ISFA 1U1IA 2EKPA 1Z82A 1NPTO 4BO1A 3KRTA 3ANNA 5C7LO 1MUUA 4J3FA 4XR9A 4BL5A 1P1FA 1ADFA 4H15A 1WNTA 2HJSA 3DO5A 4YT2A 2DPGA 1GTMA 4GGPA 4IXWA 1P1HA 1V35A 1VSVA 2V6BA 1B3BA 5T57A 3WYEA 5GZ3A 1JWAB 1LSJA 2VNSA 1E7RA 4IGEA 1R37A 4Z9XA 1TT5B 4CLRA 3ZHZA 4JROA 1T2EA 4GBJA 2QX7A 1HRDA 1EQ2A 3H9UA 3BHIA 2QRJA 3OJLA 4R9RA 1ZK4A 4KTTE 4BO2A 3GZNA 4RGBA 3AK4A 4XDZA 5A9TA 4K26A 1QP8A 1ZIDA 5A05A 3H4VA 3SXPA 3DZGA 3BA1A 3K31A 3RU9A 1GPJA 4H16A 2NM0A 1TEHA 5JMPA 4B3JA 2FR8A 2BRUA 5AXCA 1G1AA 3V2HA 2GYYA 3ASVA 3I9NA 1ZNQO 3B6ZA 2PA3A 3GZ4A 3SLGA 1ULUA 3PGJA 5C7OO 3TQHA 3TJRA 3PHHA 3VDRA 3V2GA 2TMDA 3ADOA 3BXXA 4UAGA 2FPPA 2GN9A 3VHRA 2NLOA 5T8KC 3VVBA 4IPTA 3TWOA 3RC2A 4CQMA 3DBLB 1DPGA 1PZFA 3M1LA 3W8EA 1PJ3A 2D0IA 2PWZA 4RQUA 4RPJA 4RZIA 2SCUA 3U49A 2VQ3A 3L0DA 5G0TA 5U9CA 4LRSB 4CLEA 4FGWA 1LQTA 2G1UA 5DN9A 5BNTA 2ZTMA 2A9FA 2EG9A 3NDJA 3OA2A 1N1GA 4HNGA 1H6AA 4IQGA 1XYGA 2AG8A 3R3JA 1KEWA 1EUCA 3NT5A 1KC3A 4ZRMA 3G3EA 4DL9A 4E5KA 2BELA 1E3EA 1ZFNA 4EEZA 1KVTA 1I01A 1LTHR 3H3JA 1PJSA 2IEBA 3OICA 4DBVO 3FRJA 2OZPA 1TVEA 3RROA 5BSGA 3CSDA 1HZZA 4GVXA 4PG4A 4IJKA 1QLHA 5G0UA 1T26A 5LCXA 4I9NA 3KSUA 1EVIA 2VCYA 1GEGA 1K3TA 5AVOA 3HN2A 1HXHA 5ICMA 4RVSA 2AHRA 1B8UA 3PZRA 5HS6A 5F3RA 2ZQYA 5TT0A 4BKPA 1D4FA 3EW7A 1YXMA 3I6IA 1KEUA 4CM4A 1DO8A 3CH6A 3RC7A 2Q1SA 2Q1TA 3NTOA 4FFNA 4BNUA 4XWYA 1UDBA 2O3SA 1A4UA 3GAZA 2VHWA 3OJEA 3WGZA 4PLPA 1N5DA 1HDRA 4W9NC 3GN2A 2ILTA 2FHSA 1P1KA 2JCYA 1A9ZA 4TMFA 1PJLA 1ISIA 1XQ6A 3FTPA 1SNYA 1HDCA 3EZYA 2H1SA 2Q46A 3A9WA 4EI2A 2ZTUA 1N9GB 2AEJA 2POQX 2CD9A 3WGTA 5KCZA 2ET6A 4IIVA 4BQPA 1MA0A 3Q0EA 4PGFA 4DXHA 4D3SA 1HETA 1I32A 1B0AA 2OP0A 4FW8A 4I5EA 2EW8A 4PLVA 2RBEA 5IXYA 1Y5MA 1QV6A 2JL1A 4QFDA 1E3JA 3ROPA 2EP5A 4OH1A 1LJ8A 2WYUA 3RKUA 5U4QA 3P7MA 5DBGA 2C2YA 1HDGO 2WDZA 3FD8A 1CQIA 3H8VA 4GAEA 2O2SA 4WCFB 5KOIA 1Q1NA 4XGIA 4YT8A 2NVUA 3EVNA 1PZGA 4RF5A 3KSZO 5IAAA 5TJHA 2PKQO 2CF6A 4OOEA 3E5MA 1J0XO 1OC2A 3A1NA 1PS8A 2ZB3A 1QYCA 4CQMB 1G0OA 3HUDA 3H9EO 5ADHA 5L7TA 3GGPA 4I08A 1H2BA 4J9VA 1I3MA 4R1TA 2CNBA 4P4GA 2E82A 4J9UE 4J49A 3WS7A 2VRBA 4WNCA 4XDYA 1UP4A 4Q3AA 3LZ6A 2AE2A 4ZGWA 3QE3A 1Z73A 3PQEA 2DC1A 4Y6SA 3WBFA 1ZJZA 5IG2A 3AI3A 4ITUA 4FBGA 3ZI0A 3BYZA 3ULKA 5KJCA 4IINA 1DJNA 4UVHA 4A7PA 2ZYGA 1YB1A 5GZ6A 3U9LA 4IXTA 3W6UA 2FOIA 4BNYA 1DLIA 1HDZA 4TVOA 1KEPA 3QWAA 1YKFA 3KLPX 3A06A 3EVTA 1F8FA 3DFUA 4P38A 4QX6A 2IE0A 3RASA 4U6SA 4UEOA 4FB5A 1ORRA 3CZRA 4ONEA 1WWKA 5KKCA 3PHIA 3IIEA 1ENZA 1NP3A 2BF7A 3ENNA 4AJEA 2YQ4A 2HMUA 2FRDA 2GO1A 2CDBA 4ALLA 4LSWA 3DAPA 2I3AA 4J1NA 2JFHA 4CV0A 4ZU3A 2EHDA 5MDHA 1R6DA 1R66A 2HK7A 3IJRA 4CM4B 1A4IA 2J3IA 5T67A 2HCTA 4WEQA 2GD1O 3WSVA 1C0KA 1A5ZA 4J16A 4PVCA 3IUSA 5DBIA 3EYWA 4MP3A 3ZV6A 1DEHA 4BMVA 4I5FA 4KDFA 2J6IA 1GU7A 3K5PA 1UH5A 1EVZA 1BXGB 4CUJA 1LRKA 1R4MB 1RWBA 3T4XA 4K6FA 3LC7O 1KBZA 4DLAA 4NG5A 3CMMA 4GPD1 5A3VA 4XRGA 5IZ4A 4NI5A 2HUNA 3WMWA 1MGOA 1X1TA 3JD0A 4NMHA 3ZGYA 3G79A 1IOLA 3LC1O 2VZ8A 5ER9A 1YJQA 1U3TA 3QY9A 3AW9A 2W8ZA 3KVOA 1JTVA 4BNXA 3GNQA 1NR7A 1H94A 5DOZA 3JQAB 1CF2O 1V9LA 1I8TA 1V3TA 4M55A 2GN4A 2PZLA 5CEFA 1DC3A 5L4SA 2BGLA 1NNUA 3OIGA 4R4JA 3NTQA 1R16A 1EMDA 4TKLA 1P45A 4UREA 4NDNE 5CHEA 4KUEA 2DKNA 2GPTA 3OM9A 4CL3A 1M6HA 4L9RA 3TPCA 1GV1A 1UP7A 4F46A 5LC1A 3TZCA 4II2A 1YDEA 1PJQA 1PJCA 2PR2A 1O0SA 4E13A 3MJ4A 3F5SA 2P9GA 3QVTA 3PQFA 1WLYA 1XSEA 2OP1A 1ENYA 5A03A 2C82A 4R68A 1QMGA 5DOVA 1H9BA 3PEFA 5IDYA 3FTNA 2QQ5A 3KUXA 3IS3A 3L9XA 4U7WA 2DTEA 3SEFA 3HG7A 4TWRA 2G0TA 5JY6A 1X0VA 3ZH2A 3GPDG 1YONA 1D1SA 1GPDG 1XG5A 2CDCA 2GCGA 3BTVA 3Q9NA 3ZV5A 4CV2A 3S55A 5A02A 2X0RA 4TSKA 2IDZA 3GVCA 1Y7TA 2O48X 2BFPA 4GWKA 2Q2WA 2HDHA 1LDNA 3QA9A 1IYZA 1RKXA 2Z95A 2Q2VA 4XYGA 1W6UA 1YH3A 2PZMA 2ZTLA 3VTFA 3PGXA 3DC2A 5KVVA 5IJZA 1I5RA 4YQYA 5DDIP 2ZK7A 4F3YA 1VRWA 3AY6A 1MG0A 1EK6A 3TNLA 4OOFA 4DA9A 2EKQA 1F06A 4FPXA 3JCZA 4JX8A 5CEJA 1CRWG 2V7PA 4TZTA 3WGIA 4LVUA 4A0SA 4TVBA 3ZW8A 5IZCA 3R3SA 3ADPA 3L4BA 4WCFC 2Y1EA 3HB5X 1P0FA 4G5HA 1X13A 4WUVA 3IP3A 2NTVA 1QRRA 2P91A 3PK0A 3BMQA 4R5HA 1MG5A 2Y93A 4NHEA 5BQFA 1NPDA 4J6FA 3QRWA 4AJPA 4FOOA 3QWIA 3CEAA 3WG9A 3BMCB 1LBEA 2CFCA 4NBUA 5HWSA 1Z7BA 1EZ4A 3DL2A 3DBRB 4OKNA 3WBBA 2Z1MA 1ID1A 2RHCA 3S8MA 5TIIA 1Q2XA 4P22A 3Q1LA 4RO0A 1FJHA 3E9QA 3O4RA 4IBOA 4YQZA 1KVUA 3I9MA 1E1LA 4YWJA 1NFRA 3BTUA 3UGKA 2IXBA 3U3XA 3ZHYA 1LDMA 4BO9A 2EV9A 4YAGA 1HE4A 1MX3A 2RH8A 1E7SA 3HDQA 7MDHA 5L53A 2WM3A 4OM8A 1FK8A 1NM5A 4PRLA 4XEHA 4CODB 3ZWCA 4YT5A 2D8AA 4IQ0A 4WCFA 4BNVA 5A3JA 5GZ1A 4J2HA 4M49A 1E6WA 2NU6A 4E5MA 1WZIA 2NVWA 3NGXA 3JQDA 1GUZA 1YBAA 3PXXA 3DBLA 4WKGA 3W6ZA 1YQDA 4ZA2A 3KO8A 5CEEA 2CF5A 1R12A 1OI7A 3JV7A 1Y5RA 5HS4A 5A1TA 2AG5A 2X9GA 4FJ1A 3BMOA 4JBGA 2WTBA 1FXSA 5CDSA 3MEQA 3ONEA 1WDKA 4S3MA 3VZSA 1LSOA 1ZUD1 1SO8A 4XQGA 5DP1A 4MP8A 4QUKA 3NT2A 1MC5A 4CMEC 1R0LA 1VL0A 2R00C 2FPGA 2Y1FA 3LYLA 5FWNA 1XCBA 5IN5A 3EGOA 4J0FA 1IPFA 3JTMA 3HJAA 1E3WB 3FSRA 3PQDA 2YW9A 2RIRA 2HLPA 4BB6A 4DBZA 5JCXA 5K0ZA 3ANLA 5I7SA 4NR0A 4WLNA 4KUGA 1BVUA 3K96A 4CMCA 3QIVA 4UUNA 4NJMB 4QECA 5JMWA 4XX0A 3DHEA 3EZLA 3GN1A 2I66A 3RFVA 4BGEA 3ZWWA 4PLCA 3ZDFA 3NX4A 4YTEA 5DCWA 5GY7A 4YRAA 4W99A 1V6AA 2Q45A 2WYVA 4DUPA 4BNHA 5ITWA 1E7WA 3RUAA 2I99A 4OIMA 3TF5A 1LSSA 5FI3A 3FBGA 4LSMA 2IYOA 5TGDA 3E6AA 2D5AA 4XGNA 4PZEA 3RUEA 3HDYA 5CDYA 4E6PA 1I2BA 4PCVA 2C5AA 4CLRB 3FBTA 4L75A 4R54A 3ZHBA 3ZZNA 3UFXA 2B36A 1U2DA 5EJ2A 1ML3A 3P2YA 5U1PA 1LDGA 3O8QA 1BXGA 3AOGA 5BT9A 4MDHA 4FC6A 1E6UA 1UAYA 2OXIA 3I9JA 3JQCA 4Y9DA 4Z3KA 2PZJA 5KKAA 3GVIA 3GVPA 2UV8A 3U4IA 2ZJ1A 1XU9A 2O3UA 3KEOA 4CM9A 1YBMA 1TT7A 4CM8A 3VH1A 4MVJP 1IHYA 3FI9A 3F46A 2GGSA 1P31A 2B35A 3BZUA 4EITA 5BSHA 1HDOA 2AW5A 3D0OA 3TFOA 1SOVA 3ZU5A 2Y99A 1OFGA 2OBNA 3AOEA 2W90A 5JAZA 2QHXA 1M75A 3GEDA 4KWHA 4E2YA 3DBHB 2PY6A 2AE1A 1O8CA 3DHNA 2W2LA 5IF3A 1NR1A 3GOHA 1L1FA 4Z0HO 2CVZA 2J5KA 3H5AA 1M2WA 1WXDA 3H2SA 2GSDA 4CMHA 1UUFA 2HMWA 1H6CA 5L95A 4PLGA 2HRZA 4IJUA 2WWRA 3AI2A 4BNTA 1PL6A 1I10A 2FP4A 3ZU4A 3ZWMA 1KETA 2OMEA 1PR3A 2C7VA 3RJ5A 4BO4A 4D42A 4WOKA 4N7RA 1DIGA 4CMBA 3H9QA 1IL0A 2JD1A 2VYNA 3OSUA 3NT4A 4S1VA 3U4CA 1EE9A 4YT4A 3GDOA 1N2SA 4MVJF 1XR3A 3MWEB 3PHGA 4E21A 1IZ0A 3RIHA 3GC6A 3K2EA 1Y8QB 2DM6A 2GLXA 1EUZA 2NUAA 3IAHA 4XQCA 5EMHA 2VZ9A 1F8GA 1ZK3A 2C07A 2JFGA 5L7YA 5HTOA 2YV1A 4DPKA 4INAA 4MVJI 4FFMA 1HTBA 4Y98A 3B1FA 1PGJA 4PRKA 3ZNOA 1YO6A 1CERA 3DTYA 3IDSA 3IP1A 3JSAA 3KZVA 5JAIA 1C1DB 1ADBA 4TROA 4UVDA 2VOEA 3LLSA 4DVJA 1QV7A 6ADHA 4R1UA 3VPGA 5K6AC 3DMTA 3DZHA 1X14A 3PHJA 1Z6ZA 1Q7CA 2B5VA 4YAKA 2CVOA 3PFFA 3VPHA 4Z6KA 2NVBA 1ZCJA 4BKUA 2G76A 1BTOA 1QSGA 4JLWA 3EUWA 5DCUA 5FFFA 2O4CA 4Z3DA 2X9VA 3LQFA 1LNQA 1T4BA 3RUCA 2X8LA 4XGKA 3QWFA 2R2GA 1U7TA 4BV8A 4N18A 3PVZA 4R16A 3KYCA 2PH3A 2FN7A 3C7CB 4CMAA 4JP3A 1I2CA 3KB6A 1MLDA 2I67A 3DB2A 1Y9AA 1XQ1A 3DHYA 5JO9A 2JD2A 3I83A 5TX7A 4J1SA 3WTCA 4XYMA 5EERA 3UVEA 4CR7A 1B8PA 1PGQA 5C37A 3WIEA 3ST7A 5F21A 3TZQA 3LF2A 4XB1A 3O9ZA 3D5QA 5L51A 2GZ2A 4XYEA 3GY0A 3I4FA 1JWBB 5FYDA 2X0IA 4FJ2A 4AJKA 5A5FA 3JYQA 5EL0A 4JNKA 4XJSA 1TT5A 4AICA 3DZIA 3COSA 4IS3A 1DC4A 3KYDA 5MGBA 3R1IA 1TI7A 1MFZA 4Q39A 1I0ZA 2C0CA 2AMFA 4MO2A 4CPDA 4WK6A 2DUUA 4R9SA 4WLOA 4RVDA 4BVAA 1VPDA 4K28A 2Y0CA 4IZHA 4X54A 1PEDA 1ZZEA 1C0LA 4WE3A 2AEFA 4BO0A 4MVJD 3O03A 4ALKA 2CY0A 1ADCA 2PTGA 2YV3A 3B1KA 3JD2A 3ZWPA 5G4KB 5IN4A 1Q7GA 2O3JA 4GKVA 4TRJA 1RM0A 4UUOA 2Y68A 3RUIA 3RVDA 3UH1A 4R5MA 3CUKA 3AM5A 4MINA 1LSUA 1QYVA 2BLLA 1KY5A 4BGIA 1C0IA 3IUPA 2VNAA 5F1OA 4XYLA 5ES3A 4B79A 4CQLB 2B37A 4IJWA 1M76A 1WMBA 4BOYA 4FGSA 1R4NA 1K6JA 2BFMA 4YJHB 2ZKLA 4PIVA 5EINA 5B12A 5DNAA 4NFHA 3RU7A 3EHEA 2CMDA 5TLSA 3OJOA 2AEMA 1QG6A 2XF8A 1IE3A 1E5QA 3Q9UA 4A03A 1J5PA 1O95A 1QLJA 1O9BA 1EDOA 5KJ6A 2VRCA 3DZKA 1Y9EA 1UDAA 4I9UA 2GF2A 3D3EA 4J4TA 1VJ0A 3L77A 3JQEA 5DCYA 1EUDA 1GQQA 3ITKA 1UAGA 5HBRA 3ZV4A 1YB4A 3U09A 1R0KA 1H5QA 3O8QB 3GFGA 1EQUA 3PP8A 4ID9A 4MVJE 1B16A 3VAZA 3IJPA 4MVJG 3WIDA 3QLJA 2C2XA 2NV6A 3DZFA 3MZ0A 1X15A 1NXQA 1Y1PA 1KEVA 4ZQBA 4CM3A 4CMGA 3BMCA 2UDPA 1AUPA 3HWRA 4RPGA 4KDEA 1GEEA 1ZMOA 4AFNA 2I5PO 4K1LA 3AUTA 3I6QA 2NU9A 3AOEC 4IDFA 4O0LA 2YYYA 3JQAA 3C1TA 2WMDA 1FDSA 4IS2A 1JVBA 2OGUA 2CVQA 4HBGA 5JAQA 3WGHA 4QSMA 1PSDA 5JW6A 1KY4A 5JDCA 5KVSA 3FNGA 3LT1A 2O3QA 3FPCA 4J7CA 4Q3EA 4RPLA 4U0KA 1PQUA 1U7HA 3I9LA 3JQGA 3CINA 5KWEA 1I3KA 3HB4X 2O4UX 2R6JA 2EP7A 4FD3A 3KSDO 1QYWA 4DQVA 1K6IA 2YV2A 3BIOA 3DZJA 3PDUA 1GQYA 3ITDA 4NQZA 4Q3DA 1E5LA 2H63A 5G0VA 5CAEA 3GMSA 1ZEMA 4XYBA 3VZQA 1BG6A 3GGOA 4PLZA 2XXJA 2VWGA 3WJAA 1JQBA 3GAFA 2VYVA 3GHHA 4QXMA 1BGVA 1U28A 1VKNA 1DLJA 3ROMA 3OBBA 2WJPA 2JHFA 2BD0A 2QRKA 3L9WA 2DTDA 2RHRA 3E48A 4K6CA 4B8ZA 2HK9A 4E31A 3MJCA 4J90A 1KS9A 4D3FA 1BDMA 1R15A 1DFIA 3RSHA 2ZATA 1NFQA 3C1AA 2B4TO 4UVIA 3FF4A 5JXWA 3DOJA 1C1DA 1QYDA 2Q50A 4KUHA 4OKIA 3DXFA 4N5MA 1XU7A 4ZQHA 4LMPA 4DC0A 2VWHA 2VOJA 1HDXA 2GDZA 3OP4A 4JJFA 4ND2A 4MIEA 2YFQA 1B26A 2NADA 4ZRNA 1DBVO 2J5QA 5THKA 3G0OA 4I8XA 4PG6A 4I9HA 3O38A 3I52A 1EBUA 3Q3CA 3OJFA 4E5PA 3K8ZA 2ZQZA 4DQUA 5JS6A 3FNFA 4M54A 1WW8A 2E6UX 4CV1A 1V0JA 1Q0HA 4FIZA 4I5DA 1BMDA 4HFRA 4CLOB 3AJRA 3HE3A 3JQFC 5I7EA 4TRNA 2HAEA 1WP4A 2IZZA 3NRCA 3LLVA 1U8FO 1LEHA 5I9LA 1QR6A 1E77A 3QW2A 3ZU2A 5KJ1A 3VDQA 4R01A 1NQAO 3I4CA 5AQ1A 1U3VA 1QYXA 1Z7EA 3DOOA 1I30A 3K73O 3Q11A 2BMAA 4CL8A 5F1KA 4E32A 4CQMD 4EJ6A 3W1VA 4BB5A 3NKLA 1D3AA 1X7HA 1PGOA 5JE8A 2YDYA 4W7IA 4MIOA 2VN8A 2R00A 3KEQA 1D1TA 4DC1A 1GL3A 3GRKA 2FSVA 3OFSA 5IFLA 4RL6A 5H81A 5TQVA 4DIFA 3RFTA 4RVGA 4Y6RA 1Z75A 4R69A 4E0BA 5JFOA 3ONDA 1XA0A 3ICPA 1T4DA 4W82A 1QKIA 1SC6A 1XKQA 2NVUB 3W8DA 2F00A 1RJWA 1C0PA 3EMKA 3AY7A 3MJVA 3KXDA 2E48A 4GSKA 5DF1A 2C7GA 2ZYAA 5HM8A 3PLRA 1O89A 2X0NA 3IKVA 3JD3A 2GZ1A 4BNLA 4CM9D 2G5CA 2NQTA 3VH3A 3OA0A 1HLPA 4KOAA 5IZCC 4JJGA 3ZWXA 3C7AA 3GNSA 4OXYA 2O50A 1B7GO 1E1MA 2IXAA 3Q2IA 4M87A 2IZ1A 4NBWA 4OQZA 3JQAD 2OORA 2NACA 3GVHA 1E3WA 2Q1WA 2XPCA 2VT2A 3EDMA 3DBVO 1YJ8A 4FDAA 1ISGA 4GX5A 4W6ZA 1VJ1A 4NJMA 2DPHA 5TSDA 4AJ1A 1Y6JA 5COAA 2NSDA 4CLXA 3WLEA 4FSHA 4EBFA 2X23A 3AM4A 5BSEA 2CZCA 2YY7A 3SLKA 3MWDB 1DC6A 3H5RA 3V1UA 5IDXA 2JCXA 1I3NA 3GLQA 4FFRA 1HT0A 1W4ZA 3JQ8A 4TKMA 4TQGA 1M67A 4JXKA 1C3VA 4OJNA 1HYGA 1LUAA 3GF4A 4KQXA 3A28A 3K2BA 4B7XA 4PG5A 5JC1A 1DRUA 5ITVA 4YRBA 1HSOA 4QO7A 1LX6A 3RI3A 3IKTA 4CLHA 1E1NA 4DYDA 1A71A 1CJCA 1LRLA 4D3DA 2P9CA 1JW9B 3FWZA 1U8XX 5IXSA 4QO8A 5CG1A 1XGKA 1W8DA 4ALJA 4CV3A 3D5TA 4R41A 4C7KA 1R4MA 1E3SA 1BXKA 1RM4A 1BW9A 4QFCA 1GV0A 4PLHA 2GUGA 1DHTA 4BNZA 3FCOA 4CMIB 4PLTA 1HF3A 2C20A 1MXHA 5L45A 3QVXA 5AXAA 3T7EA 4IZIA 2ZCUA 4HFNA 1ONNA 1ENPA 3STHA 2JHGA 4O63O 5BNIA 2I76A 2PD3A 2D4AA 3UKOA 4GWGA 4I1IA 2WEKA 3LSYA 2A94A 4FN4A 4H3VA 1E7MA 1WDMA 3HSKA 3TOZA 1WPQA 2X4GA 3NUGA 1PGNA 1U4SA 4LGVA 5DP2A 3UICA 1HWYA 3D3WB 3P2OA 4ESOA 5JO0A 3FHLA 3UCXA 3GZNB 4BV9A 2GR9A 4B7CA 4FFOA 1F12A 4Q3BA 2ZIZA 3MOGA 3DWFA 5ILOA 1LI4A 2DBZA 1HYHA 3LT4A 4Z0PA 3IMFA 5G0WA 4ND5A 1JDJA 1PIWA 4IGFA 1YL6A 4B4WA 3D64A 2W2KB 1Q0LA 2EERA 9LDBA 3PJGA 4IMRA 3TL2A 3F47A 3PJFA 6LDHA 1ADGA 4XCVA 4G81A 4JBIA 3QVWA 4RVHA 4YVFA 4MKZA 1LLCA 1DDOA 3GMDA 1PS9A 4BNJA 4BMSA 5TS3A 1J4AA 1RYEA 1O6ZA 3CE6A 2O3TA 2Q1UA 1WZEA 3GG9A 4GKBA 4A73A 1Y8RA 1YRLA 3PZBA 3BMNB 3PYLA 4DREA 2HSDA 1IUKA 2HK8A 3E8XA 4GLLA 1J6UA 1H93A 1C1XB 4D79A 4RJTA 3GDGA 4R1NA 4CMEA 2WD8A 2PKRA 3N7UA 3VPSA 5AOVA 3GEMA 4D45A 4KZPA 4R3NA 1X1EA 3RD5A 4BGUA 3OF2A 3UCEA 4CJXA 2Z5LA 3N58A 5K9ZA 2JFFA 1SEPA 1GCUA 5A9SB 4DPMA 2WE7A 3F9IA 3PWKA 2QIOA 5HA5A 1PZHA 3CZMA 3R0IA 3S2FA 4WASA 5I8ZA 1H6BA 1ZW1A 2D5CA 3C3XA 7ADHA 4CLOA 3ZWVA 4WLUA 4NNJA 3V5NA 1P0CA 4IJVA 3LC2O 3GDFA 5DZSA 3GT0A 1SZJG 4WLVA 2VWPA 2PKQP 2RAFA 3RKRA 1LU9A 1AXEA 3WX0A 5EIOA 3ZWAA 4B3IA 3ZCXA 4UUPA 3GVXA 4EYEA 4PLYA 4JIGA 2CSUA 2WD7B 1B15A 4Z0TA 3HQ4O 3MCVA 5LDGA 1B8VA 5L9AA 2Q49A 2NTNA 2NU7A 3E9MA 1AE1A 3SVTA 3PFWO 1U3WA 2FMUA 2PV7A 3JQBA 2DBVO 4BNKA 3WYBA 3WDSA 1J49A 2LDXA 1HE3A 3OIDA 3OQ6A 4FOSA 5DT9A 2VHVA 2V65A 2Y05A 2DQ4A 1G0NA 1HZJA 3M1AA 4LW8A 3AUUA 5JSFA 1CQJA 2HMVA 4DLLA 2NWQA 4ZQGA 4BNWA 5FEUA 1YDWA 3HDHA 3S2EA 2C59A 2Y0DA 5DULA 3I9OA 1DIHA 4CR6A 4NJOA 4BKRA 2X22A 2FZEA 1ZK0A 4ZQEA 1M66A 1RM3A 2YJZA 3LK7A 5KVQA 1GUYA 3HFGA 4IMPA 5G2OA 4ZD6A 3IOYA 3G1UA 4NFYA 3VTZA 4DYVA 3FR7A 3DBHA 4UVEA 1PL8A 2J3JA 3OIFA 4II3A 3ZW9A 3QHAA 4HNHA 1SB9A 5JC8A 4UEKA 1QXSA 4OYRA 3ROKA 5H82A 2D1YA 3K30A 4TRRA 1N7GA 2X0JA 4P8RA 2VTEA 2CDAA 1ISHA 2PH5A 1R4NB 2DVMA 2E37A 1XEAA 2ZB8A 1PWZA 4J43A 5I7FA 1DXYA 1ZSVA 4J7UA 2YDXA 4M86A 1UXGA 5JPIA 4EJMA 3FR8A 3WGOA 4UUMA 2UYYA 3HHPA 3QP9A 3LU1A 2AQIA 2JJYA 1I36A 4Z9YA 2QW8A 3BMNA 3DAFA 4AJ4A 4RQTA 1Y8QA 4RORA 4E4YA 3A14A 2V6FA 4BO5A 4PFJA 3F5QA 1P33A 4JGBA 3NDRA 1UR5A 2E4AA 3GH3A 2VYVD 4EZBA 5CPBA 1ZK1A 4NBRA 3QV1A 2ZB4A 3E9NA 1GYQA 1XDWA 2YHIA 5AXDA 1E92A 3PIDA 2TMGA 2P5UA 1ZXLA 3DONA 4XIYA 4WEOA 8LDHA 1HEUA 2IYPA 2J3KA 1L7DA 3F1KA 4ND3A 4URFA 3GEGA 3E1KA 3MJTA 4E33A 4G2NA 3AM3A 1OOEA 3INGA 4L4SA 2Q99A 2D3TA 3WSWA 4CUZA 3KETA 1ENOA 4PLFA 4RPKA 5JBIA 1JAYA 2YZ7A 2GZ3A 1BW9B 1LRJA 1DB3A 2O2YA 5KVCA 2BGKA 3D4PA 5KJFA 4YAJA 4KQWA 1B3RA 3G49A 4OQYA 4LVCA 3IC5A 3K6JA 2BI7A 4Y6PA 3N74A 4NU5A 1D7OA 5A04A 4NFSA 1V8BA 1P3DA 2GN6A 4NU6A 4RDHA 5THQA 1F0YA 1N8KA 3JQGB 4A2CA 1M6WA 3VKVA 4EUEA 2X1HA 3RBXA 1VL6A 3ZWYA 5CDGA 1VLLA 3FWNA 1V3UA 4RLSA 2I6TA 3SC4A 3G1TA 1N9GA 1X0XA 2OBYA 1NQTA 4OGWA 2O3RA 9LDTA 1HYEA 4L74A 2X86A 4HKTA 1PTJA 2X5JO 3NGLA 4R1SA 2HJRA 2Y1DA 4K9DA 1LC3A 1P1RA 1BDBA 5JDIA 3JD1A 3BMOB 2PK3A 4PN3A 3OEYA 4FFPA 4DWVA 3ANMA 3WWYA 1HE2A 2VTDA 1ARZA 4YDRA 4LRTB 1HL3A 2P4QA 3KYDB 4WPGA 2UUOA 5A4DA 5G0SA 4OXKA 3RBVA 2VHYA 2FZWA 4AL4A 1LDEA 3AU9A 3LDHA 4M8SA 2EGHA 1NHGA 5EPOA 1HDYA 1AN9A 3RFXA 3Q2KA 3VVCA 4O1MA 3DMYA 1NVMB 2HQ1A 4J2OA 1YL5A 5JDCC 1ONOA 2J5RA 2GASA 2XAAA 1ISMA 1N92A 1T24A 1AXGA 3I3OA 3AUSA 2PGLA 5ILGA 1C1XA 4OL9A 1CIVA 3PJEA 3U62A 1G6KA 2P2SA 1LA2A 4RF4A 3WGQA 3VZPA 2GN8A 3DEYX 4P4NA 2VHXA 4F45A 5EN4A 4F6CA 2B83A 3ETDA 3R6DA 2IZ0A 5T6BA 5EESA 4ZICA 1RM5A 4QTZA 2RCYA 1GZ3A 4JN6B 1CYDA 2QZ9A 1N7HA 1S6YA 2X5KO 2PLAA 2QZZA 4DTIA 3NYWA 4GMFA 3ZHXA 1HKUA 3P5SA 4U8GA 2WYWA 1W0CA 1UZLA 4OXNA 1IPEA 3MJSA 3CIFA 5BR7A 3NDIA 3D7LA 3DR3A 1U9JA 5K6AA 1U4OA 2QYTA 1ZKMA 3O26A 1NFFA 3NJ4A 1VI2A 3OECA 2DFDA 3VC7A 3WOHA 4HXYA 3LVFO 4CM1A 3NTRA 2PFGA 1P77A 4L8VA 3QVOA 3H2ZA 3L6OO 2X9NA 4D0RA 3L4BC 3W4JA 3MJEA 3GA0A 3NAQA 1YVEI 1ZMTA 3FN4A 3JYNA 4YR9A 4GMGA 3CPSA 2UUPA 5I9MA 2AQKA 2Q3EA 1GQ2A 1BXZA 4XQ9A 2D2IA 4RF3A 4J4HA 4UULA 2HKIA 1LLUA 3RWBA 1EK5A 1GAEO 4HADA 3RUDA 3F6YA 4B4UA 3BAZA 3DDNA 2GRAA 4JCOA 5DBFA 3S1LA 1F17A 1KYQA 2JAPA 3C7DB 3U5TA 2AXQA 4OHUA 4W9NA 4B3HA 4FFLA 1E0DA 4BO6A 1I33A 3WB9A 4FQ8A 1DAOA 5JYDA 1LDBA 3KBOA 4L76A 5G4LA 3TRIA 3JQ9A 2FR1A 2VT3A 3GUYA 1JKFA 4YJDA 1GDHA 4HFMA 4BIIA 3LT2A 1UXJA 3BHMA 1SPXA 3JQ7A 4HX5A 1K5HA 5B4UA 1DIRA 2VYND 1ZEJA 4RZHA 3OHSX 3BTOA 4HP8A 1LXCA 2I9PA 5CG2A 4YACA 5F1PA 1C14A 1D8AA 4L4XA 4WCDA 3ROQA 3MOIA 3RUHA 3VPXA 1IY8A 1OC4A 1KVQA 4E3ZA 2ZCVA 3UXYA 1JKJA 2VRCD 1BRMA 5JY1A 4LCJA 3PRJA 3OMLA 3EY4A 3E03A 3UN1A 2VUUA 3QVSA 5F5LA 3H6KA 4MP6A 1I2ZA 4ROSA 1PJTA 4BGVA 3WYCA 3PJDA 1PR9A 2HO5A 1NBOA 3IQDB 3HADA 5ENVA 3ZV3A 1VC2A 1LQUA 2OO5A 4N5LA 4Q3NA 3WQRA 4UEJA 2VUTA 3CXRA 1DRVA 1FMCA 5B1YA 1CETA 1ZVMA 4YCAA 3AFNA 2WE8A 4J91A 3JD4A 5TRTA 1EVJA 2EIHA 3I1JA 3M2PA 2PGJA 1KC1A 2Z1NA 4UVGA 5F5NA 4KWIA 4YA6A 4QQRA 2IODA 3WICA 1I3LA 3WNQA 4NBTA 4Q9NA 4OAQA 4IDGA 3JQ9C 2Q4BA 1GUFA 3GUCA 1IZ9A 4NK4A 1FDTA 3GRPA 3TL3A 3E5RA 5L3ZA 4YJFA 5KJEA 1Q0QA 2H6EA 3RC1A 4WNIA 2J3HA 3GNTA 4E5NA 4AJOA 3NJ8A 1MB4A 3DQPA 3KM0A 2GNAA 2BFAA 5CP8A 5I7VA 3I23A 4FR5A 4E5YA 3ICCA 1DFGA 3INRA 4YJGA 1YL7A 1U3UA 4LCEA 3U0BA 5IDWA 4M1QA 1NYTA 8ADHA 1ZSYA 1RYDA 3AU8A 4D0SA 1AHIA 1SMKA 4GQAA 4L4RA 1T2AA 2ZYDA 4TRMA 3VOSA 1PJBA 4XD2A 3RUFA 1EBFA 2X58A 5CDTA 4AJJA 4RVFA 2XXBA 4MKRA 2JAHA 3W4KA 4A10A 5A06A 4LISA 1MXFA 2HRBA 1Z45A 1JLLA 1JN0A 3L6EA 3DOCA 4D7AA 4CM8B 2OOSA 3H3FA 1JVSA 4YXFA 3KLMX 1V3VA 4J7XA 3C8MA 3H65A 4DIBA 2AQHA 5JCJD 1A7AA 1VL8A 1OAAA 1XLTA 3S2GA 1KVSA 3GK3A 5TJ9A 3WLFA 3QJ5A 1T2FA 2FSSA 3DMTC 3DZBA 3WQQA 4O6VA 4E2WA 1ISJA 1KIFA 1MC4A 5KNLA 1T1SA 2EF1A 1DC5A 4A5OA 1NAIA 3D4NA 1TA4A 3ETGA 3H9GA 4ZVVA 4B7UA 2PD6A 2ZJ0A 4R3WA 1ZJYA 2FY8A 3K92A 1O5IA 4NIMA 1KERA 3NEPX 5LDHA 1E7YA 2Y1CA 4JP2A 1BHSA 1EDZA 1U5AA 3AFMA 4IDBA 3PIIA 2Y1OA 2PNFA 1IHXA 4B4OA 5B37A 3A4VA 2UVDA 1PS0A 4J0EA 1X7GA 4U0JA 4YB8A 3B1JA 1K6XA 3UOGA 1JKIA 4XKJA 1CEQA 4RCVA 4RPHA 3WNVA 1DSSG 1XHLA 4LMRA 3C24A 4ZJUA 5ER6A 1ZO8A 3K9QO 2PD4A 5TNXA 3SJUA 1MP0A 1RPNA 1YBVA 4N5NA 3WGYA 1HE5A 1WVGA 1ZXBA 2Y66A 3KTDA 2HMSA 2YHIB 5TF4A 2PGDA 4D41A 1DRWA 3KHUA 1GYRA 4YAIA 4AJNA 4AJIA 4GX2A 3U4HA 3ASUA 3JYLA 4EDFA 4Q3CA 5TC4A 4PZCA 1GD1O 2H9IA 5KIAA 4A27A 1E3LA 2NNLD 3JQ8B 2JCVA 3MTGA 3PWZA 2FWMX 3WXBA 2V6MA 4ZN6A 2B4RO 1SB8A 4GI2A 4IDAA 3ZN2A 4DLBA 3LF1A 5COQA 1YB5A 1TB4A 3CTMA 1GZ4A 3E18A 2EKLA 4I5GA 4PLWA 3ZWNA 2DUWA 4BO7A 1A9YA 3VZRA 2DT5A 4N54A 2XOXA 2QYSA 1YE3A 3F3SA 4YJGB 1WMAA 2GERA 1E3IA 3PYMA 3ON5A 3WTBA 2J8ZA 1UDCA 3SBOA 4WJZA 1UZNA 1UP6A 4IY1A 3VKUA 2EWMA 5FF9A 2CUKA 3RQSA 2DFVA 4XR4A 3TN7A 4U6QA 2G82A 1GCOA 1NVGA 1CDOA 3KYCB 3FPLA 3L4SO 4J1TA 5KTKA 1JU9A 3TDKA 4GX0A 3OQ1A 4C7JA 1NHWA 4M89A 3RC9A 4PG8A 4HUJA 1K2WA 2A35A 4EUHA 1PJ2A 4IQ8A 3GPIA 2IEDA 2FR0A 3H7AA 2Y0EA 3TOXA 3WR5A 3P19A 4AG3A 4TZKA 3C85A 4NPCA 3EK2A 2OL4A 3JQ7B 1NTOA 1ULSA 3V1YA 4EW6A 3JYPA 1T25A 2O23A 1E1KA 3AUAA 2QRLA 3OEWA 1QORA 2BKAA 2W2LD 4BO3A 3D3WA 3UHAA 3ORFA 1A27A 4E12A 4DMLA 1NASA 2G17A 3LT0A 2YUTA 4IDDA 5J23A 1EFLA 2FPIA 2W98A 1ZBQA 2O7QA 1R0SA 4LK3A 4ZQFA 3F4LA 4DIOA 1I24A 4CMKA 4QT0A 1MV8A 2DU8A 4MIYA 3JYOA 3X2FA 2I3GA
chains in the Genus database with same CATH superfamily
1Z3IX 4L3OA 1INLA 4P4TA 4I1PA 3UO8B 4LDRA 3T95A 1A7JA 1TO2E 2YJ5A 2B5WA 3PNVA 4G1EB 1Q7RA 3ED1A 3H99A 4XUGB 5C7YA 2J32A 5BV0A 2QB5A 2X19A 3ZVMA 4ZV9A 2C1EA 2FZGA 2L19A 3KUCA 3N28A 3QUBA 3QUQA 4GL4A 1W73A 4GXTA 5EAIA 3ZHVA 3FTFA 3CNEA 2P4HX 1VJTA 4ZVTA 4I8DA 3R9XB 3G2IA 3E2PA 5M5BA 5FWAA 3CH7A 1CHDA 2XMGA 2JGEA 1RC0A 3NV9A 5MN5A 1CE8A 2HU2A 4JLSA 4CUKA 1NY5A 3L7JA 3BJMA 1M1UA 3JVEA 3STYA 1UWLA 1B4DA 3STUA 3Q9SA 4YRGA 4IM7A 3B6MA 3IGFA 5HCNA 4U3JA 3FKSD 1KI1A 3BD6A 3O2SB 5HUQA 4DNXA 5LOVF 1DTSA 3ZNNA 3BQ9A 3WMRA 4P7KA 4U9UA 2CW5A 1S7GA 3KFXA 5HUJA 3R7WB 4YYZA 3JQFA 1U0SY 3T61A 2ZUCA 4J1QA 1PEKE 4LJSA 3O9VA 5TT1A 3SE0A 3A6KA 4LA4A 1BA3A 2OE2A 3LIIA 1VQ1A 4WKNA 4D56A 4JXXA 3IURA 3QQPA 2AR0A 1T9BA 2O2DA 4JEIA 1LBIA 1YGYA 2QPLA 2WIJA 1PJ4A 2AJ8A 2PLFA 3CX6A 3QKWA 4NH4A 1KFCB 1NWHA 1Q0PA 2HZBA 1U5CA 2F4VB 4UU1A 1ZR4A 3AKEA 3PLNA 4B4VA 5FUQA 1TYBE 2ABWA 1XRNA 1TTHA 2R68A 2VEDA 1RACA 3EAGA 4EI8A 4GSLA 2XBMA 4QDUA 3FNHA 1TZKA 2R47A 4N49A 4PG7A 1QGDA 3UGQA 1KU0A 4FHGA 3WFJA 1RRPA 5E6UB 3QMWA 1WCIA 4HH3C 4AZVA 4XVCA 5JC1A 2V6IA 1UMBA 4BNMA 2F59A 3I2FA 2OB2A 4IIUA 2A4KA 4KGDA 4Y0VA 3X2EA 1EA7A 1W5EA 2RH4A 3N2GB 4KQHA 5JNVA 1S01A 3KEMA 4Q3KA 5CLIA 4DGSA 3OZXA 5CFZA 5H59A 4KACA 2VZ0A 4X60A 3QPWA 1XMVA 4DMGA 5BY2A 1B2LA 3HR4A 1IBMB 1TQHA 1VP3A 4BAGA 2V8OA 4GZLA 4MPRA 2WSLA 1U8UA 4ZKEA 2PPVA 5GIPE 1FQWA 4Y67A 4UM7A 4JQYA 1NAHA 2QE6A 5I9BA 2IS2A 4LPKA 5ALXA 1DPFA 3HN7A 3FHTA 1SK9A 1UCFA 2HL6A 4OMUA 1ORVA 4AKGA 3A7DA 1XIVA 1WAMA 1ZH0A 1D9XA 2R96A 4WZBA 1NJ2A 5CA0A 3M33A 1HT3A 2PL9A 2R2AA 2BFNA 4CKWA 3F4BA 1Y98A 2W6MA 1PO7A 2QG4A 3MERA 4G0UA 3EIXA 3EQ9A 1U2GA 1S5PA 3IUBA 5KDLA 4CDNA 3JQBC 2YWBA 4C9BA 2D2FA 2YRXA 4IUYA 1BFUA 5CU7A 4ZHQF 1AUXA 3H4TA 4L4YA 3HFSA 5IJAA 4LY9A 5DNUA 3JWGA 3IXLA 3SX2A 2MYUA 1QCCA 1EU1A 3I05A 4BS9A 2WSSA 2FF7A 1ZHHA 3I9KA 4IKOA 3ID6C 5A5EA 2PAAA 3UHOA 3AINA 1Q0TA 3K94A 5BORA 1X8LA 3ESZA 3WGJA 3JXEA 4U1RA 1K68A 4OYHA 4ZCLA 3PDJA 1XXLA 3V8PA 2FEPA 3ZEAA 1X7DA 5BWNA 4Y8VA 3BD8A 2GA9A 1SOWA 4IZOA 4ALIA 3KQUA 4AJHA 1Y8RB 3LWBA 5B5SA 3I6YA 5I9TA 2B99A 2WK1A 5C18A 4G9BA 4L28A 1S3GA 2PGIA 3BRSA 1H2HA 4WGGA 3ZQKA 1N78A 3GHYA 1XRSB 3JATA 4EG3A 2I7CA 2OWEA 4ARZB 2ZI3A 1HT1E 4UU7A 1C1YA 2IXDA 3QTBA 5K0CA 3L3BA 3E3OA 3ZU3A 2HPVA 4RTQA 2VH5R 3LK6A 5BSFA 1ZGHA 2P68A 2W22A 1FDVA 3T9DA 3KV3O 4EGQA 3V1MA 4ETWA 4MJLA 3I04M 3C43A 3I30X 4HY3A 3WGKA 2W2TA 4U39A 3NRJA 3FPHA 3P2IA 4MS3B 1Y80A 4O2AB 3S2IA 5JAMA 1EVKA 4J8PA 2XNDA 4K9NA 2HU7A 3OOYA 4Y6GB 5LLDA 3A58B 5L40A 2JLVA 3PI6A 1ZL2A 1CUFA 1HE8B 1JAXA 3KT3A 5ULLA 3M2TA 2JD0A 3NC4A 1E1QA 4JBHA 5LWQA 2IYAA 1W75A 1LK5A 1Q7BA 2OM6A 3IDFA 1UXIA 2VJKA 4H1VA 4LN1A 2BHLA 4KPGA 4O5OA 1IMOA 2C9BA 1KJWA 3A25A 4V0SA 4ZANA 5JHHB 1MAUA 3QWHA 4O4JF 3REFA 3UGJA 2GPNA 2RH9B 1IDOA 2W42A 2YHUA 3IYLW 4CMIA 1GR0A 2V7UA 1JI3A 2M32A 3GJXC 5G1PA 4A23A 1P4GA 3VVMA 5EXTA 2MT9A 5HKKD 1IUNA 2VJNA 4HCJA 1MA3A 2AN3A 1YR6A 5EIBC 1FX1A 3SDSA 1OR8A 4M36A 4FLMA 5KTYA 5HRUA 3WQSB 3K71B 1KK3A 5HBGA 3HY3A 1A4XA 1T9ZA 1P7CA 3QSGA 2CYCA 1DL5A 2H00A 2GVZC 3NBZC 2QZJA 3NEAA 5TV2A 3HCOA 4LNUB 5FNVB 5HZMA 1BH6A 1MMFB 3LX4A 3CLSC 4EYQA 5DASA 4WKCA 2L2QA 4YXWD 1MT3A 2F3UA 5EKUA 1RYMA 4QHTA 3R7SA 1AQUA 2JASA 4HJRA 3G2MA 2VPPA 1JDZA 2WJWA 5JYEA 3GFRA 4S1TA 5IKPA 3I0ZA 1P2SA 4KEAA 2DBRA 5DX1A 4HS9A 5B3KA 1LDYA 1QAQA 2GWRA 3UAVA 1W36D 2YWCA 4V39A 3WWZA 1W5FA 1Z74A 5L7WA 1V9SA 1S96A 2GOYA 2CFRA 3DFFA 4Q15A 1CNMA 1F2TA 5KOYA 1EFKA 4HNUA 3THWB 3FXAA 2ZQ5A 4TLMB 4G97A 1B6TA 1JJAA 2QYOA 1OXXK 4NZ9A 1YOVB 5C3MA 4YAUA 1KJ9A 1ZX1A 1RKVA 3FCYA 2ZDQA 3IPYA 4NC9A 4AZ0B 2OYSA 4CKBA 4B6PA 1XXHE 4IDCA 4FNOA 4OB7A 4D5EA 4I99A 3OCXA 1SZDA 4HHEA 3G9XA 1E2JA 2CDNA 1FP1D 3GGDA 1TFUA 1MJNA 4DT1A 3L1JA 3O90A 5IVDA 3P0IA 1UBJS 4FDUA 4RV9A 4GKJB 1SBCA 2A5DA 2IPMA 2RBKA 3NHSA 3H6GA 3EBPA 2QA5A 1P2BA 4OYLA 3RLFA 1KY2A 5CXSA 3WLMA 4D8UA 4F5EA 2FPKA 1GGNA 3QELA 3L1VA 3Q7TA 4UCXA 5C7IO 3C97A 4FMCF 1Z26A 3AEKB 4WBSA 4TKUB 5JCJA 1TXGA 3OX2A 3V8VA 4MPDA 3WJ2A 5DU2A 4WOJA 1TX4B 3LV8A 4A26A 2FEMA 2XUFA 1OYWA 1MC8A 3KOUA 4CMJA 1L8LA 1AHHA 5HE9A 1PL7A 2V6GA 5CK4A 4ZCSA 1FLAA 2JB9A 3GARA 4HAYA 2MR6A 1F3OA 1K27A 1QZZA 2UAGA 5E7IA 5EQFA 2E2WA 1NPYA 1YWGO 4AWXA 4UQLA 2A0UA 2HLHA 2BKUA 3OZFA 4MEBA 4OYYA 4WDRA 5COBA 1IAVA 2IQ5A 1KDRA 3MTJA 4FS8A 3ETHA 1ZK2A 5HCIA 1H2XA 1U2QA 1H3NA 1TW3A 4Q48A 4QVGA 4BFXA 4BUCA 4MQ5A 4DMMA 4IVRA 4RQAA 5FQNA 1YTUA 1G66A 1P5JA 1H8EA 2WRZA 2I1QA 3EXFB 1W4CA 1WCWA 2DJIA 3A3PA 4MW2A 4TKZA 5EHNA 2PO5A 3EG9A 4I1UA 2ATIA 4MPTA 1NW6A 3A1WA 4Y6OA 1G17A 2QVZX 4WLFA 3GJ3A 1YB2A 4RMJA 3FWHA 1O6FA 1LWOA 2ODNA 2VUSA 4YNBA 3C6BA 2Y1XA 1Q7TA 1XU4A 3CVYA 3BFPA 1NPTO 3PGVA 1N9ZA 4BVGA 3GELA 3F8TA 4J0KA 1XDSA 2C42A 4JLJA 1VRVA 2FE1A 4H15A 3NXSA 1QIGA 2GEKA 1GR1A 1GA4A 4HDSB 1V35A 3FWPA 3KVVA 5A71A 3L6RA 3ZD7A 1K7YA 5IK2A 1B3BA 2PANA 5T57A 1LSJA 1ZGBA 4II7A 5E7JA 2AOTB 1YU6A 2BHTA 3L8YA 4IVNA 1SQ6A 2IP4A 3TBHA 3DMNA 4CLRA 1AK1A 1QTRA 3C6YA 4XVQA 4GBMA 1IXZA 3FUWA 2REQB 3F9RA 4NZMA 2W8BA 1U0LA 3H9UA 3QU4A 1GPUA 3SX4A 4L6CA 5DTRA 3NNSA 4RGBA 4XDZA 4H7JA 1RZUA 4RABA 1ZN9A 4K26A 1ZIDA 2QX8A 3SXPA 5EIAA 3DZGA 3RTGA 2D0OB 3BA1A 3UNXA 1GPJA 4DE5A 2NM0A 1SUCA 3M5CA 2Q6IA 4HDQB 4QGHA 2H1OA 2BRUA 4HTAA 3TTVA 1XL0A 1C4WA 2BMEA 5FPQA 4QVIA 1OPXA 2WAOA 3BJIC 5KHAA 3DF7A 4QDTA 3X2SA 1DKUA 2RKOA 4YDHB 3CBGA 3A2KA 3GZ4A 4BAUA 3WA7A 3MSXA 1LNZA 1MX1A 2BM0A 2QTVB 4PC7A 1ULUA 1G4AE 5HKKA 4URYR 3TQHA 3PHHA 3FZYA 1QZUA 4UAGA 4X85A 1M8KA 5AHKA 3K2IA 4G56A 4P53A 4WL0A 2NLOA 1WZCA 5EXSA 3U44B 3QI2A 3R5XA 4TS3A 2TMKA 1K75A 4IPTA 3RC2A 4YIKA 2ZSBA 1JXOA 2H2FA 3DBLB 2RC6A 1E4OA 4Y2HA 2VO1A 3RH0A 3W8EA 2BP7A 2D0IA 1RMTA 2GPWA 2XBUA 3RSLA 2P41A 4C1NA 2VQ3A 3KJEA 2AC2A 1L6IA 1O95C 4K6OA 4CLEA 3IBGA 5IC5A 4YXWA 4F1JA 1QQAA 1KFJB 2ODAA 2CE7A 3LECA 1C9NA 4B43A 1L5VA 1VG0B 3IBYA 2A9FA 1ECCA 1QG4A 5CVEA 3RSQA 4D9BA 2A9VA 3B6IA 4JH0A 4HGPA 5CVCA 5IJZA 4HNGA 4IQGA 2YJ4A 1XYGA 2BFEB 1ORTA 4AY4A 5ALIA 4HAIA 3B6KA 2OLJA 2FETA 3RS0A 1XMSA 2QJFA 4QULA 1KC3A 3ZE7A 4H6WA 4E5KA 2BTQA 4FE3A 4UBIA 3IAAA 3QE4A 2W4IA 4D96A 2J6CA 2X41A 2C8VA 3ZY6A 4NCXA 2DB3A 2YWGA 4TXHA 1LTHR 1PJSA 2W43A 2IEBA 2ZBDA 3OICA 4YLGA 2LCQA 3DDUA 1QH1A 1L7OA 3QUAA 4LI3X 4JI5B 2PZBA 3FRJA 1QHHA 1WCYA 1YJBA 1MW8X 3JARA 1PWYE 1C5KA 2Q2OA 5TMEA 3TIIA 4OI0A 5FOUA 3M5DA 1ZD3A 3MYYA 4X93A 4DVJA 1AMUA 1HZZA 4PBRA 5ALHA 4DDHA 1T26A 1N6NA 4I9NA 4MWSA 1EVIA 1D6MA 5H3HA 4OY3A 4LYGA 1KH3A 4JUDX 3L8ZA 3OQIA 1MX5A 1AM4D 2LVBA 1N3LA 4PCUA 1RW4A 1W8IA 3EW7A 3F5FA 2WM2A 3PDIA 3NLLA 5D3QA 4CM4A 3EXFA 2VPZA 4YV0A 2Q1TA 3B9PA 4OQPA 1E2BA 3QH4A 4MS1A 5AK6A 1MVOA 1UDBA 2I1LA 2O3SA 2P1DA 2ZRMA 4NARA 4UPDA 2IEAA 1NMXA 2XQIA 1X7ZA 3OJEA 1FZQA 3C8ZA 1N5DA 1M0EA 3AO0B 2BEKA 3HB7A 3DKVA 3QE0A 4HAOA 1P1KA 3REQA 4UC0A 1BXRA 4TMFA 2CLDX 3FKSA 5ESDA 1PJLA 1ZYUA 5G53C 1ISIA 3LBNA 1ZNXA 5CRIA 5EA2A 1U7DA 1JH8A 5D00A 4PSUA 3A9WA 1HLFA 3SZRA 3RK1A 3RIXA 4DLPA 1ZAYA 4MRVA 4RNCA 1L5HA 3ND6A 1N9GB 2AEJA 1NMEA 4MA5A 2XB6A 3ZX4A 3LH5A 3ZR4B 2F2TA 2P2GA 2POQX 3RVKA 3WGTA 3WKDA 2P78A 4DDKA 2PSJA 4IIVA 1MA0A 3Q0EA 3ZI7A 4ZVMA 1I32A 2KB0A 4JC8A 1E62A 1OYOA 1Z12A 3GCZA 4UUAA 5IASA 1B0AA 4RKQA 2C9ZA 3IHLA 2BT4A 4L6AA 5KQPA 5IXYA 4PYIA 4XSHA 2Q8PA 4QFDA 4BEBA 4QRHA 3HLTA 2IH5A 3AFHA 4QOIA 4M60A 5CVTA 2FZ5A 1R5JA 3C3DA 3D8TA 1V45E 1Y34E 3AESB 4OH1A 5CT6A 3H1TA 5D87A 3P7MA 5AW9A 5DBGA 3FD8A 1HDGO 2AOUB 1E9RA 1DZ3A 1W5TA 4GAEA 1ZD5A 2CWDA 1GZVA 1NUPA 2YR0A 4BZWA 3KSZO 3F6PA 2IDKA 1L7BA 2QORA 5TJHA 3OTOB 3FDZB 3R0VA 2CF6A 2YTZA 3SE7A 5C1BA 1E8DA 3FZQA 1O87A 3TMAA 1J0XO 3OUZA 2V54A 5DWDA 2WFLB 3RB8A 1VZ2A 2F62A 4O0MA 1JH9A 1IJEA 2EEPA 3HU2A 3H9EO 5ALUA 5ADHA 3OEEA 4L07A 5GP1A 2Q7DA 3T15A 4I08A 5JBQA 3BCUA 2BHNA 3WBJA 4D57A 5M7EA 3FI0A 4P4GA 1W94A 2R65A 1Q57A 5CFQA 4HAZA 4DUZB 3WS7A 2PYZA 5JFGA 3GLGB 1Z22A 1VLZA 3KOOA 1XZFA 3OC0A 1Z5NA 1SK8A 2Q9CA 3L06A 4M1SA 4UCQA 5JG7A 1NVVQ 2VP3A 1NXTA 3N3BC 2AE2A 2H92A 3FCEA 1W5BA 2CL6X 3ITNA 4A0GA 3QE3A 4C04A 3PQEA 3DZCA 4Y6SA 3TAUA 2BAGA 4D9FA 3MLEA 4I36A 5HJ5A 2MIIA 4ER3A 2OCDA 3A31A 2G6BA 5SYMA 3ULKA 3ZI0A 5KJCA 2XT6A 4OXRA 2ZYGA 1OASA 2VJAA 4LSGA 3RBXA 5HXAA 2FSVC 2H8KA 3FOCA 3HEBA 3U9LA 2QZSA 2C78A 4G0MA 4MVYA 4BNYA 3KHKA 3TECE 2X3FA 3Q8XB 1EFVA 5CBPB 1JU3A 3TLGA 1Q84A 3FCCA 3ZJVA 5IVHA 4MYHA 1SN7A 1V11A 2YHAA 4M76B 4QX6A 3RASA 4F21A 1CZOA 2F7SA 3CZRA 5KKCA 1L4EA 1NP3A 1B42A 1GKYA 3EEFA 2QP3A 4QHYA 4AJEA 1II0A 2FRDA 1XVIA 2GO1A 3K0AB 4GOJA 1V2GA 2I33A 1ORHA 3E9CA 3DAPA 1A50B 3TO5A 1JG4A 1TKCA 2IZ7A 3ZCSA 4HZUB 4C21A 4QBGB 5J4KA 5JZBA 1BE8A 4KPFC 2EBFX 4UBLA 3NOOA 3LJKA 2G9ZA 4K3UA 3V7WA 3WK6A 1M1ZA 3KOWA 3PA6A 2HCTA 4JBXA 2QN3A 1C0KA 4NONA 4B9AA 1BZYA 5BRJA 4DCNA 4LF8B 2MYPA 2FPLA 2G28A 3EVBA 3EYWA 2XVYA 2PUTA 4MP3A 2I34A 4WXHA 4CT0A 1E9SA 1FFXB 1VCNA 1W36B 5HSGA 2JBHA 1GU7A 2BMWA 3GP5A 5SY4A 1CV2A 1E63A 3GT3A 3EEQA 3PNQA 3EZGA 4KKXB 4Q5IA 4TL8A 4V24A 3VMMA 4D9EA 1XF1A 3T4UA 1R4MB 5GINE 3C87A 1PHRA 1J22A 1M8JA 2AGVA 3R6LA 4L85A 3SFVA 5A0FA 4DR2B 4K6FA 1GSIA 5CT4A 3HO8A 4TLAA 3HYNA 5E4TA 3CMMA 3MCUA 3HU1A 4YCSA 1P62B 4AZ3A 4JJZA 3WMWA 1MGOA 1QCZA 4L8FA 7REQB 2WG1A 2Q6OA 3ZGYA 4AWAA 1IOLA 3PTAA 3LXUX 3VYUB 2A1TS 3WL5A 3LUKA 2QD2A 1YQTA 4IX9A 3KT8A 4NH0A 3CLTC 3IHWA 2FEKA 3KVOA 4ZARA 4F4IA 2PU5A 1ODJA 4LZWA 5FA6A 2IVFA 3NALA 1NR7A 1QB8A 3G23A 5AKJA 2PLRA 1F2TB 5FBWB 2G7ZA 4ZI2A 1V9LA 2IA5A 1I8TA 4OUKX 1G8GA 4ZTUB 1SXJB 2GN4A 4M55A 3AJAA 1E4EB 5A3SA 1LS6A 1DC3A 4MQMA 5CEFA 4KRXA 4BP3A 5L4SA 1OLSB 4JB8A 4ZQIA 4Y2TA 1B6GA 5TS2A 3GFOA 3NBFA 3L6UA 1J8VA 4JLDA 3MUFA 5KEIA 1ITZA 1QP4A 1P45A 2GK6A 2GS9A 3DUFB 4UREA 3UV6A 3OM9A 4ZCIA 3AONB 2GYWA 3RVMA 4QZVA 3NFRA 4RXTA 2QAIA 4YRFA 4EJ2A 2ZWPA 3L7DA 4INJA 5LC1A 4BATA 2F3QA 1JG1A 2HCFA 4JC0A 2QTTA 5LYYA 3TTUA 1G1MA 1JIJA 1Y3AA 2IPXA 2O1WA 2RGAA 4R3UC 4DNFA 4CQNA 1GNQA 1KEEB 5DTQA 8MHTA 3MJ4A 5BXYA 5J2TB 5FTLA 2XB2A 4JXJA 1UBNA 2O0LA 3QHQA 1NN0A 3ETLA 2YMQA 4R6XA 2V96A 3DFMA 2G25A 2M6KA 6REQB 3DLCA 3D3KA 2CMKA 2CNDA 2V5VA 2NXWA 4RW0A 3ZE0B 3CGGA 1ODLA 221PA 3QENA 2W58A 3F7TA 4U7WA 3C5EA 2BISA 2G07A 2GYVA 2RC5A 2VLIA 3AWIA 3HG7A 4RS4A 5B3JA 1ZIYA 1X0VA 3QVLA 4TQ9A 3TK1A 5JC8A 2CDCA 2GCGA 3ZV5A 2ONJA 1ZCZA 2IHUA 5A02A 4PSAA 1P3JA 3L49A 4GOKA 3U7QA 3PRHA 4H2DA 1Y7TA 4BQQA 4YUYA 2R11A 1ZN8A 1XQXA 4L5IA 1B8NA 3QA9A 2JZNA 3TL6A 4QNRA 3PBKA 4LHZA 4E7OA 3Q8LA 5KYWB 1PUJA 5EUQB 1Y5LA 3B12A 4NPAA 3DC2A 5EXDA 3T7SA 1J56A 1I5RA 1QPZA 1N7JA 3OEED 1VRWA 1VE6A 4GR5A 4IXNA 3GAAA 5EYPA 4DA9A 2WHYA 2H4JA 4MS1B 3FFXA 3MT9A 2VP6A 1Q91A 4TZTA 4QATA 2O7RA 2R44A 3VNRA 4A0SA 4GVPA 3WGIA 1TD9A 1VSQA 1MOZA 5EJAA 3RVNA 4CKYA 2QU7A 2JVJA 4EGSA 2JEYA 1XKTA 2CJPA 3I3SR 3FTQA 4BECA 1WF3A 3L4BA 5HKLA 3THYB 1NLUA 2WP8J 3VO9A 1P0FA 1X13A 3IP3A 3PK0A 4A6PA 3KZMA 4BWGA 2QT0A 4E6EA 2YY5A 1AZWA 1MG5A 3LKBA 2Q07A 1NPDA 2RJNA 5BQFA 2ZM5A 3FA2A 4FOOA 3HCBA 3CEAA 4RA9B 1QHXA 4N8EA 2OILA 3H97A 3KNZA 2CFCA 4FOPA 4JT2A 1EINA 1Z7BA 1MX9A 1Z62A 2AYZA 2CBGA 2RHCA 5EJGA 1F6BA 2ODPA 3HZOA 5IARA 2CMGA 1XMOB 4ZJYA 1C7JA 3O4RA 1FNSA 4P7GA 3VR5D 3ZPXA 5ALFA 1KVUA 3I9MA 4LFAB 3BTUA 3CZ5A 4QGFA 3U3XA 4BO9A 1LDMA 3DMDA 1P61B 1HE4A 2DKFA 5AT1A 2RH8A 1U8ZA 4AZ0A 5FBHA 3KHTA 7MDHA 4OM8A 2QTCA 1FK8A 3OOHA 3PX3A 2IU4A 2JKYA 4PRLA 4XEHA 5HFNA 4CODB 2ASEA 4BNVA 2D8AA 4JJ7A 4DLKA 2O9JA 5A3JA 4DB4A 2XHEA 3I2JA 3P97A 1DAKA 4M49A 3IP8A 5IP5A 4KXWA 5I7OA 1C0EA 2XMPA 3A9CA 2KJQA 4TMVA 1KYZA 2BCJQ 1AGPA 1MIOB 1TUEA 1VPVA 3PXXA 1WNFA 2G6TA 3DBLA 3MD0A 4LZNA 3W6ZA 4NFSA 1CXZA 2GCNA 1YQDA 1U9ZA 4ZA2A 2SCUB 4NE9A 4Q05A 2FPIB 2X8BA 1MOPA 3P4UA 2Y1WA 1LBSA 1YZNA 2QUBA 5LMCA 1AZTA 2B8WA 5KTOA 4DLNA 3ZE2B 2QV0A 3R5KA 2IHVA 3WV4A 1F38A 4C7MA 2ZUWA 1VBKA 2AG5A 3CE9A 4C7XA 3P2EA 2NZWA 5EMKA 3WLOA 4Q6WA 4GI3A 2JRCA 2H9YA 3VZSA 2G4VA 2IQIA 4HDMB 2QAGA 4BMZA 2JARA 1GTVA 1ZUD1 4KO3S 3WL4A 4TWAA 4MP8A 3RTBA 4PWZA 3BOSA 2FMKA 3OLVA 4OQQA 3UB4A 1K3FA 1M2JA 3X1YA 1XEXA 3TCXB 2R00C 2D0PB 2Y1FA 3AF1A 3LHDA 3LYLA 3L79A 5AJVB 4EJSB 2V7QD 1TTTA 1R4ZA 1ZMXA 2ZJAA 1IPFA 1NLZA 2WHPB 4RUKA 4F7DA 1FDOA 2BIFA 2RIRA 2HLPA 5E95A 4BB6A 4C22A 2AH5A 4I3FA 4DBZA 3HXOA 5I7SA 1F6WA 3K96A 1SU6A 3QIVA 4UUNA 1T1GA 1L8XA 1WF6A 3BQNB 4QECA 2HOQA 3FNQA 4JLMA 1IRXA 1EWKA 1NDHA 2J45A 3RFVA 3ZWWA 3K9CA 2X76A 4RVOA 4ZU6X 3NX4A 3LG2A 1XDGA 3FB4A 1K8ZB 2WG0A 2IHJA 4J0QA 2Q7OE 4BBJA 2TSYB 4TMZA 1EG7A 2Q45A 2WYVA 1P7ZA 1KE2A 1JG2A 2YWFA 4Q1AA 5ITWA 3FGOA 4MUMA 3UV7A 3DNMA 3MTEA 4QFBA 5IXJA 4NVRA 3FBGA 4LSMA 1J07A 1E98A 5TGDA 4IIEA 4PZEA 2EDCA 1IXYA 1FMLA 3HBJA 5FPTA 4OHZA 3C3YA 3HDYA 3MK31 5CDYA 2FSFA 1I2BA 4OK6A 1DV1A 3I6ZA 4R0MA 2FZKA 3A4TA 4L75A 1U2DA 5CIQA 3P2YA 4CG1A 4NZYA 5U1PA 1JAHA 5KNBH 4P34A 3OPYI 4OGFA 3AOGA 3LOUA 4G5SA 5BT9A 4R8SA 4FC6A 2RHHA 1CULC 4JOCA 2P1ZA 3RS9A 3RS8A 3I9JA 3FZNA 1QO9A 4Y9DA 2PZJA 2R8PA 1B1CA 3NM6B 3Q5DA 3AZPA 2UV8A 1VDZA 2HXSA 4RHEA 4K88A 4GRDA 1Z7GA 1XU9A 1NYRA 2M1ZA 2O3UA 3GJZA 4XWKA 3KKQA 1J0CA 1MAAA 4UMFA 3WFZA 2PJRA 2FLVA 5AQEA 3DLAA 4PWYA 3STVA 4NV0A 3VH1A 2R4TA 2JAXA 1Y1SA 4MVJP 3ZH9B 1IHYA 1TZJA 3FI9A 4BCCA 1P31A 4DA7A 4DF3A 3KUKA 2YIDA 1XCMA 2DXIA 1A8PA 1G5TA 3HJCA 4J76A 4YASA 2UVQA 2QL6A 4YRIA 3TFOA 3BC1A 3CO5A 1XROA 2RMKA 3L5KA 1EFPB 2AXNA 3ZU5A 2XTZA 3M1IA 5AI0A 1ECBA 4KCGA 4U2GA 4MGIR 5IF3A 5JXHA 3DBHB 1CUUA 1O8CA 3DHNA 1QK4A 1NR1A 3T8YA 1UZAA 1L1FA 3HC7A 4FOTA 1XTQA 4UATA 5AKIA 1J70A 1WXDA 2CLFB 3U3OA 4ZT5A 4MV8A 1SZCA 1FFEA 1SM4A 4V0NA 4ZQCB 3WKBA 4FFBA 5DHSA 1BJKA 1N2ZA 3HBMA 3OM0A 3R5JA 4HYQA 4OL0A 3ZWMA 1ZKDA 3H11B 1KETA 2OMEA 4Z8YA 3RJ5A 4W63A 1O95D 4BO4A 4D42A 2H51A 2G1PA 4N7RA 3TTSA 4OAOA 3HXMA 2QN6A 4QUGA 4CMBA 5HILA 4DMKA 3OSUA 2JGDB 3U4CA 5DMXA 2XBLA 4A15A 2V1XA 2YNMD 3O1LA 3OQPA 3VNAA 1N2SA 4YT4A 3C3KA 3L4JA 3G89A 3MWEB 3NP7A 3HVIA 1IZ0A 3PCTA 2WIFA 1UQTA 2AG0A 2DM6A 1MO4A 2UZ3A 3W3AA 3ZX5A 2VHCA 2JK0A 2ZUVA 3I4LA 1JAIA 1ZK3A 3ZQ6A 3LDFA 3FYUB 1N77A 3CNBA 5LP6C 3U16A 3TXXA 3WNZA 4QVKA 2QIPA 5J4VA 1S8FA 4U3JB 1Q6YA 4Y98A 1XMJA 2P3OA 3OD5A 1E9BA 4OU4A 5C5EA 1R18A 4QGSA 4IJ5A 3QTTA 3HFRA 4X1YB 1ISSA 2JIQA 2VQDA 3REOA 3MG9A 2R4UA 3EAQA 4QOEA 1WUJS 1R2QA 3GLFB 3IKMB 1C1DB 1MORA 2JHCA 2QLBA 3PRYA 3O93A 2MOKA 3QOYA 1RBMA 4TROA 1T10A 1VE5A 5KTTA 4R1UA 1NMQA 3CVOA 3HH8A 5JRJA 2P67A 1V9CA 1ESMA 2QE7D 3LLUA 3M34A 4U5XA 1L5NA 1ZQ9A 1ZHFA 4XDGA 2CNKA 5DHPA 3SF8A 2C0PA 3B9RA 1NW3A 4HZUA 4RKWA 3PFGA 3WWPA 2MYTA 5LNK6 4YAFA 4C01A 2B5VA 1GU1A 2IPNA 2ONCA 2WJJA 4N4AA 1RYBA 3HR7A 3VPHA 1M33A 1ZCJA 4BKUA 1QGOA 1BTOA 1QSGA 2XLCA 5DCUA 3TNJA 2O4CA 1S4QA 4O08A 4Z3DA 4MR9A 4NYIR 3TTTA 4B84A 5JUWA 1LNQA 1MV5A 2R6ZA 4A91A 3A7EA 1RYHA 1MJFA 1AK2A 4FR0A 3RUCA 2X8LA 3CR3C 4D3ZA 1JR3D 3Q2OA 2R2GA 1RQ2A 1RRKA 1V95A 4KAAA 4L3WA 5CXUA 3NUQA 1XYVA 1ZWKA 2IW3A 3KYCA 4R16A 2OBBA 3GNLA 1S2DA 5NULA 2FN7A 3UK6A 3MIZA 1Y82A 3KB6A 4JP3A 5BW8A 1FTYA 4MXDA 3DB2A 1Y9AA 1XQ1A 2Q6KA 1TC2A 2GLUA 3KPUA 2WF6A 3DMPA 4FFVA 4J1SA 1XRQA 3MQFA 3CUUA 2FG6C 3SYMA 4FGLA 1B6SA 2R9VA 3WIEA 1L1QA 2XTJA 1UK8A 5F21A 4FYIA 4WXEA 3VR2D 1O0BA 3O9ZA 2HCJB 2PYIA 2A9JA 4Y2RA 3WKAA 2GF9A 1Q21A 2PKYX 2QGZA 3I4FA 2AOUA 1JWBB 1WY7A 4KJXA 1RTKA 2PX8A 3EODA 3OM1A 2B2NA 3EEBA 5EL0A 4R8VA 5K3OA 2JK1A 5WRFA 2BWJA 1KDZA 1JFLA 3O8OB 3ICVA 2QD1A 1E69A 4FDTA 4IS3A 3O3MB 3QY0A 5EWMA 1JL3A 1E2UA 3KYDA 3UK2A 5MGBA 1EGMB 3SR4A 2FDRA 5DIFA 4CN9A 4QA9A 2HDNB 4CTNA 5F4BA 3CV3A 3DZDA 4JFRA 4WK6A 2ZSAA 3ESQA 1GN9A 3P32A 4RVDA 5CLGA 5BWBA 5B1DA 1VKJA 2BBOA 4BVAA 1T91A 3NBYC 3TS1A 3LUAA 2WR8A 13PKA 1X3LA 3Q3JB 4TKVB 2JCBA 2NUBA 3AL0C 7AT1A 2CY0A 2YV3A 1QHIA 2WMOB 1KJNA 2BL4A 1RFGE 2A5FA 4N7BA 3ZBPA 3ZWPA 4HXGA 2SNIE 4DIDA 1ECGA 4DA4A 1PI3A 3T54A 1Q7GA 3EVDA 4GKVA 4KN8A 4P2GA 4TRJA 1IBKB 3ANYB 3LPMA 2CV0A 4DJDC 3BDIA 3FLMA 4UUOA 3AEKA 1HM5A 4HQOA 4X91A 4YLYA 3W5AA 1NUAA 3GWGA 4KN9S 5ARCA 4DUYB 4PSCA 1J23A 5IYZB 4Z4GA 2UYGA 3WAKA 3T1OA 3FNIA 1Y3CE 5ARDA 4B79A 4MUYA 5LVAA 3B53X 3H7IA 4OU5A 1F0KA 3KE9A 1KZHA 2VAVA 4RFLA 3OPNA 4M1MA 4TLEA 3GI1A 1Z2NX 1TM3E 2WFMA 3PEUA 5IPFA 3ZWYA 4OQLA 3PXUA 5EINA 4D81A 3ENZA 5JATA 1E4VA 4W7SA 1E1RD 4Y2VA 2O8FB 4POOA 3GJSA 1I7QB 2ZITA 3EHEA 2CMDA 5TLSA 3OJOA 3MJRA 3NWJA 1OXBB 5LWHA 4NABA 1E5QA 1OZGA 3Q9UA 1J5PA 1O95A 1QLJA 1XZKA 1GL7A 3ILSA 3OO1A 1FLDA 4FILA 2QKYA 1I14A 1QH1B 2YWJA 3GIWA 3KKZA 2OGTA 1UDAA 4FP9A 4K86A 5FP0A 3AT1A 3IUJA 1XKXA 2GF2A 1EJBA 3IMEA 4O2RA 4QBTA 5G3ZA 3TQCA 3W79A 5K6RA 2GEUA 4C2BA 1RWQA 1GQQA 1QX4A 4MNTA 3P1JA 2FKAA 1U63A 2GN2A 3ZV4A 4RHCA 2JIRA 1T0UA 5FEMA 3R6TA 4W9RA 5JVDF 5EEGA 3O8QB 1U4NA 1V8PA 5FOSA 4DLSA 1W85A 3QNMA 4PC3A 1M2VA 2IEZA 2C2XA 2PKEA 3QLJA 4HSEA 1O4VA 4JLOA 2NUTA 2ZJ4A 1HZZC 2KW5A 3MZ0A 1X15A 1NXQA 2ACVA 1KEVA 1KNXA 2AZTA 4ZQBA 3WLHA 4CMGA 4JI1B 1AUPA 4FFWA 4DWOA 1FFYA 4KDEA 3TLZA 1GEEA 1T36A 3CNLA 1R88A 4GFDA 3JQRA 1ZMOA 2YW2A 3CY6A 4L02A 4TTIA 3VM6A 4JGGA 3DQQA 3AR9A 3QKUA 5FV7A 2I5PO 2IE8A 2OCPA 5CIYA 3AOEC 4IDFA 4O0LA 2V0CA 1DJOA 2RHJA 2J1LA 2WMDA 4IS2A 2XE4A 4KBGA 5FULA 4A8PA 1NW4A 1AD2A 2H7XA 4IFTA 3Q12A 2P35A 4U00A 2GBFA 3CA8A 5H5JA 1Y8CA 3ROEA 4F9FA 2GAJA 1ZJ4A 1SCUB 4QSMA 1PSDA 4MHSA 5I8PA 5JDCA 3IPAA 3B1ZA 2R5WA 4O4JB 2FG7C 3KWFA 3G7UA 3KBBA 3O7WA 1O8BA 1PQUA 3QPCA 3S5UA 1FTNA 3KEGA 3VR6A 5IF9A 4N8DA 2AFRA 4M99A 4AMVA 4ERNA 1YAHA 2WJAA 3BPSA 5KWEA 3T5PA 4M9SA 2R6JA 1JILA 2XTAA 1CJBA 2FW9A 2X5XA 3EMVA 4FD3A 4K6KA 1OXUA 4F12A 1QYWA 1K6IA 4ZTBA 3DZJA 1K06A 1A5BB 1NRIA 1WCXA 2J0UB 3WAJA 1R6TA 1NU6A 2CXNA 3ITDA 1SXJC 1LWNA 1Y48E 2H63A 4Q3DA 4Q4DA 5AHWA 1ZEMA 4CFYA 3HYCA 1AH2A 1N8NA 1BG6A 1K7FB 1S02A 3GGOA 1BVYF 4MCAA 1ABBA 2O0MA 2ZWOA 2HIAA 1JFFB 1QWSA 3FSEA 3Q40A 4ZMBA 2AR7A 3GAFA 2L82A 4X1KA 4YP9A 4HL6A 4JB2A 4KXFB 4HDRA 5TE9A 2H5EA 2KBFA 3FYTA 2X42A 3I1IA 1ZRNA 3OKPA 2HA2A 5AW1A 2WJPA 3L8HA 2C4MA 1N2JA 3IAS1 1RRVA 3O4GA 5EIWA 4RMIA 2XW6A 3EIQA 4BP9A 4BE7B 3H5LA 1GO2A 2MMGA 2WHPA 3PGLA 2WT4A 2MINB 1BDMA 1FTSA 4UHJA 3TCNA 2ZATA 1JI0A 3T7AA 4E14A 3FJYA 4RD4A 2G72A 1D04A 4D9IA 5K8VA 4UVIA 3BEOA 1PF7E 3DOJA 3CM0A 1EUQA 1C1DA 1KDYA 1QYDA 1ONBA 4UE3S 3IH5A 1KOFA 1OFUX 3QA3E 3SCZA 1EX1A 5BNWA 2MWMA 2FGKA 3T3IA 2G1AA 2AFVA 1OROA 5AMXA 4ZT4A 3T3OA 2VJPA 1Z35A 4KLNA 1HDXA 4MW5A 2GDZA 3B6EA 3OP4A 1NC1A 2ISQA 2C5GA 3UHFA 2ZYUX 5ABPA 4WERA 2CK3D 1VYUA 8ATCA 1N36B 2V4ZA 3P4YA 4MIEA 2H5IA 5BVGB 4QYIB 1P2FA 3RK4A 3HP4A 3ZYZA 4YMLA 4I8XA 1H23A 4FT2A 5CA0F 1UDXA 2XXAA 4TV9A 1E2MA 3O38A 3Q3CA 3UJ8A 4EF5A 5A3RA 4E5PA 5JS6A 1VCOA 3FNFA 3AL2A 1WW8A 3D6HA 2E6UX 1YA8A 1V0JA 2YVKA 4QUAA 1EFDN 4I5DA 1BMDA 2PUEA 4RA6A 2Q7XA 1GZHB 4KQ2A 1YI1A 3ECSA 3FF1A 4AK9A 2HAEA 2DFPA 3DOFA 4IHJA 4C87A 1OTXA 4MV0A 4KVZA 2B30A 1U8FO 4IDNA 4PW0A 1LEHA 2HRQA 1QR6A 5ALLA 5I7HA 4KO1S 2R6FA 4R2LA 2V0NA 4XWWA 4LDZA 1GAXA 3O94A 2FK8A 1QYXA 3DOOA 1I30A 2ERCA 3K73O 4GUDA 5KAPA 3GBVA 3AKZA 3TE6A 1CZUA 3IQWA 4XARA 4CL8A 2J31A 1Z8NA 5F1KA 2FX3A 4CQMD 1MOQA 1SBTA 2HIHA 2X5NA 1G7RA 2ZAMA 1B23P 5KB3A 3DFIA 4B5LA 3AF4A 2P2DA 3JALA 5LM3A 4FMBB 5FIUA 4ZVPA 2YDYA 4ND7A 4G5XA 2VN8A 2R00A 4OM7A 1D1TA 3FMFA 1J97A 4OHBA 1SOAA 1RE0A 3EZ7A 3HKDA 3M70A 4D8XA 2FSUA 4KHPB 2BEUB 3GRKA 1D0VA 4AS2A 4JR2A 4RL6A 3LY8A 3DE7X 5H81A 4YQFA 4ZDWA 5KX5A 2BVNA 1JLSA 3TD2A 4DIFA 1TFRA 3OJXA 4NQRA 3B85A 3MPUA 4UAJA 1Z75A 4AY3A 5IAOA 1J06A 3SWWA 2BFDA 4LFCB 2PJZA 1T4DA 1TJ4A 1T8SA 2ONKA 4W82A 2IHZA 3PG5A 3SR3A 4KE7A 3W8DA 5CJ2A 3M6UA 3BGOS 3EMKA 1FCJA 3ML1A 5B57C 3KXDA 4GSKA 2ZYAA 1G8MA 1EGAA 1CUEA 2G9UA 2RGBA 3GLHE 4ZVLA 1SH7A 2X0NA