4QQRA

Structural insight into nucleotide rhamnose synthase/epimerase-reductase from arabidopsis thaliana
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
284
structure length
274
Chain Sequence
b'SFNFLIYGKTGWIGGLLGKLCEAQGITYTYGSGRLDRQSIVADIESVKPSHVFNAAGVTGRPNVDWCESHKVETIRTNVAGTLTLADICREKGLVLINYATGCIFEYDSGHPLGSGIGFKEEDTPNFTGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLTNPRNFITKIARYEKVVDIPNSMTILDELLPISIEMAKRNLTGIYNFTNPGVVSHNEILEMYRDYIDPSFTWKNFTEPRSNNELDATKLKTEFPELMSIKESLIKFVFEPNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3,5-epimerase/4-reductase
publication title Structural insight into nucleotide rhamnose synthase/epimerase-reductase from Arabidopsis thaliana
rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 96
structure length 274
sequence length 284
chains with identical sequence B
ec nomenclature ec 1.1.1.133: dTDP-4-dehydrorhamnose reductase.
pdb deposition date 2014-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4qqrA00
3EW7A 4PLTA 3D4PA 1J6UA 4OXNA 2B5VA 3BMCB 1VSVA 4TKMA 3DXFA 4RJTA 3WS7A 4GWGA 5A9SB 1B8UA 4XQCA 1NVMB 4FSHA 4EITA 3GUCA 2GN4A 2NU6A 3O9ZA 4XX0A 3ZW9A 2Z1NA 2D8AA 2VTEA 3D5QA 2P4HX 4JP3A 3WNQA 5IDQA 5CDTA 5JAQA 2W2LA 1CF2O 3C7AA 1CWUA 2JCYA 1B0AA 2ZQYA 4XYLA 1MC4A 1V9LA 4ZRNA 4R1SA 3K5PA 4DVJA 3IIEA 1HZZA 4CMBA 2I9PA 5JCXA 4YJDA 1BWSA 4LMRA 4EW6A 1HDXA 3WGIA 3NEPX 1XR3A 3ULKA 2B4QA 4U5QA 4AG3A 5ADHA 1GV0A 2O7QA 4GVXA 2D3TA 5HS6A 3EAGA 4UVHA 5EQFA 2OHXA 5G0VA 1KC1A 4BB6A 2Q2VA 5JAZA 2NACA 4E13A 1T2CA 3NDJA 4PG5A 1GEEA 3UW3A 1DB3A 3S2FA 1E7RA 1WP4A 5TQVA 3BYZA 2TMDA 1T1RA 1XHLA 3HB4X 2O50A 2ZK7A 2HSDA 5L4NA 2QZ9A 3BXXA 2J6IA 4Q3AA 3LT2A 3PJGA 5U9CA 3JYPA 1C1DA 3JQAA 4GSKA 1I32A 4Z0HO 3DBRB 3GPDG 4RZHA 4O6VA 3RD5A 3DOOA 1HTBA 1E3SA 5EIOA 3E9MA 4PZEA 1NQAO 2RHCA 5H83A 3SJ7A 4DYVA 2BLLA 4MINA 4D42A 3D3WB 3ZWWA 4ZQFA 1YBAA 3ZHXA 1LDGA 3W4KA 2P2SA 1H94A 3C1AA 2XPCA 4AJ2A 4BKQA 3PHLA 3I83A 2HJSA 3DMYA 1EUDA 1YL7A 1EK5A 3GDOA 1EMDA 4IQGA 4IJKA 4QX6A 5H82A 4RVUA 4HADA 2BMAA 4D3FA 2X9GA 1Z6ZA 2JAPA 1PGJA 3AUTA 4IJWA 4CMKA 1E92A 4DREA 2X22A 4ESOA 1PEDA 4QSMA 3RU9A 1NP3A 1TB4A 3PQDA 4BUCA 3RUDA 4A27A 2QX7A 3AU8A 3QY9A 4K1LA 1PJLA 1GAEO 1V8BA 3SLGA 2X0NA 1WXDA 1SBYA 2JL1A 3GNTA 4K6FA 5ENDA 2NVUA 5BSGA 3HN2A 4KQWA 4BMNA 1E7WA 4D3SA 3GMSA 5J23A 3OQ1A 2PKRA 4Y6SA 2IE0A 5TNXA 1YDWA 4H16A 1X0XA 4FGWA 3H8VA 1EBUA 2W2KA 4RLHA 1M76A 3PP8A 3QJ5A 1JN0A 4KUGA 5FWNA 4GMFA 4PG7A 5KKCA 2RIRA 4UULA 5LDGA 3TSCA 3DAPA 3CPSA 5L95A 4IDAA 3VVBA 1YOVA 4IS2A 3PIDA 2EWMA 4R01A 1B3BA 3AI2A 4FJ1A 2RH4A 4RVHA 2EIHA 2YHUA 3WNVA 4DWVA 3WTBA 1HF3A 3RWBA 3MTJA 4J7UA 4CM5A 4DPMA 1A7KA 1YH3A 1X14A 4E6PA 4QTZA 2WD7B 5T8KC 3NT4A 4WLUA 5TF4A 5G0TA 3CH6A 4C7JA 1DIHA 1JAYA 3ZV4A 1SB8A 4XDYA 4ZRMA 1BGVA 4BNKA 3G1TA 3GDGA 4O5OA 4EUEA 3QW2A 1QYDA 2Y1CA 4I1IA 5HBRA 4W82A 4ND5A 2VRCA 3Q6IA 5G0WA 3B6ZA 1GZ3A 4NH4A 4ZHSA 3SX2A 2QG4A 3ITKA 3ABIA 3C1OA 1OOEA 1E7MA 3GR6A 5CEEA 4WPGA 1N5DA 3DWFA 2HMSA 4NFSA 3UKOA 1LDYA 4PLWA 5BNTA 3F4BA 4N5NA 5JW6A 4OSPA 1EE2A 2QZZA 3AK4A 1E3WB 1HZJA 3PHJA 4GI2A 3ZNNA 3RBXA 1X1TA 1DEHA 1K6XA 2IZ1A 3DFUA 4EJ6A 4OH1A 4XJTA 2WYUA 1PS0A 3PJDA 3LVFO 3ZI0A 1L7DA 1QYCA 2WMDA 4K28A 5JCJA 1B15A 3WX0A 5IN4A 1IE3A 2O3QA 4ALIA 2HU2A 1UH5A 3QE3A 3DBLB 1JQBA 3QP9A 4WLVA 1Y8QA 4GL4A 2YV2A 3WWZA 1V3TA 4XQGA 5K6AC 5KVCA 5F1KA 3MJEA 3HB5X 4NPCA 2X4GA 4R4JA 5H81A 5TT1A 4E30A 2V7PA 4BO9A 1R4NA 2NVBA 4DYDA 1KEUA 2GRAA 3F9IA 4S3MA 1SAYA 3H9JA 5KVSA 1LC0A 1MG0A 1RYEA 2J5QA 2X5JO 3FF4A 3FWNA 1NNUA 2Y05A 3CZMA 3VKUA 2D59A 3M6IA 2EGHA 3ZWAA 5JFOA 1ENZA 3NAQA 4BGEA 4BKPA 3H5AA 1ENPA 1T4BA 2EXXA 3Q9NA 3FPLA 4YQZA 1X15A 2I6TA 4HFRA 1LLQA 5G0SA 5IF3A 2B69A 4RORA 4IM7A 1XU7A 4HFNA 3RQSA 1WDLA 3QVWA 4FD3A 1KVRA 1HYHA 1XDWA 4O63O 3PGJA 5BNIA 4ZQEA 2VRBA 3IS3A 4XB1A 5BSFA 1KVQA 3LSYA 1QXSA 4UVIA 4BOYA 2F1KA 2JCXA 3LYLA 3HFSA 3K96A 3JV7A 3WBBA 1EQ2A 3GK3A 1H6CA 1OI7A 3OA2A 1E3IA 4PVDA 3PVZA 3TZQA 3ZCXA 1SOWA 2AEMA 2P5UA 2GASA 3PLRA 3WGQA 3AOGA 3R3SA 1HKUA 4IMRA 4K6CA 5TJHA 4B79A 1YE3A 3E9NA 1LLDA 2V6BA 1ZW1A 3PZRA 4H15A 4D44A 5L51A 2Q99A 3JD0A 4L4RA 2JFHA 2X5OA 5A03A 2Q1SA 1U7TA 3GZNA 1QORA 1MXHA 1Z7BA 2YFQA 3AW9A 4HV4A 2FWMX 1DC4A 1V3VA 5I7SA 2I3GA 1JWBB 1R12A 4FFPA 4XR9A 1ADFA 1EZ4A 1HYGA 1CIVA 4YJGA 1SNYA 4XEHA 3U5TA 3ZHBA 3M2PA 5TRTA 3M1LA 2Y68A 4H7PA 1GYPA 3JD2A 3QHAA 4WLFA 4CQLA 1ZXBA 3AU9A 5IZ4A 1U3TA 5ILOA 2FPGA 4BV8A 2RH8A 5JDIC 1LSJA 1MB4A 4TRMA 4MP6A 4WCFB 3Q2KA 4Q39A 2VOEA 4YT2A 1KVTA 2Q4BA 1DXYA 1T1SA 2CFCA 2WSBA 3GGGA 5CDUA 3DBHA 3JQCA 3F5SA 5F1PA 3PYLA 3JQFA 1PS8A 4PFJA 1P1RA 3JTMA 5JO9A 1UAYA 4BNZA 2NQTA 3ZWPA 2Q49A 1X1EA 2X8LA 3VAZA 4I8XA 4AJNA 3JQGA 1ZK4A 3VPXA 4XJSA 4ZD6A 4ZU3A 3U4IA 2FSSA 1DIRA 2I76A 4CMEC 1NASA 4A26A 4TVBA 4BO1A 2GZ3A 2G0TA 2H5LA 1DDOA 1O0SA 4NK4A 1ZBQA 4W99A 5FYDA 3VHRA 4YT4A 1LJ8A 1YVEI 5ENVA 2FPIA 4P4GA 2UUPA 3MJSA 4MVJD 3C7CB 4CM4B 3JQ9C 3GVHA 4OIMA 2NNLD 4GVLA 2Q46A 2HK7A 1E7SA 1NHWA 4DA9A 5IXSA 1N7HA 3DQPA 4FOSA 1XELA 5JY1A 3W4IA 3QVXA 5TC4A 3Q9UA 1R15A 2O23A 1P33A 5EPOA 4EEZA 3R6DA 3OP4A 1UXKA 2PWZA 4UUPA 2E4AA 4I9HA 5CPFA 2ZTVA 3FRJA 5AXCA 1DJNA 1H9BA 3RFXA 3AUSA 4Y67A 2AE2A 1KOLA 3C24A 2C5AA 1ONOA 4IGEA 1ZK3A 1UXIA 1RYDA 4BKOA 4MIEA 1QYVA 2IEDA 4UREA 3EY4A 1EVJA 1P77A 2IZ0A 1WZEA 1I2BA 8ADHA 4U6SA 4MJLA 1RKXA 1I2ZA 3GN2A 3N7UA 3HDYA 1SC6A 1XLTA 5MDHA 5KJ6A 3JYQA 3I5MA 4BO0A 1ISFA 1KERA 2DC1A 3WGOA 1TA4A 2D0IA 2VHXA 3KM0A 4PLYA 3F1LA 2GSDA 5FFFA 1BTOA 3WLEA 4U0JA 3EGOA 4R9RA 2O3UA 2B4TO 1C1XB 1ZEMA 3SC6A 4MVJG 3UCFA 4OJNA 1UAGA 4RPGA 3OA0A 3PTZA 5I7EA 4CUJA 5TJ9A 4DLAA 2GR9A 1UZNA 3V2GA 1LSUA 4LGVA 3WIEA 4OM8A 4NU5A 4GGOA 2WTBA 2EERA 3GG9A 2NTNA 3RVDA 3QWBA 3C1TA 3LZ6A 1AXGA 2W98A 3RAJA 4A7PA 4BMVA 4FC7A 5AXAA 4YJHB 1TI7A 5KWEA 1CQIA 1YS4A 4FJ2A 5G4KB 2G5CA 3KEOA 1UZMA 3JD4A 4NMHA 4BKUA 3ZGYA 3GH3A 3D3WA 4M1QA 2YHIB 2AQKA 4GMGA 1E5QA 3PPIA 3OIDA 1PGOA 4E2YA 4PLGA 2EKQA 2WWRA 3KSUA 1MG5A 4FS3A 2X5KO 1UDCA 1B26A 2CF5A 4JLWA 3L0DA 1F12A 1H0KA 4WNCA 1I24A 1HDOA 3DR3A 2FR0A 1ZVMA 2GLXA 2JCVA 4JIGA 4FFRA 4AJEA 5B37A 3FNGA 3BHIA 4DBZA 2A35A 1AGNA 4B4OA 1E6WA 3WGZA 4Z9XA 2EJWA 2OO5A 1ZJZA 1BVUA 4P38A 2EV9A 1VL8A 1DFIA 3AUUA 1HDCA 2QW8A 2QIOA 4BNWA 1BHSA 4KUEA 2VYND 4J49A 4KUHA 1EQUA 4ID9A 3QVSA 3JQ7A 1XWFA 4FB5A 1PL7A 2A9FA 2Y93A 4ZA2A 2C20A 1GCOA 4Z0TA 1VI2A 5JXWA 5COAA 4B8ZA 4BNJA 4RPLA 2X1HA 1BDBA 2PD3A 1G1AA 3H2SA 2HKIA 3B1JA 2ILTA 1KEWA 4IQ0A 4IXWA 1RM4A 3HDJA 1DHTA 2IYPA 1RM3A 5A9TA 1HE3A 4XYEA 4IDCA 3BMNB 4OL9A 3ZV6A 2BFOA 3EZYA 3EHEA 3HJAA 1Y6JA 1IL0A 1DAOA 1PR9A 2FZEA 2PZKA 3ENNA 4KTVE 5GZ6A 3TWOA 4CLRA 4IJUA 4M49A 2WD7A 2C7VA 3W6ZA 1ISIA 1A27A 2VT2A 4CR6A 1O89A 1ISGA 4E4YA 5F5LA 4EI2A 1DHRA 1Z45A 4DGSA 3O26A 3F3SA 4FPXA 3V8BA 3OICA 4BHTA 5CFZA 4ZQGA 3ROQA 1PJ4A 2HK9A 2DUUA 4XWYA 1N8KA 1NAIA 2ZTLA 1XG5A 3NDIA 2ZTMA 3ETGA 5CPBA 3BHMA 4DLBA 4KZPA 3P7MA 1GZ6A 5JMWA 4KDEA 2WM3A 5ITVA 2AQ8A 3CE6A 2PTGA 5JE8A 3ZWMA 3K31A 4E0BA 5ICSA 4N5MA 5GZ3A 3KLMX 2IEBA 4AJ4A 4DIBA 3VZQA 4YJFA 3OF2A 2JHGA 3ETEA 2PD6A 3O03A 4MKXA 2OBNA 2PY6A 4KTTE 2NVWA 3B1KA 3IUSA 3LF1A 3AM5A 2X9NA 5A04A 1KVSA 4IPTA 4JNKA 4GAEA 4XA8A 3H3JA 2VHVA 1CEQA 4L4XA 2EG9A 4BL5A 4DIFA 3BMQB 3AFMA 1IOLA 2P9CA 1LSOA 3ANNA 4UVGA 2C07A 4GX0A 3TF5A 3INTA 2GN8A 2XXJA 3H2ZA 4GQAA 3VDRA 4DRYA 3WLFA 2VWHA 1VE9A 2ZIZA 5JBIA 1G0OA 1KEPA 1LSSA 5CP8A 3TOXA 1IZ0A 3C7DB 3KOUA 3OQ6A 2VQ3A 2CDCA 1XGKA 3ICPA 4YAGA 3RBZA 3PZBA 3LDHA 4E2WA 1A71A 3PJEA 4TZKA 3H9UA 4EYEA 4Q9NA 3WDSA 1K6JA 4MDHA 4D43A 3EUWA 1PQUA 3D4NA 4L4SA 1X7HA 4GKBA 5B4TA 4TSKA 1O94A 4ZQHA 2VWGA 1ZK1A 3GVIA 3VVCA 3H6KA 4H3VA 4AJ1A 2EGGA 4GBJA 3E5RA 4YXFA 1DRWA 3MJCA 4J1QA 4R5HA 1SOVA 5JO0A 3AM4A 5L3ZA 1J5PA 1SB9A 2HUNA 3IKVA 4HFJA 5IDXA 1HE5A 1I30A 4AJOA 4ILKA 3FI9A 5BSEA 3PYXA 1X13A 4E32A 2XOXA 1F06A 4OOEA 2WJPA 3KYDB 2H63A 2NU9A 1YWGO 3ZZNA 3PWKA 4XCVA 4R41A 3E48A 2Z1MA 2DUWA 1JDJA 2ZATA 4IY1A 1K3TA 5DOZA 3LQFA 3TZ6A 4NHEA 4EEXA 3MCVA 1ISMA 5DNAA 2PLAA 6LDHA 3ZHZA 3RUIA 2DQ4A 4XQEA 4D7AA 1MFPA 2BELA 3JD1A 1VJ1A 4DBVO 4CODB 1C0LA 3SC4A 3X2EA 4ALKA 3BMOA 1H2BA 4EBFA 1K6IA 5F1OA 3ZWXA 1PU2A 3D0OA 5CEJA 1UDBA 4IGFA 3INRA 2C7GA 2CVQA 4R54A 2OOSA 4JBHA 1TT5A 4PLHA 4CR8A 1NX6A 3K73O 3M2TA 4D79A 5KVQA 4IJVA 1A9ZA 1F14A 3AY3A 3SBOA 5BR7A 1PZGA 4RVDA 3F46A 1R37A 1DBVO 1MP0A 1U5AA 4RLSA 2Q2QA 2X58A 2RBEA 1DOHA 3TRIA 3WFIA 1HT0A 3RASA 5L4SA 4YAKA 4F45A 3KEQA 2NLOA 1FDVA 3ST7A 4J6FA 3ZU4A 2GDZA 3W8FA 5AXBA 4RO0A 3E9QA 5AXDA 4FFOA 3UHAA 1PL8A 4II2A 5A05A 2UUOA 1HDYA 4J16A 2NUAA 1SMKA 1Q0HA 3FNFA 4RCVA 1D8AA 2UVDA 1U2GA 3NT2A 3PK0A 2BI7A 2H1SA 2Y1OA 1ML3A 3KYCB 1PWXA 4R5MA 3Q3CA 1DFHA 5CG2A 1PGPA 2G17A 1E5LA 4LMPA 4LRTB 1QYXA 2WDZA 1DRUA 2X86A 2X0RA 2J3IA 3GMDA 4RL6A 5MGBA 4B4WA 4BNGA 1JAXA 2J5KA 3I9KA 3FHLA 4MKRA 1KIFA 2G82A 3F47A 3NGLA 1LLCA 3RC2A 4BNYA 2HMWA 3A4VA 4UVEA 5U1PA 4YVFA 1E3EA 3B20A 3PWZA 2FPPA 4P22A 1PZHA 3KYBA 3GGPA 4KQXA 2XAAA 4E33A 5L7TA 2J5RA 3FTPA 4OXKA 4BO4A 3PYMA 4IDBA 2PZLA 4RQUA 3ZHYA 1MFZA 4DL9A 4MIOA 3DAFA 5CEFA 1V35A 4R51A 3HDHA 1NWHA 5DOVA 3H9QA 1JKJA 3PQEA 4Y6RA 4BS9A 5AYVA 1GFSA 4IDDA 4L0QA 4O0LA 3AOEC 4UEOA 1L1FA 3TDKA 1RJWA 1XYGA 1U4OA 3OHSX 5G0UA 4L9RA 4IQ8A 3VZPA 2NSDA 1N1EA 4UUOA 2ZYGA 4CMHA 1BW9A 4L74A 3ZWCA 1GUZA 3CZRA 3D7LA 3DMTA 4YA6A 4NJMB 1O9BA 4R16A 9LDTA 2R00A 3PDJA 5HA5A 2Y1GA 4GKVA 4W9NC 2B0JA 4JGBA 3SXPA 4JN6B 1ZK0A 4UUNA 3FSRA 3KLPX 5LC1A 3A1NA 3SJUA 2RHRA 2VN8A 3BHJA 4OO3A 1H6AA 1YQGA 2E49A 1LC3A 3W8DA 5CAEA 2OZPA 2IZZA 4CM9D 2W90A 3JQFC 5I9MA 1XQ6A 2HCTA 4S1VA 4W6ZA 4BO7A 3JQEA 1LA2A 1PJTA 2CVZA 4YPOA 1AN9A 1EEHA 1FDSA 1OAAA 2EHDA 3NDRA 4WOJA 3TNLA 4YT8A 5B4UA 4YDRA 5TLSA 1P45A 4OXYA 3OIGA 1GUFA 4R68A 3WMWA 5HWSA 1JTVA 4EZBA 4BO3A 3JCZA 3IC5A 1FDUA 3O38A 3OJFA 3KVOA 4FOOA 4PG4A 1PQPA 1K0UA 3DHNA 5KVVA 4PLPA 2PGLA 5IDWA 5JMPA 5CDSA 2VYVA 2ZYAA 3HFGA 3U0BA 3KHUA 4IBOA 5ER9A 3QVTA 3PDUA 4Z9FA 2UV8A 3LT1A 5G4LA 2YZ7A 3F6YA 5C7IO 1KY5A 2NTVA 5AOVA 2AW5A 4BGVA 2IODA 3P2OA 3U9LA 3DOJA 3IUPA 1JVSA 1YBMA 4J9VA 4PIVA 4YJHA 2AA3A 5G4KA 2HQ1A 1WMBA 4R69A 4WE3A 4U8GA 4DQXA 4AJIA 3IKTA 1ZMOA 4XDZA 3RI3A 1UXJA 2AE1A 4LCEA 3QSGA 1ISHA 1BXGB 4WGGA 3UAGA 3NRCA 4GX2A 1FF9A 1P1IA 1WW8A 3I23A 3PHHA 4NDNE 2GCGA 5I9LA 1UJMA 1ZZEA 4RVFA 1F0YA 3H9GA 4GPD1 2JJYA 4ALMA 4W7HA 2BD0A 3WQSB 2FY8A 3WGTA 3FTNA 3UVEA 4UAGA 1EFLA 3CIFA 4CLOA 1EFKA 4IDGA 1FXSA 5DULA 4LRSB 2OXIA 3BTSA 4CUKA 4E2XA 3ROMA 4NBUA 2H9IA 4ROSA 3ASVA 4X54A 2LDXA 3ROKA 5IZCA 2Z5LA 3ZDFA 3IMFA 3QLJA 1QLJA 2OBYA 3DO5A 1N9GB 2O3RA 4M8SA 1P1FA 4RDHA 5A06A 1Z7EA 3VH4A 1EVIA 4ZN6A 1LDBA 3STHA 1GEGA 1BMDA 1MX3A 3RUFA 5KIAA 4D45A 5KJFA 3H3FA 1VC2A 3BMNA 3TFQA 2GD1O 3I52A 4G5HA 2FN7A 3LLSA 3TPCA 3TZCA 3JQ6A 2AQHA 3BIOA 4HBGA 2C2XA 4CMIB 1QMGA 4I5DA 4LVUA 4CQMB 4D0RA 3MJ4A 2DAPA 3HSKA 2ZYDA 4TMFA 3GF4A 3RJ5A 1GYRA 4I9NA 3GEDA 3KUXA 4BV9A 1A72A 3MEQA 3C8MA 2Q50A 3JQDA 4G81A 1BXZA 1J49A 2O3TA 4CPDA 1XU9A 4BNLA 1ADBA 5CHEA 3S2GA 3WJ7A 1LI4A 2CZCA 4QFDA 2Y1DA 2YV1A 3I9MA 2HO5A 3OEWA 4XYMA 2DBZA 4DPLA 1YB5A 1WMAA 3E8XA 3ZU3A 3RU7A 4A5OA 4I08A 3LU1A 4GLOA 1EVZA 3GRPA 3TOZA 2WYVA 4R3NA 2DPGA 4NNJA 1YGYA 4I5EA 1Q2XA 3ITDA 4E5MA 4J7CA 2NQ8A 2C2YA 3LT4A 3GEMA 4YTEA 4NBWA 1PS9A 3JQBA 2EKLA 3K2EA 4XZ3A 3RIHA 3SLKA 4YRBA 3FNHA 2OORA 4UEKA 4BO8A 4ZJUA 1MXFA 3UCXA 3F4LA 3QWHA 4A2CA 4BQRA 1YKFA 4DC1A 1P9LA 4MVJE 4YQYA 5EERA 2YUTA 2D5AA 4HNGA 3PFFA 8LDHA 4CM1A 1ID1A 1V6AA 3DONA 1QV6A 4C4OA 3PEFA 3CUKA 1X7GA 1LDMA 3TN7A 1MGOA 1R0SA 4KWHA 5JS6A 3W4JA 2PGJA 3LC1O 4NFHA 1R4MA 2X0IA 2XXBA 2J8ZA 2I99A 3ZNPA 4JP2A 5A9RA 2VNSA 4MIYA 2GO1A 5IFLA 3HE3A 1UXHA 1Z73A 4NK5A 3IJRA 1YL5A 1VPDA 1AUPA 4YB8A 3DOCA 2X7HA 1B2LA 2ET6A 3GRKA 3G0OA 3PXXA 2JFGA 2DLDA 4FFLA 1A4IA 3OETA 3B70A 4NBVA 4DMMA 2CDAA 5ES3A 1D4FA 1PSDA 1ZSVA 4MKZA 1DIBA 1NFFA 4FC6A 1VKOA 1DC3A 1ULSA 5B12A 5JPIA 1Y8RA 1FMCA 3A06A 1WLYA 4NR0A 4YRDA 1Z74A 4LVCA 4XIJA 5TGDA 3U3XA 1C1DB 3JQAB 4TZTA 4YAEA 4CQMD 2O7SA 4B3HA 4L75A 3ROPA 3KZVA 3MJTA 4EUFA 5I8WA 4PN3A 2J3HA 3JQ8A 4HP8A 4DC0A 3WGHA 3N74A 1LRLA 1I3KA 2ZB7A 3O8QA 2NU7A 1QP8A 4A73A 4J43A 4CM3A 3E1KA 3KYDA 4CM8A 3P19A 4J2HA 1P31A 1ISJA 4CMIA 3G1UA 4YAIA 1E7QA 4B7XA 3G49A 5T5QA 3D5TA 1CERA 1Q0QA 3HQ4O 3BMCA 4PLVA 5JC1A 5KCZA 1NQOA 5HRUA 2VHWA 3MWEB 1I3NA 4HKTA 5A9SA 3I6IA 5DDIP 2NU8A 5ITWA 3A9WA 4CM6A 3A28A 1H5QA 1I0ZA 2PNFA 3D1LA 3ONFA 2DTEA 4EJMA 1VM6A 1VSUA 2VHYA 2AQIA 2ZB3A 3DFZA 1NVGA 1PL6A 4JBGA 1BRMA 2DM6A 5A5FA 3ADOA 4IDFA 4BMSA 1M67A 4DLLA 1CRWG 2W2LD 3PFWO 2NVUB 1QR6A 1DSSG 3E03A 4U7WA 3GHHA 3W6UA 1ZMTA 1MLDA 1WAMA 2VWPA 2QQ5A 3WQRA 3JYOA 3L4BA 3T7EA 2FR1A 3DHEA 3V1TC 2B4RO 2W2KB 4PGFA 1E7YA 1BG6A 1H6DA 4OKIA 4OQZA 5T64A 1SEPA 4HUJA 5JDCA 1ADGA 1JLLA 3QWIA 1P0CA 4U0KA 1YOVB 4XGNA 3RC9A 4FDAA 1LDNA 5A3VA 4TQGA 4QEDA 2JD0A 3DZKA 1JKFA 1I8TA 1HYEA 1CETA 5IN5A 5A1TA 1SEVA 4J9UE 4YEDA 1TVEA 3BTUA 4CR7A 3KV3O 2Y67A 4RF2A 3L6OO 1XQ1A 4B8WA 3UXYA 3QRWA 1HLPA 1S6YA 2NV6A 4DIOA 2BGMA 5FI5A 5EINA 4IMPA 3N58A 3HADA 2FOIA 3DBRA 4MP8A 3JQAD 2HK8A 2CF6A 5EL0A 4N5LA 2BKAA 4NZ9A 1I36A 2BH9A 4MVJF 4P8RA 4KDFA 2JHFA 4EJ0A 2QRKA 4JXKA 1TXGA 2OP1A 4WCDA 1XA0A 1PR3A 4ND2A 4R1NA 4IIVA 3U4HA 2V6GA 2Y0CA 1EVYA 4ITUA 3ZH2A 1IUKA 5CDGA 1GTMA 3R3JA 4DQUA 2RCYA 3FN4A 2NM0A 4LN1A 3U4CA 1W73A 3Q11A 2PH5A 4DMLA 3ON5A 1Q7GA 4JJFA 3E82A 1QG6A 2QRLA 3HZZA 5DT9A 4CV2A 2D4AA 4HXYA 2B5WA 1U3VA 1JKIA 3H4VA 1OFGA 4YYZA 4FR5A 1Y8QB 4YBZA 3UUWA 4I5FA 5DCUA 4BO2A 1Y1PA 4YCAA 2D2IA 3K6JA 1ZKMA 3HHPA 1DO8A 2Q4EA 1IY8A 4QFCA 6ADHA 4OSOA 1OC2A 4XYBA 2BF7A 2OL4A 1YL6A 4AVYA 3TFOA 1R4NB 2C5EA 4MVJI 4J1NA 1P44A 4RF3A 4AL4A 4E2ZA 1NM5A 1H2HA 2I66A 2DBVO 2O4CA 1EUZA 3NTRA 3OMLA 1Y5MA 5AQ1A 1ZNQO 2NADA 2CMDA 3NT5A 3GY0A 4MP3A 4O1MA 5L7WA 2GPTA 5JDIA 1PX0A 2OP0A 4II3A 1T26A 2J3KA 1HSOA 3JYNA 4WKGA 5C7LO 1UXGA 1L7EA 3WICA 4OQYA 1R16A 3ENKA 3KRTA 1G6KA 5TS3A 5I7VA 2AEFA 4Y8VA 2IDZA 1CDOA 1P0FA 2HJRA 4U6QA 3G3EA 3FD8A 3WBFA 5T57A 3DEYX 5KJCA 4ALNA 1CJCA 4C7KA 4OAQA 5A5EA 1D1SA 5JYEA 2PA3A 1I3LA 4XD2A 4CMCA 4WEOA 1GL3A 2R6JA 1LEHA 3WB9A 5LDHA 4B7CA 2VRCD 1RPNA 3VZSA 1IYZA 4D41A 2YJZA 1KVUA 4J4HA 4TRRA 4ALJA 3RCBA 2AXQA 4KMSA 1M6WA 2V6MA 3PGXA 4DQVA 5A4DA 3HUDA 3U62A 1PJ2A 1PIWA 3EDMA 4PG8A 1E3LA 1E3WA 5DBIA 3HNPA 3EK2A 3GUYA 1IPFA 3I6QA 4MOWA 1RM0A 3GZNB 3Q0EA 2ZKLA 3NYWA 3ONEA 1NPDA 1U7HA 4DXHA 5JCJD 3DBLA 1HL3A 5LCXA 4F6LA 2DU8A 1H9AA 3GAZA 1NPTO 3K92A 4YJGB 3AI3A 3GC6A 1AHHA 4BGIA 1B3RA 1RM5A 4G65A 2A94A 2ZJ1A 3GVCA 3PLNA 4QECA 1K2WA 4CQLB 4CV3A 1NBOA 4FQ8A 4G2NA 1G0NA 4Z3KA 4MVJP 1N7GA 1PQWA 3PIIA 5C3MA 1IZ9A 1HDZA 3PWSA 1I5RA 1FDWA 5IDYA 4ALLA 1D3AA 5EESA 3QWFA 3SEFA 2Y1FA 1GD1O 3RUCA 1HDGO 1QKIA 2UAGA 1TEHA 3I4CA 1WPQA 2HDHA 3FR7A 3DBHB 5I8ZA 1VLLA 1U5CA 3V1UA 3LT0A 3TZKA 3MOGA 3VPFA 5BQFA 1A7AA 3L9XA 1Y9AA 7ADHA 2VUSA 5I7FA 1U28A 3ZWOA 3M1AA 4XYGA 3BZUA 1N9GA 2B83A 3AM3A 1VJTA 2WYWA 2YW9A 3IQDB 2AG8A 4W7IA 1DC6A 1U8FO 1ZSNA 2BFAA 4BB5A 2C82A 3ZU5A 4YRAA 3L6DA 1P1JA 2DPHA 2PFGA 1UP7A 3JQGB 3OECA 1ENOA 2Y1EA 2GGSA 1YJQA 1OMOA 1WDMA 4MVJM 5DBFA 1LBEA 2NWQA 3TZHA 4RVSA 5T67A 3AJRA 2ZQZA 4J4TA 1GU7A 2JD1A 4URFA 1NFRA 4EDFA 3S2IA 3WTCA 1P3DA 3BTVA 2ZCVA 4BGUA 4MVJA 4IS3A 3GDFA 4QXMA 3E18A 2YYYA 3CINA 1HSZA 4N7RA 1WNTA 3L07A 4N18A 3S2EA 3WOHA 2EF1A 2DVMA 4FW8A 3PHGA 3ANMA 2BGLA 1HETA 1E6EA 4RPHA 2CSUA 3DHYA 1Q7BA 3V2HA 4PZDA 4FJ0A 4PLZA 1B8PA 2HLPA 4J1SA 5L53A 2QYSA 5DBGA 3AFNA 2C54A 1LUAA 1ZIDA 2AEJA 4JK3A 3HDQA 2ZCUA 5JY6A 1YDEA 3CXRA 2D5CA 4DPKA 1GADO 1GYQA 2O48X 3I3OA 3QV1A 5FI3A 3VOSA 2B36A 1HE2A 4Q3DA 4OHUA 3RUHA 2AHRA 4FFMA 3OIFA 1GV1A 1JVBA 1HXHA 1HDRA 2CVOA 2BFMA 3X2FA 3EC7A 1KBZA 5KJEA 3ADPA 3OH8A 5BSHA 4WCFA 5IZCC 3GAFA 2GERA 3NKLA 2P5YA 3U49A 2CY0A 4AFNA 2ZJ0A 1RWBA 4TRJA 3ANLA 4RF4A 5COQA 3EYWA 3DZHA 4KP7A 1A9YA 2WD8A 3ETDA 3OJEA 3UGKA 3VKVA 1DRVA 3EMKA 3IDSA 4WJZA 4GGPA 3UF0A 3WXBA 4M89A 4WASA 3WMXA 4CL3A 2VOJA 1YQDA 5C37A 1PGQA 2DFDA 3UN1A 2FRDA 2EJVA 4XIYA 1ZFNA 2Q2WA 4IINA 4IZHA 2LDBA 1HRDA 1NXQA 1YQXA 3K9QO 3P2YA 1PGNA 2IRWA 1XSEA 4CJXA 2VT3A 1KETA 1IULA 4M86A 1EBFA 3H9EO 4OOFA 4AJLA 1N92A 2HMVA 5L40A 1ULUA 4QO8A 4AJJA 4RF5A 1ZH8A 2VUUA 5HTOA 1GUYA 3NX4A 4CM4A 1YB4A 2VZ9A 4RGBA 3UH1A 1PWZA 3V5NA 1WZIA 1YO6A 1E0DA 1CYDA 1U4SA 4DTIA 1GQYA 4FBGA 2NTJA 1ZCJA 2JAHA 2Q1WA 3RFVA 2PGDA 2YQ5A 5DCYA 5DZSA 4WEQA 2O2YA 3JQBC 1M66A 4J3FA 3DAGA 1LNQA 4BNFA 1FJHA 2Y66A 3DC2A 3MZ0A 4TWRA 4A0SA 4BO6A 4CLXA 3CMCO 2VYNA 1NHGA 1DIAA 1LU9A 1T2EA 4M87A 2FHSA 1NVTA 3I9NA 3W8EA 4RPJA 5L45A 3L77A 1W6UA 5THKA 3WSVA 2FR8A 1ZXLA 3JQ7B 4PVCA 1ZUD1 4D3DA 4XGKA 3ZWNA 1YXMA 3FWZA 4QQRA 5EJ2A 2OUIA 4Y6PA 4GX1A 4LISA 2FZWA 4KWIA 1Y5RA 1YBVA 5DN9A 2HMTA 1IPEA 2CD9A 1GPJA 1W0CA 4PLCA 2EEZA 1M6HA 5TT0A 4Z0PA 1NTOA 1U1IA 4BNUA 4WLOA 1T2AA 2X0JA 5THQA 1B7GO 3GEGA 3TL2A 1C1XA 1Q7CA 1H6BA 4CLRB 1LRKA 2E37A 3F5QA 4QUKA 4Y98A 3RKUA 1P74A 1VL0A 2HRZA 3WG9A 1Z75A 3CMMA 4JCOA 1WWKA 1KEVA 4J0FA 2UYYA 4BNVA 2CDBA 1O6ZA 1VRWA 5HM8A 2CUKA 9LDBA 1KC3A 1V3UA 1C3VA 1ENYA 1LTHR 4E5KA 3ICCA 4RDIA 4MO2A 2YHIA 4E5PA 1WVGA 1FDTA 3Q2IA 3L4SO 4IZIA 3RBVA 3H65A 4NU6A 1P1HA 1YRLA 1PJBA 4NJOA 3WFJA 5JYDA 5K0ZA 1YJ8A 5ER6A 3FBGA 4K9DA 3Q1LA 1S7CA 3WGGA 4BNXA 2BFPA 3GZ4A 4YJFB 1DJQA 5JC8A 4PRKA 4L73A 4RQTA 3VH2A 4CLEA 3LK7A 4YWJA 3ZV3A 3WGYA 2I3AA 2VCYA 4A10A 3BA1A 3O4RA 5U4QA 1GR0A 1R0KA 2I5PO 5JNLA 4E5NA 3R0IA 3HG7A 1QV7A 2IXAA 2FSVA 2GF2A 4J4BA 3OEYA 4E3ZA 3VC7A 1DLJA 1LX6A 2VTDA 2PK3A 2JD2A 3L4BC 2WE7A 5K9ZA 3T7CA 3NTOA 4J7XA 1GCUA 4E21A 1LRJA 1XIVA 4O59O 1HE4A 1CQJA 1UDAA 3D4OA 4ZQBA 5A02A 1WDKA 4P4NA 4PRLA 1V0JA 3RC1A 3PRJA 5JDCC 2RAFA 4IIUA 3QQPA 5DF1A 1E1MA 3ZV5A 5G2OA 1I01A 1QYWA 5JAMA 3GA0A 4LSMA 3WIDA 1AE1A 2YY7A 4E5YA 5HS4A 3ORFA 2G76A 2Z95A 4ZGWA 1C0KA 3K2BA 5IAAA 3I9OA 4JX8A 2HAEA 4CV0A 3COSA 4JJGA 3WR5A 2Y0EA 1E3JA 1OZAA 2P9EA 5JAIA 2O3JA 4PLFA 4P4LA 2GNAA 3KSDO 2X6TA 1DLIA 4B3IA 2I67A 2BHLA 3OSUA 1R0LA 2FMUA 4XR4A 5TSDA 3TQHA 2FP4A 3ZWVA 3E5MA 1SPXA 3INGA 3L9WA 4IDEA 3WYEA 3C85A 3RUEA 3WWYA 5L4LA 3KBOA 1DIGA 3NV9A 1SCUA 3RSHA 4TRNA 4Y9DA 2OMEA 1GDHA 4TVOA 4K26A 3VPSA 5IG2A 1PJCA 1U9JA 1U3WA 2PD4A 4QT0A 3L6EA 5CG1A 2PKQP 4NBTA 2I65A 4PCVA 5BT9A 4ONEA 1GY8A 4Q3EA 1LXCA 3DB2A 1W4ZA 2V65A 2Q3EA 4TKLA 3KSZO 1DPGA 4I9UA 4N54A 3PQFA 4E31A 3H5RA 3GG2A 4J90A 1Q1NA 2POQX 3AI1A 2D1YA 4CUZA 3FPCA 1UP6A 2C0CA 1XCBA 3EVNA 1NR7A 3BMOB 4I5GA 4OMUA 4UEJA 1YB1A 1I33A 2A92A 3CEAA 5B1YA 3ZNQA 2UDPA 1BDMA 1TT5B 4XKJA 3BMQA 1Z82A 3H7AA 3DTYA 5FF9A 5CDYA 4HX5A 2ZB8A 4J0EA 2O3SA 1DFGA 4WNIA 3C3XA 2TMGA 4GH5A 3KO8A 3AOEA 4BNHA 1NPYA 1ZJYA 2EW2A 4D46A 1I3MA 1KS9A 4MVJH 4BVAA 3DZGA 4XGIA 1LLUA 2W4QA 3B1FA 3MWDB 4BIIA 3GQVA 2Y0DA 2GUGA 3QA9A 1OC4A 2PZJA 4W9NA 4FGSA 3DZJA 1ONNA 1JW9B 4GWKA 4Q3NA 5GMOA 3UOGA 2Q1TA 3MJVA 4ND1A 3DZFA 4NG5A 5F21A 4Z3DA 3T4XA 4W4TA 3ZWYA 1F8FA 1IHXA 1O8CA 1Q0LA 1LDEA 2AG5A 2B37A 2GZ2A 4Q3CA 4WECA 3NJ4A 3RFTA 3JSAA 1UUFA 4HNHA 1ARZA 3AWDA 2O2SA 2P9GA 1SZJG 1R66A 2HRBA 2DTXA 4INAA 4NI5A 3LC2O 1T25A 4M54A 5KKAA 1U8XX 4HWKA 3VH1A 1U3UA 1E1KA 3BAZA 1C0IA 5T8KA 1GQ2A 2YFHA 2QHXA 5BNFA 3TJRA 1FK8A 4J1TA 1MUUA 2YV3A 1JU9A 5KNLA 5B4VA 2QRJA 4D0SA 1E77A 3FR8A 1QSGA 1VL6A 1QRRA 4YR9A 5T6BA 3FNEA 1MC5A 3CKYA 1EE9A 2ZTUA 5GY7A 2P4QA 4GX5A 1D1TA 3LC7O 3DZIA 3GNQA 3EVTA 1X0VA 4CMAA 1HWYA 4F6CA 1MA0A 2DTDA 1NFQA 2WE8A 4XB2A 3HN7A 3OJ0A 2SCUA 4B4VA 4BKRA 4BNTA 2P91A 3ZW8A 2ZB4A 3ZN2A 3LLVA 3GVPA 1BXKA 1O5IA 3GOHA 4LW8A 2Q45A 2R2GA 2PKQO 4F46A 3GLQA 1NYTA 2WEKA 1N1GA 3RUAA 1F17A 1BW9B 2GZ1A 4B7UA 4YACA 5F5NA 1J4AA 4CMJA 3NTQA 1IHYA 3GPIA 5JSFA 3WYBA 3GN1A 3KETA 3BTOA 3EZLA 3WJAA 5K6AA 4LSWA 3I9JA 2OFPA 4NIMA 3OQBA 3OFSA 1XKQA 1EK6A 4CM9A 2AMFA 3GHYA 2YDYA 3IL2A 3KTDA 4HY3A 3TL3A 1AHIA 3GNSA 3UICA 1ZEJA 3V1YA 5ICMA 4OGWA 4BQPA 1H93A 3ZU2A 2VZ0A 3GGOA 3S8MA 5KOIA 1T4DA 1ONPA 3KYCA 4WUVA 2GYYA 4BNNA 3FCOA 2DBRA 4R9SA 7MDHA 1VJ0A 5GZ1A 1M2WA 2YQ4A 1U2DA 2EW8A 4L76A 1I2CA 1ZSYA 2O4UX 3F1KA 3NGXA 3V2UA 3IAHA 2JKVA 2Q1UA 3CTMA 3QVOA 4UVDA 1GPDG 2VWQA 2X9VA 1GZ4A 3S55A 1HEUA 3SVTA 3NJ8A 4YAJA 4OKNA 1GQQA 4DUPA 4KOAA 4YT5A 3ASUA 4RVGA 2GN6A 2EP5A 3U4DA 2BI8A 4Q3BA 4OYRA 3PI7A 4R1UA 1LQTA 1C0PA 4EGFA 4XRGA 5AVOA 1EDOA 1PJ3A 1UR5A 4FIZA 4GSLA 1E6UA 2DT5A 3JD3A 1OBFO 3OJLA 2P68A 1PZEA 4FCCA 1ORRA 2EP7A 2E82A 4QO7A 1EUCA 1MV8A 4WLNA 4ZVVA 3S1LA 4CMGA 5L7YA 2IYOA 4CLDA 4BNMA 4M55A 4NJMA 1PZFA 5EMHA 1IB6A 1A5ZA 4NQZA 3I9LA 4WCFC 5IXYA 3MTGA 4JBIA 1T24A 4J2OA 5F3RA 3WYCA 4CLOB 3RROA 1NWCA 1DAPA 1KYQA 1D7OA 4J91A 1UZLA 1O95A 4TROA 1NQTA 2DFVA 1BSVA 4RV9A 2XF8A 3AY6A 3D64A 4FFNA 4AJPA 3ZNOA 1BVRA 1PJQA 1X7DA 3DTTA 1NAHA 3GFGA 3I4FA 4ND4A 3VH3A 5I9NA 3RJ9A 2BRUA 3AY7A 3NUGA 4F3YA 2PR2A 1W8DA 3I1JA 2DKNA 3K30A 3GFBA 1DC5A 1ZK2A 2PH3A 2W8ZA 3G79A 2VZ8A 4R3WA 4IXTA 3VZRA 3G17A 3KXDA 2PZMA 2F00A 1Y9EA 4A03A 5A3JA 4GLLA 4L8VA 3IP3A 4B4UA 4AICA 1AXEA 1JWAB 1UP4A 2IXBA 2VYVD 1R6DA 1F8GA 5FEUA 4JQCA 4BO5A 3DDNA 4CMEA 5KTKA 3PHIA 3QIVA 4R1TA 1J0XO 5TIIA 4PZCA 4LK3A 5L9AA 1A4UA 4LCJA 4XQ9A 5IJZA 2C59A 3QWAA 4MPDA 4B3JA 4RZIA 4JJIA 2E6UX 3CSDA 1EDZA 1T2FA 3GVXA 1I10A 5DCWA 3D3EA 1TT7A 3VDQA 3MOIA 3JQ9A 3R1IA 4RPKA 3RC7A 3A14A 4E12A 3UFXA 2DBQA 1BXGA 3DMTC 1XEAA 3DL2A 1HLDA 4CL8A 2R00C 3E6AA 3GT0A 5TX7A 1PTJA 4Z6KA 3DZBA 1E1NA 2B35A 1JA9A 5C5IA 3VPHA 2C29D 3IP1A 1N2SA 3UCEA 4AJKA 5C7OO 1K5HA 1ZO8A 4WK6A 2J3JA 1SO8A 3P5SA 4WLEA 2HMUA 3H5NA 4PG6A 2A4KA 3W1VA 2G1UA 1B14A 3DBVO 4CV1A 4JROA 1C14A 2VNAA 2X23A 3ONDA 2V6FA 1B16A 3LF2A 1T2DA 3RKRA 1NR1A 1LQUA 4ND3A 5EN4A 3OBBA 4ZICA 1P1KA 3WQQA 2JFFA 2QYTA 1R4MB 3KB6A 1E1LA 2VHZA 4EUHA 3T4EA 1YONA 4IUYA 1TLTA 5ILGA 1M75A 1KY4A 3OJOA 3K8ZA 1Y81A 4UUMA 5COBA 4WOKA 5JLAA 3IJPA 2BGKA 2Y99A 4CM7A 3WSWA 4NFYA 5EQDA 1ADCA 3IOYA 4NBRA 4CLHA 4Z9YA 5DP2A 4FN4A 1QLHA 1Y8RB 3HWRA 4CQMA 2PV7A 3ZWBA 5DP1A 4AJHA 1B8VA 4BNIA 2CNBA 1Y7TA 1PJSA 2OGUA 3U09A 3VTFA 3JYLA 3JQ8B 1NQ5A 2E48A 3PJFA 3VTZA 5KJ1A 3AUAA 3FBTA 3OM9A 3O8QB 2H6EA 2VUTA 3VPGA 1VKNA 2EKPA 4CM8B 2GN9A 4XRRA 4HFMA 1K89A 2YDXA
chains in the Genus database with same CATH superfamily
3T9AA 2YZKA 1RJDA 5HCUA 3SMVA 1GPAA 2P0AA 1LB1B 3R6WA 5LMCA 3EWSA 3Q0IA 5G1PA 2CJYA 4MRRA 5EKXA 2X41A 2YWXA 3UK7A 1XP5A 1C7ZA 2PRYA 1TLLA 1US8A 2DHDA 3CNLA 2PVPA 3CXUA 1E5VA 4MS1B 1Z4JA 3CR7A 4GWGA 4WOPA 5I7AA 2I4NA 1B8UA 5AKJA 4E07A 2NU8B 5A9SB 4JKOA 4FSHA 2A9KA 1L4YA 3EVCA 4FINA 4EITA 1FLDA 1Z4KA 2GN4A 3WLJA 3S1SA 3NUZA 4XARA 1LBIA 1IHUA 2HZ7A 3EPRA 3L7OA 3BXHA 2AX3A 3P9YA 2FSHA 2D8AA 3CE9A 5LP6A 5CGQB 3D5QA 3ILYA 3HCBA 1H1LA 4DIMA 4GOMD 5AKKA 3LCMA 3VPAA 1S96A 2Q5IA 1CF2O 1BGWA 4LPKA 1JF8A 1NQVA 1UKAA 3NYQA 4QG7A 4ZRMA 3HWX1 4X1KB 5ITSA 4XYLA 5JEEA 5DTEA 4DQKA 4IQFA 1XVUA 4MV1A 5FFNA 4Q00A 3UJ9A 3Q9SA 4IIGA 3IIEA 2ZBPA 1UMCB 3BS4A 4HGQA 1EFCA 1HZZA 3W79A 2I9PA 3WMEA 2YKGA 4E1VA 3LP6A 1WSBA 2B30A 5JCXA 1OPRA 4YJDA 4LMRA 2ENUA 3CLRD 3ZD9A 3ULKA 2ZDGA 4Q4AA 4C43A 2B4QA 3AVUA 4M0UA 1VSBA 2NW6A 4FYMA 3AR9A 4IICA 4RFLA 1NN5A 2HCBA 4Q93A 4ZIRA 5ADHA 5BQXA 3BQMB 4JAVC 2OHXA 4NECA 1JLLB 3JZAA 2BLNA 4DAEA 5HJ7A 1KRXA 5G0VA 2Q2VA 3GJ7A 2PRKA 1XDBA 3LHKA 4JA0A 4HQOA 1DB3A 4QLOA 5AKIA 1E7RA 1YNSA 2HGZA 1XVLA 3EGXA 3R0VA 3SICE 4WXHA 4BP9A 4Q9AA 5EPUA 5LSAA 2FW7A 1OE0A 1XHLA 3HB4X 2C57A 3R20A 4RZSA 5FNVB 4WRRA 2HF2A 2HSDA 3ROXA 4JC4A 4EG6A 2QZ9A 1G5QA 4XD7A 3ZHOA 2QLBA 4WZ6A 3VO9A 5JXHA 1A9QA 1VBNA 1JUDA 2I6UA 4NZNA 3NKVA 4HLQB 1AQYA 2RG1A 1V39A 3GPDG 4MV7A 4DN6A 4OHOA 1GO2A 4OYYA 3QUTA 3BWCA 4DYVA 1NU6A 2I3BA 5LQJA 3QHQA 5GTDA 1WW2A 3ZHXA 2ZOSA 2ZSKA 4G01B 3BRWD 4ZVSA 1YZGA 4K9PA 3DGEC 2XPCA 2YS6A 4S2EA 5ECYA 2E6KA 4AJ2A 3I83A 2HJSA 3N2YA 3ZIAA 1JFRA 5JBQA 2VHQA 1A2QA 3DLTA 1JG7A 2AFHB 1A9XB 2EBUA 2W0SA 3DWIA 4MWCA 1EUDA 4XTCS 3UBTA 2NO5A 3D3QA 5FBQB 4MAFA 5DI3B 3AMVA 1EPUA 2O2EA 4REQA 4WHMA 4IQGA 1JHRA 2VPZA 1XA3A 1XKTA 3NFRA 3AR2A 3G7SA 4LBZA 4QPJC 1Z6ZA 4YJ2A 3PNSA 1E92A 1S3IA 2X22A 5DM4A 3GFSA 2Q6IA 3PQDA 3NC4A 5TF0A 1W4LA 1YACA 3NWBA 3RUDA 4A27A 4K1LA 3KHTA 1WDTA 3P2KA 1GAEO 3WAKA 2Q3MA 3WP1B 3ZGZA 1E2NA 1SBYA 2JL1A 1SXQA 1GRCA 3V32A 5HW0A 3FHCB 3GNTA 2D8MA 2G3YA 3HN2A 3KLNA 4F21A 2EZUA 5IAEA 1E7WA 2GK6A 1ESZA 2A1UA 3QUSA 4ER3A 1V7QA 3HA5A 4UJ3A 4EFNA 1MB2A 2AOTB 1YDWA 2HWUA 2ZE7A 3BJRA 2R5FA 3FFAA 4NESA 1VHDA 2HZBA 2LCFA 2W2KA 4RFVA 5AVKA 2DT8A 3OOWA 1T8YA 2C8JA 3BSWA 1XTTA 1YZYA 1Y4ZA 4EI7A 5FWNA 4PG7A 5KKCA 2RIRA 2AKEA 2NXEA 5LDGA 4F9GA 4C03A 1ZR4A 5CHYA 1YCGA 5LLDA 2EWMA 3VAAA 1K9SA 4R01A 1B3BA 4FJ1A 1QFXA 1P1CA 2G09A 4B3DA 4Z7JA 3EX7C 2A3RA 4DWVA 1EUYA 1HF3A 3MTJA 5DHSA 5ISMA 4H4DA 2WZDA 1T8TA 3JVEA 3KG2A 4DPMA 1R18A 5KU7A 3ZDBA 2HIMA 4H1TA 4AROA 4E6PA 3IHKA 4HPXB 4KE9A 2Y0BA 1MGPA 4TYMA 4NTZA 4QOHA 5B7GA 2WNSA 5TF4A 2WTEA 2C94A 4L4UA 3T3MB 2GH1A 2I6QA 1SB8A 3PFGA 2PWBA 3AVXA 1EFUA 1SUWA 2J9GA 3ETJA 1CUWA 4PIMA 5JVDA 4O5OA 1FMTA 4EUEA 3QW2A 1E98A 3QSYA 1ID8A 5CNMA 4I1IA 3IJEB 4M7WA 1LBTA 4R9NA 4W82A 1JDTA 1BEZA 1PR6A 1N1DA 2VRCA 4HGYA 4H08A 4C4AA 3VU0A 1P0MA 3B6ZA 1EGVB 4Z0NA 4D9NA 4K88A 4OB6A 3OEED 3T7DA 5JD4A 3ABIA 3CX3A 1PE0A 1XVTA 3H0EA 4QUAA 3W5UA 2DCMA 2HF8A 2CBZA 2ZRMA 4HAIA 4I4NA 5CEEA 1THTA 4JVLA 3RAGA 4DLTA 2HMSA 1VE6A 1ZM2A 3HZOA 4XCQA 4N5NA 5JW6A 3TQOA 4YBRA 1PSWA 2J85A 3EGEA 3WIVA 2VEDA 2V3WA 2I1QA 1T2UA 2CJWB 2IFTA 3KWMA 4JQYA 4C88A 5JHGB 1K6XA 2C61A 5J4VA 3PVCA 4U7DA 3K9WA 1X8KA 5B53A 1XQVA 1CLEA 4XJTA 4BKQA 4EJ6A 1J1ZA 4EEKA 1MMFB 4UCXA 3CV3A 4PQRA 2VPPA 4OI1A 5B7PA 1QYCA 3SJZA 5F3DA 1B15A 2XZPA 2Z9DA 1FU7A 2X3YA 1IE3A 4HH0A 4MQEA 5ALKA 3T9CA 1UH5A 4ALIA 4R1QA 5JR3A 3QE3A 3UT5B 4REOA 3V1MA 5AUPB 2GPWA 1TQ2A 1PDOA 2QU8A 5KDOA 4OD0A 4GL4A 3W8NA 4CIXA 2M6RA 5EUMA 1HT3A 1VI5A 5K6AC 5KVCA 1LD3A 3QIAA 4C0LA 3KHKA 3AL0C 1TNDA 3TEMA 2PUWA 3FYDA 1NONA 4ARAA 5JNWA 2HWKA 2X4GA 3E7XA 5H81A 1YKSA 3JS5A 1D5WA 4BO9A 3ZVLA 3PDIB 4CWAA 2QXYA 3H8WA 4DYDA 1XDDA 3GELA 4K40A 1VZ2A 2JIQA 3EZFA 5DIZA 3H9JA 4JJ4A 1U94A 5FP0A 1RTTA 2X5JO 4IHJB 1KFKB 5FDFA 2ZJZA 1JE1A 1W76A 4RMJA 5NLLA 5IH7A 1H5UA 1QR2A 3BX1A 2EGHA 3ZWAA 1Y3FE 3ME5A 5EKUA 1CEXA 4ZEXA 1NUUA 2OQIA 2A33A 3F6CA 3MSXA 2GJ4A 4HFRA 4KGZA 3PQ2A 3WZ2A 3SN6A 1NP7A 2B69A 2PWYA 2HNAA 4JKIA 2FWRA 3ZE6A 4EA7A 4IM7A 1IB0A 2A0FA 1QGED 2N46A 2H3EA 3QVWA 1YQQA 1HYHA 1TW3A 5KI6A 5GVSA 3QE4A 5I7HA 4ZQEA 4G07A 1M7GA 1Q83A 3IS3A 4XB1A 1SUCA 2KBFA 3LSYA 1V1RB 5CTAA 2DETA 4GI7A 2XUZA 5AM4A 1Z12A 2W8BB 4DLSA 4KQ2A 1UJ5A 1N6PA 3LYLA 3NOOA 3NOXA 5DM70 1OI7A 2C4MA 3C14C 4GYKA 4RLQA 2IPAB 3NP9A 3TZQA 3RVSA 1XXHE 2AEMA 4WK4B 3ZCXA 5CD1A 2GASA 3DOFA 1N9KA 3G2JA 4HXGA 2CE7A 3M1YA 2HF7A 3R40A 2J0UB 4JQZA 5D6NA 1L5FA 1UMDB 2C95A 2HQOA 3UIEA 3E9NA 4B79A 4YDQA 1F7VA 3WRYA 4D44A 3K9FC 4L4RA 4D4HA 3R5HA 4LJ5A 2QRVB 3IDAA 1KH3A 2JFHA 2AD5A 2X5OA 3AUJB 4WZAE 4YMGA 1XJWA 2CXRA 2RAUA 4IO1A 1J20A 3WHIA 3LE8A 1MXHA 2F17A 4IF4A 4ZV9A 2ZAGA 1HV8A 1E61A 4RD6A 1K5DA 1R12A 4L0DA 4FDTA 2XDYA 1A2BA 3G5TA 5C7YA 1P2DA 3VA7A 3VHXA 2XF2A 1Z0IA 3M1LA 2Y68A 5CLGA 1CTQA 3UWMA 3QHAA 3VR5D 2IPXA 2H52A 3ROFA 2F1RA 4ZMBA 5JJBA 1CDDA 4W5HA 3GPLA 3VM6A 1KO8A 4CQLA 1ZXBA 3MS4A 5JS2A 2IH5A 1XP8A 4YAWA 3AU9A 2XSZD 5A71A 2O9JA 2D0PB 2Y2UA 4KNWA 2FPGA 4BV8A 1FA9A 5KWVA 3BK1A 4R8KA 4YAFA 2ZUTA 4AULA 1E8DA 2Y6UA 4NEHB 3TTVA 3VTAA 1X1DA 3BL5A 1KVTA 3RSOA 3MGAA 1T1SA 5CDUA 4L72A 1RNLA 3GOQA 3GMTA 2IX3A 3JZFA 1DAMA 1YASA 2DQYA 3DKRA 4WUTA 3WP0A 3SHFA 2GJSA 4LNUB 3QKIA 3SS9X 1PS8A 4ZU6X 2R8PA 3JR7A 1P1RA 2VHEA 4EB6B 1TYDE 2MSCB 2OBLA 4WN3A 2NQTA 2F8TA 2VK1A 4O2BB 3P9XA 4IAOA 1PK7A 3PVSA 4YMHA 2CUZA 2AC4A 2L17A 2WU1A 3JQGA 4DT1B 2P65A 4EF6A 2DSNA 3U4IA 2J9YB 4U3JA 3GXOA 4RAQA 5HCIA 4OTZA 4QDZA 1ST3A 1BWPA 1E62A 3TTWA 4A26A 5ALMA 1M2KA 1FYVA 2GZ3A 3C8ZA 4X6UA 1TFUA 4FONA 4W8GA 4WBSA 1Z26A 1MORA 5I9IA 1QNFA 2OLJA 4J0KA 5A3SA 2C9YA 4NK4A 1ZBQA 2CDNA 4G0YA 2GXQA 2QWXA 3EZ7A 2A1IA 1P9NA 2W5UA 3WRWA 3MJSA 3CH5A 3CNQS 3C7CB 4KO2S 4F38A 1JEYA 4ARIA 1VE3A 2H8GA 3GVHA 4OIMA 3JARA 3CZ5A 3QNMA 2NNLD 4Y18A 4B3CA 4LYHA 1MD9A 1EU1A 2HK7A 3MD9A 2B0CA 1TM5E 1Y8CA 2DHQA 1UBSB 4DKXA 3M3DA 5FUYA 1FU8A 1OLSB 2PGAA 5IXSA 1OJLA 1N7HA 1R8JA 4FFDA 3GRRA 3JRNA 1G20E 2RK4A 4DR2B 4HWPA 2PYZA 1ZH4A 5EZ6B 5TC4A 2F8LA 5AVJA 1JT9A 2P9QA 2WSMA 3Q9UA 1MVLA 1DC8A 2MT9A 2O23A 2ZBEA 2PMBA 3OO1A 1JIXA 2AFIE 2CLKB 2OOKA 2VHTA 3K2IA 4TYYA 2FGJA 2XE7A 3GLFA 4PGMA 1K5GA 2WI8A 5AP9A 1OYOA 4K9SA 1FBNA 3MCZA 1A8PA 2I1WA 1OASA 1MZVA 3RFXA 4Y67A 2AE2A 2VT7A 2FEXA 2ORIA 3C24A 1JYEA 1W2HA 2C5AA 1ONOA 3G6KA 3IBGA 2GILA 3KT3A 3LLCA 3IE2A 4IGEA 4IVQA 3U3OA 1UXIA 1YS7A 3IXLA 1XMPA 1SIWA 2WKSA 1U8YA 3H2BA 3HBFA 2ZYRA 3HVJA 4PYQA 4UD2A 4KXNA 1BQEA 4YASA 2B8TA 2IEDA 3EE6A 2VSXA 2XZTA 2HU5A 3DCIA 4BV2A 3KOOA 3ZUPA 1WZEA 2QXTA 3DBOB 3TQIA 2C8VA 2PGXA 4QPNA 4KYUA 3GN2A 3HCAA 2WB2A 3IAAA 3ELUA 2Y3IA 2ZUBA 3IRVA 1V71A 2ZBQA 4LC0A 1N0IA 3WGOA 5DHUA 2NP7A 2D0IA 2CYAA 2VHXA 5IABA 2QW1A 13PKA 3ZY4A 3F1LA 2GSDA 2W83A 1WS6A 3P94A 4LBVA 5AJUA 5FFFA 4CZ2A 1IMOA 3KJQA 1BTOA 4BLRA 2GXAA 1GPWB 1N6KA 2PJUA 5K0GA 1KZ9A 3X0DA 4BZWA 3NIGB 5ALRA 1LVUA 3TAUA 1TIPA 3DFIA 2FV8A 3RYHB 4ZMRA 1EWQA 3SC6A 1KNXA 1Y3BE 4CFZA 1QZ3A 1DKRA 3UCFA 2ATXA 4OJNA 3V4ZA 1X3LA 3FCXA 4GPTA 1OLUA 1M33A 1Q91A 4Q3KA 4LF9B 1Z6GA 3OBIA 4GXTA 1DOAA 4CUJA 3MXOA 5B1HA 3VR4A 2ISCA 4M0KA 2WTBA 4UHJA 2VYCA 3EQ2A 3JAWB 4P4SB 3QWBA 1QIGA 3SBEA 3RF7A 4W5NA 5HKKA 1EXNA 4K86A 2JAWA 1CQIA 1LBSA 1OFUX 3NBMA 221PA 4FJ2A 4DCPA 3KEOA 3N75A 2V3VA 4UQPA 3ZGYA 4E51A 3D3WA 1BU8A 2AQKA 2P41A 2QU7A 1DUSA 4TTJA 3PPIA 3WK7A 4MV0A 1PGOA 3VNVA 5AWFC 3TW0A 1PKXA 1SD1A 3AKEA 3RREA 2WWRA 1N2JA 2ZBRA 2VJPA 1IHDA 4H4CA 3THYB 4ARCA 4RULA 4JLWA 3L0DA 4YRZA 5LP6F 1HDOA 1D04A 3TX6A 5E2IA 5NULA 3DR3A 5EJ9A 4DJAA 2XTNA 4EUSA 3KJHA 1BS9A 5DPMA 4KFUA 4DBZA 3ZHCA 3GROA 2FPOA 1A04A 1U0EA 1ND5A 3O92A 1FP4A 4MV8A 2O5RA 4Z9XA 1BOFA 3OZDA 1DQZA 1ZJZA 2BZ0A 3AI7A 3SR3A 2G7ZA 1PG0A 1VL8A 1DFIA 1XZGA 2JIRA 2ZUCA 3MRSA 3FY4A 4WH0A 5AIBA 4AX8A 3T5BA 1HZZC 3VR6H 1WMDA 4KUHA 3RT1A 1L4HA 1ZVQA 5K3CA 1FUUA 2WFAA 4PNPA 4FB5A 1PL7A 1JKMA 2A9FA 4M1WA 4IILA 2E21A 2C20A 1GCOA 4QQKA 3AEYA 1TYEB 2HI0A 2PD3A 2CV1A 3FB4A 3T7KA 2XLBA 4CG1A 2PX3A 1PK8A 4NMMA 2ILTA 4YK7A 4QUDA 2FRDC 1IG3A 1RQGA 2FWIA 4IQ0A 4NCHA 1GG9A 3WYAA 4EQ6A 1DHTA 4F8YA 2IYPA 1FXWA 3CSUA 1ATZA 1RM3A 1B1CA 3LJKA 1BE8A 3UHOA 1XJ5A 4IDCA 4GEGA 1J99A 4OL9A 2O2JA 1NLYA 2VP3A 4JLSA 1NW7A 3KJZA 4X66B 1P5JA 4KAXA 4KTVE 3ENNA 1FB5A 5DXAA 5E6UB 5F7ZA 4X6LA 5GZ6A 1PTKA 4WZBE 2GA9A 4OA5A 4IJUA 5DO9A 3O21A 5FNZA 1SBZA 5B30A 3ZY2A 2GVZC 4G0NA 2YOGA 4RE6A 4YP5A 4Y2UA 4EARA 2NG1A 4CR6A 1MABB 1XL0A 4JBLA 2OB2A 5KYGA 1OFIA 5HFNA 3O8DA 1POXA 1SVMA 3OOSA 4ND8B 2BW0A 1Z45A 2JDID 1SCUB 2PQ0A 3H04A 4BHTA 4ZQGA 3ROQA 4JXZA 1PW5A 2Q9AA 1R6TA 2YX1A 1UC9A 5CFQA 1PQYA 3GO4A 4MSUA 4EKNB 5CFPA 1JWLA 5LLSA 4DRXB 1ZVVA 2COKA 4F3KA 4V0ME 1XPRA 1RWPA 5H4HA 2ZTMA 5KYUA 4Q0MA 2W22A 2OFOA 2NUPA 2WM3A 2CXPA 5BWCA 4CKCB 1Q14A 2I2BA 2TSYB 3CE6A 3DE5X 2XUQA 3F2VA 4E0BA 5BP7A 4N5MA 2Q4RA 1BX1A 3G0IA 3VKGA 4YJ2F 3DFKA 1JQDA 1Z68A 2QE7A 3KKOA 2K2WA 4KMOA 4DIBA 2G0AA 2BGTA 3QITA 2BFDA 5B64A 3ETEA 1VSTA 4GOOD 4AURA 4FGUA 4R71A 5IKEA 5C53B 1I9CA 1YQTA 3AB3A 3AM5A 1CR6A 3ZKAA 5A04A 1KVSA 4A0HA 3QEKA 4GAEA 1I7QB 1OX6A 4PYKA 2E0IA 4MQ6A 4L4XA 4WXYB 1P61B 3ZWKA 4FZRA 1N6LA 1V5WA 3AFMA 2X4IA 2E4XA 3SY8A 4UVGA 3UENA 4ZHQB 1Z34A 1T9AA 4GX0A 3TF5A 3INTA 3I2KA 2GN8A 2FWBA 3H2ZA 4FFSA 1N2ZA 1SU8A 3SC2A 1VE9A 1V43A 5BOSA 2B94A 1LSSA 1XCMA 4U9UA 5CP8A 2PLRA 4C04A 1CZRA 2FMKA 4ER7A 2WJZB 3HYLA 3U7QB 1Z9BA 2ODWA 3EVDA 3R5XA 1Q21A 2CDCA 3HRIA 3HK2A 3EQ7A 1VI6A 2AMLA 1OV4A 2QW0X 2L42A 3DE7X 2CL7X 4X6XA 4E2WA 3CJQA 2EDAA 1XMIA 2W11A 3DEJA 4Q9NA 4LJ4A 1K6JA 4UUAA 3EUWA 1PQUA 3D4NA 4YCSA 1UBEA 4JMLA 3B8HA 3ZUGA 1HA3A 2R1VA 4KGXA 2JFQA 3LQQA 1K8YB 4Y0AA 2P7IA 2FFJA 1ZYUA 1ZK1A 2ZROA 4R05A 4NF2A 1ECJA 4IG9A 4H3VA 3SYKA 4AJ1A 2EGGA 2AN9A 5ITZA 3OFJA 3RV3A 3GJ4A 3GRVA 5JVDF 5K0SA 4J1QA 4HGRA 3IAS1 1QG0A 5SYNA 1NVBA 4HRAA 5JO0A 3X1MA 1SB9A 2IEZA 3EXG2 1DXHA 1GUAA 1HE5A 2J33A 5LIRA 2BEWB 2YY5A 3OPYB 3FDZB 4AJOA 4ILKA 4JLAA 1NMZA 1PR1A 2CW5A 2FB9A 2XOXA 2QVXX 4JZKA 3LNTA 2OHOA 3O73A 3KYDB 3S8YA 2FPWA 4R41A 5CJ2A 2HQRA 3RH0A 3U17A 3NM5A 3B1ZA 5CYPA 3LXMA 3GLGE 4ENWA 4H7EA 3AZPA 2R8EA 3ILVA 4NJEB 5DNUA 2X9QA 3MCVA 3VR2D 2QMHA 3FDXA 3N7AA 5LU9A 5CW1A 4W5TA 2IK8A 3UK0A 2AJ8A 2BELA 5LMNB 5CT6A 3R9WA 1VJ1A 3UM9A 3FZYA 3MWLA 1U2EA 4DIUA 4CODB 1C0LA 3K0CA 1OHHD 5FTLA 4ALKA 3QGMA 3BMOA 3L4EA 3PUHA 2J87A 2P27A 3D0OA 2DG2A 3ZWXA 5CEJA 1L8AA 2DECA 3DUFB 2WKWA 2C7PA 1UDBA 2ANCA 2XE4A 3WIUA 3U61B 1J5XA 1TT5A 4AIRA 1KFEB 1VCIA 3PKZA 1DQYA 1BN6A 1E1CB 1NX6A 2P79A 3M6XA 4PLHA 4CR8A 3RJZA 3H75A 4ARSA 1VTKA 2GRJA 3SBOA 5GM2A 4RVDA 3K5HA 3V6LA 4ZV4A 3KKEA 1XMQB 3H19A 3OM0A 5JNTA 3GFFA 4OHRA 2RHDA 2NO6A 3KZCA 3QA3E 5LIPA 1KYVA 1XJQA 1DOHA 1Y34E 4RX1A 4DSNA 4POAA 2IYWA 1HT0A 3JATA 1EXWA 1ZUIA 2BIFA 2BM1A 3P0IA 2QROA 1E6LA 3HA3A 1DKUA 4F45A 4OJTA 3KEQA 3CISA 4XWTA 3GP3A 4AF8A 3ST7A 5ELMA 2ZPTX 5AXBA 1V2HE 2JGDB 2XMGA 5A6VA 3E9QA 3K15A 2Z09A 3S7TA 2FZ4A 1G5TA 2F3PA 3OLCX 3W6PA 1HDYA 4J16A 4DSUA 4B3MB 1Q0HA 1GDDA 1G2IA 2QN2A 3IOCA 4XW2A 1RRGA 2XX3A 1RLMA 3NT2A 1CV2A 1GXSA 3CRW1 4L5CA 2J0QA 2NP6A 2Z3WA 1WUTA 3OG9A 1XU4A 5K0LA 2ZJOA 2YBEA 4KIUA 3Q3CA 1YVDA 2O2GA 2G17A 1FX0B 3CNEA 2PSEA 1PYDA 1QYXA 2KM1A 2MYUA 1ECFA 2NT4A 2J3IA 1QIJA 4TQAA 3HXOA 3SNHA 2W2OA 3HR4A 1VXOA 1AY0A 3LYHA 1Q0PA 3RC2A 1GG2A 3CU5A 1J23A 1ZUNA 4DM4A 3HV2A 4KKVA 4ACBA 3I5XA 1FFDA 4QIHA 2ODAA 5U1PA 4YVFA 1E3EA 4EVQA 1J21A 4NY1A 2A5YB 4RPCA 4MI9A 1POWA 4S2UA 1IMJA 3V34A 1T6XA 3RTCA 3ONWA 2ZETA 3GGPA 5AKXA 3T54A 3D6FA 3WRYC 3UWDA 3PR3A 4G3XA 4U2EA 3UY4A 4KGDA 1SM4A 2RGBA 4EW2A 3F7NA 5EXTA 1MFZA 1R5OA 2V9PA 3N8IA 2I2WA 3DAFA 1C9MA 3QEMA 4HH3C 4MA4A 3U0VA 1O0BA 4NPHA 4R51A 5I5GA 4BLOA 2ZM5A 1UZAA 1RAHA 4B9AA 4DQDA 1ITZA 3H9QA 3PQEA 2YMPA 2IU0A 5EMNA 1IG0A 2P6RA 2WIDA 2PUCA 4GPBA 1GFSA 3P9IA 4Y2YA 2FKAA 1WR8A 1Q6YA 1U4OA 1XZJA 1W48A 1EYZA 1WTCA 1Z5ZA 2JLRA 3D6AA 3OHSX 1W5BA 4IQ8A 4R31A 3U3DA 3U5ZB 1VPLA 1I7NA 1N36B 3L6BA 3L93A 1V3QE 5FIUA 1ICIA 4CMHA 1IN1A 1CUUA 4IO0A 5JADA 4Z9BA 5KX5A 4YA6A 1USIA 1O9BA 4R16A 2R00A 2BZSA 3PDJA 2X1MA 2Y1GA 4G9EA 2B0JA 2JGLA 3S8MA 3HXTA 3SXPA 4KHPB 3L8DA 1IIRA 1FFHA 5LC1A 4M1MA 3TYXA 2I6SA 2OV8A 3UJCA 3A1NA 3WLSA 1C41A 3IAXA 4O2AA 2RHRA 4DJTA 1ZH2A 4HZUA 4OB7A 4EP1A 4OHMA 4PXAA 4Q4HB 2AFHE 4O4JA 3RRFA 2E49A 3W8DA 2VZEA 4PS1A 3RRBA 4OBEA 3D8TA 1RC1A 1FCJA 4QM7A 3KIPA 4MUNA 3RIXA 2QMYA 3M34A 3ID6C 5AJYA 4E15A 1XEWY 3JQEA 3QOFA 4EF4A 1LA2A 4A15A 3HCDA 2PMCA 1OAAA 4WOJA 2EHDA 2PQMA 4MRSA 1BKSB 5KSWB 1AS0A 3ZTWA 1P45A 2V7QA 1VG9B 2FYTA 3BULA 3UMSA 2LGJA 1JTVA 2Z2ZA 3CONA 5ESRA 4RTRA 4PN7A 4UFNA 4MWOA 5BMVB 2REOA 1BJRE 3IC5A 3B5EA 5BV0A 3OJFA 4A8HA 3KVOA 5AO9A 3GGDA 4FDMA 2NMVA 2XCLA 2DJ5A 3AIMA 3PT5A 2QJRA 4IQ4A 2XCSB 3ODPA 4TPKA 2PGLA 3OFND 5JMPA 1Z4NA 4CKZA 2YHAA 2WJ4A 4B9EA 3GUHA 3LBYA 2ZYAA 3IE1A 3HFGA 4V03A 3OZTA 4W9RA 4IBOA 4MV6A 5AW7A 1WBBA 3PDUA 2O7VA 2H2DA 5JSQA 4AMUA 1XV5A 2DJIA 4RZQA 3ZLVA 3MGCA 121PA 2FKNA 3JTEA 4WKPA 4Y7DA 3IVCA 2YZ7A 5AOVA 1HFKA 2OAGA 3P4YA 4JB2A 3U9LA 3IBYA 4AO8A 5AW0A 3IUPA 1R4ZA 1XRJA 3SG0A 4PIVA 1H0HA 3EA4A 4PPYA 1AF7A 1OX4B 2AA3A 4FE3A 5G4KA 2OZLA 4R69A 3TW6A 1U3GA 5BV7A 4QELA 4U8GA 4ZCQA 3Q7EA 1L7NA 3RG2A 2V7BA 3QFTA 3QSGA 2O54A 2F43A 3GRFA 4YFVA 5C32A 3SFTA 3VKHA 1ISHA 3CWCA 4ZPJA 1M2OB 1Q22A 3LUJA 4BKMA 1OJ7A 4GX2A 4D57A 1E4EB 3RIYA 1Y1SA 2JFNA 3PQ6A 4L3WA 3IELA 4UBIA 4YCBA 1XTPA 1P1IA 2WDPA 4CKEB 3PHHA 2VF2A 4PTLA 4MLCA 3OQJA 1PAUA 1TK9A 4LDJA 5I9LA 4XLTA 2AYYA 4QBGB 1F0YA 1IUNA 3H9GA 4GPD1 4CF7A 4TOIA 2V5UA 3Q85A 4W7HA 3HH8A 4QGFA 4X92A 3TTSA 1G8HA 2EFDB 1GN9A 3UVEA 3AXTA 1U0LA 3AP2A 3CIFA 4F2HA 4HVCA 1L4FA 4YO7A 1M5UA 2DFLA 4DAOA 5DULA 1CUSA 3V46A 5CT9A 2N3ZA 4E2XA 4NBUA 4ROSA 1BJKA 3ASVA 4HGOA 1RQLA 4URYR 1O95D 1WZCA 1X8XA 2LDXA 1BA3A 1FEZA 3TOCA 5BY2A 5JSHA 1H8HD 2GARA 4GG1A 3ZDFA 4A3SA 2H0QA 2OBYA 2W7TA 3IAM6 2IUEA 3N2LA 3R8FA 1IAVA 2VH2A 2OECA 2OBXA 3CG4A 3GJ6A 3M0EA 2FFBA 3M6WA 3OOYA 5DGCA 3STHA 2ZDQA 5DNCA 3HL4A 3RVPA 4LRQA 1SKMA 3GFVA 4J0IA 3F7OA 1D2GA 3GJZA 4P2GA 3QTLA 3TKYA 2FN7A 3GDHA 4LTNA 3ZLBA 5F52A 3LWZA 3ZJTA 2MSLA 3LLSA 5DX0A 3AYZB 1I4LD 4K03A 1QRDA 1CFZA 4XM2A 3VKWA 3LWNA 4UKDA 2KS6A 2C2XA 5AI0A 2BCGY 4AT1A 3EPJA 2QUBA 4DCSA 1E63A 2ZULA 3NC0C 4IH4A 2Q3CA 4FLEA 4RHYA 3DD1A 1C2YA 1DJLA 3O4GA 3PNOA 2WSIA 3RJ5A 5M3BA 3B3JA 4I9NA 2ZRQA 4BV9A 4D9IA 1L1RA 3IBFA 5E6SB 1ECCA 1L4NA 5DT2A 5C8YB 4WESB 1HC7A 3W5DA 1R74A 4CPDA 3N8HA 2FVYA 3FVRA 5AK6A 3PD7A 1E2IA 2H54A 3K0KA 3CPHA 4QGBA 5CHEA 4QFDA 2Y1DA 2BAGA 2BKXA 2XMZA 2HO5A 3I9MA 4YMWA 3EEQA 1E9BA 1CQPA 2W6JD 4PX3A 1VZ3A 1V8PA 3EMVA 4LXQA 2XB2A 3E8XA 1TFRA 1US8B 2PU5A 4ISBA 4KU4A 3ZU3A 4QSHA 1E59A 4OX9Y 1FVOA 5EY5B 2Y9PB 3F3YA 1WBDA 1Z13A 4FMCF 1U7DA 2C9MA 4Y2VA 2ORED 4YNBA 5WRFA 2ZSAA 4NNJA 2DWPA 2ODBA 3AHFA 2LXNA 2PUTA 4I5EA 4RA9A 2QZSA 4XQ0A 1Q2XA 3AP3A 3ITDA 5EJMA 1KEKA 3BFPA 2X13A 3AHEA 1I4DD 2W2QA 3FRIA 4GZ3A 3GEMA 3OIVA 4NOLA 1H1LB 4NBWA 5C8XA 5KDDA 2Q0HA 4YRBA 1GAQA 3UOWA 3H84A 4GI3A 2OORA 4K05A 4BATA 4ZJUA 5DM2A 4FGZA 3ADKA 5LLTA 1GAXA 2WNHA 4LHEA 2CHEA 3F4LA 3QWHA 4DC1A 2DQZA 2EZTA 2YJ3A 3KFVA 4MVJE 1AUXA 2IQ5A 4L02A 4TTIA 4YQYA 5EERA 8LDHA 4UU1A 2OYRA 2ZJFA 4EPYA 8OHMA 3Q8WA 1CKEA 4JYMA 1MRZA 1N5IA 3JASB 3VJLA 1KZHA 5ALOA 1FXWF 4QAQA 4A0QA 4ZFNA 4Z9AA 4LOHA 1MGOA 4TT3A 2Z30A 3FNQA 4KWHA 3ZGNA 3LC1O 2IITA 3LTEA 1XK6A 3N5KA 2J8ZA 4HWOA 1Z2OX 2XKBA 2LE0A 4BXOA 2GO1A 1UKCA 1RD4A 2QPOA 4NK5A 3REQA 5IUNC 4CXMA 2C88A 3WIBA 1YL5A 3PLAE 1VPDA 1L5QA 3IOMA 1OKKA 1B2LA 1VOTA 3G0OA 4IHKA 4JDPA 2QMQA 3TCXB 3O0DA 1O0CA 4PO1A 3OESA 3B70A 5IC5A 1XTKA 3EGXB 3UHPA 1D4FA 1WUKS 4KQJA 2ZSDA 1NBMD 3UKDA 1NNEA 4Z49A 1E2EA 1DC3A 1ULSA 2GJ9A 4CEHA 3HSSA 3KPVA 1FMCA 3W5HA 1N5OX 4EJ2A 4MTLA 2F3RA 3ESAA 3FFXA 3EH1A 4KAAA 4ZT7A 4YREA 3ZOZA 5TGDA 3QPDA 2O7SA 4DMKA 4LF8B 4L75A 4EUFA 2J3HA 4XWKA 4HP8A 1L7VC 4JWTA 2P6OA 1DEKA 1ZP6A 5SY6A 4IJ5A 3Q3IA 1I3KA 2D0OB 4R7TA 1EFVB 1QP8A 2XR1A 1QK4A 2VPTA 4J43A 1IWOA 2EFEB 4ZWNA 1GLVA 3U80A 4CM8A 3BZWA 4D9FA 4HB0A 4PXSA 1VE5A 4YI3A 4YAIA 2E4YA 5T3UA 3T06B 5MF6A 3OLVA 1GDTA 4Y1RA 1PG2A 4QM6A 2W48A 4JODA 4KQ6A 5BW6B 1CERA 1R5BA 3HQ4O 2CKMA 2XB4A 3I92A 4UOEA 4MA5A 5KCZA 1YC2A 2G9VA 1TK2A 2H18A 4OP2A 1Y80A 3DB1A 4REQB 1HO3A 1I3NA 2EZ8A 2IGTA 3IR6A 3O1HB 4IWYA 1R7RA 5DDIP 3TQFA 3W2TA 2K87A 4BLSA 4Z7NB 1UDWA 3ZVKA 1CQZA 4YJ2B 5FUBA 5CFMA 1H5QA 2PNFA 1DP4A 1DO2A 1GGVA 3O8LA 3ONFA 1GTVA 3K4HA 3D0QA 4LE2A 1YBHA 1VSUA 1SFRA 2VHYA 2ZB3A 3BORA 3GFTA 3DFZA 4MEJA 3U56A 1JNYA 1AK1A 3KKLA 2FDCA 1W93A 3DKIA 4IP0A 5KTPA 1EWYA 2W2LD 5EP2A 3EAQA 3UPTA 2XVXA 3HKBA 1A8IA 4B2LA 3DWEX 3V33A 5BQ3A 2A1UB 1GGEA 3R7WA 1WAMA 4PEVA 1U8AA 4FXPA 3WQRA 1COWD 1E79D 2FEOA 2H1RA 2BJVA 1X6VA 3L4BA 4KPFC 3T61A 2WQ6A 2B4RO 2W2KB 3RKSA 4D82A 1OH7A 5IU6A 4RMGA 2MTBA 4MW0A 2R5WA 1SCBA 4PRZA 3RSSA 4B6SA 3W5BA 3HYCA 4OKIA 3EG5A 4FUTA 2B4KA 3B60A 1VKZA 4YCCA 1I1QB 5JDCA 2QN3A 1ADGA 1V25A 3EA5A 2X2EA 1KZGB 2FFRA 4U0KA 4LFCB 1E18A 1LDNA 2H1CA 3I9FA 5AK0A 5A3VA 4QEDA 3QMVA 3WL5A 2VQ6A 1S8NA 3DZKA 1RKQA 5CLJA 2SNIE 1JKFA 1I8TA 4BJ5A 3Q40A 4UATA 5IN5A 3ROEA 4AS3A 3EIWA 4F5ZA 5A1TA 4YEDA 1P5RA 4INOA 1SC1A 1TVEA 3K0FA 3EOBI 2YIDA 2LWIA 3E53A 3RSFA 1MH1A 2Y67A 4FHZA 2QL7A 3O83A 1PT6A 3H1EA 3SJBA 2D6FA 1TUBA 3MFQA 4B8WA 3UXYA 4DIOA 3W7VA 1S6YA 2NV6A 3ZR4B 5FI5A 2HSZA 4X94A 4IMPA 3AR3A 4O4IA 2LCQA 1E20A 2JCSA 1XYYA 4MGEA 1ZAYA 4RIHA 2JFXA 3JQAD 4MP8A 5JVDB 3ICWA 1GTZA 5EL0A 1JX6A 4N5LA 3GPBA 4S0ZA 3EIXA 2GCOB 3COVA 3F5DA 4GM4A 4NMWA 5CLQA 5E1MA 4OEHA 3V8NA 1UBOS 4GC9A 2OG2A 1A3CA 1ZI8A 4MB0A 1RCTE 2P8JA 4XJVA 3CC8A 4EJ0A 3L4KA 1RMTA 4HDQB 2OP1A 4H2DA 1FNMA 2AKAB 4ARZA 4YN3A 2CVPA 2Q5CA 3UTDA 1F1JA 4LXYA 3ZH2A 3AINA 4MHTA 4B81A 1W25A 4QPZA 5CDGA 4WK2B 1SOAA 1GTMA 3ZBTA 1RRFA 2QAIA 4MQFA 3MT8A 2I0FA 2NM0A 3FPGA 3I2FA 3LRXA 1CJUC 4PHTA 5K51A 4CU5A 3ON5A 5CVUA 4D6YA 1L5ZA 3CNHA 4M9XA 5DT9A 5A6SA 3A6PC 1S4MA 4JEHA 4CV2A 3I2YX 4YV7A 2BP7A 5LFAA 1JKIA 4MQEB 3H4VA 4LXGA 4QOIA 1Q0UA 4P7GA 2QM0A 4ZAGA 3ZJVA 4Z2YA 3AG5A 3WKCA 5ALSA 3UUWA 1U63A 4I14A 4WW0A 1MV5A 4GM1A 4OJQA 5DISB 1Y1PA 2D2IA 1Z6QA 1C3LA 3K6JA 4RE5A 3IOBA 1VHWA 3HHPA 1IY8A 5HHTA 1DWOA 4EHNA 2VO1A 3P4UA 3PICA 4IYJA 1DAKA 2OL4A 1YL6A 2ZRBA 1B8NA 4IZOA 4R2KA 4AVYA 1QCZA 4TSRA 1K75A 3KL4A 5E3HA 4RANA 4TMZA 1YFLA 2YYAA 4TV8A 1XZDA 2ZBGA 3PNQA 3I1YA 2D00A 1B6SA 4QGHA 4J16C 4RF3A 3RV4A 4E2ZA 4EO7A 1H2HA 5FFMA 4WNAA 2DBVO 3CEPB 4B7AA 4DR5B 4NU8X 3NTRA 2P40A 4L6IA 3OMLA 1Y5MA 3QF4A 1XTRA 4ME6A 4MLDA 1REQB 5HQTA 3C3YA 1BHJA 3NT5A 3GY0A 2ZVPX 3SFVA 5IHPA 1PX0A 1MQ8B 1Z7YA 4ENSA 1I1HA 2ZSBA 3MSCA 1K63A 4FEYA 4KX3A 4O4LA 4WKGA 3LHIA 1PRYA 1L7EA 1N2GA 3A25A 5IMBA 3CF2A 2G0NA 1MH9A 2GPAA 2PZ8A 4BFYA 4KYVA 5FULA 5I7VA 2HL6A 4MUEA 4R40A 1VMAA 2IDZA 1N77A 3TVTA 4I99A 4U6QA 1CEEA 1YHZA 1F6WA 1U8EA 2PZFA 3E4DA 5FRDA 4CN9A 4ML3A 2WNIA 2J6BA 1S5PA 4QYTA 5IMSA 1JEAA 3C7KA 3KSRA 4JLNA 3LXRA 4PPFA 4URWR 4A5SA 4WEOA 5IARA 4V1CI 1GL3A 2R6JA 1NVXQ 3WB9A 4EZIA 2G8LA 3ND9A 5LDHA 4PXYA 1ORIA 4TMWA 3AL2A 1KAQA 3KYJB 4DDUA 1RZ3A 3RK0A 3SIWA 3MK31 4GO1A 4D8WA 1MCZA 1KVUA 1Y8ZA 1EHYA 4MCJA 3L2OB 3QMMA 4ALJA 2ADOA 2TECE 1EA7A 2V6MA 2XUJA 3M33A 3W7AA 3TRFA 1LNZA 3D02A 1Q95A 3GD7A 1R0CA 1RADA 2GKGA 1P2SA 2PX2A 3CFYA 3OUZA 4DADA 4DUGD 4Q7QA 1Q1AA 2IU4A 3EARA 4HRYA 4RW0A 1E3WA 3A6EA 2OGZA 4LTDA 4U7HA 5HIKA 4ZGGA 2QVGA 1S1CA 3I6QA 2G6TA 4RTKA 2ZREA 2NV2B 4PICA 5CVJA 2IDMA 1A98A 4MOWA 4RS3A 3T1QA 3WLKX 4D81A 9GPBA 3FOEC 4ETNA 1NPDA