4QRBA

Structure and specificity of l-d-transpeptidase from mycobacterium tuberculosis and antibiotic resistance: calcium binding promotes dimer formation
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
351
structure length
339
Chain Sequence
b'LLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,d-transpeptidase LdtB
molecule tags Hydrolase
source organism Mycobacterium tuberculosis
publication title Structure and specificity of L-D-Transpeptidase from Mycobacterium tuberculosis and antibiotic resistance: Calcium binding promotes dimer formation
rcsb
total genus 85
structure length 339
sequence length 351
ec nomenclature
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 4qrbA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qrbA02
3TX4A 5DZPA 3VYPA 4A1JA 5D7HA 5DVPA 5DUJA 1ZATA 4QRAA 3U1QA 2MTZA 3TURA 3U1PA 3VYOA 3ZG4A 4HUCA 4A52A 5E5LA 4LPQA 5DC2A 4Z7AA 4QRBA 3ZQDA 5DU7A 2HKLA 5LBGA 1Y7MA 4A1IA 4GSQA 4JMXA 4JMNA 3VYNA 4A1KA 5K69A 5DZJA 5DCCA 4QR7A 4GSUA 4LZHA 5LB1A 4GSRA 4QTFA 4HU2A 5E51A 4XVOA 5E1IA 5E1GA 4ZFQA 3ZGPA 3VAEA 4K73A
chains in the Genus database with same CATH superfamily
2EYRB 3R18A 5HDBF 5JQ6L 1RFDL 5DRXA 3WFCL 3I75A 1LO3L 3F12A 1PAZA 2CBTA 4XC3L 1R3JB 1BMWA 3WEAA 2L3BA 2YD3A 4UNVA 5F6HJ 4X6BB 1ITCA 3DA0A 5AVYB 4EBQH 4HSQA 4F9PC 3DV6A 1AXTL 1U8QB 5T5FH 3DIFA 5KBDA 4HIJB 2X6VA 3S5ZA 3V6BR 1S6NA 4G7VH 3KLHC 1TVHB 3VFUA 5C2BH 1LLAA 3A4AA 1QFWL 2XX1A 1G1OA 5J5EA 5C0DB 1THAA 2FEEL 4OJCA 4AITA 1L0QA 3MBWB 5HHVH 4C4UA 1NFKA 1NLDH 2AJYL 3GMPB 4CVXA 4MA1C 2LU7A 5TPWL 3G6DH 3FSVA 4H8UA 2IG2H 1H8LA 4DHLA 2QPDB 1WZMA 2XACC 2J73A 2Y5TB 4RIRA 5DJYB 3S3DB 4FQ1L 1H3VA 3LAFA 1I85C 4L4TA 3IDGB 2H9GA 4F7EB 2HG5A 1F1GA 3ERXA 5I6OA 4KUZL 1ZEAL 2AK4B 3C6LA 3HG3A 1U8IA 4JY5H 5ITBL 3D39A 2PW1A 5IJDC 2CR3A 3ZYIA 4FQHA 2YAQA 1MHCB 2BNQA 4LPQA 4V2CB 3BUTA 4PG9B 4ELMF 4TQHA 5KYYA 4GXVL 1RMFL 2NTFB 5JHMA 1IU1A 3APMA 3ZYOA 3ULVC 1DLHB 1N6QL 4FQJH 3LKPB 5GZNC 4E41E 1TMCB 1IGCH 4I0KA 2J6EL 5KYUB 5FAAA 4GKLA 3KDMB 5CD5C 3C5ZA 3B2MA 4H1LH 3IRPX 1MI5A 3HUJF 1IGIL 5LGYA 3KPNA 1LWHA 4JDZA 3HAEG 4NQEA 3QORC 3DSFL 3QRGL 5L4MA 3TBTB 3ZTDC 3GXPA 4HH9A 3DX2A 4B5EA 1AQHA 2PMZA 1KPVA 5IIEA 4LDLB 1JD9A 1D9KC 2YAMA 1U8CA 4JR9L 2J21A 3JUYA 5L8JB 1U30A 2ESVE 1J8KA 4PGEB 3HR5B 4U1MA 4DUWA 3NCXA 2EZ0D 4H0LC 5AAMA 3RZCA 4N0FA 5B38B 4XX1G 1SYSA 4QGYA 2LFEA 5CJOL 4G72B 5T1LD 2BHZA 4PS8A 1BZ7B 1BYOA 4EN2A 3UIZA 2GT9A 3S6CA 3UXFA 4LT7A 1OGTA 2WO4A 3A6BL 1PEZA 1G7JB 2A1WL 3ARED 2OW6A 1NC4B 4JM2C 3BZ4A 4MDIB 5E08L 2DQGH 3DVGB 1S7RA 1Y07A 3F7RA 4GKZB 3QIUA 2V9RA 1R3LA 7PCYA 5TJWK 4ZZKA 2O6FA 2CXGA 3IEAA 3ZR6A 2DW5A 4C4KT 5C0AE 3GNML 2AK1H 1KN4L 2BXZA 2EXWC 4ANUA 4NHUB 2DICA 1C16B 1JGDA 3L7EA 1LVEA 3B6SA 3EJYD 1UG9A 5KSAD 5T1JA 1I8MB 2DM2A 1Z5HA 3TO4B 4B9CA 3VD1A 3LB6C 1GR7A 1RI8A 1RUAH 2K8MA 4MMZC 2PABA 1OAJA 5HGAA 5AD0B 4PJGA 1G6RB 4JGUA 4BFEA 5I8CB 3VO0A 3W9EB 2OMTA 1OK8A 1OT2A 2A74A 1U8MB 5T8IA 2WTOA 4EBQL 4UTAA 2PWDA 2Q8AL 3OX8B 5AW7B 2FX9L 4XXDB 4U7MA 4X4YB 3ABLB 2WZPD 5AB0A 2GYSA 2JV6A 3UYPB 3QIBA 4PRPB 4YVNA 4ZNCD 5LGJA 1CQYA 5MEOB 2XN1A 2DD8L 2HP4A 5EOCL 1GXEA 3L1OL 3MRPA 2EIKB 4RNRA 4YNYB 3HJEA 1MLBB 4HIIB 2VTFA 1MJ7L 4UZSA 3B9KB 5IFJB 4NHCH 4DN4L 1CLZL 1V7NL 3HB3B 3BAJA 1KYOK 4IJTA 3HG1B 4UIMB 1YYLH 2YLKA 5CGBA 3LN9A 1MHPH 1EVUA 2JMRA 5K9KA 1V3LA 2AANA 4JFOA 1RMFH 3GMRA 5DEGB 1KGIA 1IEAA 5GSRB 2XC8A 4ZSOE 3VCLB 4FYSA 2LAAA 2OP4L 3IFLH 3RJOA 3WDHA 2Y7MA 5DS2A 5K9KB 1YC7A 3BKML 3KL3A 4Z7QE 2O6DA 1A7QH 4DGVH 5JZ7D 1O9WA 4HUUA 1N8ZB 3IN0A 3N43F 2P4AB 1XCXA 1IGIH 4NAQA 1MCDA 4ZUTB 5LAPA 3OLDA 4AKPA 1A4AA 1CGTA 4YNYA 3MV01 2XG5A 3KYOB 5GZND 2Q7NA 2F7QA 5I1KL 2HLAB 3C2SA 3K5SA 4WI9A 4JFDB 3WN5A 3U9PL 4D0DA 4GAJH 1X7SA 3PAVA 5BV7B 3ELQA 4W1TA 1QA9A 2BVPB 3PWJA 2ZWSA 3NZHL 4LQFH 4O02L 3MRKB 4AG4H 4UV7H 4AKQA 1C12B 2VN3A 1U8MA 1E8ZA 4IBSA 3AG2B 4OLVH 4XN8A 5F7EH 3JVFC 4MJ2A 2HCZX 1D9KD 4M7LH 5K59F 4G9FA 2DYRB 3X11B 2EE2A 1UXSB 2G9HA 4FJZA 5EBMB 3EHBD 3O11B 1KGWA 5T1DL 1I7ZB 3PPSA 1OW0C 2UWEA 3OB0H 1MFBL 5DRWB 2J6WA 1ZIAA 1CD8A 2VERN 5IREA 2JJUA 4MVBD 4NRXA 1KEGL 3VYOA 3P4LA 3DUUB 3PNRB 1QLFA 3P9LA 1LEIA 3GJFA 4XWGL 1GPOL 1WGVA 3AAZA 5EV7A 1MW3A 3KPQB 5T33H 4NFDA 4C58B 4N0CD 4XNUL 3OG6B 5D9SA 2FX7L 2ZOTA 1AMYA 2BCKA 1MFDL 1QYGL 2BZDA 3ARFB 3LH2L 1ZK9A 4YL9A 3MXVL 4HFWA 5T3XD 1ZVSB 5E2TL 4Z7QB 3ISRA 4AEEA 4C83A 3AM8A 4X9BA 1ZVNA 1TQBB 3CH1B 4F93B 3E6HA 2EXSA 3BD3A 3TXAA 2CCLA 5CZXC 4PBXA 4TQEL 4P2OB 4L0ZA 4M3JA 1YY9C 3A21A 4ZO8A 3N2JA 5FUCC 3UX9B 8FABB 3VVVA 1L5GA 3GMMA 4P5TC 5EOCJ 4MQSB 5FPIA 3OKMB 1FNSH 4JZOA 5HDWA 4NUJB 4XBPB 4WTQA 4WW2C 3PDOB 4OLZH 3VA6A 3EYVA 4X42A 2YPVL 4QNPE 5KSBB 3NACH 5IMLB 3EUUA 4A7UA 4RISL 4HXAL 5L4FA 4ILDA 1OPOA 2GC7C 4HKZB 4PRHE 2AQRA 3D9AH 3JTTB 5I0YA 4G83A 5AKRA 5HGHA 3GBDA 1U6AH 2GUOB 3SOTA 4A2HA 4OLWH 4CJ1A 2E6QA 4ANXA 3FQRB 4JHAL 2ZWKA 4ORZC 2WLZA 4BXSV 4UQ3B 1ZGLM 3QORA 1HZKA 1FRGL 1NWOA 5I8EB 5ACMA 4U6XB 5EN3A 2AEQL 4GQZA 4N26A 2A9NH 2VM4A 3Q48A 2V3DA 4HS6B 4JN2A 4PBDA 1JPTH 3HG0A 3SE9H 1CL7H 4EE2A 5FOBB 1KDIA 4Q6IC 4J3XA 43C9B 2I9TA 2C9AA 4TYUA 2YSTA 4E41B 4ZFGL 1KPRB 1INEL 4LPCA 5EA0L 1CD9B 1EGJH 3QHZH 3BO8A 1ZPUA 4EN3B 1MVYA 4Q7DA 2J8HA 5HVHC 2XYBA 4LLUA 5HPMB 3TJHD 4A68A 1Q38A 4N5UA 1TZOA 1AHMA 4B53A 2XZAH 3IBEA 1AHWC 2UZIL 4RIRB 5EF0A 2J55A 2P9RA 1K3IA 3DGGA 2YIHA 2X12A 1MJUL 4XRCB 2EACA 2QPEB 2W0KA 3MLSH 5CNHA 2WINB 4RCAA 3QNFA 1M05B 4XAKE 3ZDXB 4GMTH 4NKOA 3Q6FB 4XP9H 1TOXA 4XN4A 5DZPA 5I6PA 3D08A 2CLRB 3NABL 4HYTB 1ZDSA 4UMGA 1S8DA 4Z7VA 4R7LA 1U58B 2EDXA 4X4XA 4I3RH 5C0DA 5BRZD 2GI7A 1CFVH 1VGEH 1DVFB 3KLKA 4G6MH 4OM0H 1KWKA 1JYWA 3D30A 3L3GB 3SDDC 5HD8C 2P5ED 3P73A 4GH7B 3V10A 5C9JB 4KNUA 5IMKB 3DIFB 3VFVA 4ZFOA 2WLMA 2VXVL 3DBXB 3BWZA 4F80A 3NG5A 4WZ9A 1DN2A 4YDIH 1X5HA 1MFEH 2NY4C 5J12C 3WFHB 5JW5A 2WWKT 4F33A 1YDPA 4YJZL 4PRDB 4ZS7L 4LVNC 3EHBC 4BWWA 5EU6E 3Q3GB 3SPVB 2LAGB 2IAND 2ID5A 2WUCL 2DKUA 4DGWC 5DD5L 3RI5K 2J4WL 5FM5M 4CC0A 2Y25A 4EI6A 3ILDA 1MUJB 4Y8AA 3TYGL 2A4ZA 2Q76A 3D0VB 2R69L 3D4CA 2NNAB 3JV4A 2ARJQ 4P57A 4HSCX 1IGML 1DQJB 2GJ6B 4UILH 4CA4A 1A4JA 4PJEA 5HHOD 2X2IA 3AS0A 1C5BL 4LF3A 5I9QB 4KQ3H 2DQMA 3OAYH 3BRFA 3NRFA 1E5BA 5AW3B 2F19H 1SFDA 3E0GA 4MMZB 4NN5B 2W8CA 1ZV2A 2EICA 2FJHA 3B3IB 1CXLA 1JXKA 3SKNA 1Z0MA 3QI9C 5HJGA 5JR1L 2E9IA 2OMYA 1GH7A 2A5UA 2R2HB 3RWEA 1U2CA 1W72B 3RUGE 1YN6B 1UA6L 2DD8H 1DHKA 4MX7A 4NNYA 4Z7WA 4OJFH 3V0VA 2UZYA 1D3CA 4MNQB 2H8PB 4DQOL 4PH8A 4XO4A 5ITFB 3TBVA 2YJQA 3F7YA 4GB9A 2R29H 4F8QA 1CDCA 4CW1B 3G6JE 2EABA 4FXKC 4Q6IB 1OSZA 5CILH 4X8JA 3VRLF 2KI6A 3AM8C 1G0DA 1UXWB 2ICEA 5E2WH 5HVWA 1AIFB 4WY7L 5AB2A 2VDNL 3B5GA 3O3EA 1IV8A 4HJJL 4X99B 2MCG1 3HE7C 1FG9C 1MI5E 3QIBC 2OP4H 1YUHA 3IFLL 2WZAA 1B0RA 1JFHA 1F00I 3DUSB 2QKIC 3OJVC 4UAOB 3RU8L 4HH8A 2A38A 3D50A 4Z7IA 1QSFA 4H88L 3QEHA 5D7IA 1IC4L 1TVDA 4NQEE 4E41D 4WHYH 3WGVB 3CXFA 4HK3J 1ZXQA 4X99A 3WNPA 3E9UA 5KEZA 5E4IA 2A83A 3QSKB 4P9HH 2CHWA 3ZDWA 2DLGA 1LP9E 2X4QB 1I9JL 2C1OA 3H9HB 4G1EB 4OI8A 3FTZA 4A6YB 2LLLA 1M6OA 4L5FL 4XBGB 3VI4E 2WOYA 2R0LL 4QGTA 2GSGA 1NCCL 1OT4A 3N3EA 3W5MA 3KBEA 4J27A 3H3KA 2JQAA 1BG9A 2V8LA 2XTJE 4MNQA 3H56A 3PWPD 4JO4H 1WEJH 1U3ZA 2GY5A 3T65B 4CU6A 4F9LA 1A1OA 4B97A 1NMAL 2P5EB 2QVFB 1KF9B 2IGFL 2YN3A 3CQFA 4U0RB 1CFNB 1TVBB 2I69A 1JGEB 3ECUA 3PWVA 1T6BX 4G7RB 3MBEC 3X13A 5CGTA 5ID1B 3SKNB 3TYFA 5A6LA 3K2MC 1I1AC 4MMYB 5D8JH 5EZIH 3D09A 1YNLL 3WUWB 2Y2WA 3GSNL 4PLKD 1CBVL 4APQD 1XAUA 2RH0A 4HCFA 4K9EH 1A6WH 3HJ0A 3NJMA 5GGRB 2JCCB 4IIQC 2ITEA 4MD0A 2W9DH 4KJYB 1DQJA 3B34A 1QFWM 1WBZB 2C7UA 4PW4A 4JO1H 3WFBL 1YCSA 5F89B 3VE0B 4G9DB 3N1FC 4U1IB 1RSFA 2BHFA 3MPCA 2H7WA 2B5IC 3L4TA 4OTXL 2HPTA 5EO0A 2HG0A 3VXUD 1HQRB 2VJ0A 1HZLA 1OK0A 3BGFB 3P30H 2XLLA 4TNGA 1U42A 5CHNB 3LDBB 1YDPB 3HG4A 2WQUA 1X5JA 3RUGF 5B7FA 1B4TA 1NOAA 1X6NA 5DZOA 4I48B 2V8MA 3LRGA 2X4NB 3L4XA 2R2BA 3FRUA 1KCWA 3CZSA 4PV9B 5C0BB 5SV4A 1MFEL 3CFBB 4F15B 1BM7A 1N9PA 5GHWH 3WHE0 3QJQB 5C6PB 5D5MF 2L7JA 4Z7VB 1P7QB 2DM3A 5ISZB 4JKNA 3MAWA 1VZGA 4KX8A 4Z0BL 2DIEA 2DV6A 2V7NA 1U36A 3BPCB 1TQBC 3F2LA 1U8KB 3ARTA 3QR1A 4OZHB 3V4LA 5HSFA 5DD0H 5C0BE 4JL2A 4IOFD 1T1YB 3PP4L 4XHJC 5AOKA 1WUNT 2YUZA 3LEXB 4JFPB 3UROR 1P4IH 4PI2A 2DQFA 4Y1TA 3MLWH 1ZJBA 5KANI 2FX9H 1XZWA 2J43A 3KCPA 3REVB 4MD0B 4KPHH 5I24A 1ZLVK 1NFDF 4IBYA 5SX4H 1V10A 5I1CH 3EG9B 3L13A 5C0JA 2FBOJ 1XBRA 9CGTA 3TEUA 3TS8A 2Y6SD 5I15H 3CX2A 3P3UA 4PJ8D 1R47A 3K4ZA 4ZQTA 4XN5A 2BXYA 4WRLA 2OMWA 4IRJD 4QJ5B 1E28B 3MVSA 4CN1A 1P5VA 4R7VA 3NIFB 1MZYA 4HCRA 1JXJA 3GI8L 4AYFA 1A6VL 4CU7A 2VISA 3TO4C 3BQUD 2CE6A 2A9NL 3O6MH 4KDWA 4ACTA 1I31A 3GQFA 4UCFA 4Y9GA 1DQDL 4NQCD 3MCYA 4MJ6A 5LXGL 4S11A 4BFOA 4KFMA 5EA0H 5CINL 4A1KA 3H9HA 4DETA 4CBPA 4TULL 3T0VA 4PIBA 1KGUA 2EC9U 4TTDD 4FLOA 1ASOA 2E5EA 4ONOA 4LCCA 5BQ7B 1NBCA 1CDUA 4JZOB 4ABQA 1D7BA 1RUMH 1FG2A 1HEHC 2Z35A 3HB3C 3HI5L 1S7WB 5HGGS 4U1SA 4X9YA 5AVUB 3T0XA 1UQSA 4ZFFA 2JELL 3IPEA 1E8WA 2COQA 4LQFL 4O02H 3FO9B 1UH2A 1JDDA 2HB0A 3ZZ1A 5DMGC 1DVUA 4MFHA 5LBSL 4EDXB 1AZNA 1ESOA 2MQCA 5F7EL 4C83B 4CW1A 4O4YH 3THMH 4JO4L 1KJ2B 1J1OH 3L5IA 3Q2NA 4WFED 4R96B 4ELMB 2NT0A 2ZX5A 4HUKB 3D69B 3RL2B 1B2WH 1JWMB 1JWSA 5G2NA 4Y2NA 4NGHL 3BJ91 2ZP8A 4TNWF 2HT4D 3L6FA 6FABL 1FBIL 4FQXA 5AKTA 2VUKA 3F58L 5B21A 1R1CA 1S78D 5E6UB 1KTLB 5BS0B 1GPOH 4IKNA 1GGCL 1NGYB 2RAMA 4WNQB 1W15A 3FL7A 3PNWA 5DRWA 5DMKA 1JGLH 5JDSA 1GAFH 5LJYH 1YEHL 1DBBH 3QO0B 3HAEH 1T5KA 4YGAB 5EEUA 3NJKA 1CYWA 4WFHD 2Q76B 4A63A 3NA9L 4ENED 1WAAF 2Y7SA 5TTRA 2CDGA 4LZKA 2W65B 2FBJL 1LO5A 4H8QA 5E00B 4PJXA 5EC1A 4L18A 4GRLB 4YGVB 5F96H 1YECL 5FYKU 1FL5A 1RD6A 2PPFA 3IFNH 2WXLA 1CGSL 4OZGA 5HI3C 2V33A 1CZ8L 3RY4A 3DI2B 4DK3A 3EBHA 3BPLC 4CADB 5JR1H 4DP6X 3D2UD 3HS9A 3P73B 4D0DB 5C9JA 4HJTA 1ROWA 2R29L 4X8CA 2Y36H 3VI3E 5GGTL 2YA0A 1LP9B 2NW2B 2HFEA 3CNKA 4S1DC 3TV3L 1IUZA 3S36H 2A0LD 1J12A 3JWDC 4POUB 1FSKC 3O2VH 4D9RD 1YAIA 4YZFF 1N8ZA 4HUUB 3B7UX 1HCFX 3PP4H 5BZWB 2OAAA 1V7MH 3HBZA 3PWPE 4OJDH 2IBGA 5B8CA 3P4NB 1IE4A 1HSAA 1S4IA 1AD9B 1SY6L 5JO5B 4NQXB 4MB3A 1F4WL 4F9PA 5KSAB 2Y6SC 1DVTA 3WIHA 3ZOAA 5DEGA 2VXSH 4XPGL 1UURA 5T1MA 4JGJA 2HFFB 1C1EL 3MBEA 1A6ZB 3GHBH 1ZTXH 2IAMC 1F3RB 3SQBA 4Z9KB 3DK0A 2VZTA 4F37F 3ZQXA 1JZFA 5JLZB 2R0LH 3DIVA 2J5LB 3R06B 1AQDA 1QW8A 2F7RA 4WO4A 3O0RH 3RA7L 4IOSD 4BKLB 4HS6A 2KDGA 3CQPA 1S7VB 1T20B 4OD1H 3QIBB 1SNRA 5BRQA 1NSNL 4JVWA 3AREC 4W4OA 1FCCA 2RD0A 4J39A 1N4XH 1Z9NA 4XVSL 3G9AB 4QMEA 4YDIL 5DD6A 2FAUA 1T0PB 1GY2A 2IDCA 3CSBA 1SUJA 1AQ8A 4AMXA 5D1ZA 4C56D 1R3HA 3BPNB 5EIIA 1BOGB 2PETA 4M8VA 5HGAB 4LNRA 4GS7C 2DQJL 3HE7A 5CP3A 3B7RL 4RMWA 5KSBA 1MH5B 5J7CC 5SWQB 5IF0B 1MG2C 4QRSA 4JO1L 3WFBH 5F6HI 3QUKA 3MROB 2Y3AA 4LK4A 3EJQA 2OTUB 2XVLA 3MUJA 3TJPA 5L7XH 2JJSA 4Z1PA 1ZSDA 2WLJA 4R0LB 5B1JC 1TKWB 1YYMH 1C5BH 2OMBA 3MCKB 1BW8A 2OCCB 3GIZL 4NRZB 5DO2D 3VGBA 3VMOA 2MWCA 3BEWA 2HVKB 2JIXA 3L5XH 3ZPDA 4HSAC 4FMKA 4KRLB 3DVGA 3ULVE 3MJGX 2MCMA 3B1UA 4XPFH 1CL7I 3MLUH 4HFWB 4XR8C 2FEDC 4ODVH 1TQCB 1S78C 4KRMB 4Y16C 4Q58C 4JHVA 1BZ7A 3NA9H 3RUGA 2VXQL 5I17A 4D0BA 1IGMH 5I66A 2Q6WA 5B38A 2MPAL 4FOMA 1MCQA 3ASOB 1MWAA 1QASA 1R3KA 4HMCA 3WDJA 3TNMA 2Q8AH 2Q8BL 5BNXD 4RRPG 2Q20A 3CJJA 5C70A 4QO1B 4XVJH 1T7XA 1O6SB 4PJ8B 2CZNA 1OD9A 4JE4B 3WAJA 1GAFL 4I8DA 4HGWA 4BFRA 4YSEA 3OXRB 2E9JA 3WLBB 4Z7NE 5CR1A 4RMQA 4AVJA 3O11A 4GSDL 4K7FA 1EFQA 2NNCA 5AG8A 1CXHA 2EC8A 5JOFB 3B5HA 3AXHA 3FS9A 3PWNB 1MH5A 2AXWA 5HHMD 1FNFA 4NZDA 3NSFA 3IXAA 1RK0A 4TLSA 2EYTB 4ODXA 5JW3H 3DHJA 2DEWX 4FTVE 5FYJL 1MPAL 2CUHA 4KMTL 2W80C 3K5RA 3TO2B 3CPLA 4WI2A 1MI5D 3IMWA 4TLTA 3RDTD 4YSAA 4K55A 5EOQL 5FFLA 1V8HA 2W9EH 4QTHA 4CMMA 3T6VA 3GBNL 5ID0A 3FCSB 1GC1L 4FZ8L 4FTVB 4IBLT 1LQSR 3RVVC 4ZJ9A 2HLAA 4U2ZA 2E76C 3Q44A 1CU4L 3IB4A 4JVUA 4HG4J 3NCWA 1J5CA 4PREA 4IRSA 1ICTA 4JB9H 5HYQB 3QJZA 2FT8A 4B95C 3QUZB 3VA2C 1RUKH 3BDYH 2Z93B 2X4PA 1FVDB 1I9JH 2H1PH 5E4EB 1P84J 3L9YA 4UB0H 3BZEB 1XIWB 3LEVL 4MAYC 4WI5A 3NIDB 5C07B 5C09E 2V0AA 4NS0A 5DJYA 1KIUA 4LASL 4Y2DC 2F0CA 5FFGA 2IQAB 3GMRB 5I5IA 1J9QA 2ZPKH 3NFPB 2RFXB 4OLVL 3KGTA 1S5IH 2AVGA 4YSUA 3ARGD 3G6AA 3WHXB 3QQNA 1Z9LA 4LHUD 1XF2B 4KNQA 4JJ5A 4MMXB 5GJSH 4OCRH 3BAXA 3KWWA 3V4PB 4APQB 3OBAA 3L2LA 1KCBA 2AGJL 2F54A 1GZQA 4OM1L 3ZYJA 1U33A 5D7IF 1KBPA 3TT1L 2V37A 2NY2C 4OZGF 1NM4A 3VXMA 3FFCA 1MCOL 4IEFB 1EVTC 5F1IA 4NPYB 4PRID 4RBPK 5DLMH 1JZIA 2EYRA 3CZJA 3ZT5A 1WYJA 1PVHA 1MF2L 5DC9B 4L1TA 2FTAA 3SGDH 4Z76A 2HKFH 1JZ5A 1KOAA 3TASA 4PVBA 4EVNB 2BOBA 2VNCA 3L7EB 3LZPA 3V4VB 4Z7UA 5C97A 3CN0A 5BV7H 3FOMB 3HCVA 3K0YA 3LN5B 2DYSB 2JNZA 1Q0YH 1PDKB 1SMDA 4JX0A 1F3JA 4PJCE 4X6FB 2JB5L 5KJ4A 2ORBH 2IAMA 2Y9RT 2FX7H 1SM3L 2APXA 2D3VA 4WUUA 2LW3A 3FO0H 4HETA 3H3BC 4KKCD 3VFMA 1E7VA 1LO4H 1KC5H 3BAWA 5ESAB 3KL0A 5H35A 3SEPA 1WAAA 3UIYA 1OP5H 5I1JH 4PSRA 4M93C 1OQXA 3HUJA 3T71A 5C0FB 2VDOB 1SVBA 1K9TA 2AJ3B 5DTFA 3RY5A 1M71A 3CZGA 4CILA 1TO4A 3FTWA 1KJ2A 4PGDB 2Y0SA 4N0FB 3QYCA 3DXAB 4MMXC 3KPLA 3H4FA 4X5PA 2ED6A 4G6KL 4U1MB 4WKZB 4P2QD 1Q9KB 5DFWH 1TJGH 4JFFD 2MQ0A 2OJ1A 3RGBA 2JKXA 3FZUC 3SKMB 2JB6A 5J1AB 1PG7W 5DZNA 5J11C 2F6AA 2NXYB 3NDZE 4JY6A 4F3FA 3BKJH 1MXDA 4JPWH 2QLYA 4L1HA 5I1IH 1OTTC 1IAIM 4RQQB 5IB4B 3BMVA 1QMUA 2PYEE 2XN9A 3N41B 2C3XA 5JW3L 1UENA 2D3LA 4QRRB 1TQWA 2AXJA 3PS6A 2W07B 3Q7JA 1MZZA 2OSLA 4MNQD 3DRTA 5DLLA 1NH6A 3IETA 5FKAA 1UZ8B 1MJ8L 1T7YA 4XMKH 2NY0D 1VGKB 5BXFA 5F9AC 3CLFL 5E95B 3HBQA 1EAPB 3L5HA 1E9OA 2ZUSA 3C09B 3UJJL 4R2GD 3T6QC 4HXBH 3UG3A 5EWIL 3CHPA 3GMQA 5CSZB 1HOCA 1U21A 1NUDA 2OMWB 1L7IH 3H9YA 4FAAB 5HYJA 2XA3A 4GAYB 1FE8H 3RL1B 1JDAA 5J12B 2NXZD 5IJCC 2WXNA 4W9GC 7FABH 1FBIH 3PV7A 2PCYA 3EO9H 4FMVA 4DW2L 1IX2A 2FDBP 3ARUA 3NIFE 1NFDA 4JG1L 1LE5A 1A1MB 1CDIA 3GT6A 3V79C 4JFZL 3US0A 3FO2B 4WCYL 1DQLL 3K2UL 1FO0A 4NKMB 1VFBA 5ADOH 4G6AC 3SKUD 2IDQA 3OR6B 1EHLL 5I1EL 3ES6A 1IQDA 1B0GB 3CFDB 3MLZL 4OCSL 4WO4C 4FL4C 4Z3TA 5IVZB 1VIWA 1WK0A 1NAKH 3DPBA 4ZBJA 3VGDA 2HPOA 1QI3A 3GSWB 1H3UA 4P3WA 1CPUA 3HC0A 3NZSA 3QA3B 1SUHA 1MDAA 3HNVL 5EU7C 4N2NA 2TRYA 5ISZA 3MRDB 4ABUA 4PVLA 4DFHA 1WT5C 4XMUA 1VB9A 1SHWA 5EU3B 4UT6L 1INQA 3OB8A 4JFVA 1P7KB 4L8CB 4OAWA 3BYYA 4HWEH 4G1MA 4KDTC 3SIKA 2G3NA 1HEZA 2XQYA 2K78A 5SWSE 2PUQT 4GI8A 4I5BA 1T5XB 3U7WL 1TZGL 1S9YA 5HDRA 3ZRFC 4IK6A 3GLAA 4PGBB 1HWGB 3OR7A 1IBBA 2R29A 2UWEF 5AW6B 1NIDA 2PO6D 3LXAA 5CMAB 4M5ZH 1RUQL 1KG0A 2W0LA 3MI6A 2D0FA 4JQIH 3GXUB 3HC4L 3DIDA 1T66C 5G4MA 3DX1A 12E8H 3MJ9H 3QEQD 3WD5L 4JGMA 3STBA 2EIMB 2VXSL 4UDUA 2J1XA 5BUGA 4WJ5A 1Q9LA 3UFIA 1UD6A 1C1EH 4GIAA 4F7PB 2DQEL 2HRGA 3H9SE 1SHXA 3B7TA 2Z8RA 1E4XH 3SYPA 4KGLA 3GUTA 1O6VA 3X13B 1S3KH 3HBGA 4AYDC 1DYZA 1TVBA 2QSCL 4JPWL 4F7PA 2GTZA 5DJDB 5EOQH 4FZ8H 5GZOC 1HXMB 5F1NA 4IGBB 5HI5D 1UWFA 3MGTB 4XZUA 5L0QB 1V55B 2CMRL 1UADC 3R7RA 4ZFOL 1G9MC 3U1SL 4GT0A 5HJBA 1JJUA 1QRKA 4HKXB 4KVCH 4ZFGH 2V9QA 3QNYB 3S48A 4HIXL 5CN3A 4N2GA 5FYJE 3LS4L 2WP3O 3N0AA 4PLKC 4Y0GA 3TWCL 4APQC 4GO8A 2C1OB 5JW4N 1UJ3A 3C75A 1XGUB 4P3DB 1EEYA 4ODWA 5L2JB 1QPXA 3P9MB 4HLZH 3QEHB 4MJJA 1BPLB 1PX8A 1DFXA 1P69B 2AV1A 2DQIL 3RTQB 1FE8L 1GYCA 1LO2L 3SDAD 4IHOB 4ZNEE 3WO4B 3A67L 4GG6E 3MR9B 4H25A 4PRHB 1ZWIA 3VWJA 3O3EB 4X6DB 4GAFB 3KPSB 5D72H 3OKOA 1NGXA 1KNOA 1G1CA 1P4LB 2VO5A 4LVHB 3U0PA 2B59B 5C08E 4RWYL 5FK9A 5D93B 4XMKL 5E5RB 5F44A 5C0CD 4NBZB 5EEXA 1IAIL 4ZD3L 2J20A 4U6YB 5MI0C 1JYNA 5DVKA 3GKWL 2F2HA 5ITFA 1DVYA 3BVNA 1ZVHA 3ZO9A 4OZFB 3D85B 1J48A 1HKLH 1PSKH 2CBQA 4FKEA 2BSED 1N5AB 3CFDA 3WS6C 4FNSA 2Q3XA 4BQBA 5IP4A 4FI7A 3JTBA 4LLVB 3CUPA 4LLWA 3D51A 2W9LA 5FDYA 4A6YH 5D7LA 2JCCE 2BOCB 4JCLA 4PS7A 1Z2KA 3U4EA 1PKQB 4H8WH 2BZCA 3ABZA 3GRWA 3WIFB 5T3ZE 5I73B 2MTAA 1K4CB 4ELDA 3OKKA 3MV8D 4GW4A 2BJML 4NZTL 1JV5B 3D0VA 4YHYC 1Z9PA 3GSUB 1C7TA 5DJAB 4EXKA 5BZDA 5ES4B 5B7MA 4O5LH 1XWVA 1AH1A 1PZUB 5AAPA 3IWUA 4QWWC 5AZEH 5CZRA 1B2YA 4PJ8C 1XF5B 5D1QD 2GFBB 4GKSA 4AQOA 3L48A 5LN8A 3RKDC 4UM9B 2OK0L 3ZMEA 2IGTA 1HHGB 2BSSA 4Y5YA 3MJ9L 4D8OA 3DVNB 3DO3A 2FQDA 1YEJL 4LHUG 1T2QL 1DEEB 4ZPTB 3G6JF 3S9DB 4WWPA 4H20L 1Z6JT 1BQHB 4I2XB 2EDLA 2WM0A 4NQDB 4OQ1A 1N8OE 1A21A 2IH1B 3VGAB 4PJFB 5JXAH 5EZOL 2DKMA 1EFXB 3ETBF 4YBLC 1DE4B 3S88L 5F7LB 4RVBA 3RZWA 4Z78A 3D9AL 4URKA 3V9FA 1QZNA 1G7IB 3MLWL 1UD3A 5ANMB 4AYEC 1K6QH 4WHCA 3TA3C 5I1IL 4A39A 4QRFA 2J12B 4HOMA 3DXAA 3BE1H 4DIXA 2PP9A 4UINL 5ERWB 4BUQA 3GB7B 3VD7A 3F64A 3X2QB 4J23A 4M7JH 1G7LA 3OD3A 4FNUA 4JFHD 4MNGA 5EZLA 2E7DA 4XPBH 5H35B 1ZS8A 2G3ZA 4I89A 2VZOA 1AHKA 2APFA 4MAUL 1MHHB 4L1SA 1OAUH 1FP5A 3AACA 4DOHB 3N44F 2PXYA 3LKNB 4HD9A 3FO1B 3DVFA 4WO0A 1WCBA 1UGNA 4JFFE 1NDGB 4K7PL 5K1VA 4X4MA 2XTSA 4IIQA 4QCIA 2VOTA 4JDEA 2OCFD 4F1ZA 2J88H 4FQIH 3MNWB 2Y06H 4HMDA 4AY0A 4AH2A 4WI3A 4BZ2A 2X89D 3EDJA 4Z7UB 2A9BA 1KENL 3UZQB 1OT1A 4EVNA 1JNLH 1S46A 2D0HA 3BKCL 3IDJA 4QUOA 3RHWF 3FFCE 4LLYA 2P45B 3JTTA 4QOKD 4ZSOA 1GZPB 3K6SB 5ETUB 4WGKA 4YHLH 5HI4C 1ZANL 3LD8C 2O6CA 3G5YB 2Z6FA 4B9GA 2BIHA 2ROYA 1HXKA 4K8RD 3UJIH 4XOBA 4F9LC 3FUIA 3SGEH 4DCQA 1E9PB 3QIWA 4PD4K 4HKJB 3FONB 2WO2B 4PV8A 1FLRL 3FFCB 1L5GB 3G04A 5I0WA 4HPHA 4ENEC 3I6SA 3F58H 3CMOH 3DX3A 1A8JH 3QS2A 2KUTA 3V0IA 3BZFB 3LPOA 3HNVH 35C8L 3UZVB 3AROA 1JZ6A 4JDTL 3DJ9A 3RVUC 3ZKMD 1BJ1J 4W9IC 4PJCA 4H2AA 4APQA 1DBMH 1IM3B 4NP4L 2B20A 3RY6A 3LZNA 4BE5A 4J8RB 1EH9A 3ARDB 2R0WH 2G2RB 3UC0H 4MA3A 1ACXA 2XNAB 3ECQA 3GF8A 3G6AB 5JA8B 1S7TA 5CIPH 3LQZB 3F8UB 4S1DD 1UKSA 3KLSA 3KPOB 4PWKA 1ZIBA 4FEMA 4KX9A 1ETJA 3UDWC 4IGBD 4XNXH 4GUQA 3EYFA 4K23H 1FJ1A 3PRZA 4G82A 3PWPA 2XTJC 4MKMA 1KTKE 4GFXA 4KDVA 2H3NB 3HAEB 5DD0L 2LVCA 2C9PA 4LLYB 4G6KH 3LQAL 5DDHB 1U8LA 2HRPH 2WGXA 4LPUA 3H4HA 3BZEA 3FQTA 5FDWA 2K4AA 1KJ2L 1ES0A 3A6CL 1T0NA 4QHMA 4P3CL 5TQ0L 3C5JB 3KCWA 5E51A 5EBMA 4N6RB 4DEWA 4RFNB 5I1JL 4L8BA 3E2HB 2BNRE 2IAMD 2ARJB 2QQQA 2I07B 5SWSD 4GAGL 2NR6C 4MA7H 2YGPA 4PHZA 3GC3A 1MHHA 1YPZF 1X7TA 1YHPA 1T83A 3EFDH 1G9HA 5E0FA 2OYKA 4CC4A 4U7SA 3AT9A 3M7OA 1VF5C 2F74A 3GXMA 4X9GA 3MODH 3KYMA 1WS8A 5E2WL 4Y4FA 1VDGA 3GI8H 3MV9B 3T04D 5E6SB 4I0CC 3C60C 3D4YA 1TEYA 3WEXB 4LNVA 1M9WA 2K6ZA 3ALWA 3M6DA 3O2WH 2CMRH 1RH8A 4J3OF 4LVHC 1MQ8A 3BLPX 3RPIA 4AXWA 3HMWL 4YO0B 3H8NA 5D55A 4ZUTA 3ZYZA 2KDYA 3S88H 1MCSA 5F71A 4NUMA 3BT2L 1K5NA 5DDHA 3VNYA 4MYWB 1EHXA 4JZJB 1NZRA 2VB5A 4OLXL 4A67A 2K7PA 4HJ1A 4R7NA 3LKQB 5DI8A 4FG6D 2QMKA 3K2IA 3DVNA 4F57H 2GI0A 3VXNA 2AP2A 2RJMA 3MRMA 3V0HA 1AGFB 4Y5XB 2JI3A 2A3TA 3IXTA 3DJTA 2BW5A 4JG0L 4WV1B 1PY4A 4L2LA 4LPXA 4J8RA 1HT6A 3RGHA 1TT6A 2K3HA 4O9HH 4FFZA 4M3HA 1WJ3A 3NFSH 4HAGA 3K7UA 2N3JA 5CSGA 3AJ7A 5F7UA 5IUCA 2OR7A 1HIMH 2JIXB 4AW4A 2IALA 5T1DH 4M4PA 1ZY9A 1H3GA 3PV6B 2ATAA 1A4KB 4PJBE 1NMCC 1N64H 3GZOA 1HINL 2B1HH 5IB1A 5J6HA 3UTSB 3ZDYE 1XGZA 4X4YA 3WIFA 5GZOA 4L4TD 1ZT7A 1WFOA 1RZ8B 2IJ0C 2OTUA 4M6OH 5EPMA 3D07A 1QEWA 4N8CL 1BVNP 3CU7A 4LDOB 2BVQB 4Q9RL 3P3SA 4UTBL 3ZKND 1I1AB 4NWTH 3PU7A 5TF1H 2OBGA 2ESVD 4LBEB 4PRPE 1IAMA 1T04A 1R3HB 4XT1C 5DGQA 5B1JA 4X6CF 5KG9B 2MFNA 4A55A 3PHAA 4IRZL 3LKRB 4XNXL 5D7LD 3FNKA 1SY6A 5J6GA 2WMPA 4MWFB 1N67A 5A6IA 2AXFB 1I3GL 3I2CL 3UJTL 4ZO7A 1QFWH 4FNRA 5KBNC 1DJIA 3N43B 1BJMA 1CGSH 1O0VA 2CD0A 3CD4A 3MOAL 3QUML 1L9TA 4X6DA 2F54D 3M8OH 4JRFA 4YDZA 5D7JD 4UQBA 2BP0B 2XPZA 5FO8B 1TJMA 3ZO0A 1AOHA 4Y88A 4F7KA 2EDYA 2LLGA 2OJEA 4W6XB 3GXDA 2YK1H 4FYQA 4AQ8A 4LRNH 5CD3B 5JXAL 2DQDL 2JJTC 1TEGA 2YBGA 3D1MC 2F53A 4WFGE 2CA4A 2DJSA 2R51A 3HPJB 3IJYB 4P46D 4ZTOL 1AO7A 5F7BA 5JO5A 2FYVA 2XWTA 3DECA 5BW7A 3BFOA 4LSQH 3I6GB 5FO9A 4ZFZB 5LXVA 4R3SB 3C08L 3FQWB 1NMCB 4WLCA 1WCQA 4OLEA 4Y9FA 1YO4A 1S5HB 2MHAA 3D12B 4PJXF 4PJFA 3RPIB 4IGBA 3QCVL 1DQML 4UMSA 2E27H 4NQDA 4Y2DB 1OM3H 5DZVA 1Y7MA 2IVFC 2BIPA 2J6EA 2RR3A 1XF3A 1DEEA 4Y2OB 3BT2H 5I2IA 3V4PL 4ODSL 1SEQH 4LMQI 5JPMB 3LIZL 1I8AA 1R24B 5E6YA 3TBCA 3S34H 3TVMC 2WSKA 4QRRD 4DERA 2CGZA 3IKCB 2KL6A 4UQ2B 1RZFL 4A7SA 2ZICA 3EDEA 2BDNH 2ICWA 4FFYA 5F1OB 3U9PH 2MSPA 3FRPB 4MJ5B 5H4ZA 4M5SA 1H9DA 5EU4B 4TULH 5KSVB 1LO5B 2B1AH 1CLYL 3ETTA 5MHSD 4IBUA 1BZDA 1N2RA 4PJDF 1MFCH 2Q7AA 4BQ6A 2IEPA 3LXBA 2B4CL 5TH2A 2Z7YA 3DSFH 3SKJH 2R59A 4EOWH 3KVQA 4MJ4A 2KPNA 3TJHC 4FQHB 1DCLA 3IDMA 2NY2B 1OKEA 2AERT 3C5JA 2MNJB 4J7RA 1U8IB 5CJ5A 2VR3A 3ZW3A 3PNWB 1JDCA 3Q9PA 4NQDE 5LNEA 1T1ZB 1GIGL 4K94H 4ZAKD 4P2OD 3WLWD 1YY8B 4WI6A 1Z5LA 4HHWA 1IAIH 4ZD3H 4LLVA 2H2PD 2GBTA 1HAWA 1N5AA 4IOIA 1X5LA 1FCGA 1KEGH 3Q43A 1JZDC 2OI9B 3K1KC 2D7OA 3STLB 3EOAB 4ORGA 3K6NA 1G7MB 3D69A 4ELMA 4UU9B 1K4DB 3P4MB 4GP8B 4F20A 4HQQL 3MBWA 5DR5L 1L9PA 3D0LB 4POZC 4XB7A 4P4KB 3GS0A 1YMHA 2NY4D 4EDXA 1W6WA 3BPOC 4XVOA 1NEUA 2R7EB 4N0UE 3STLA 1RIHL 1GY1A 1A7OH 3BZFA 4IDJL 4OLYL 3T0BA 4EZJA 5I5RA 3MLVL 2R0WL 2R39A 1A6PA 3CSYB 4RGNE 4MHHG 1IAII 2L0DA 4JHZA 5ICXA 1Z0NA 4U1SB 4FQLL 3IGAB 3ARGB 4IU3B 4DTGH 4XNZC 4J3VA 3ZN6A 2PPEA 2F8OA 1R5VA 4YHIB 3WJLA 3WMQA 1KELH 3VSVA 4G42A 2X3CA 1AI1H 3S35H 1SJHA 1QTYT 1VA9A 4H8VA 3DMMD 1VSCA 5KAQF 1UJ3B 2IWFA 3I50L 4P3DA 5BUAA 1JV2B 2PTTA 3ZGIA 4LLMA 3RL1A 3K6SA 3D2UA 1UKQA 1HOCB 3A23A 3GHEH 3IDJB 3EH4B 1OTTD 3ARDC 4P06A 2X9WA 2ADFL 2AXGB 1E9OB 1T22B 2KHAA 2LQRA 1XAKA 3V7AG 3DWTA 3R8BB 5CM1A 3ZE2F 2A9DA 4H0HB 4CUCA 5LCVA 2NYZA 1GGBL 4OF0A 5DJDA 3TFKC 1N6QH 1P5VB 1OSPH 2PCFB 1SJVA 3SGEI 4HUVB 1H15A 3OF6D 1UASA 1BAWA 4KMLB 4WENB 4ZW5A 2Z4TA 2W07A 2XPGB 1OAYL 2PTVA 3SQOL 3SDCB 4L8SC 1DJXA 5EBGA 5LQBL 5SWZB 1G84A 2OXGA 3AUVA 1KJMB 3W57A 3EG9A 5MENE 2HKAA 1CU4H 4JY6B 5EO9A 5EUKB 2DQDH 3FQWA 4F3FB 1UA7A 4OBSA 5KYXA 4Y16A 5DUJA 3MYJB 3TFBA 4M00A 5LGHL 3JT2A 5B38G 3L3DB 2ENYA 2H1PL 2WKOA 2ZD0A 1SQMA 2VLLA 4OW6A 1KYDA 5L8LB 3L4YA 4FNQA 1WEJL 3IAPA 3TA3B 3TF7C 4FTVD 3BKJL 1RIUH 4HALA 3F6IA 4NCDA 1KCRH 1G9NH 5SWZE 2AJ3A 5ESVA 4CGUB 4K7PH 2AJSL 2JJSC 4HT1L 2AAVA 1H8OA 2OXGB 3K4DA 1H6TA 3KM1A 2EDBA 2P28B 4KZEH 4G1MB 4PCKA 3T2OA 3CVBA 4OAWB 3I6KA 1XIWD 1U3HB 4JM4L 2WXHA 1MFMA 2EIBA 3HE6A 2Q0ZX 4HCRH 1G4MA 3ZDZB 3QUYC 2FNBA 4KRPD 3BD5A 4LEOB 4ZG1A 1UWXH 4GBXD 1HIML 1URIA 2ICWI 3WE6B 4CSTA 3WOVA 3IAGC 1CIUA 1CD0A 4HXBL 1N0LB 2ITDB 3NAAL 4S0SD 3ESPA 4HZ1A 5DHXB 2AXGA 4PP1D 2C3VA 4U6VL 3LH2H 3AREA 4W4OC 4R0LC 3KD4A 4NRYA 1FSKB 4G8GE 1SXCA 1JV5A 5KVFE 5A7BA 1MRCL 3NCCB 4M48L 5DLML 1WQVT 1GIGH 1SJHB 1J10A 1TNNA 1NFDB 4LB8A 4U05A 4XWGH 4BWUA 1LE5B 4EF3A 5F1IB 3VD2A 2Z1KA 3IDIB 4K2UL 4LIQE 1GYUA 1S7UA 3BPNC 3LV3A 1XMWA 2J5LC 1ZT7B 3GTVA 3SE4C 2CO3A 4XI5C 4M62H 2EVGA 5DEZA 5EB9A 2HRHA 4DVBB 4GUPA 4GUCA 4P48A 3MLUL 3JWNG 5FWRA 4X8GA 1COBA 3AREB 2QGEA 3ECBA 2F15A 1GYVA 4U2YA 2WOBA 1NCJA 3KGRA 3D48R 2Z31D 2EZ0C 1E3ZA 2ZF9A 1VGKA 5BXFB 4F2FA 1FIEA 4JJ5B 5EU5A 4UU9A 1BQLH 4OIIL 1MPAH 3IJ8A 4EUPA 5IHWA 1QNIA 4TPRL 1G7MA 1TJHL 4Y5XA 1OW0A 3POCA 1CQKA 3X17A 4XBGA 2GK0A 5F9WB 5INDA 2MEJB 4RA0C 4AJ0A 2X0VA 1HC1A 1CI3M 2W92A 4HBCL 5IESH 4OFVA 1ECZA 5AVSB 4IS6A 3MV7E 1DP0A 4YDJB 1JPTL 2AV1B 1ZE3C 2ILLA 3MLPA 4WUKL 5T3ZH 2DF3A 2OSYA 3ARDD 3BN9C 4NN6B 4NZRH 3LKOB 3SQOH 1TG8A 3GLDA 3OXSB 3TGXA 4MD5A 4IRSB 4X5LA 4GRLD 2YMXH 2JCCF 2DWTA 3PABA 3APNA 2KLTA 2XTJB 1JCKA 5ID0B 1TQCC 3QDMD 4Y16B 3GBNH 1M71B 4MJ5A 2XRAL 1GGBH 2H41A 3KBPA 4FQCL 3RX5A 4BCXA 3AY4A 4KK6C 1M57B 3MGTA 3V0VB 4F57L 4PJEF 3K46A 4UQ2A 2ZX7A 3NH7L 2GTZB 2LGNA 4LRIC 3TM6A 3OQ3B 1CVSC 4JG0H 4MAYB 1O5DT 2AEPH 3II1A 1QI4A 2OMZA 4FCAA 2Z1PA 4ODXB 1RIVH 3OKNA 1H15B 4N2LA 1FVCB 3GEWB 1CB4A 1WWBX 4PMFA 3CFEA 5IHHA 3KHOA 5IQLA 3WXVH 4M7LL 4PJ7A 4E9XA 1F3JB 4X6FA 2DEXX 4N6RA 1ADWA 2A73A 3OZLA 4JHUA 3FC8A 4P99A 3AB0B 3FOMA 3HCVB 2HTKC 5CCJA 2XY2A 4UT6A 2JQMA 4LU5H 3CFKB 2J72A 5I82A 1H5BA 5C6TL 3PLYA 4ZX3A 2NNAA 1EZVX 3JV4B 3VNZA 4PG2A 3EO0A 5H2BA 2AV7A 2G5RA 1I8KB 1P84K 4UIKL 3HAEA 5AVVB 5TE6L 1YEGH 3WTVA 4NENB 4ABVA 2EXWD 4OSUH 4MA8L 3GBLA 1A3QA 4HBQA 5K9QG 4O2FB 3OQRA 2BP3A 5EG6C 4F7TB 5TK2A 2R69H 1G6RL 5BO1H 2AJVH 3QJOA 4K8RL 3DBXA 4FYTA 1N12A 3WSQL 3WFCH 1PF3A 3W56A 3IDYC 4JO3H 1UWEL 3MLTB 3P30L 1KB3A 2BOLA 4PJCB 2OULB 2FECI 3I9AA 2R7EA 4G5ZL 4NDMB 1MCPL 4J28A 4UAHA 1KBGL 4AIZA 2YGVA 4X4XB 2WUCH 3SPHA 2X4UA 1TKWA 2IXQB 1FYTE 1XSOA 3NIDF 1N7ML 1T3FB 4KU1A 1XX9C 2WP3T 1ITBB 3GSWA 3Q0HA 4HKJA 3N06B 2NT1A 3ZZLA 5E2VH 1U3HD 5F7YC 3EYQC 4QXUH 1F4XH 4X6DF 3QJFA 3WFDH 3WY3A 4KK8C 1DJGA 1JZHA 3DYOA 3H2QA 2YPLA 1A22B 4DPCX 1BOGA 3D4GA 1KMGA 2AK4D 1GZPA 1XEDA 1F42A 2K9UA 3AU1A 3CC5A 3MUUA 2F19L 3LMJH 4ES9A 1NWPA 3TN0A 3UZQA 5HYEA 1TJGL 2W0PA 4AH2B 2XVKA 3A0OA 5GRXG 1CXKA 5IB1B 3ARQA 4JCWA 2C4FT 2NQDA 5B3NA 1MIEL 4GAYA 1JXDA 2JXMB 2OR9L 1AHWA 5I1CL 3LNFA 4WFGD 2KT6A 5JZ7C 5TH2B 2E27L 1CICD 3FCSA 3FO1A 3I02B 4ODTH 4OZFH 5I8EA 5KSVA 5BZZA 2AZUA 1EAPA 4NWUH 2ZCZA 5JLZA 3D87B 3SPIA 3VWJC 3MU3A 2FWSA 5EZLB 4ADGA 1EGJL 3QHZL 4HIHB 3GM8A 2EADA 4LSRH 5B7EA 2WUBL 2X5PA 3KHQA 4JM2F 4J3SA 5FGBC 4RLDA 4LOFA 4EAEA 5IMLA 4NQXA 5IROC 3UJJH 3D85D 5ANMA 2VDLB 3VRLE 4PJIB 5B8CB 4U1LB 1FGVH 1YMME 2OMNA 4GSQA 4P5KB 4P23D 4Y7OC 1N59A 3DX9B 5CINH 3KYKH 5CZXD 5EOTA 5HI4D 1AKJA 4BZ2H 4D3CH 4UANA 4ZFZA 5FO9B 4H0IA 4JN1L 4PJIA 1E4WL 4M43H 4H8PA 2JJWA 2VKWA 1G9MH 2VQTA 1XF4A 4NJAL 3TNMB 3C2AL 2NUTB 2XG4A 5DFVC 1VGEL 1G9NL 5C6TH 1UOWA 3OJMB 5D5MB 2DYPB 4X83A 5KOVC 4PJIF 4AC4A 1JF1A 1ZHLA 1HQ4B 5E6ID 1HSBA 4OJAA 1RAMA 5CIPA 5F7FA 3C6LC 2GFBA 4GKSB 4XOCA 2BW4A 1OAUL 1FL5B 2BP0A 3OHMB 3G7TA 4BH8A 1MRFH 4PJXB 2HLFC 3VFMB 3GWJA 1TZHA 5DMIL 1D5ZB 1MCWW 1O6TA 2CDGB 3EBGA 1YPZE 3GKWH 5CO1A 2ARJA 2CDFB 3A47A 3GSNH 3EAKA 3KDPB 1FLRH 4MKTA 5I73C 1AHWB 3ULUC 2WNWA 2WJ5A 4YFEA 2HWZL 2JKLA 2NXYC 3WL9A 1F97A 2BM3A 1NC2D 1RIHH 3EXLA 3FPYA 5E0QA 1JSYA 2PKDA 2W95A 4PPTA 5F8QC 1PKQA 2EVIA 4N8PA 3JVGA 2X10A 1MRCH 3PJNA 4U0RC 3Q6GH 1NGYA 4LCIL 4AIXA 3DBSA 4QRBA 2K1MA 3LPPA 1VZHA 4KK9D 3UBGA 1T04B 1PYWB 3DSNB 1FJ1B 3GRBA 3QUYB 5GS3A 3NESA 3QDJD 1BLIA 5D1ZB 3FFDB 2BNQD 3EF7A 3QJFB 1A5FL 4OZFA 4OF6A 1MCFA 1Q9WB 1QEWB 3AMKA 5C0CE 4HU8A 3MJWA 4YSTA 3DLQR 1QNZH 4IEFA 2VLME 1OQOA 2HMID 1OTUC 3ARDA 1IARB 4A37A 1QVOA 2NY1D 3BLBA 3IT8D 5AG9A 1WO2A 4GJTB 3IGFA 3JYBA 5DJ6B 2IXQA 2RALA 4PS4H 3WIHL 3P69A 2JTYA 3KH3A 4RZKA 1X5XA 3QW9A 4TN9A 5KYWB 2OYLA 3U0PB 1KNOB 1P4LA 3I9PA 2LABA 4ZUSB 4TUKH 4J4PD 2ZOLA 2OR9H 1HESA 1FL3A 2GCYA 1X5GA 1XR9B 4HLZG 2P48B 1JE6A 4O2FA 2QTVA 5KYNA 1UGKA 1CYXA 2BHUA 2E47A 3VXNB 4L4JA 4JFTA 4BQ8A 5LG6A 5L2JA 4KJPD 4OZ4A 2QQKH 4LIQL 1JVOA 1HN1A 2AEIT 3VCLA 2GBAA 3KEDA 3FYEB 4NKIH 3EO0B 1GZHC 3M46A 5D96B 2B3RA 3IPFA 1SLWA 3FB6A 3L5JA 4UIMA 4UM8A 1I3RA 3S3PA 4ZMVA 3WNNA 3FRPG 3V5KA 4LRIA 4EI5D 2FR4B 1R46A 1MLBA 1UT1A 2A73B 1BVNT 3VWJD 3T6WA 4W9ZA 1NDGA 1FVCA 4BFKA 1LO2H 4N85A 1HILA 4ZAKB 5C9KA 2OMZB 4YC2C 3P40A 2IFFH 3APFA 1X9LA 4M1GH 3MODL 3LEYL 2VC2B 4YDLB 5IROD 1ID2A 2ZOOA 3KLQA 2D0GA 4YGVA 3ULVF 3TEWA 1P5UB 1SJXA 4KKAC 4P9ML 5ERWA 1DZBA 1XT5A 2I07A 5DMJB 4TUOA 4XXCC 3P2DA 1H6FA 3GJEA 2DQFB 3S97C 2WZ6A 2UX7A 3UTSD 1HL9A 4U6VH 4TSAL 4MD5B 5KJRH 4FDWA 3WTXA 1DE4A 2JIXD 3ESUF 1ES0B 1HZHL 2CRIA 1EFXA 3LX9A 3CVHB 5EEYA 4S1RL 4QO1A 3AGVA 5F1KC 4IS6B 1M9SA 1RL1A 1T5XA 2XIIA 4N9OB 3WE1A 4H5SA 3EOBA 1CLOH 1QOKA 2BS71 4L4VE 5TDOB 2EUZA 4TVUA 2YS4A 4Z3GA 4MB4A 2HLFD 1YN7A 3OAUL 1IGJB 1P7KA 3EOTH 4P2CG 5I17B 3RNKA 1G7JA 2ITCA 4AL8L 2I7OA 1ZAGA 5JHDA 1A9EA 1B3JA 4V1DA 1KJ3H 4MA3B 4NWTL 4HUXB 2NXYD 3L4ZA 4UT9A 4G59C 2XFGB 2NX5E 2R4SL 4CKQA 3D34A 5FUCE 1N7MH 2BC4A 4PGEA 1GGCH 1AAJA 5ICZB 5D4HA 2IG2L 2OK0H 4Z7NB 3JWNC 1MVUB 5I0VA 1XGTA 2BRRH 3OKKB 5JHAA 1BD2D 1K4CA 1USQA 1ZSDB 3E2HC 4MTMA 4R0LA 5FLUA 1VKXA 4YXLL 3QK0A 4LCIH 2RIKA 1I1AD 1B4RA 4FQ1H 1FG2B 3C8HA 3MROA 4NQQA 3MV9D 5J8OA 3I6LE 5AYTA 4ZW8A 2WIIA 5IF0A 3QQXA 3ILQC 1AD0B 4XX5A 5AOJA 1J5IA 1I3VA 3U4AA 2YWYA 1BVLB 1CS6A 4JQVA 4Y9CA 4UOZA 1P5UC 2ZG3A 2VM3A 4G80A 5F21B 4HK0B 4NRYB 2ADGA 2MPVA 3GMLB 2F1EA 2C3VB 5I71C 2BO0A 2DOCA 1F4WH 4MCMA 4AYFB 5I1DB 2OYMA 4YMPA 3WE6A 4CSSA 4OLUL 4IIQB 4H8WC 4OFYA 4KXDA 5D1ZI 2BNQB 3FQXB 3HNSH 4WO4B 2AQ2A 2JKNA 1U3HA 4G1EA 4OGYL 5HDQL 2XN2A 3F00A 1PX4A 4XAWL 4YHML 1IMHC 1ZWIB 3VWJB 4H25B 3QJXA 3QRLA 4OV5B 3QAZC 3KG5A 3MBEB 5ESVB 1ZD6A 3ZHLA 3LRLA 1B6DA 5FHBL 2HFFA 3IPBA 3ALXA 4BGLA 3BE1L 2QGCA 1LL1A 4AJVA 1VESA 4EN3D 4ODWB 4XBEH 5JOPD 5BRZB 4B9KC 4EI5C 5L2KD 2Q10A 4ISVA 4B5ZA 2QVIA 3MOQA 4N0YL 1X7QA 4JQIA 4NQVA 5IMMB 3N50A 1ZTXL 3VXQA 3D18B 1F4HA 3RWIB 4DGIL 4K73A 3DHMA 4BZ2L 3MACL 4HEPG 1LDSA 5ECGA 3AC0A 2ZOUA 2W59A 3ZZQA 4AGQA 4GY4A 3ATFA 5DTFB 4MHHI 5EWIH 2H8PA 4LHUB 5C7ZA 4UTAL 4YHKL 2IBZX 3HUJB 3R8QA 3NCEB 1LP9A 2NW2A 3PL6D 3P11H 1BQHA 2OLDA 1NDMB 2AJVL 3KYAA 1CK0H 5IG7B 4W9CC 4AG4L 1HZHH 5CCGE 1NUGA 4HUVA 4D0CA 2IAMB 2VYRE 2BDNL 3H7LA 4K3DH 2BHYA 3K8MA 2LU5A 1PDKA 2VLKA 1CLOL 3L9EA 4Y9BA 2FUTA 3IKKA 2NXZC 3UGUA 2IPKB 3BQUC 3X1NA 4A7QA 1MFVA 1MCOH 1FQ9C 4HIQA 5E6ZA 5TGBB 5KS9E 5A1AA 4LCUA 5DZ9A 3WN5C 3QAQA 4LLMB 1AGDB 4N8CH 2DBLH 2XXCB 3EH3B 1XZ0B 2J4WH 3QH3B 4JFQA 4ANKA 3QDGE 3EHBB 2EEDA 1M3JA 35C8H 1WP6A 1R5VB 4YHIA 3WUWA 5BS0A 1MCPH 3VXMB 4UNIA 3ARFD 3K8KA 1HEZB 5IWLA 4UWQB 3U25A 5FFOA 4AUUA 4QT5B 1D7DA 4HHAB 4Y1AD 4Z18A 3JUZA 2J5WA 3J8F7 1S8DB 5DQ9A 5FYKD 1G1KA 4S1QL 4K23L 3MDJA 4XCFH 4AUYA 2CLRA 2JKRM 5GS0D 4PGCB 1XF2A 3O2VL 4H26A 3VXPA 3V55A 3N0PB 1UYWL 2ZTBA 4BQ9A 4DZBA 5BV7C 4ZXBC 1CLCA 2ZNWA 3SDXB 4YDKH 3FU7B 2WYIA 1XBDA 5BRZA 3QZWB 3OZ9L 3OR6A 4G6FD 3FSWA 5DQDH 1BECA 4IBVA 1FPTH 3VFGH 1NKOA 1FNSL 1HNFA 5LWYH 3CXDH 5IZ7A 1TITA 2C5DC 3LPWA 1AG0A 1BVZA 2GKIA 1T1ZA 3MXWH 3O3BB 1VEOA 3KW7A 1T66D 1XXDC 3KPMA 1T0OA 2C3GA 4YHMH 3QUZA 2R23B 2QV4A 4GSUA 1EEYB 4PTUB 1ZLSH 1XGUA 1BMZA 4IBQA 4B0MM 1LXMA 3POHA 4GG6A 3FQXA 2LU4A 5DJZA 5GS0L 3HI1B 3HB3D 4KUCF 1S9WA 4KVCL 3U30B 4U6XA 5FEBA 1PIGA 2HJFB 5HXMA 4U4BA 1PBYA 3FRPA 1SEBB 4PJ7E 5CS7A 2PR4H 1TCRA 5E6RB 4S10A 1NICA 1CDJA 4AEHH 4X7DC 4WU7B 1JRHL 4G6FB 3F84A 1J0IA 5GZOD 1AKJD 2LV4A 5F6IB 1AR1B 4UT9L 2HJLB 1INEH 3MKGA 5JHLL 3GMNA 2WNKA 5I2IB 4HWBL 2R1YA 4KNTA 3B3IA 1BVLA 2H45A 3N6YA 4OKDA 4UTAH 4KI1A 5JYLA 5C0JB 3O45A 1GGUA 4NIYE 3N40P 2YJLA 4FLQA 3BLKA 4NIKB 1TPXC 1A2YB 3LDBC 5A7EA 1JHKH 1CC3A 1FDLL 2B1HL 3BCFA 4DUXA 5KBLA 2H5UA 4GIOA 4ODHH 2WQVA 2ZP9A 1MVUA 2Z34A 4QY8A 5B22A 1CE6A 1IC7L 2X28A 1GCYA 1MOEA 2Q86A 5F1SA 3HR6A 3LEXA 3G6JB 3JXAA 4GT7A 2G30A 3HPJA 4MSWA 1WHOA 3U7YH 2XXFA 4Q56A 2Y07L 2ZWNA 3OHXC 4MNQE 4YDVB 5E56A 3Q8AA 5CD3A 4ZTEA 1IQWH 3X1EA 3LZQA 1BQKA 3Q3GA 5D71H 4PW3A 5K9JL 3PIQA 4F2ME 4M02A 2OJEB 1LDPH 2B7DT 2H32B 4IK7A 2HKFL 4TM9A 2BSRA 3GK8H 4XO3A 1KXQE 5FO8A 4RGNC 2KMWA 1IC1A 2F58L 1GHFH 5H94B 1CXEA 1AC0A 2ZUQC 4K94C 3G08A 5IMKA 5D9SB 3UTSE 3ZDYB 4Z0XA 5GGQH 2Z92B 3CFTA 1W0YT 1FH2A 2YQGA 4H5SB 5KANG 3BEWB 1UB5A 4QKXB 4QRTA 2F5AL 4HMEA 4IDLA 1E65A 1Y18B 2AJXH 3BFWA 4XPAL 1B6UA 2G4GA 2D03L 5J6GB 2CR6A 1B0WA 3HC0B 1A3ZA 1B9KA 1CN4A 3O8XC 3KPSD 4FXGA 2WINA 5F89A 2TRHA 4UILL 4WWOA 1L9NA 3OF6A 4KI5C 3DGGB 1JYVA 1B0GA 2QV2A 4PJ5E 4S1QH 4XCFL 3N1MC 3AY2A 3S4SG 5L9DL 2DM7A 1VFBB 1FO0B 5GISL 1PZ2A 1BLNB 4PM1A 4IKLA 1MW2A 1NCGA 1WZ1L 2GJJA 1BREA 1UJTA 1V3JA 2WVTA 4EN3A 4N2OA 4WSKA 4OF3A 3FO0L 3QDHA 2DRUA 4Y1AB 1AIZA 3MRKA 1VLXA 5E2JA 5I19H 1TTGA 4E41A 3LIUA 2ZUYA 3MRGB 1HNGA 4QRUA 3WTWA 1HJCA 3U46B 1Q72L 2UV3A 1HILB 4MYPA 3SD5A 1OE3A 5DO2C 1CTMA 2XY1A 3QEQB 4BKLA 4FD0A 2B4CC 2HA1A 4W9LC 5AW0B 2PYFA 3PGFL 3AMLA 4LFHG 3V4PH 4E42A 3V5KB 3ZL2A 4FA8A 4WV1A 4KY1L 1NMBL 1BX2B 2E6PA 3NABH 4KJWD 4LP4A 1KZYA 4NO3A 5GGSY 4ONFH 1YNTF 4NKIL 3QFJB 5HDLA 2Q7YB 4TOYH 4HKZA 1L9MA 4QF1A 4J3BA 4HOXA 4L29A 4NUGH 2YO3A 4KWUA 2B08A 3NIDE 3C08H 4X0NA 5C07E 2FK9A 3AQYA 3CX5K 1Y6KR 5E23A 1PLBA 5AB9A 1NMAH 1HSAB 4G8FB 4W6YB 2CO6B 1F3DH 2GABA 1UD5A 4AYID 4QRPD 2IADA 5FO7A 1OD7A 4R26H 1S5IL 5J1AA 1XGRB 2XZZA 1GS7A 2JB6B 3OWRA 2EXTA 1YG9A 1KCUH 3FCTA 2AABL 5C0RH 4ZUSA 1DTUA 5F7KC 1Y1UA 2NY5H 4RMSA 4AX3A 3NMEA 5J56B 4B6ZA 4YDNA 4XCNB 2Z91A 3VRIA 1ML0A 1U93A 3V4VH 4ZI8A 3UYPA 5LGJB 3TH3T 2WV3A 1OZUA 4PGDA 2FJUB 1QI5A 1ZVSA 1ZA3A 2IH3A 4X5XA 3KNBA 1NCWL 4JHWL 2CK0L 3MZTA 2VXTL 2D7NA 2A74B 1QUPA 4P5MA 3UTOA 4M1CD 4YFLI 1CFBA 4R5TA 4HF5L 4KH9A 4QHKI 3BWUC 1J1OL 5AD0A 3SE3A 1CF1A 1PYWA 1QUNA 1P53A 4M5TA 2BSBA 3KE0A 1JZGA 3BAEH 4UQEA 2CUAA 2DQCH 2NY3C 3RGVC 1NEPA 1YPZB 1A6WL 5DQJA 5HHQA 2F58H 5E4OA 3QO0A 5L6YL 3DDFA 5L4JA 6FABH 2YXFA 3WLBA 5JDSB 2O4EA 3OXRA 4N2KA 3OMAB 1YRKA 3FN3A 3INUL 3FQTB 5FDWB 3SB3A 5HHQB 1YPZA 1XH1A 4NP4H 4CBZA 1OSEA 1I8IB 3RQ3A 5AEAA 3B56A 2YR3A 4U1GB 5CAYB 1D5ZA 1KGCD 3B8SA 4FG0A 1ZHKB 2ERJB 5DR5H 1HL5A 3SGJA 4WUUE 4HG4K 1E50A 4P5MB 2EE6A 3ARBB 1AYOA 3SYQA 1OE1A 1CYGA 2HT3D 2ZOWA 5JW5B 3IGKA 1J8HE 3DETC 2PCPB 1V5JA 3ARGC 3UBXI 1CF8H 3VGAC 1INDH 4ZFOB 2OCJA 5B4MD 4KRPB 5GISH 1SYSB 2WN3A 1ACYH 5JXEA 5E9DE 1KFGA 1YECH 1EERB 2JKTM 3RDTC 2BLFA 3FO9A 1UHVA 4JFDE 3L17A 4JY5L 5ITBH 1WG3A 2E9WA 1URLA 2IOIA 3FT4B 3JQOB 5EOTB 4MMXA 1HAUA 3EJPA 1FN4A 2K0RA 1I9IH 2B2XL 4PFEA 1P7QD 1B4LA 3TESA 2ATKB 1E9PA 1QWNA 3TBTA 4KDTA 1T4KB 2JI2A 3KJ6H 5DHDA 2Q1EA 3HC3L 2Y2YA 4MLSA 2WLKA 1KIUB 3FK3A 5GSRA 4C57C 4LNRB 3ABGA 5ETUA 1B90A 2HZHA 3B83A 4Q4IA 5GPRA 4ZSOB 2R15A 1EEQA 2VC2L 3QFJA 2Q7YA 1XIWA 1KB5A 1W72H 3KLAB 2Z93A 4E42B 5DFVD 1J5DA 2VISB 2W60B 2EE9A 2VWEE 1RIUL 2MJWA 1MWOA 2QSCH 2GJ6D 1T4WA 2PYFB 3B4NA 4UINH 3T09A 4DGYH 2UY7A 4RESB 1E28A 4FTVA 2VGLM 5D6DC 1AQDB 2TSBA 2YFNA 3QORB 4W9HC 4UQ9A 1KIQB 2J1YA 3FH5A 3HN8A 2IANB 1RFDH 2CCVA 4YSQA 1RZKC 2J6EH 4BSWA 3RWHB 2WXPA 2XWRA 1OGAD 3DOSB 4XX1E 1S2EA 5EZIL 4BZYA 4DK5A 3GB7A 1I1YB 2ZT9C 1HFUA 4R4NC 5GS2H 2VRAA 1RK0B 2NY2D 4XVSH 1DVFD 4TSCH 4L48A 4OCXH 1KB5H 4EUPG 1G7IA 3HG2A 2X2JA 1GYAA 4KK9C 4ODHL 1JPEA 4PV1C 3RIFK 4AM0Q 4QJ4B 1O6SA 4PJ8A 3QJRB 3N9GH 2HFEB 4AEIH 2JK5A 3ZKXB 4B9YA 4FABL 2F8IA 1MCRA 4XP5H 4Z0XB 5JMOC 5I9QC 5FGCB 3MLTA 4Z6AT 1BCIA 3BZ4B 3PHSA 4EQ3A 4HCIA 4WNSA 2R1WB 3WSQH 5J11B 2CM6A 1O7DE 2Z3FA 1XGPA 3GIZH 1UZGA 2FT6A 2VR9A 2Z7ZA 2VRKA 3VI4F 1RUAL 3RIFF 4S0HA 4XCYB 5BMFH 2UVEA 1BFTA 2ISDA 1ZHKA 3FMGL 4GIPD 5BZDB 4Y4KB 1I8IA 3G6JA 4PS3A 3MXVH 1YQ2A 3GJFB 1UYWH 3P9LB 2F53E 1WIOA 2VDQH 3MCKA 4NRZA 4GW4B 4RMRA 5MEQB 5D1ZD 4KJYA 1BZ8A 3AWGA 2ATPA 4N90D 5DMKB 2Q3ZA 2PTUA 5GGTH 4PWJA 2WNGA 3UACA 1CGYA 5DQJB 3O45B 4OUOA 4NQEB 2G9HB 3RX9A 1BIIA 3BAYA 3OKNB 4XP6H 3HE7B 3PXHA 1MI5B 5EIIB 1Z9OA 5B4MC 2VN7A 3D85A 1JF5A 1KGJA 2JF1A 2O6PA 3T0ED 1XCTB 5DD6B 3TNNB 5DYOB 4DP8X 2N7AA 3G5VA 1M2VA 3U2SA 1JWSB 1JWMA 4H40A 3S4SB 1DLHA 1RK7A 2O5ZL 4MDJB 1KTRL 3GZQA 3X3FH 1ZA3B 2IH3B 2BVPA 4XPGH 5EOCH 2CA3A 3RJDA 4U6YA 4NWUL 4LSDA 4NI3A 4PLJC 1AY1H 1T20A 3PJLA 1D5BB 5DK2B 2B59A 4TQ8A 1TU2B 3U2IA 3V6ZA 4ONFL 2XWJA 3OKOB 3BVTA 4KY1H 4KKAD 4ZMXA 5GRZA 4W9FC 2K6YA 3CVDA 4ZQKA 3K72A 5CU9A 2VDLL 1IB5A 4OB5L 1S7WA 1CFSB 4ONHB 1BVKA 3RTQA 4Z3EA 5IHZA 1YEKL 1NCTA 4OH2A 3VAEA 4GAJL 4L4TB 1HEJC 4R9HA 4XODA 5F3FA 5KSAA 3FQ1A 3V9EA 2PWHA 1JIBA 2CLZB 3FB8B 4QF1B 4JFOB 4BEIA 4P5TA 4KVNH 4U3CA 3VXPB 3WKYA 2YPLD 1F58L 3BUYB 4I0PA 4ZMWA 2YD0A 4LCVA 1CLYH 2D9QB 1E4KA 1CVRA 3TBVB 5T3XE 2FLRT 2MOGA 3O9WA 3UJIL 4MX7B 1FAIL 3ECBB 1NGZB 3O3DA 3UDWA 1WIPA 3ARSA 3RWEB 1WH0A 1AR1C 3DV4A 2XZCH 3MRGA 1UWEH 4GKOA 1KENH 2QR0A 3GEFA 2F61A 3N9GL 5TFSL 1LWJA 4OZGB 2Q3AA 1S7UB 1DVFC 2MKWA 5IM7B 4WJ5B 5FA4A 3W9EA 5I8CA 4AL8C 4IRSC 1D7CA 4UNUA 4JW3A 4MA8H 5I76A 3SOBH 2VXVH 3W0WD 3QUMA 4EEEA 5IQ7L 1A1NA 1UWXK 2HUEA 3B7YA 5DD3L 3LVEA 4FXGB 4GI9A 2LU3A 4FGMA 4UOJA 4U3XA 5EN2A 4S1SH 5ESQB 5HP5A 1FH5H 2M26A 2DWSA 2V7NB 1RUPH 2VDKH 3BPCA 4O5LL 1NAMA 2EH7H 4LCWD 4GFTB 3FH7A 4F33B 2Y1VA 1FORH 3M1OA 4LEOA 5I8KL 4YHNB 3BUPA 4YOKA 3D3VA 3IFNL 4TQEH 4FQXB 1YQVL 3HE6B 5D1XE 3VFVB 1S7QB 4TVSa 3G08B 4PYHA 3EJCA 4POZD 5KW9L 4L8CA 2WVVA 4RFOH 2R2BB 5D7KD 3PY9A 5EU3A 1QPPA 1E2WA 4R96A 1FF5A 2GT9B 4LHUA 3WFDL 3MRDA 3Q1SL 2WXIA 4L4TE 4LDEB 4O02A 4M03A 1NAMH 4AQEB 4JJOA 1HQRA 5JHBA 1MJ7H 2VITA 2YQ3A 4LEBA 2ERJC 4PR5B 1QBAA 3T8XA 5IMMA 1NJ9A 2HH0L 2XV0A 1CE6B 2WKOF 4AJWA 4WUUD 4OD1L 2BNQE 4I88A 4ZFFB 5KYXB 1ZHNB 6TAAA 1LK3H 1A1MA 2K3TA 4F27A 4JAMB 3BQVA 4KITB 2VUYA 2X1XR 3OKYA 4JPVH 2FD6H 3KPTA 4P0DA 4Y9EA 3SD2A 1QFUH 4XP6L 3FQ4A 4JB9L 3P77B 1A4CA 2F5BH 5SWZA 3U9WA 5M7QA 2VDNH 4MMYA 1OAYH 4X98B 1QHOA 3EYUH 3VXRE 1RVFH 3VM5A 3TYFB 1JMZA 3R4DA 4GAAA 4MAUH 4UB0L 3KDMA 1NCOA 4KH2A 5CP7A 4N1CA 4ZNEA 2H0JA 1J8SA 3I9GL 5KSUA 1EJFA 4NQTA 3B2VH 2P5EA 3KBFA 1IGYB 1SVZA 2GSIA 4G3YL 4TRPH 3RWCB 4N68A 4HX1A 2HJFA 2PPAA 4FQIL 4AK2A 3FBKA 2GUOA 1ANUA 4K3EH 4NZUH 2UY6B 3GMLA 3HI1A 4C56B 9PCYA 3IETB 2YD4A 4EPSA 5CP7B 3D2UB 2MNWA 4OZIF 4GG6B 2X4QA 1MRFL 1CCZA 2AJSH 4HT1H 2XN9B 1UXLA 3MZGB 4ZTPH 3P77A 5CLWA 2VSKB 2ZYSA 3X1GA 1WUZA 2H9GB 2MKLC 1ILSA 1CK0L 4PRAA 3UZEC 1GSKA 4A2DA 4EKXA 5L6YH 4HIEA 1MFBH 4AE0A 3FU7A 1NCWH 2FBRA 3EO9L 2WYHA 4BSVB 3PWLA 2ICEB 4ZS7H 1J1PL 3KPRE 1PY9A 3CQQA 2QVTA 1OSZB 4H26B 1YMMA 4XVJL 1AR1D 1XIWC 1T89C 3A6OA 3P0GB 1CG9B 3P11L 3P0YH 4U1HB 3U9UB 3VD5A 5DURB 3ARFA 1BIHA 3HW7A 2HWZH 1FC2D 2W5PA 4YFDB 1U9KA 1KJ3L 2BCKB 3MFFB 3NJXA 4IRSD 4QWWD 4FP8H 3Q1EA 4R7DA 1MCNA 3DV6B 3DYMA 2P46B 2X4NA 1D5IH 5GS0C 1Z5LB 2CUMA 3AAZB 4GS7B 4MMZA 2V2TB 1YQVH 1EEZB 4KMTH 5BRZE 2VMEA 1R3JA 3T6XA 1NAMB 4NC1C 4NXSA 2VDQL 4LF3B 4YK4B 3UP6A 3UTTE 3P3YA 2UWEB 1XZ0A 4YN3A 4JFED 5EO0B 4BD4A 2EEXA 2GJ6A 1UA3A 25C8H 4G9DA 2WCPA 4LCUB 1FGNH 4LFHD 3L1GA 1RJYB 1FHGA 4S1SL 3NCMA 2PN5A 1NGQL 2QJDA 2V4LA 4G7SB 4OCYL 4XI5D 3WO3B 1DANT 1Q94B 5F6IC 2VDKB 5ISZE 2DJUA 4PJDA 2JCCA 5I5JA 3O4LE 3ULUH 5DHVA 2YKLL 1JI2A 1IBGH 3SDCC 4WK0B 3T3PF 4J12A 3V8OA 3TA3D 4LP8A 3ZE0E 3QZLA 4JQIL 3WFHA 2VR4A 4YAQB 5E8PA 1HJBC 2CR0A 2Z31C 1BEYL 2QR0B 4XNAA 5JPMA 4TUKL 1KFAH 1ORQA 1UB6A 4JO2L 3T77A 2RCSH 5IG7A 5KZCB 4AGNA 2EE3A 4RMUA 4MBRA 1DQMH 3LD8B 4U1JA 1NGZA 3O3DB 4Y2DA 4O51A 2O5ZH 4F58L 4Z3HA 1OSPL 2XG5B 1P9MA 2ZPKL 4GQQA 5DS8B 3JV0A 3Q2CA 4Q9QH 1QBMH 2CLVB 3IBOA 3KR3L 3KWWB 2GTWB 3OL2A 4Z77A 1NBZB 5B1BB 4XAWH 2VIRB 4ZS6C 3SYCA 4DQAA 2WQWA 3BUYA 4LVOB 3VFPA 3CHQA 1WV7T 5CBAA 2GHWB 5E1AB 2G75B 3BSZA 2FHFA 1DO6A 2N7BA 4JHBA 5D2NE 2XVBA 5E2UL 1UM6L 3AB0C 4H88H 4ACPA 4N3UA 3GJFK 5HVFB 1XR9A 4DP9X 1OWWA 2CHZA 4LSUH 3DGCR 3W2DL 1KGXA 2KC0A 5F2FA 1E4HA 4GI6A 3B9KA 5HHNB 4I87A 3ORJA 4K8RC 5D8JL 5DUBA 4P5TD 4GW5B 2I9TB 4RNRB 4YBQC 1OLLA 3V6ZB 3P4OA 3F5WB 4JN2B 4JFZH 4AEIL 3NK3A 3FUHA 5IBLC 1NOFA 3C9NB 2G2NA 4PCYA 3ESVF 5FUZL 3HFMH 5I1DA 4E9WA 5BCAA 3H0TA 4LCCC 3IU4L 3T4AC 3C8DA 3RTQD 3ARXA 4J3OD 4MNHB 1NIFA 4BHUI 3OSVA 3CPLB 1BOYA 5DYOA 1W72A 5C0BD 1Q9WA 3ZY7A 2Y07H 1G94A 1O5PA 3ILEA 3HMXH 4G80B 5JOPE 2EYTA 3PCYA 4PJ9D 2CDEA 3PF2A 1RZGB 1I1AA 4P2QE 3VXOA 1WT5A 1DQKA 2YPLE 4P9HC 1BD2A 1QQDB 2IWKA 4W9JC 1SRDA 2CO7B 3KXFE 4K7FB 2H3KA 5F9DC 5EPMB 1SOXA 4WTZG 3EYSL 1BVOA 1L9RA 1BMGA 3V6OE 5E99H 1SXSA 4P2OA 2NX5D 4P57B 3U7WH 3X14B 4TUUA 3GZKA 3T3PE 5J3HD 2AAAA 5KVEL 1MUJA 4OD3H 1TQVA 5AVTB 1FORL 1MWAB 1R3KB 1AP2B 3QPQD 4JRXA 3V9CA 1WGOA 2ICWJ 1TZHB 2AEWA 3VI3A 5JHDD 3MRHB 2Q6WB 4HULB 4WY7H 4D9QD 3PHOA 1PY0A 2UWEE 4CDGC 1XV8A 3MRCA 4NZTH 3RUGB 1OGTB 3W39A 2QPFA 3II2A 1I75A 2NY4B 3MNZA 1XGPB 1J0ZA 4ZMAT 2DYPA 1NKRA 1B0IA 4FE9A 2AMGA 2A4EA 3L3GA 1BXXA 3LKQA 4DTGL 2NMSA 2XTLA 3VXUB 3HR5A 4JFEA 2ZWZA 4WEEA 4N8UA 1I9RL 4JLRB 1U8JB 2WTRA 3SDDD 2NQ3A 4XE0A 4NRXB 1GJUA 5HD8D 3V6OA 1EJOL 3WCYA 4AMKH 3VG0H 4A7TA 3U30C 4CKVX 1EX0A 4OFPA 3GRGA 4YO0A 5JHLA 4Y5VC 1P4IL 5M94B 2AJZA 2FO8A 5B3SB 1DQTA 5LCVL 5DC0A 2VLRD 1UT9A 4Q9QL 4Y4KD 3CN3A 3BN3B 3GJEB 3ZIYA 2HT2D 1KBVA 1LK3L 4X5QA 1ACCA 1CLZH 1V7NH 3CDZA 5ANHA 2QHRL 1HXYB 3FAXA 4JQXC 4Z7UE 4AC2A 4EIUA 4FZEL 5IFAL 4HIHA 4FHKA 5I18L 1IBHA 2IV8A 1SXZA 4MDRA 4KVNL 4BSWB 2OMVA 2AQQA 2VDOH 4NNXB 3D6GA 1YJDH 2ZSWA 2A7BA 1KIQA 1L9QA 2YUXA 1KB9K 3O41A 3FB7A 2CO2A 2HX9A 1TZIB 3UPAA 4JKMA 2YSSA 2WSPA 3ML8A 5GGSA 3KYOA 4G7QB 4XPBL 5GXBB 3TBYA 3E8UH 1E90A 4FERA 5JHLH 3C6LB 1TSHA 4I9WD 2GEEA 1QSVA 4JJHA 2E8ZA 4RDBA 2DKSA 4MCYA 5GRWA 4ZX5A 3QJHA 2BERA 3BW9A 4RSYA 5AZ2H 2ZSVA 4OZIB 3THML 5IKCA 1FNLA 5AWNH 5C3TA 5ABAA 1YNTA 2EKSA 2A9ML 1WZLA 1K2DA 1DO5A 3OPZH 4MS8D 4OZ4B 3RILA 1KIRA 3UTQA 1HOEA 3ZL1A 1DJZA 3FBQA 3ARZA 5A2FA 1C08B 4P46C 4I13B 3GM0A 4WAFA 4NO0B 5HHOB 1DUZA 2PP7A 1M7XA 2RMNA 2XCMC 2Z0UA 3U0WH 1AZBA 5IFJA 4FFZH 5K1JA 5LG1A 1P4BL 5F93C 4WW2F 2NZ9C 3V4VL 4PJEE 3C6LD 4N2AA 3EF4A 3MRPB 4UOW0 1EO8L 1XL6A 3JZYA 3QAZB 1ZRUA 1U8QA 2VXTH 1QVOB 1T03L 3M86A 4GEJA 4LGSB 4YX2L 4PV8B 3TVMD 1IBDA 4NERA 3S5YA 3HMXL 3CLEL 4NOBA 5EC1B 3G5YA 1GOHA 3D25B 4XPFL 5D1XD 5K9OA 4NT6B 4FFWC 4FQXC 1D6EA 3O9WC 1M2OA 4Y19E 2QFRA 3LXUX 1CGVA 1X5MA 1VAHA 2X6MA 3DUUA 2H0FA 2VAJA 1FZJB 1YNKH 3VX0A 1KN2H 3GHEL 3UAEA 1DL7L 4YE0A 3QDGB 1I7ZA 3B43A 1UATA 4KPHL 4RH4A 2QVKA 1XB6A 3EBAA 4AZ8A 3J07A 3LSOA 5J9PA 4KQ4L 2NXZB 1W0WB 4JDEB 1R3LB 2QHLA 5EIVA 4P2OC 1JZ4A 5D5ME 4BK5C 1XH2A 4QYAA 3ULUL 4QHUB 1S7RB 1L9OA 4MAYA 5D96C 3MTXA 5ACZA 3UABA 4Y4HB 3IYLW 5L8KB 2P7TA 3VXRB 2ZUUA 1IIKA 4K15A 3HBPA 1QW9A 3PGCB 4L37B 4X5XB 1X4XA 3VD3A 1GTFA 2QHRH 1G7HA 4A38A 4K3HA 3RZCB 4PJIE 3FU3A 1KIPA 1W72L 1ZLDA 2GIMA 5CLZA 2YHGA 2LFGA 3NDYE 3CVHL 1F13A 4KOCA 5AFAA 2HTLD 1KTJA 1P6FA 2AQPA 2VDOL 2VDPL 4X9FA 5DHYA 3HKFA 3LXCA 2XYCA 1ECYA 3B1TA 3D33A 4Z78B 5HYJE 1JGUH 1U8CB 1HWHB 2WD0A 5DD1L 4YVUA 4R4ND 3ZDZF 3NFNB 1XVSA 3CAFA 3RWJA 2V17H 1LD9B 2A6JB 2Z35B 4HPOL 4NYLA 3SBQA 4ATTA 3K71A 4C59B 4H13C 2O1AA 4LCCB 3QG6A 5DEFA 2J88L 3R4RA 2IFFL 4LLQA 2QSQA 3SBWC 2A1WH 4UV7L 1FYTB 1URZA 3DMMC 2WBJA 4I4WB 1DSWA 1QKZL 4JR9H