4QRBA

Structure and specificity of l-d-transpeptidase from mycobacterium tuberculosis and antibiotic resistance: calcium binding promotes dimer formation
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
351
structure length
339
Chain Sequence
LLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,d-transpeptidase LdtB
publication title Structure and specificity of L-D-Transpeptidase from Mycobacterium tuberculosis and antibiotic resistance: Calcium binding promotes dimer formation
rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 85
structure length 339
sequence length 351
ec nomenclature
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 4qrbA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qrbA02
5LB1A 5DC2A 3U1QA 3ZG4A 4JMXA 5E1GA 4A52A 3ZGPA 4LPQA 2HKLA 4QTFA 3U1PA 1ZATA 4QRBA 4GSRA 1Y7MA 3ZQDA 4GSQA 3TURA 5DU7A 4QRAA 4LZHA 4GSUA 3VYPA 4A1JA 4HU2A 4ZFQA 3TX4A 5DUJA 5DVPA 5E51A 4Z7AA 5LBGA 4A1KA 5DZJA 4HUCA 5D7HA 4K73A 2MTZA 4XVOA 4QR7A 3VYNA 5DZPA 5DCCA 5K69A 5E1IA 4JMNA 4A1IA 3VYOA 3VAEA 5E5LA
chains in the Genus database with same CATH superfamily
3AACA 4OUUA 1L9MA 2HUHA 3CXHK 1ID5I 1M53A 2G5RA 2WBJD 4ZMNA 2B0SH 3U79A 1WHOA 3VMPA 4MWFB 4LSSL 1M3IA 4LAQH 4XPTH 1RHFA 4AL8H 1KWKA 3M17A 4QF1B 5HYJD 3KDMB 2D0HA 1JZ2A 1IKNA 4HKZA 2IQAA 2G2RB 2X0WA 3D48R 3DMMD 3KJ4B 5DS2A 5IIEB 4RAUA 4QXGH 3T9WA 3ABZA 1E5YA 4K71C 4ANWA 2QDVA 4QHKJ 2NCEA 4WDIA 1RY7B 1PDKA 3BKJL 4YHKH 5AVRB 3NIFB 1CFSA 1KELL 2E4FA 5AOJA 2D9CA 4E2OA 2CDFA 2ORBL 2RJMA 3O11A 1IBDA 5C6PB 4YHOH 4X5WA 4UNIA 4Y1AE 1MCJA 3OTTA 5F9JB 1PTZA 2ZWNA 2DQEH 4ZQKB 1JWSA 2DQ6A 3FO1B 2Q87A 3L3OB 5DUJA 5DFWH 4N0RA 4MNGB 3NJFA 3LH2L 5E0QA 3CHOA 4NO3A 5EF0A 5HSFA 3V5KA 2K3HA 2MRYA 1U3HC 2FGZA 3JVFC 2VDOB 2ITEA 3IMWA 5IK3A 5IMMA 4AQ1C 4NZUL 2CHXA 4Y4KA 3HMWH 1IM3A 1WAAE 5D70L 3W0WA 4HIHB 4LDCA 5I1KH 4UTBA 4NWTH 5ISZB 1I1AC 1ZLVK 2NLJB 1U8LA 3JXAA 1JZFA 3VFMA 3AGWA 2IXQB 5C2BL 4LLUA 4ODHH 5I76A 4JFQA 4K7FA 3QG6B 1HHGB 1WWWX 3QUZC 2Q8BL 3LYRA 1N0LA 4S1QL 2CBPA 2XN2A 2YGOA 4GFXA 1BYOA 1IGIL 1ZE3H 3ARRA 1JRHH 1XZ0B 4WWKA 4X42A 4LEOA 3JV4B 3F7LA 3QJVB 1CFQA 3VH8B 1D5XB 3Q2NA 2CLRB 1NFIA 5D1QD 5D71H 3ZO0A 1E40A 4AUUA 1MHPL 1PD0A 3RIAK 1RIHL 2EEFA 3VWKA 5FHBH 3E3QE 4PJ6A 4TQEL 4UM8A 3PNWA 3S36L 2FYYA 4CUCA 1PKQE 4D8PB 5DJ0A 3VX1A 5I16B 1E4HA 1H8SA 1JCVA 2BIIA 5HGHA 5IFHH 4PBWD 4XMLH 1NDGA 2BWQA 4AYFB 4HYTB 1R33A 2VN7A 2DWSA 2JKXA 4AKQA 3M7OA 3NCYP 4I1RA 2N7BA 4LDOB 3BX7C 2XWRA 5D1XA 4B5ZA 5KBMA 3KPLA 5FO7B 2Q7YB 1YA5A 2X44D 1ET7A 5DVKA 1K4DA 1GA2A 1RULH 3NTCL 3QISA 1GPOH 5DUBA 1VEPA 1SYSB 1XIWA 2CIIB 3MCKB 1NUDA 4FNPA 4LOVA 4WU5A 5SWQA 4G9FD 3MLWL 3MGOA 4JZJC 5FYLH 3FUKA 3QCVH 3K2MC 1AZBA 3FFOA 3GMQB 2KQNA 2OMTB 3NCEB 2BRQA 1O5PA 4JMNA 1IGJB 4JDVA 4Q9QL 5FK9B 4PJ9C 4AZ8B 3G5WA 4FFVC 4NO2B 4V1DA 3SEPA 2D03L 2NNRA 4JG1L 1NCNA 1I7UB 3L4YA 4PTUB 3W9EB 3EO1B 1G87A 4JO1L 2P46B 4GW4A 4ZUVB 5I6XC 4RMTA 4X98A 3MRHB 1OAXH 4JG5A 4WK4B 2Q86B 1MFAH 4B95C 3P4MA 1PLGH 4GT7A 2VO5A 3CUPA 1ORQB 2OL3B 3CXDH 4BV1A 5BS0D 1IO4C 4P48A 1NEPA 4MS8C 4N0YL 3GXIA 4XO4A 1ULVA 1B0RB 1OO2A 4CVWA 1BLIA 5A3IC 5A2AA 3AMLA 3DIFB 1Q72H 5GPRA 3EH5B 2L04A 4NSKA 2ZWLT 3ATBA 3KR3H 1OF2A 1OARH 3IT8D 4Y19B 1NPNA 3QT2A 2JELH 3NH7H 4AXWA 5IROC 1IAKA 2IDUA 4J1UA 2V7HB 3BPNC 1EEUA 2VDLH 3LKRA 3GSWA 5A2FA 1AE6L 3P2TA 1H3VA 1ZEAH 3AS0A 3FQTA 2ZOKA 3FTSA 4JKNA 4QRUB 5EBLA 4L4VE 4DF9A 1G0YR 1HCZA 2P49B 1URIA 1B3IA 3BVNA 3PWVA 2CDEA 4DGVL 1T20A 2D73A 2IALB 2F54A 3OG6B 2HG5B 4B9GA 5LNEA 3LDBC 2ADGB 4KJWC 1CQKA 1BM3H 3IRZA 2QSQA 1J0YA 2HFEB 3GHBL 4K15A 2DQFA 3QPQD 2WBJB 3SDXB 3T8XA 3VI3A 4NIYE 4ABUA 4ZMTA 1H6TA 3FL7A 2FGWH 1TYJA 2CO7B 1H6UA 4L5FE 5FFGA 1L9PA 4MD0B 4HD5A 5HYJB 3NRPA 1NPUA 2AJSL 1CL7I 2AI0L 3LS4H 1NCBL 4NZDA 3DMMB 1PCXA 5IWLA 4AVHA 2WN2A 1GSKA 3Q3GB 4IRSC 3WXVH 1JPGA 3QUYD 5T5FA 1TENA 3PFUA 2NMSA 4TSAH 4GB9A 4B0MB 4PW3A 5AWNL 3P11L 3WG7B 5FB8B 1WIPA 4E9TA 5HI3D 1NAKL 2GEEA 1FZKB 2EILB 1V3KA 1WCBA 3WJMB 2OSYA 5BUPA 2XV2A 2H32H 3VXUE 1MQKH 1JP5A 1C9SA 4JE0A 3RIFF 1JWUB 1P9MC 4JGJA 5CHNA 4GRLA 2MIZA 2VRAA 4TLTA 3T0EA 3QDMD 2C1PA 4AKPA 3MRGB 4GAJH 3ZKMC 3O9WA 4J3XA 1DQLH 4XTRD 1T21B 1E5UI 1ODUA 1FVEA 4R6UA 3RB7A 2B4CH 3NIGE 4M29A 3OLDA 1QASA 1NCGA 4HCRH 1S78D 3N43B 4XO9A 3KMDA 4JFYB 2W38A 5IMOA 4PHXA 2J44A 3SQRA 5HYSG 4XP1H 4EO5A 4YMPA 2Z65C 4U1HB 2C1OA 2OSLB 4W9LC 3ILEA 5EEZA 3QO0B 1AHWC 2GBVA 4TNVK 1U8KA 2I9LB 2EDRA 3EFFA 4OZIE 2AKRB 1EFQA 5CKAA 3CFJA 5F1NB 2FJHB 5JW3H 4KQ0A 3SDCC 1UQSA 1ZHNB 4F58H 5F7EL 3PWJB 4GI6A 3ZGHA 3B6SB 4Y9BA 1AZVA 2BFVH 5CSBA 4ZDHA 2FNWA 1QPXA 3F12A 3VFUA 4KX9A 3WN5A 1FFOA 1ZIAA 1RIUL 3O3AB 5FAAA 5EN3A 2W88A 1XF5B 3DVGB 1OPOA 3S88L 1AYRA 3D2UD 3GMPA 1FH5L 4KJQD 1JZ8A 1G9ML 4QYAA 5D1QB 3OKDB 3NAAH 3TIDA 2QSVA 3C9NA 3ULVH 4LKCB 3LHAA 3L81A 3V8CA 3DX7A 3ZZSA 3HLKA 1WPCA 3RFZC 1SF5A 3JV6A 1H3XA 1TCRB 4Z7NF 1DN2A 1M7XA 3NJXA 2LHAA 5BMFL 3ULUL 3AS1A 4M48L 4RFOL 4CBPA 4PJBA 4YH6A 1EIBA 1B90A 2R0KH 3O0RL 4KKCC 3TBCA 4NQCD 5JORA 3BFQG 2Y5TB 4XBEL 2QHLA 3QP3A 3OKEB 2E27H 3SQOH 2CBOA 5EULV 3FNKA 5CJOH 5I8KL 1OHQA 3C75A 5J6SA 2ZF8A 4XCEA 2DN7A 1T7XA 1E27B 3P4NB 1ZTXH 3GNML 4UOW0 4HC1H 5CD3A 1IBFA 4Y9EA 3MZTA 2OMXB 4G9FB 4MXVF 4N2MA 1MJ8L 2NY2C 2YEZB 2VIRA 3S3JA 2VXQH 2XICA 2NY5H 3CIQA 5HYQB 1RAMA 1JK9A 2OZNA 4Y4FC 4JRYE 3DPDA 4K2UL 3TC9A 1EHLL 2CGZA 3TM6A 3H53A 4N90D 4CDGC 1EZUA 2OW7A 3X11A 2E7HA 4ZUUA 3V7AE 4YNYA 5J5EA 5IJVA 5D4IA 3UBFA 3UYRL 5TFSL 3HFMH 1JYXA 1JNJA 1UZ6E 1CU4L 4I3SH 5ADOH 1NBYA 4ORGA 4H8WC 4NQTA 1CUOA 5GGSB 3G7TA 1FP5A 5BS0B 1OCZB 1DDTA 2R59A 3HZMB 4MXWH 2ZYRA 3LTVA 1R3HA 4HJGA 2AV7A 4Y5YC 3RQ3A 2G3XA 3CZUB 4A04A 1AAJA 1TYRA 2HKHH 2WQXA 4I7ZC 1X5IA 1QLEB 3S9DB 1TEGA 4NNPL 3IDXL 4UT6L 5CJXC 4BWUA 4PJEE 2WUBH 3DX0A 3HG2A 1KGCE 1SEQH 3SE3A 4PGCB 3Q06A 4ZPVA 3WFZA 3ZJAA 4Z7WF 2ENYA 4Y4KD 5IUSA 1IM3D 3L7EA 3W0WD 3POCA 4NHUB 3S5LA 2GUYA 5EOCL 4X7SL 1B4TA 5ID0B 3WJLA 3SJVA 1NANH 2K4WA 2WTRA 4FNSA 4L8DA 1N5AB 1LMIA 1MG2C 4RRPG 5HJ3A 4UF7C 3SKOA 5GJTL 4AH2A 4K5PA 3HS9A 5GGSY 3ARFA 2ADIB 1QX1A 2H0EA 3GXDA 3ASNB 2GCYA 3DGDA 2DEYX 2Y23A 1O7VA 4JGMA 4OIIH 3TBWA 1T2QL 3WI9A 4WWKD 2HWZH 2X1PA 4NO0A 1CFTB 4ENEC 3RGBA 2OXGA 1DVTA 4MBRA 2F74A 3MXWL 2RALA 1F4XL 3VWKD 1T7ZA 2VL5A 3FB6A 1X5HA 2ZUXA 1TQCC 2UWEB 3ROOA 1BMZA 4G1MB 3DUSB 3MLUL 1J5CA 1F0LA 1PZ5A 3BAKA 3QUYB 2WTPA 3MLSH 4XGZA 3UPRB 2I7OA 1R3JA 1D7FA 1N3NA 2J72A 2X6BA 3U4BH 1ETB1 4L3AA 4XN7A 1IMHC 3R1GL 1HJCA 3TURA 2ED6A 3B2UD 5TGBB 5A16B 5D1XD 3QQ4A 4H0IA 5DD5H 5KOMC 5AVZB 7FABL 1I9IH 1M6OB 2PWDA 4WFED 3U0WH 1X6LA 4P0DA 4NQXB 3TL5A 3ESVF 4FCHA 4GQQA 1XGYH 2F08A 3QDMB 2X3AA 3UZVA 1JBJA 5JO5B 3V9FA 1A6AB 2AEPL 4PJDA 2YK1L 4PJ8A 2HCZX 1OCOB 1OKEA 3NSXA 1IAMA 4HKXA 5I6NA 4KZEH 3BE1H 1WBZB 1GYUA 2EDJA 4V1DD 5EO9A 4LMQI 3CZKA 3HBQA 4JHAL 4PD4K 4UYPA 3LPGA 1NBVH 4EIBA 2GABA 3PAVA 4TUOA 3ZT7A 3QHZL 1YMHA 3VXPB 3QQ3A 3JZYA 2WWOA 4X7TB 3RPIA 5KBPA 3P54A 3D69A 4NENB 4UV7L 2JCCE 4EZJA 5F1OB 5GHWL 4Y16B 5F1KC 4EPSA 5FO2A 4JFDE 1FUNA 3E7JA 3ARQA 4U0QB 4Y1SA 3ZGPA 1SHXA 4RWYH 2DM3A 4L23A 4PS3A 3JWNH 1DQQA 2ZWSA 3PUCA 3D2UB 2YPVH 4MA8L 1HI6A 3FRPA 2P43B 4HLEA 1W72H 1G84A 2DTMH 2I26N 2VDPB 3OMIB 2B5IC 5LXVA 3LQAL 2EC9T 3MHZA 3UO8B 4WWID 1O0VA 4H8PA 4PRNB 2C4FT 5EU5A 1H9DA 2XFXA 3KJ4C 2Z93B 4FE9A 1X5AA 4KO9A 1N6UA 2F54D 4NQCB 3WEBA 5GS0C 3EYQC 3HHRB 1F02I 1E4XL 1NOAA 2X70B 4ZS6D 5JQIB 4TPRL 3U2JA 4FQ1L 3FTXA 2WVSA 4W81A 2L3BA 1IL1B 4XE0A 2HPTA 3FU5A 4OUUB 3N41B 1HOEA 4QRRA 2IH9A 1Y6KR 3KYMA 1YECH 5LNGA 3WD5L 3L3OC 3LEXA 3STLA 1OTSC 2M8XA 4FEMA 1EBPA 4HKZB 4IQHA 2IQAB 3TNMA 1HXYA 3ATEA 1T6BX 3MYZA 1MY5A 4Q0XL 3AWGA 1JV5A 1LNUA 1NLDH 1Y6NR 3FBKA 3MV01 3R06A 4O02H 4RAUB 4AY0A 4H4NA 1IE5A 4XO5A 4J3OC 3BOVA 4FQXA 1PDKB 3ECQA 2EINB 1CFSB 2B8OT 3JTSB 1PZDA 2CDFB 3H54A 3O11B 2YGVA 1YYML 2YA2A 4XP4L 3KWUA 1TTBA 4GLRI 4X5WB 4QAWA 3V4VH 4ZRGA 4K94H 1AY1H 4GRLD 3MUGB 4MA7H 3T0ED 1JWSB 1CB4A 1UACH 2XBTA 3ELAT 5ITBH 3O9WD 4NGHL 1TTGA 3GTVA 3WU1A 2IFFH 4M7JH 5KS9E 1MCNA 1CD0A 1MWAA 2BNRE 4U3SA 3V5KB 3IDUA 1LO5A 1IFHL 3CVHL 2OM5A 2H1PH 4KUZH 4B5EA 5IMMB 4TV3A 3VGFA 1UFGA 2XCMC 3IDGA 1QBMH 4IM8A 4RSVA 4ZOEA 3L45A 3P1VA 4KK9C 1IM3B 3W0WB 1KLFB 2WCSA 2IV8A 2ARJQ 3PWPA 4OUOA 2FL5A 1NLBL 1KY6A 2CPUA 3I6SA 1S9XA 1MKFA 4JAMB 3IFPB 1U8LB 4PB0H 3AABA 3VFMB 5IHBA 4MJ2A 1GGCL 2PR4H 2ZOTA 4RGNE 3B56A 5BVJA 5I76B 5BV7L 4K7FB 3SD2A 5IB2A 2Y7MA 3FO0H 2NSXA 4NX0A 1CFBA 5FGSA 1DQTA 5EZPA 3L9BA 4R83A 2CKBH 3IF1A 1KBBA 4WWKB 2W81C 4BUQA 4OZHA 5EH1A 4OZFH 2DQCH 3GXTA 2CJUH 1TZGH 1I7TA 4LEOB 1CFQB 5CINL 4K8RD 4XN8A 1NFIB 2H26A 1AD9A 2FE0A 5KVMC 1ZHKB 3BFWA 4LL4A 4C4KT 3WNLA 4XN2A 3VWKB 3PABB 4GQ9L 5AOMA 5C1MB 2VW4A 3KYOA 1MPAL 2FYYB 4RX4A 5E7FA 4RZCA 4JFZL 4FI6A 3FK3A 3RVWD 1M7DA 3I50H 4NOBA 3S37L 5JW4Q 5HHME 5HGHB 5EORH 4Y4HA 4JM4H 3GJEA 1FCCA 1NDGB 4ZX5A 5EZJA 5TE7L 2G4EA 1F90L 1W8NA 2FEJA 4KXZI 4RWHA 5JW4N 4QTIH 2Y07H 4JEGB 3KPLB 3EGDA 1UC6A 1G1OA 3S35L 3UG3A 3ZL1A 1K4DB 4AIZA 3LZFL 2QKIA 4KVPA 2VOTA 3FF8A 2P24A 5GGVH 5I0DA 2DBJA 4ELMF 2R7EA 2EICA 5C6TL 2R39A 1A0QL 1UZ8A 4WU5B 5SWQB 2ED8A 3LPOA 1C12A 3ZDYF 2CCWA 2CQVA 1UA6L 3MGOB 2ZQKA 2BVPA 3MAWA 3P9LA 4OLYL 2DLIA 4PSPA 1HSBB 3SDYH 1MCWW 2X9XA 3UO1L 5IEHA 4JGUA 3APCA 5CLXA 5DRNA 4TQPA 3MMEA 4ZUSA 1A1NB 3FB5A 3P02A 3NCMA 4YSQA 1B4JL 5E99H 4V1DB 1J8HA 1YMME 4QO1A 2YD7A 4HHGA 3U6XA 4CN4A 2X2UA 1K6QH 3AUVA 3I02B 2R23A 4BZ1H 3BXNA 4GW4B 5HPOA 4R4FH 3HMXA 4KTYA 4X98B 4GYBA 4UT7L 1U3YA 2DWYA 4CA4A 3WTTA 4QDGA 4J3BA 5F7WC 2PWFA 3UAJA 3P4MB 2YRPA 2BW4A 3CUPB 1OAZH 1QAWA 2FRGP 3N44B 3ARYA 1CGVA 4ZQTA 3KVPA 2YS4A 1QFUH 3HKZA 3FQUA 5DMIL 1MREL 3G6JF 3D2TA 2R8SL 4M6OL 4NSKB 2NW3A 2IOIA 3OAYK 5F21B 1CYWA 2IDQA 4X4ME 2WBJC 4AXWB 3LEVL 1IAKB 2F61A 3VNYA 3U9PH 4J1UB 1R24A 1JYVA 4DOHB 4DP0X 3TJEH 3LKRB 1WJ3A 3BUIA 2JKJA 4AT6A 5I1DB 1SLUA 1V54B 3GSWB 3WELA 1OE2A 1ZLUH 4FULA 2OV0A 4P2QE 2DEXX 3FQTB 2ZOKB 3NJHA 5EBLB 5B4MD 3SJVD 4I4WA 3DMMC 25C8L 3BVNB 3PWVB 1A65A 2CDEB 2P80A 1T20B 4FP8L 2F54B 2KZWA 4CMHB 3HLAA 2D3LA 4PJ7A 2R69L 1JVLA 2W65A 4RQQA 2X89A 1ADQA 1GGUA 3W2DL 3RWHA 1AQKH 3CHPA 4OFIA 5H4YA 4FN0A 1VFUA 4N25A 4U33A 1J10A 3T8XB 4JKMA 4NO0D 3VI3B 3O8XA 2AK1L 1XTLA 5AG8A 4KKRA 2JJSC 4FLRA 5L4JA 3GSVA 1BJ8A 4AC2A 3MLRH 3NIDF 5F7DA 2YLKA 2Z7YA 2K9FB 5TD4A 2AQNA 4PGBA 3BDXA 1DJYA 4Y9CA 5HVHB 5IMLB 3HAEA 3NPZB 2J4WH 5KVGL 3N3EA 4MMYB 4PCTA 4WUUE 4OLXL 1WCBB 2Y5QA 2MPAH 3T2PA 3RHWF 4D9LL 4D0CA 1DVYA 1YEDA 4WFHD 4GRLB 5CHNB 4FEIA 1E4WH 3QXUA 2C1PB 3T0EB 2F19H 3WFHA 5FOJA 4UNTA 5AAMA 3RU8L 3LMJL 1SMAA 1FVEB 3MGAA 4AQZA 3FQ2A 4NRYA 4PJ8D 4TULL 4PAZA 3W1ZA 1DBJL 1F00I 1T89C 3HUJE 4PJGA 5DLML 4CW1A 4JN2A 4WFFE 2C1OB 4H40A 4HXBL 4UCFA 5D1QC 3NCYS 1NEZA 2BIQA 5DDHA 5JHLL 1T83C 1U8KB 2VQ1A 3EFFB 1CYGA 3L4CA 1OCRB 2X4SA 3QULA 1YUHA 3ZTJH 4PGZA 3ZMRA 3A4FA 5FUZH 2DMBA 1EZVY 5TPWL 3EFOA 3VXME 3HNTH 3UC2A 1XBDA 3IXTA 5D93B 3RWEA 4ZDHB 3F12B 4UNUA 3WN5B 1FFOB 1BXUA 4KX7A 5AW8B 2W1NA 4G43A 4EDXA 1MCDA 2ZF9A 5MHSE 1X5KA 4GEIA 2IDFA 4WI2A 3RWFA 3GMPB 2AJZA 4XOEA 2D7QA 2DQIL 4L9DA 5I6MA 5ILTL 4ZTOL 1N6QL 3TIDB 1QLFA 3C9NB 4PWEA 5C71A 1OQOA 4P49A 4RMWA 2AGJL 5IQMA 3QCTL 4NIKB 3DX9A 4NZTH 3JV6B 4X6DE 4F91B 2OMBA 4UIMA 5TDPA 4AEEA 4IBWA 1A2YA 2VLMD 3V7MA 4JQIH 1BDYA 3GSRA 4LCVA 3EJPA 2WSDA 3I6LE 5JORB 1OAQL 1P84K 4QRPA 3MV9A 1MSPA 3GIZH 1BECA 3VXRA 4UDTA 3N50A 1VKXA 3I3DA 4XCEB 3U48A 1AIZA 2CUAA 3ZUCA 3I9IA 3UTTE 3ULUF 3PAYA 5CD3B 4QRRD 1ET5A 2Q2EB 1BZDA 2E8ZA 4AEHH 3FT2A 3VI4A 1AGBA 4HUXA 3ECBB 4PJFE 1UM6L 5I5RA 1DSFH 2V9QA 2VIRB 2X09A 3OKLA 4HIXH 4PLNC 4J3SA 2HG0A 5FGRA 2JB6A 2YIHA 2ZWYA 5LUMA 2VN6A 4YSUA 1JK9B 3X3GL 1XX9C 2X53A 4KMTL 4GOSA 2CSPA 1L0QA 2ZONA 2C34A 2BZ7A 3X11B 4FQXD 1HHIA 4ISVA 4ZUUB 4K3HA 3PGDA 2F8VA 3IFNH 4L18A 4J3UA 1IVTA 1SOXA 4R5XA 2YD0A 1QBAA 4EOWL 1NBYB 1NAML 2XA8H 2OJEA 1JGUL 5JDSB 3C8DA 4YSRA 4E5XG 1RQ5A 3DKHA 3RUGB 4XH2B 3O3UN 5JHAA 5KYYB 2A6JA 1CPUA 1A7PH 4HJGB 5JQ6H 3UX9B 3OJMB 5EZOL 2AV7B 4JM2A 4YFEA 1S7XA 3UH8A 4MYWB 1RZPA 3KNBA 2EADA 5IB1B 1NCDL 3MRRA 1DEDA 2VLJD 4YHPA 2GEQA 3C2AL 1L7IL 1ZSHA 1G6RL 3QPQC 4ANKA 4MKTA 1G5GA 5D7JD 4DHLA 2FX9H 3V4UH 3L7EB 3JWOC 3S5LB 1L3NA 3FH5A 3UROR 2VM3A 1XGTB 5JMOC 1F3DH 2UZIH 3CLEL 5J1AA 3T3MB 3SJVB 1XH0A 2VMJA 4M5ZL 4L8DB 4OFQA 3TH4T 2X4QB 1XGRB 5EZLA 1ZATA 1COBA 5HGGS 3QUYC 5HJ3B 5JIKA 3SKOB 4AH2B 4BH7B 4C8XA 4QKXB 2F5AL 1WFMA 4GG8A 5HI3C 3U7WL 5CN1A 3TBWB 3HC3L 2X4PA 4X4ZA 3L3KA 3WJJA 1CJYA 3FONA 4NO0B 1P69B 3OAZH 4J3WA 4DNLA 2ICCA 3T3PB 1WEJH 2F74B 3HA0A 1I8KB 1ZOXA 3APMA 2B1AL 3R7QA 3W56A 2H45A 1MCWM 4YR6A 2VL5B 3FB6B 3ZVVA 1NIDA 3AXIA 3CLWA 4XTRC 4ZSOE 1NSNL 3O81A 1PD6A 3ROOB 1S7SA 1LQSR 4RX4D 4X5XA 1G7HA 1NBQA 1PZ5B 1S78C 3L6FA 1YEFH 1I8MB 4XGZB 4R26L 1I9RH 1R3JB 1N3NB 3NJIA 1FORH 4BCZA 5AZEH 3OJDA 1SXNA 1DUYB 3QQ4B 3MBXL 3QG7L 3LJ3A 3C5XA 2NRDA 4K7PL 4QPEA 4LZKA 4WJG3 1RKRA 1JXJA 4MQ7A 2P5EE 3SZKC 3CHXA 3GKWL 1FBIL 1ZANL 3UZVB 4A7TA 5HHOE 3A3YB 4DKEH 1SJMA 2EH7H 2XQBL 4N6RB 4QTFA 4JE4B 3S36X 1EWHA 4PJDB 1MHEB 4PJ8B 3TT1H 2DMKA 3SZ6A 1MCKA 4OQTA 5ABAA 3OWRA 4HGMA 4HKXB 1LP9E 2JQMA 3Q05A 2HB0A 1JE6A 4U2YA 2FR4A 4KJQC 1JV2A 5AKTA 4KOBA 1J8HD 1Q8MA 5EO9B 5HDBE 1PLBA 3QJSB 3O6LL 1FJ1A 3JTBA 1KIQA 1L7TL 1JPSL 2MHAA 4LSVH 3EYSL 3TFBA 1YUKB 3IMRA 4KHXH 5BW7A 1YMHB 2QGEA 2JI1A 4HFUL 2VNCA 1E8XA 3SKJH 4TQIA 2NPLX 2ESVA 3QQ3B 3UAJD 4UQAA 4DKFH 4NUGH 3RPIB 3D69B 1MFDL 1P4LB 1AMYA 3BPOB 3OMNB 4HMDA 4TRPH 3P3RA 3V0IA 3S96A 4PJCE 3FFDA 1TPXB 5J06A 2F53D 3DX4A 2QPSA 2XDHA 3MLTA 3CX5J 4ONFL 4PV9B 4TYUA 1N26A 3T6VA 3DETD 5JNYB 1HI6B 2CLVA 3FRPB 3H3BC 3NOIA 4TVPH 4PMEA 2BCKB 3D30A 2C3VB 1QA9A 3LNDA 3MOBL 3KD4A 4M02A 4JCLA 4KU1A 3OM3B 1R3IL 5EMYA 1Z9LA 1IKNC 3KW7A 1A14L 1RJLA 5EU5B 2LLNA 3TWCH 5HPMA 2BRRH 2XFXB 1J9SA 4GXUM 4FDWA 4HLZG 4YBLC 2QL1A 4NFCA 3D33A 4LLMA 5DQJA 2P80D 2W9DH 1W6WA 2WKGA 2G5UA 1MCRA 3IGUA 1MHHB 2X89D 4J7RA 2YR3A 5CM1A 2L0DA 1AXIB 1ADWA 2AQ1A 4EZLA 3CD4A 4H5SB 3FU8A 2GTQA 3O8XD 4PS8A 4S1SL 3JWDH 1EEQA 5EIIG 2N0MA 4QRRB 1G9NL 1N8ZA 4OZGA 3KYMB 4ZFZA 1XZWA 5DJZA 3LEXB 3STLB 1HYRC 2M83A 4XHJD 4L3CA 1HXYB 4LCWA 2HX9A 3GBNL 1DBKL 1JV5B 1LNUB 4YFLF 1DCLA 4HISA 2Y2WA 1QBLH 1XH3A 4FQXB 2ZXWB 1FAIL 1QABA 1N18A 2DWEA 1R0AH 1DLHA 5HDLA 3REVA 4Y4KC 1JZGA 2WO2B 3US9A 2YAMA 2VC2L 1A7NH 5DZLA 4Q56A 4Z3HA 1EMTH 3G9VA 3II2A 4ODTL 4UT9H 1JPST 1OAYH 3GI9H 2ZYIA 2HH0L 1HAUA 3II3A 4BHUA 2HX7A 4WFGE 5CGTA 5IVXE 1E9QA 1Y0LA 2G9KA 1NC2D 4NPYA 4U3SB 1MWAB 4I88A 2VLJB 3OKNA 1LO5B 2OR7A 2Y4SA 4WWKC 3TF4A 1JRHI 3ESMA 4JFVA 4HUCA 4WI8A 5H2BA 4L4TA 2VLLA 3RI5K 3IDGB 5D7JB 4EN2A 1MI5A 2Y2TA 5F8RC 5K9OA 3LSOB 2I5YH 4U6XA 2FL5B 1V8HA 4X50A 3WS6C 3VWKC 3EOBA 2X9ZA 2XJKA 1S9XB 2XTSA 4X8XA 5DYOA 4DKTA 5BVJB 2A6IA 1EXHA 1G7JA 1UH4A 3TBVA 4BK4A 5IB2B 3L3GA 2HLEB 2A4ZA 3IF1B 2WQRA 1UGKA 3B2UC 5I30L 5T33H 1O6VA 4XNDA 2DL9A 5D1XC 5DT1H 3UBXI 4P2OA 3MBEA 3EO0A 4OAWA 2EIBA 2Z0BA 3HNSH 4H1LA 4OZHB 4I0KA 1I7TB 4DFHA 1PNCA 1A6VH 3HZKA 1R34A 1YEKH 3CX2A 2H26B 1AD9B 1HL4A 3ZTDC 3U1QA 4HS6A 2EDDA 4RIRB 3QDJA 1OT1A 4WU7A 2QPDB 4RZCB 5I71B 4NC1C 2X41A 2KQMA 1HSAB 3BVUA 3B9EA 1M7DB 4HULB 1YAZA 5KBLA 1BXVA 1MF2L 2VDMH 3GJEB 2EVJA 4OVVA 5EZJB 3KPRE 4L1SA 4QRPD 2EH8L 3NJLA 4PPTA 4X4YA 4GJTB 3VXRD 4NQSB 3EGDB 3OAZK 2ZYSA 4UANA 2QKIB 4J28A 4AMXA 3FUHA 3SBWA 2Z8WC 3MRCA 2KERA 1T66D 1UZ8B 1CXFA 1TQSA 1ONQB 1C12B 3KGSA 1N7ML 1KLGB 3EJRA 1JL8A 3P9LB 1MHCA 5FGCE 2XVKA 5IEHB 4HWBH 4HK0B 1Q9LB 2IQ9H 1GIGH 5DRNB 1MFCH 2VTFA 1NBCA 1JPFA 3NJNA 4MB3A 1Z6JT 4QHUA 3ZIYA 4PRHA 5LCVH 4K4KA 2NUTA 4BZ2L 3IAPA 2R23B 5DRZA 2VDKL 5CBEB 4GG6B 5E6SB 1SBSH 4O4YL 1MELA 2GT9A 2PCFB 2XZAL 5I1JL 1E7VA 2GJ6A 2Q7NA 4R7NA 5AW7B 4UOJA 4HIQA 4CMHC 4D3CL 3WTXA 3A67L 4CAGA 4JM2D 3ZE1B 2O93L 3FQUB 4HEMA 2E8YA 5T3ZD 5FFOA 4G83A 4ZS6C 3SSGA 1KJ2L 2F53B 2XQ0A 2ZUQC 5EOTA 5F93C 1WZKA 3RRQA 3OR6A 5D5MF 3Q5YA 4PJAF 2VDQH 4MGXA 3VXQA 3HHSA 1DVUA 1XFPA 1R24B 4N0CD 5E5LA 5I73B 5IHZA 4AT6B 2XPGA 1HAWA 1QNZH 1A4CA 1KELH 4ZX6A 4XO3A 3THMH 3RAJL 2L4OA 5IWLC 4FYQA 2I24N 4NZRH 1BYPA 2WXQA 2XZQH 5HVHC 1BVKA 3HLAB 4LBEA 4I13B 4PJ7B 2A9DA 1OCWH 4R84A 2W65B 4RQQB 5E4AA 2DQTH 1AS8A 2XRAL 5FECB 3OF6D 3RWHB 4N0UE 4P3CL 4GKSB 3S8FB 1KGUA 2R15A 2IH8A 3SGEH 3O8XB 4Q7DA 1JHTA 3UXFA 2FB4H 2EKJA 4YDJB 5T3XH 1BD2E 3AQXA 4GRLC 4NZUH 4Z0XA 4XAKE 3GSVB 1XSKA 4YBHA 5F0MB 3HR6A 3T0EC 1T03L 5D70H 3WAKA 1QW9A 4JREB 1GW0A 3O9WC 5C07A 3GK8L 4LLWA 4BFFA 5DZNA 4QWWD 4KVCL 1FNGA 2A38A 3PF2A 1W0WA 2HVKA 1NFAA 5F1SA 4Z18A 2H6UA 1CK0L 3HAEB 1WWAX 2XFGB 3QDGE 4BYHA 3WY2A 5C2BH 1AHKA 4P4KA 1II4E 2WZPA 3IBOA 2A9NL 5EBGA 1UXMA 4KXCA 1BBDL 1TOXA 5I1IL 4D0CB 2OMZB 4LSPH 4TSCL 1IGIH 1OAKH 1YEDB 4K3DL 1S7QA 3O2WL 4XP9L 4DGYL 1AGEA 4IRJA 5KSBF 5LG6A 3WKMH 4KTDL 1PIGA 5GS0L 2BMKA 3WFHB 1GYAA 2W0LA 3ESPA 1MHPH 4Q9RL 3T08A 4FLHA 3UTPE 3EYOA 5JDJA 5KG9A 1RIHH 4UI2A 5D93C 1VGEL 3DRTA 5I0YA 1NC2B 1CD1A 3H8NA 3QAZB 1DLFL 4TM9A 1GYCA 3WN5C 4M3HA 1F42A 3PHAA 4PJGB 4E42B 3EDDA 1J88A 4RMUA 4CW1B 4JN2B 5F7LB 4K8RC 4KPHH 5GGTA 4DGWC 1NEZB 2X1WL 5CIPH 3BWUF 4R5TA 4MFHA 2VQ1B 3WMPA 2MOQA 1EEYA 2X4SB 3QULB 1MEXL 3L7FA 1BSIA 4MXQD 4GO6B 4M4RA 1MCCA 2VDOL 3NTCH 5C0AD 4Z5RB 2ESVD 3EFOB 3S0PA 2EDKA 4P3WA 5GRYA 3RVWC 2PYFA 1J5HA 4NUMA 1M71A 3IXTB 3VCLB 2Z34A 5CILH 1PL3A 3RWEB 3ZBMA 2GHZA 5J3HD 4LVOB 3MLWH 3UTSE 4LOUD 4FG0A 1N70A 3MRPA 3HCVA 4G43B 1RZIB 4EDXB 3CXHJ 4FTVE 4LB8A 3CFBA 3RWFB 3E8UL 2AJZB 4AKOA 4KH2A 3MQIA 2CK0H 43CAA 4Q9QH 1CMOA 1MNUL 1QLFB 1KCSL 3SE8L 1A1OA 2JB5L 1PKQB 4OCYL 3VRLF 1RZ8A 3HS0A 3FO2B 4X6EA 4JO1H 4BQ8A 1UENA 3AU0A 2HJLB 3EH2A 2MFNA 1IJ9A 2VDNB 3DX9B 4X99B 5TK2A 4UIMB 5TDPB 4RAHA 1PG7L 3L5HA 1CLZL 3WAJA 2J5LC 3GSRB 4JO8A 4HJ1A 5IQOA 2H3KA 3OHMB 3DIVA 1NL0H 4QRPB 1A3LH 4HUWA 4WKZB 3ZTNL 4HQQL 1CC3A 4UDTB 1PVHA 1VKXB 4WUKH 3RPBA 3MUY1 1CGSH 3BO8A 4FJYA 1H8NA 1XXDC 3D4CA 3SOBH 1Z3RA 3C5SA 4GI8A 2WQUA 4XC3H 1ODAA 5J57B 2VXSH 4KKPA 3FT2B 3UBXA 4BXSV 3VI4B 3ZU8A 1BBJA 2YAOA 3OKLB 4N8PA 3L3JA 4AEIH 3BVXA 1N4XL 1TTCA 2JB6B 4LCWD 1NGPL 1AOZA 5I74B 1KYFA 1DBML 4DGVH 1UWXH 3MRNA 4H26B 4WNQA 4F8PA 4BRVA 4ISVB 3WHXA 2CE6A 3L2NA 3PGDB 3SE3C 4ATTA 1JZHA 4WHYH 4ALAC 3EJTA 1MDTA 3MLXL 3QWRA 5C86A 4ZOAA 2OJEB 3WJLC 2NNCA 5B4MC 4DW2L 2AW2A 4Z7QF 3MNMA 4KAQL 4R2GD 3VVWA 1MLCB 1YEEL 2V2WB 3ZL4L 2FLBT 1QZ1A 2A6JB 2EQDA 2ILLA 4BUGA 2DW5A 1DJWA 1DVXA 4JM2B 3DK0A 1S7XB 3CDZA 2AJSH 3N0PB 4XC1H 2MNUA 3KNBB 1NCBH 1SHMA 4OF0A 2G5BA 1IBHA 3KPSA 3MRRB 3ML9A 4M93B 4YHPB 5C0BA 3WUWG 3L5WA 2OL3H 4V11A 1NFDA 4L4TD 3KL3A 1ACYH 1VF5C 2HLAA 3P9MB 4L4JA 3GI8H 3DYOA 4LK4A 3FS9A 1S6NA 4NUJA 5J1AB 1M1XA 2M26A 2ARJA 3HW7A 4WRLA 4M7LH 5DD0L 3H7LA 1HZHL 1ZS2A 2EP6A 5EZLB 4ZS7H 3IDJA 4L0YA 4GG8B 3GKZA 1MXGA 2AAVA 4YXHL 4Q89A 3A21A 3ZE0F 4YDVB 2X4PB 4IU3B 5HHQA 3L3KB 2O5NA 3BISA 3FONB 3MBED 5A2BA 3TS8A 4NM4H 4YHML 1K5NB 4W70A 4XXWA 1JZ6A 4A7GA 5L8KB 3PXLA 5E2JA 4PV8A 1U8QA 3Q8EA 2A9CA 4YR6B 3VU2A 3BI9X 1MCBA 3BAWA 3QDJD 4FXGA 4J4PA 1S7SB 4PJ8C 4X5XB 4OCSL 3OLGA 3L6FB 1S3KL 2XX0A 2KZKA 3FB7A 3ESNA 1V7NL 2WZAA 5IY5B 1CGWA 5GRWA 3AQZA 3QB7C 1BFTA 2EZ0D 3UP6A 1ZHLA 1OGAE 3H85A 3OJ2C 4HSQA 5ICYA 1JZ7A 1TTAA 4WEUD 4MQ7B 2H6PA 1G9MH 2ZUYA 4FABH 3FJTA 3R0NA 4WW2A 3EOYG 3BPOC 2H32A 4AQEB 4UYQA 1B9ZA 4AIOA 4OCWL 3EJYD 3QQDA 5DK2A 3S37X 1TPXC 1ZKAA 3Q0HA 4JB9L 3ULUH 4M48H 1IBGH 4RFOH 3NCBB 3EH4B 2FR4B 2D2CC 3ISWA 4PRHD 4HW6A 1TJHH 4W9FC 3VD0A 1NJ9B 4FHJA 2AJ3A 4R8WL 5EUOA 4HCRA 3HB3D 3S35X 2OSWA 2MHAB 2G0KA 2A83A 3KXFA 4LKXB 3NQKA 5ELIA 4LARL 5I8KH 2JJTA 5GS1B 3WDJA 2NZ1A 2X3CA 1JZDC 5C0AB 3VXSA 1H3TA 2NQDA 2BWIA 2ESVB 5PCYA 3HI1A 2XHNA 2YAHA 1ZT4B 2Y24A 3DDGA 4HZAA 4KKLD 1T7YA 4MXVE 5F72S 3S96B 4PJIF 4NC0B 3FFDB 2ISDA 2Y7OA 4ZD3H 1EFXD 5AB9A 5B3JF 4K9JA 3MLTB 3ROLB 1NKOA 2HT4D 1JXDA 1S9YA 1JI2A 4GRWB 4X2UA 2CLVB 5J6GA 1UGNA 3ARZA 4MB5A 3FOMA 4G1EA 4Q4EA 1DQJA 1QA9B 2I07A 4M56A 1KF9B 3UYRH 4OM0L 1UXLA 1JHLL 5TFSH 2EECA 5IJCC 1LWRA 5HPMB 4L1LA 2LE9A 3ET9F 4LLMB 3CQFA 5DQJB 2R2CA 2JF1A 1LTXA 2NYKA 4PWGA 4YAQB 5GZNA 1GOFA 4ONHA 1WS7A 4KK5D 1DJXA 1N67A 4FQXC 2OXHA 1C08A 3HEIB 4B50A 4XNXL 1WGVA 3AG4B 4RNRA 3OBAA 3QEGH 2ROXA 1OL0A 2X4RA 5FEBA 4KK6D 2GJRA 4OZGB 3QR0A 3V0FA 4ZODA 4P4RA 4ZFZB 1NGQH 3VYPA 1K3IA 1Z1WA 3QNZA 5DJZB 1KXHA 1M7IA 2QGCA 2FSDA 4NP4L 4L3CB 3U6XS 4LCWB 3RL2A 4MBOA 5L2KE 1OB1B 3ESUF 4HC1A 3G6AB 1CDGA 1MI5E 1AP2A 5DTFB 3X1GA 4G8GA 2HYMA 3ZDXE 12E8H 1XH3B 4P4KD 1ND0A 2VXQA 4JO2H 2VN4A 5AVUB 5GJTH 2DWEB 3HG3A 1DLHB 2WZPD 3MLYH 5D7JC 3REVB 3X17A 4DPRA 2J1KA 1P7HL 2HX8A 3QUMH 4QKTA 4H88H 3UABA 4F7MB 1MAML 4OD1L 3QEUA 5DUPH 3RWGA 1JGVL 4IMLA 4A39A 4IRJD 4DVRL 4OJAA 2XI9A 2N59A 2R2BA 3VQ2C 4R2GB 2IADA 3L1OH 2PO6A 4WAFA 3MXWH 1KTLA 2ZPKL 5I5IA 1T0NB 1U6AH 1E9QB 1U8PA 2NCMA 3EJZD 1Y0LB 4YVNA 1KTBA 4NPYB 4YSCA 1DVQA 3DSNA 3FSZA 4Z1PA 1UWXK 5D72H 3TWYA 2DI7A 2VZSA 4LP4A 5D7LE 5H2BB 2VLLB 4D0DA 2WOYA 3H0TA 5FYKH 2PPDA 5AW5B 1HWGB 3OG4B 4F5CE 5K9OB 1HOCA 3KGRA 1AQ8A 2P5WA 1KACB 3R1GH 3EOBB 2VUYA 1G43A 2H1LM 4BCXA 5E2UL 3N85H 5B38A 1K4CB 3J8F7 4OJFH 2DLFH 1E90A 2L7JA 5DYOB 4BKLA 4OTXL 4PGEA 2ICWI 1J0IA 4NO5A 2QPEB 5E9DE 5I71C 4TNEA 2A6IB 2BIHA 5CEXA 3TBVB 1UJ3A 1ZDQA 4Q58C 1UD6A 2C9RA 2F7PA 3NCFB 4F9LA 1BF5A 2AEPH 1WUNT 3OPZL 1NCWL 1U8JB 3M6DA 5B1AB 1F1AA 3M7FB 4QHMB 1TEFA 1YNLL 3FTGA 3SIKA 3MBEB 3EO0B 4OAWB 3EIFA 4H1LB 3UTZB 2QKIC 4NJAL 3HZKB 4GSRA 4F80A 2QJDA 4TOYH 4HX1A 3F6IA 4PWKA 4HS6B 4J3OG 4J2QA 1AFVH 3QDJB 4FFYL 4W4OA 3GSOB 3KBEA 3NFPB 5LGHH 4FQQB 4AQOA 4Z3EA 2DIAA 5JUEH 5JXAH 2VLRA 4UV7H 32C2B 2MCAA 1NIAA 5GHWH 1Y7VA 5I8CA 2WLHA 3K4DA 1WVZA 1OT4A 4X4YB 4P57B 2Z4QB 1XB8A 3B83A 4JZNA 3LHPL 4NQDA 1PX3A 5F7MC 5AB0A 6FABL 3ZTCC 2NNFA 4HETA 3LXAA 3MRCB 1GJIA 3UAJC 3QEQE 2J8UB 2XSKA 5ALBH 5DD3L 5GISL 1MHCB 2J8HA 3GDCA 3VH8G 4OGYL 2B1HH 4O5LL 4R97B 5AYTA 1ITBB 4GAFB 3PS6A 1QBBA 2VAAA 1JPFB 1UWEH 2X6AA 4QHUB 3IETB 4PRHB 3V0WL 3DETC 5FYLD 1HKLH 1IX2A 1E6OL 3HB3B 5DRZB 4RGOL 1DR9A 1E4XH 4C59B 5I18L 3QWRD 4XCFH 5I73C 4OKVA 3LS5L 1YNKH 4FQ1H 3DV6A 4S1DD 5F9OL 1LK3L 1OVZA 2N1KA 4MMXB 2F2HA 1CD8A 2CU9A 3BZDA 1BLNA 1NMCB 2NZ9D 1GHFL 3DLQR 3Q48A 1MRCL 1PF3A 3O6ML 4JFUA 3VD7A 1EAJA 1EFXB 4F20A 2DKMA 2A9AA 3KPSD 5C7ZA 4KMQA 3PJNA 3OR6B 3WEAA 2X10A 3WN6A 2DLEA 5C0BD 1CIUA 3O4LE 4FKHA 3MGTA 3O8XC 3CC1A 3CFDA 3VXQB 5C07E 5IESL 4RA0C 1UXSB 2WWKO 4G59C 4YBQD 3IRCA 4KUCD 1XSIA 5IHZB 2XPGB 4DERA 2CNZA 4XHJC 2E7MA 4JREC 4NJ9L 1I7ZA 4MJIE 1J9RA 1F4YL 1FVDA 2ODHA 3QHFL 2YPVA 5JOFA 2OLDA 4W9DC 1W72A 4OD3H 3WDIA 1E8YA 3DHMA 1ZVSB 4KI5D 4APXB 2CWRA 4R3SA 4DP5X 5H35A 4LSRL 3QE5A 5F0LB 4KBPA 2QMJA 2ITCB 2VDPL 1RVFL 3IPFA 5I8OH 4MNHA 3WNIA 1FA4A 1S8DA 4HCGA 1B4RA 1AXTH 1K2DA 2DQHL 3SPHA 1M57B 4G2AA 2NUPA 2ID5A 4BA0A 5EHFA 2FO4A 3KLDA 5KVEH 4Z0XB 4LIQL 5F89A 2BW5A 3HJEA 3HZ3A 4DSYA 4YSDA 4ZX4A 3UMNA 4KGJA 4OCRL 1FGVH 5TQ0L 4NT6A 3CLFL 3DBXA 4LLWB 4YO0A 2FQEA 4J4PD 5L4FA 1FNGB 2BPBA 2FQDA 3QIWA 1W0WB 2HVKB 3QAZC 4N22A 4QOKE 5I5MA 3GZQA 4P4KB 3C8KA 1MIEL 4WV1A 5ECJE 4HGWA 4QY8B 4PD4J 4PJXF 3SB3A 4PP2A 3ABLB 4O02A 2JI3A 5HGDA 4Z7OE 5C8JA 1ZK5A 1S7QB 3AVEA 3MUHL 4FC3E 3MC0A 3BLKA 1AGEB 1UT9A 3TO2A 4IRJB 3OLIA 4OB5H 4BFKA 3DI2B 1R4XA 4EI0A 2BMKB 5I1AA 1GMIA 2R27A 3C5ZA 2CH8A 1YQVH 3EYOB 4HUNB 3IMVA 1P5UA 4GQ9H 3DRTB 3AWEA 1CD1B 3MACL 3RA7H 4H13C 4LVOC 3V4VA 1WFOA 2RB8A 4YHNA 4ABVA 5BXFA 5IOPA 1MPAH 2EUVA 1FI8C 2ETWA 2LAAA 3CDGA 4JFZH 1N0XH 4ZOBA 5D7IE 1EVTC 2K1MA 2E4TA 3DXAA 5I19H 1DQVA 1XV8A 2GITB 5TE7H 4EQ2A 1F90H 4WJKB 3PJSB 3PREA 4K7PX 3KXFD 1EEYB 4ODSL 1R5VA 2D3VA 1RL1A 1TZOA 1TZAA 2BLFA 3L7FB 3NIFF 3V6FA 3C2SA 4M4RB 3ZR5A 3VXSD 1DZBA 3S34L 4HJUA 4TVSa 3RGHA 5E2TL 2PYFB 1F58L 1M71B 4TNWK 1DYZA 4YPJA 4HIPA 3GMMA 1CCZA 3MNZA 1UA6H 3ZDYE 3QYCA 2JTYA 4OLYH 3SY0A 3ARDA 4UTBH 3UO1H 5DQ9A 1Z32X 3HCVB 4LEEA 4MB1A 5IHUH 1FC1A 1IC5L 4HJSA 4HH8A 2VYRE 3MJWA 5D7SH 3CFBB 3QRBA 4RISH 43CAB 1G7IA 4J3OF 2BFGA 1A1OB 1T66C 3LKSB 4NRXA 3PXHA 2CKBA 1RZ8B 3G5XA 4XNQB 3HS0B 3FMGL 4X6EB 1QWHA 3PPSA 1B9KA 4OZFA 1Z9PA 4QR7A 4UT7H 5H37G 1RURL 1E2ZA 2GSGA 3IEAA 5I74C 3BWSA 3KEHA 4P8QA 4F93B 3ULVD 1NDMA 3A6BL 3UIYA 1WTLA 1ZAGA 4HUWB 2V3EA 1BX2A 5MEOB 2ZXQA 2RQEA 1KCLA 3BO8B 2BSRA 1UM4L 1I3GL 2WV3A 1ILSA 1UURA 3QDHA 5JXEA 2C9PA 3B7YA 4U4IA 3PHSA 4XAWL 3UBXB 3V0HA 1BBJB 5JPMB 1ZWIA 1D5BA 4CC0A 3L3JB 2RHEA 3D08A 2XLLA 1ML0A 2DRUA 4JM2C 1NFDE 5EN2A 1FFRA 1YNTA 4J6RL 1I9EA 3LNFA 4HT1H 2APFA 3I9GL 4M93C 3F62A 4QAMB 4JO5A 4Z95L 4A52A 4IKJA 3WY4A 3LN4A 4HD9A 3WHXB 1UD2A 5ICUA 3QZBA 5EIVA 2F7QA 1KFGA 4KTEL 2PPEA 4N0CC 2AZUA 4O00A 1J5DA 5SWZE 1CURA 4I1NB 3RL1A 3ALXA 1KPUA 2CGYA 1Q1JL 5TQ2L 1KB3A 3KPPA 3X1EA 2AK1H 1TU2A 3KVQA 4IOFD 4BZ1A 2PO6D 4FQCL 5IKCA 2QADD 3QNFA 4G71B 1EAQA 4Q9CA 4GKOA 4U1SB 1KY7A 3CDZB 2NSQA 3D39E 4GMSL 1EHNA 3INUL 3KPSB 2ZX7A 3Q6FA 4JFXA 4N28A 2ZYHA 1U3JA 3CU1A 3CV5A 1M42A 5C0BB 1NC4A 3L5WB 3T4YA 3DOIA 1XHHA 2HLAB 4MAYD 5KVGH 3ZDZB 2R29A 1OWRM 2P5WD 1GC1C 5E5MB 3K5RA 3GLEA 5C0JA 3T6WA 4QWWC 2BVYA 4LEBA 3UC0L 4S0SD 1R3KA 2YPLE 3ZR6A 5C0DB 3NSCA 5E6IA 3FQWA 1U91A 1IT9L 2IOMA 4XRCA 1MJ7L 2Q20A 3IDJB 5HTSA 5IB4A 3F7KA 4BH8A 3LMJH 1RJZA 1X5GA 5L9DL 5DO2D 5F7UA 3BGFB 5FHAL 3WHE1 1DBJH 4WK2B 1Z5LA 3I3BA 1KBGH 4HEPG 2PYEA 1GJUA 4PV8B 1U8QB 4HBCL 4XPAH 2PUQT 2HRGA 5C0RL 4YHZH 1ERNA 1BVLA 3BKCH 1J9CT 1SHWA 4FXGB 5DF0A 3ABKB 3TFKD 1QKZL 1KLUA 1FYTD 4WUUB 4HFWA 2Y36H 3FB7B 1QVOA 4GMTH 5TPWH 1KN2H 1XGPA 4WO0A 4EBQH 2EO7A 2VLRD 3V7AG 1V5JA 4MLIA 1RU9L 1AGCA 2NY4D 2NYZA 3K81A 1XBRA 4I18A 4JRXE 1ZHLB 1A7OH 4FZ8H 4P3DA 4C56A 2DICA 4NQDD 2JIXD 1TNNA 5GS1C 5IOKA 4MXQC 1IIKA 5T5FL 2H6PB 1SN0A 3QFJA 5IQ9B 5ILTH 1N6QH 4WW2B 2F58H 2H32B 1NICA 1OD9A 3QA3A 5J3HC 2A5UA 1Z5YD 3QQDB 5DK2B 3MRBA 4LOUC 4X83A 3N5AA 2EABA 4TUKH 4F27A 2C3XA 4Z7VA 3IJ7A 1DBAH 4CN1A 5D8JL 2R83A 4GS7B 4RAVA 3TYFA 5L7XL 2AJ3B 2F7RA 3ZUNC 4AYGA 5EUOB 4G7YH 3WEMA 5J13B 4UINL 2QZQA 5I15H 2A83B 3KXFB 1S3RA 1CLYL 1CTOA 2ATPB 4IOSA 5D7KE 3VXMB 4BK8A 5LNDA 1SFHA 1THCA 1KIRA 2BHFA 3VXSB 1F4HA 2IDSA 1V3LA 2ADYA 3QC5X 4KXAA 1OW0A 1VA9A 5HY9A 1CE6A 4LHUA 2GTZA 1YPZE 4I3RH 4PVBA 4IBSA 1B0GA 1IGTA 3PP4L 4IIQB 3BCDA 3QZOA 4XCCL 1BZ8A 4KZDH 2P1YA 4WSKA 5JOPE 1S9YB 1TO5A 1MFUA 1SY6H 3MLZL 5INDB 4LLDA 1LEKB 1UWGH 5IHHA 2X9YA 3MRMA 4R96A 2XG5B 4G1EB 3TYGH 4DTGH 1DQJB 2ZCLL 2I07B 1KIUB 3RZWA 1FGNH 5KYUA 5JR1H 3RLSA 1SVCP 2WUCL 4K8RH 4PW4A 5DZ9A 3MCLL 3CSBA 4ONHB 3QZWB 1IGFL 3LCYA 4YE4L 1N64H 4Z3JA 2OXHB 2XIBA 1MCSA 4RNRB 5IMKA 4M7ZB 2K78A 3HBPA 4JQIA 2UXTA 2X4RB 2ZP9A 1M56B 3C2AH 1L7IH 1G6RH 1Q0XL 3DRQB 1O7DC 3NIGF 3ENEA 3GS4A 5FKAA 3K4ZA 4P4RB 3K2UL 3KG5A 4R2GC 1CFNA 1A9BA 3BZEA 1M7IB 3H42L 4O9HL 2EVGA 3IMBA 3RL2B 2HRPH 5LLIC 4XNYL 4E41A 1NGXA 1AP2B 2D3JA 4BFGA 4MAUL 4APQA 4M5ZH 1WYJA 3QUZA 5FA3A 4OZIF 4S11A 1QWNA 5F3HB 2IVFC 4Z7IA 4QRAA 1ND0B 4ZPTB 2F5AH 1XF3B 3WHE0 2BX5A 1KEML 2FWUA 2LFGA 2W92A 3QNYA 3QEUB 3RWGB 4P2YA 2A9BA 1FNSL 4IMLB 1KC5L 2DWDA 1CG9A 2R2BB 1JGIA 2IADB 1Q94A 2AV1A 2PO6B 3C5ZD 4E9SA 1KTLB 2C9QA 4PJHB 2B1AH 4IDJL 1UD3A 4ZTPL 4Z23A 3JTTA 2WYHA 4MX7A 2ODIA 2BHYA 3DSNB 4G6KH 3QRFM 1UCTA 2CLZA 3MXVL 3U9UA 4HHAA 1S4IA 2BZCA 3N9GL 1I1RA 3PP3H 2H6OA 4XN9A 5DURB 3OAWA 3MBEC 4NYLA 5JHMA 4N2OA 4D0DB 3SGDH 3DURA 4MAYB 1S9VA 5IJBC 3H0TB 4R26H 5IQNA 4L05A 4A6YL 1HOCB 2EDTA 1OV8A 3BMWA 4Z77A 2P5WB 3L2LA 1G5AA 4EQ3A 4M6ML 1V7ML 4DVBB 4RMQA 3QG7H 5B38B 4YDKH 3DARA 5L88L 4NO5B 5CEXB 1P84J 1IV8A 1FBIH 3GM8A 4JZOB 4ALAH 4FQHA 1S5HB 4N8UA 3BSZA 1D7CA 2J56A 5EEYA 4Y2DB 4OLVL 1WFJA 3ARDD 4PJ9A 1SOQA 2EZ0C 4LZHA 4ZUWA 1P1ZB 5CCKH 2A1WH 2APXA 1ZLWH 4ZFFA 3DX8B 2IDTA 2HFGL 4HX1B 1WAPA 2ICWJ 4LSUH 2J25A 1X5LA 3WKYA 3M46A 1PMYA 4X8CA 1DSYA 1L7TH 1JPSH 2X87A 4XOBA 1ORSA 1OZUA 4MHHG 2OMUA 3HJ0A 4XMPL 1FYTB 3EJYC 3K46A 1HE7A 3MOAH 2C9UA 4R97C 2G9HA 4HFUH 4XPBH 5FYJH 2HKLA 1ZJAA 3EOTL 2WN3A 1MJUL 4N2GA 4DO4A 2VLRB 1MFDH 1UZ6F 2NY4B 5JIDA 2YKLL 3NK4A 3MLVL 2IBBA 2DM2A 2BM3A 3HB3C 4JZNB 4A7QA 4NQDB 2IH1A 5IROA 2Y3AA 2JIXB 3EG9A 4K5MA 1HHJA 3AT8A 2A7BA 5I9QB 3GXUB 3BUYA 4MMXC 3FTVA 5JXED 3DVIA 2YMXL 4OLEA 5J12B 1QMUA 3TCLB 4YHIA 3EFDH 3G6DL 1NMCC 3V5DB 3A6CL 4PJEF 3Q6GL 3DO4A 4KKLC 1IB5A 1R3IH 2H0FA 2UWEF 1ZS8A 5CEZH 2V5RA 3OMAB 3F64A 1L9TA 2HT4C 4GP4B 5E1HB 2AVGA 2LVCA 1U21A 4J3VA 1A6ZA 2JJWA 1A8ZA 3GLAA 1P7QA 5D6DA 1BJ1J 1WK0A 5CO1A 3BYYA 5I6PA 2EIKB 4K3EL 4XPHH 4U1IA 3ZHLA 4XT1C 1YY9D 4K73A 3DV6B 1XCWA 3UJJH 1QSEA 5C97A 5E6ZA 4BGLA 1CL7L 4S1SH 3NEEA 4FQIL 1ZXKA 2DQDL 2G30A 4FMKA 3E9TA 4F2ME 4OCNC 3VW3H 4KK5C 4F9PA 1MQ8A 1QACA 1JS4A 2IBZY 3ZLQC 3CFTA 3OPUA 4DKAA 4FADA 3FU7A 4YQXH 1E5CA 4ESKA 1W0YT 1NC4D 3KL0A 2B59A 3GMLA 3MGTB 4BSVA 5KJRH 3KS0H 4DEWA 2Z31B 4IKLA 3SGEI 1ZV2A 1S7WA 4KK6C 4N8VA 1GTNA 2O61B 4JL2A 4IRZH 5I1GL 2LGNA 2OULB 4WY7H 4WI0A 4G7VH 4B3EA 2EVIA 4P9HL 3DGGB 2KPNA 1FVDB 2VC2H 3ATDA 3MV8A 2ZX6A 5E8OB 3VGEA 4ODTH 1W72B 2OYKA 4G5ZH 4ZMVA 2FT7A 2HH0H 4AL8C 4U1NA 3HN5A 4R3SB 5E6ID 5H35B 3ARBA 3V0VA 3GEWB 4WTXA 3VDAA 4TSBL 4BSJA 4P4KC 1A02N 2QQKL 5F2FA 4YHLH 1S8DB 2X4OA 1I9JL 1IZJA 1K2DB 1J5OL 2RMNA 4M1DH 2ZXGA 2NUPB 5IVZA 2A77L 2FO4B 4PS7A 5T5NG 4IRJC 2PYED 3IBEA 2BOCA 4IHBA 2W0KA 1D9KD 4Q6KA 1T6WA 2EO9A 4WO4A 4JY5H 4NT6B 4FS0A 4AYEC 3EJZC 1BEYL 3A47A 3DA0A 1R19A 4U6HA 3DXAE 3ZPDA 4YXLL 2H9GA 1QRND 1BQHA 1T1WA 5L0QB 3DECA 4I77L 3WGUB 4QMEA 4XX1G 2WPGA 3PE9A 4WV1B 4HGWB 4JPQA 1F6LL 4PW9A 3E6HA 1HZKA 4LCIL 2G0LA 2ZCZA 4C56D 4O02B 5HGDB 5C8JB 1TTRA 1KBPA 3B8YA 1LEGA 3V6OE 3TO2B 4K5OA 4ZOCA 3F2LA 3N41F 1C1EL 5I1AB 1T7VA 3C5ZB 3COOA 4JY6B 3NZHL 5M95B 1DQMH 1P5UB 1R1CA 1EQWA 2BZDA 4UT9A 5INCA 4MDRA 3V0DA 3MUZ1 3V4VB 3DO7B 5BXFB 5IOPB 5T1JA 4WI9A 3CDGB 5CEYA 4TUUA 3OQ3B 4ABWA 1EAOA 2QLYA 3DVNA 4ZW6A 4UTCA 1C5DB 4C47A 1EJOH 3IKCA 2G60L 4J8RB 5GRVL 2XPZA 2EH8H 3QH3A 1R5VB 5DZPA 3UJTL 2H0PA 3HS0C 4IOSD 2C7UA 5BQ7A 2NT1A 3BD4A 1J0JA 2NQCA 1GGBH 3K8KA 1Z0MA 2WO4A 1WD9A 1DDHA 1E9OB 4M8RA 5HYSA 2EYTA 5HDQL 3GMMB 8CGTA 2F8OA 3SY0B 4MQSB 3ARDB 5DQ9B 3PIQA 5I6OA 2BHUA 2WJ7A 1QG3A 4U1GB 4JFEA 5DEJA 2R4RL 1EJFA 3GXPA 2O6PA 2Q10A 1G7IB 4JS7A 3U25A 5CLWA 5DHVH 4GQZA 5KBDA 2WZ6A 2APSA 5KBKA 2DV6A 3G5XB 3GB7A 5E2VH 3VSQA 5DWUL 5JPMC 2VDKH 4L37B 3EO9L 4N9GB 1XR9A 2EDOA 2GSGB 4MD4A 2VLKE 3GBEA 1A3RL 1NDMB 5ESVA 4U6TA 4D8OA 3MJ7A 4N1HB 2VQTA 2EE0A 4F7TB 2FWOA 4D3CH 1BX2B 4GUOA 1OGTA 4KDTA 2BSRB 3GFUA 3MRDA 3RTQA 1NGZB 4G80A 2P52A 4S1DC 5C08A 1S5IH 2YWYA 5FGCB 4IK6A 4QGTA 5GRJL 5KS9F 1BOYA 2NZ9C 2BP8A 3E0GA 3PGFH 2FSEA 1ZWIB 1D5BB 3NSJA 3Q8AA 3KW8A 4WF7A 1PPIA 5F7BA 1FV1B 5EN2B 4Q52A 2WQSA 1DCEA 1YNTB 2RACA 4FQLL 3VE0A 2ZOOA 4E41D 4UQ3A 4APQD 3VDCA 2AXWA 1SRDA 1J1XH 2JVUA 3LN4B 1XTMA 5DRXA 1AI1H 2EEBA 4JFFA 1EH9A 4KTGA 4YBQC 4HWBA 5KTEL 1QNIA 3EAKA 1KXVA 4GXVL 5DVLA 4QT5A 3RL1B 1EA9C 1SXZA 5FS5A 5LO7A 3CZNA 3QWOA 4P9ML 5ANMA 5K9QI 5LCVA 2XA3A 3KPPB 2E7BA 1HQ4A 1MFEL 3SE9H 5IKCB 4KI5C 1B88A 4FG4A 4P2AA 3BRFA 2KLRA 1T5XA 2NTFA 3HMXH 1Y1UA 4M9OA 2APWA 1UYWL 3Q6FB 2W9EL 4JFXB 3A0OA 3GK8H 2FH6A 4GAGL 4KVCH 3QARA 1NC4B 1R46A 3BGFC 3DOHA 4D2NA 3W11D 1CK0H 2Z7UA 4KQ4L 1VZGA 3T2OA 3ZKND 2XWBA 1UT2A 1RHHB 4PWJA 4J2XA 4PFEA 1MAJA 2A9NH 1MW3A 5IW6A 4U3XA 3FHQA 2LVEA 5I1IH 5C0JB 4FXGC 3X13A 4J4PC 3O2WH 4DGYH 1P2CA 1R3KB 3T0AA 4LLVA 1VERA 4WLCA 3FQWB 1U91B 2QSCH 4N26A 5E6IB 4XRCB 4N0UB 3EYFA 3GINA 4LU5L 4BH8B 2W60B 5C92A 3Q7JA 3ILQD 5E94A 3RG1C 2X05A 2QZ5A 4PRDA 5DEGA 5E8NA 3VXTA 1RUQH 1HIMH 3D1MC 3QFJE 1Q0YL 4M6NL 1CXLA 1FL3B 5ESQA 2VMDA 5HDOA 3ZZLA 1Z5LB 4MTMA 2PYEB 3TV3H 3GJFH 1I85A 4MYPA 3ZXAC 1H3GA 1D9KB 1YYCA 4WW2C 1BVLB 3ISYA 4WWPA 3N1FC 4OY9A 1ADQL 1GKEA 1F8TL 3S98A 3N6YA 4HFWB 1IU1A 1QRNB 1D5MA 3S5LG 4FQ2H 2ADFL 3GTNA 3SPJA 4DWHA 4I18B 4EZMA 2B3IA 4GS7C 3VG9B 3OR7A 1FIGH 1XB6A 2V0AA 4N2KA 5J13C 1AKJA 4P3DB 4C56B 1KG0A 4R0LA 1BQ5A 3LN9A 4MWFA 2RCSL 5DZVA 4L1BA 1JFQH 4LPYA 1XSOA 4QF1A 3MA9L 3Q1SH 3KDMA 1SEBA 4CL7A 3K71B 4KY1L 4B97A 1TJXA 2ZOWA 2G2RA 2JB5H 3L95B 5FXCH 4HAFA 4IJ3B 1J0ZA 4OCYH 5IIEA 3L4XA 4IIQC 2J20A 3MRBB 5IBTH 1GJWA 1O9ZA 2J1XA 1CLZH 1FE8L 4Z7VB 5HI4D 3NACL 4OF6A 4N8CL 2P7TB 4JFOA 5C0CA 3O6KL 3CZSA 1RUPL 3VGDA 1BFVL 2BVOA 4XOCA 5BPPA 1RPQA 4MA3A 2WXRA 3ZTNH 4HQQH 1JDDA 1YEHL 4PGJA 4OGXH 5A2LH 5C09A 3Q8BA 1QSED 1JGLL 4ELMA 1KIRB 4NP9A 4HSAC 4XVJL 1KDJA 3S5YA 5IV2B 2DJ4A 5CIPA 1NCOA 3ULVC 5HY9B 1CE6B 2GTZB 2XXMB 1IGTB 4XBGA 4ZNEA 1P5VB 4M7ZC 5ALCH 3S4SA 4F37K 3F7VB 3WMQA 1RK1A 4LLDB 3L3IA 3HI5L 3IDNA 4L3EE 4HIHA 4R96B 1P4IH 4NCDA 1Q9WA 1LLAA 2J7LA 5KYUB 2NLJA 1AH1A 1BG9A 2WJ5A 5EA0H 5IJDC 1D7BA 5IREA 4U7KA 2FO1A 3BYTA 3UG4A 5BOJA 4P59L 1MFNA 4TVPD 4DW2H 3QXTA 3CZJA 3QG6A 2GVYA 1HHGA 5K9JH 2BJMH 3ARBD 4O58L 4G72B 2WLKA 3G6JA 4R90H 1B4LA 4XNUL 3TJPA 3PG2A 2NY5C 2DBLL 4IEFA 2VDNL 1D5XA 4OCXL 5L6YL 3UBGA 1HL8A 1PFOA 5E56A 2Q8AL 5FKAB 1YAIA 4NDMB 2JTDA 3F6JA 4M3JA 2XZCL 4IOFC 4UQDA 1CFNB 1E4KA 1A9BB 3HE6A 5JW4R 2PO6C 2FX7L 5LN8A 1RLBA 2QADC 3HUJF 4WO4D 2WXJA 4POZD 1MRFL 3FRPG 2IAMA 5I16A 1JZ5A 4ODBD 1J86A 4E41B 1NGXB 5CGMA 2AEQL 4APQB 3UYOD 5FA3B 4RSYA 4PJBF 4ICXA 5JW5A 2QQNL 4HF5L 4MAYC 1IM9A 4YX2H 2Q7YA 2R0LH 2K7PA 3M8OL 1B3JA 1DVFA 5K9KB 3QNYB 3ZE0E 4ZAKA 3NFSL 2DWDB 2CIIA 3O3EA 1CG9B 4JDTL 5I28A 4YHMH 3RJDA 2CM6A 5KJ4A 3NJJA 1Q94B 1JSYA 2AV1B 3SOTA 4GSXA 2HMID 5J89A 2CO4A 3OAUH 4Q14A 4MX7B 1INDL 3D51A 4NM8L 1B2WL 4BK5C 2CLZB 4F9LC 3U9UB 1U95A 4WEBH 15C8L 2YKKA 2YQBA 4HHAB 4RCAA 2BSBA 5DO2C 1DQKA 1GGYA 1CGXA 2XQYK 5EG6C 4NYLB 1S3KH 1INQA 1GL4B 2CR3A 3DURB 3QRLA 1S9VB 3H6JA 3EO1A 3AC0A 4XODA 2GJZB 1DJHA 2VRKA 4Z77B 3CZLA 2AMUA 2E0PA 4QJ3B 1J48A 1C5BH 2YRBA 2Q86A 1SOSA 3S3PA 4UB0L 4W4OC 1ORQA 2OL3A 3AB0B 3FRUA 3GTTA 3V0EA 2AJUL 3TFKC 1E43A 1RJYA 4FA6A 3UZQA 2E59A 3C8HA 2JLPA 2E86A 4Q2ZA 4FQHB 4X7DC 5C0IA 1T4KB 3DX3A 3AG3B 2NY4C 3CGTA 4H0GA 5AZ2L 3TGXA 5EF3A 3AUWB 4ZUWB 4DN3L 4GKNA 1RIVL 3R8QA 2VXTL 2J55A 4ZFFB 4GNKB 2Q3XA 4PJFF 3K0WA 5I9QC 1TZIB 1NIBA 2IWFA 3TCXA 3CU7A 4J5VA 5J12C 3LZLA 1JNLH 1OANA 2V17H 1DP0A 2OMUB 2LOEA 4LARH 3T2NL 2PKDA 4L5FH 4P23A 4YDMA 3T3MF 5FWRA 1MCPH 5HI5D 1JMXA 4JR9H 3RURA 1FLTX 1FNEA 2ADGA 2OJZL 4XOAA 4OLUH 4IOIA 3BKML 1K5WA 2JKTM 1GC1L 2HFEA 1IQWH 1GAFH 1L9QA 4TKWA 4YLBA 3SDXA 4PJIE 5B3JE 1KGYE 2YC1A 5DJ6B 1HHJB 1IKFL 4HK3N 3RTQD 5ID1A 1H3WM 2Z9TA 4JO4L 4OJCA 1HCYA 4GQRA 4O2FA 5C08D 3JZ7A 4K23L 5LWYH 1NCIA 4FJZA 4YFLI 1IEBB 3K6SA 4YHIB 3FF7A 5E8DL 4LDEB 4Z7NB 1CQYA 4X6CA 4DQOH 3Q3GA 1IGML 3MNDA 4TN9A 2KLTA 4PS4H 4KHTL 3B3IA 3DHJA 1A6ZB 3S48A 5L4IA 1X9UA 3WJMA 4JFFD 2GAZA 1BOGA 4U1IB 2F8IA 1KB9K 5EOQL 4Z3FA 1D6VL 1AJ7H 1LWHA 3VGHA 2OTWB 4JUSA 5CN3A 4ZMZA 2AQQA 3OXSA 4M8VA 3UEQA 3GIVB 4NP4H 5EC1A 3M1OA 4JFYA 5T1LA 4OFYA 3O4LD 5HVWA 1Y07A 1ZLSH 2IGFL 2QFRA 3FU7B 3O41B 2R0ZL 4U1HA 1HEZA 2B59B 3GMLB 4XVUD 1KGJA 4N8VB 4HMCA 3UGUA 3HG5A 1M2VB 4WI0B 1BP3B 1P1VA 5F1NA 3LKPA 3ZE2B 1OAUH 2XN9E 3F65A 3PWJA 4XMVA 2W07A 3MPCA 3B6SA 2H1XA 4Y88A 4ZMPA 4U1NB 3PDOA 5L0QC 3ARBB 2PETA 2AJXH 5TE6L 2NY6D 1KPRB 1T89A 3GT6A 4WV1C 1S2EA 1XF5A 4MJ6A 2VMFA 3FFCE 5CGYD 1XL6A 2X4OB 3ZDWA 3T0BA 1J8SA 1YEWA 3EZ8A 4MNQE 4RGMB 5D1QA 2CUIA 3OKDA 3VSTA 2P42B 4Z7WB 5KAQF 4X80L 1EDQA 4XBPA 4LRNH 5IVZB 4FLSA 5KVFL 2LFEA 4XXDA 5LXGH 3DTXA 2BOCB 1PZBA 1J9QA 5DSCB 5K5YA 2ZCKH 3C5ZC 4NQEA 4WO4B 2G75A 3VFOA 4PH8A 3ES6A 3IMUA 5IFAH 1P5UC 3MRIA 3P3SA 3L5XL 5AW6B 5HDBF 1KJ3L 5E2UH 4U6HB 1AACA 4HJJL 4K94C 1U58A 1FLRL 1OHZA 1T1WB 2H9GB 5T3XD 4YDLB 5ACZB 5JHBA 3AZUA 4DP2X 1NCAL 2X9WA 4G11A 4N5UA 1NINA 5IW1A 2TSAA 2WQWA 4N2FA 2DAVA 4F8NA 2AC0A 4OIFA 3E6HB 4LESA 1ETZB 1TNMA 1U8NA 1AKJD 1CVSC 3P4NA 1NCWH 4I2XE 5F70A 4AMKH 1LEGB 4PCYA 4WSGA 5AD0A 2UUDH 1UOLA 2JLLA 3V0JA 1CYXA 5JIIA 4G9FA 3CMOH 4OSUL 3IJ9A 4PJCF 2VH5L 1IRAY 3WNMA 1GS7A 3QUMA 4WI4A 5KW9L 1CFVL 4JFEE 1CLOL 2ZZUT 3FN3A 5HYQA 4O2CA 5INCB 3BN9D 5D7LB 1A7RL 1LO3L 2W94A 3ARDC 2LR4A 4WWOA 5A6IA 1ZLEA 3U30B 4F2EA 2CXGA 5CEYB 4U1GC 3BAEH 4ONOA 5C0CD 3QQXA 2XV3A 4ACTA 2NZIA 2WWKT 4RDBA 2OI9B 3I9PA 1DL7L 1L6PA 3DO3A 3HAEG 3QH3B 4OLZL 2YGQA 1KCUL 3A6OA 3IE9A 1A4BA 2CD0A 2EO1A 4JRWA 5GGSA 3HC0B 2FCBA 4Y8DC 5C09D 3O6FD 4UV4L 5BQ7B 6FABH 4X9HA 1A6TA 2VR6A 5DGQA 3ISRA 1FQ9C 1GY2A 5D4QA 2XWCA 3M07A 1XGUA 4POYA 1DDHB 4YSAA 1E67A 5HYSB 2QQLH 2EYTB 3HG1A 1EZVX 1T0PB 1AANA 4L2YA 4JNXA 2KZ1B 4EIUA 3S5ZA 3VYNA 3PIQB 4A63A 3I2CL 2ZUVA 3QQ9D 4PGCA 3D3VE 5KVDL 1RZJL 1E9PA 1IC4H 4KNSA 3WIHH 5JXEC 2YJLA 1DHKA 1E6OH 2ZWZA 4WVRA 4RGOH 4GW1B 3BJ91 1GZHA 5HHVL 5CFAA 4QIRA 3OKOA 3RWCA 2Z4TA 1I7RB 1XR9B 4JANA 3VG0H 1M9SA 1NEZG 4H1LH 1F6AA 4MDJA 4PB9L 4MD4B 2MOVA 5ESVB 2K70A 4A2HA 3QJRB 3MJ7B 2V5YA 2Z35A 1DQDH 1RSYA 3RNKA 3AWFA 5ANME 1MCLA 2FWOB 3WFEL 4M1GL 2BXYA 3O6MH 1QQDB 1OGTB 2FUTA 1QO3A 1RMFL 3MRDB 1YY9C 3RTQB 4G80B 2VDMB 5C08B 3D0AA 1HH6A 5IVXF 4EDWH 2HSIA 1L9OA 4MASA 3DX1A 2BP8B 3HE6D 4IBQA 2W0FA 4HPHA 1H8LA 4WI7A 3NP3A 4FF9A 2IAMD 2YSSA 5EEVA 3VE0B 1W15A 3TOPA 3UPRA 1I8LC 3QHFH 4UQ3B 5ADPH 35C8H 1AS7A 4WHDA 4M62L 1WICA 5SWZD 5DS1A 5DA0B 5DRXB 1NBZA 4UU9A 4AM0A 4JFFB 1IM9D 1LO2L 4QT5B 5DC0A 1OTUD 1RVFH 4Z7UE 1N5YH 3IVKB 2VZVA 1DVFD 1AQMA 3GGWA 3QWOB 4ZAKD 2DQHH 1OSYA 3EXJA 3B2VH 1HQ4B 5MENE 5TF1H 5E6IC 1LO0L 3PV7A 3OJVC 4EXPX 1T5XB 4UQEA 3LEYL 2VMEA 2NTFB 1UA7A 1H5BA 3O4LB 4RFEA 5AFAA 3CLFH 3GO1H 3S3BB 2ZOLB 1EHAA 4ZMOA 1ROCA 3IFLL 3NJKA 2RGSA 3Q5TA 1USZA 2FTAA 4XXCC 2H0JA 1JMZA 2ZCHH 2XWBB 4CVUA 4XX5A 5IW6B 1NMBL 1UWYA 2NTSP 4PGDB 1D9KC 3FW6A 1P4BL 4EF3A 4KITB 1GCFA 1HKFA 4X7TA 3X13B 2VDQB 5FCUH 1MRDH 1UM5L 1QSFA 2XY2A 3TIEA 4Y16A 4LLVB 3EYFB 1QHQA 2NY6B 1ZSDB 3M45A 2R9HD 3RWIA 2OPCA 5E94B 4I18C 4PRDB 5DEGB 3VG9C 3VXTB 3EUDA 5ESQB 3C6EA 2HRHA 1NM9A 5ABDE 5PAZA 3BVTA 1YYLL 4DP6X 4IKKA 4JG9A 3GHPA 2N0KA 2A4EA 1TCMA 4MMZB 1TTFA 3BT2H 1NCUA 1LDSA 3UPAA 4B96A 5E08H 1AXSA 4IJ3C 3H9YA 4JPWH 4P23D 4CVXB 2VN3A 3NIFE 3IGLA 4RDQF 1D5MB 4KGLA 5J1SC 4IKNA 3T65B 2LU5A 3IS0X 2O5YL 1VLXA 3PYCA 3S34H 1GH7A 2C3HA 4MCZA 5LN4A 2EDMA 4PJ7F 3L5JA 3X14A 1IL1A 4I9WE 3OR7B 2YSTA 3L3HA 4PBDA 1AKJB 2P9RA 3SPGA 4YDZA 1KG0B 4R0LB 4MNGE 5GGRB 4JPVH 4LP5A 2EE6A 2B0SL 1IC5H 3UGXA 1EO7A 3BKYH 1LE9B 2I9TA 4ZNEE 5EDXA 4L8CA 2EIEA 1SEBB 3EJUA 3VGBA 1TZ8A 1NEUA 1HQRB 1OW0C 2XWDA 5D2NA 2PTVA 1DO5A 1ZA3A 3QO1B 1BGXL 4QXGL 2XBZA 2YZ1A 1YVLA 3QUGA 2FQFA 5ISZE 4JFOB 5C0CB 2WKOF 2EEAA 3T8MA 1PZAA 3JTSA 3MTXA 1CE1H 2BVOB 4L29B 3TBTA 2CG9X 4MA3B 1MLBA 4YHOL 2R0WL 1FNLA 2V7NB 1FHNA 3NJVA 3WNPA 3BJLA 3ULUD 5C09B 3O6FB 4ELMB 1UM4H 1I3GH 3MUGA 4W1TA 1S7VB 3SD5A 4EKXA 2DQEL 3HBZA 1SQ2N 5K39A 1GYVA 5CIPB 3OX8A 5GGRY 4LFHG 1KXQA 3MNVA 5GGTH 2CMRH 4LPUA 3QK0A 4XBGB 4IS6A 4HPYH 3DROA 5T1LD 4AGLA 4OFYD 1VSCA 1IZKA 1HH9B 3S4SB 3V0GA 3S7GA 4DO5A 1RZ7L 4X8GA 1RK1B 3NA9L 4BELD 2ZJSH 3L3IB 3HMWL 3IDNB 4HUUA 1KLFA 4PJGF 4Z95H 1T80A 4K3JH 1Q9WB 3IMSA 4ZT1A 5I1KL 1YCSA 4NWTL 4JAMA 4BKTC 5K59E 3IFPA 3N42F 5E1QA 3V6ZB 5I2IA 2BIOA 1U42A 1GKOA 4ODHL 1FO0H 5TQ2H 4JQXC 4APQC 2O5ZL 2JJUA 3EGXA 1R6VA 2K0RA 3G6JB 3II1A 3PWLA 4JL1A 2NX5A 1JRHL 1MJJA 1HILB 3C60A 3NA4A 1TITA 2EACA 1T6VN 4PJAA 5D5MA 4IEFB 4GMSH 4MD5A 2DYRB 3PQYA 1CDIA 2E74C 5D71L 4DZBA 4X4XB 5I1EL 1M05B 1ZHKA 3SDDA 1T3FA 4UBDD 3OB8A 2WGXA 3SY6A 3WS6A 1O7SA 1SUHA 2AJVH 3PABA 3STZB 3CFCH 3IDMA 5FHBL 3HE6B 4NQED 5CUSH 2IAMB 2WAQA 2V3FA 3EKCA 1BVNP 5IFHL 4XMLL 1GRWA 3UC0H 3FT1A 3N91A 1WZMA 4CC4A 5SWZB 4A1IA 5JW5B 3W11C 2TRYA 1IM9B 3ZKNC 1X4ZA 3SGDI 5LDUA 5EIIA 3SN6N 4JFHD 2XU9A 1DVFB 2XVGA 5L9DH 1GPOL 2QHRH 4PY7A 1OSEA 4ZAKB 5IBLD 2D7OA 3O3EB 5FHAH 1KENL 5AW4B 1X5XA 3AB0C 2J3SA 1JNNL 3QHTC 3D39B 4Y19E 3NIDB 5FYLL 1HSBA 3FU6A 4G7RB 3EBGA 3QCVL 3NZSA 1R5IB 4GSDH 3VI4F 4BM7A 4TNFA 5C7XH 1A1NA 3ILQC 5TJWK 2OYMA 1U95B 3GMRA 3QZLA 4RMBA 1I8IB 1INQB 5FM8A 3I02A 2PCPA 3RX8A 2CIKB 1CGTA 3VUAA 1OAXL 5KSBA 5FGBA 3B2MA 1MFAL 1TQTA 4FNUA 1X5YA 4U3CA 3RY4A 3FRUB 1PLGL 3CXDL 4X6BA 3ZHFA 5JHDE 1RJYB 5FYKD 1XCTA 3QFDA 5CZVL 3UZQB 4HA1A 4GT0A 3SDXE 4Q2ZB 1PQZA 5C0IB 3B5GA 3FOLA 3WUZA 3HG1D 4BKSC 1ZT1A 4PRIE 3MREA 5DFTA 3KR3L 1AQDA 4ES9A 5HYJE 4GKNB 3UGEA 5LG1A 3Q2LA 4MJ5A 2JELL 2FBOJ 4MB4A 4PLKD 1WZ1L 1OWWA 1XWVA 4UOW1 3TTSA 3L9RA 2EE2A 1UCBH 1CDYA 5IR1A 5I1DA 2VDLL 5E2WH 1MCEA 4B41A 4TMPA 2HAZA 1PGRB 4FG6D 5FUOH 1ZEAL 5JZ7D 1WZLA 4IGBA 5DLLA 4BFBD 4P04A 3PWNB 4P23B 4W9ZA 4YXKL 1K8DB 4URTB 5B3NA 2X38A 1FZOA 1FNEB 4IOIB 5HI4C 2HVBA 4PI0A 1JHKH 3A4AA 3P30H 1YY8B 5ETUA 4UM9A 2NNAB 5D6DC 2W9LA 4YEEA 4DN4L 4F57H 1WG3A 2YC1B 3GSUB 5ID1B 2FGWL 2VT0A 4MZ2A 4O2FB 1ZPUA 4OBRA 4AYID 3K6SB 3MFGB 3BDYL 5F7YC 3W9DA 2ZCLH 4X6CB 2CHZA 4F9PC 3VD9A 3WXVL 5IMLA 4ODXA 1LO4H 4U6VH 1LGVA 1KJVA 4MMYA 2WUCH 3FQNA 1A22B 3B3IB 3CN0A 2ITDA 3MCLH 5MP6L 1IGFH 2WLIB 2BK8A 4ZW3A 2GAZB 1BVZA 5F8QC 1BOGB 1MQKL 4NXSA 2X6CA 3VD3A 1THAA 1F3JA 3WFDL 4GAJL 1A7QL 2RA1A 1Q0XH 1DQLL 1NCJA 2YN3A 3OXSB 3WBDA 2B4CL 2G3MA 1ECYA 5D1QE 2K9UA 3H3PH 3ARBC 3K2UH 5EU6E 3U9WA 3WY1A 5EC1B 5T1LB 3H42H 2JXMA 2VKXA 1H6FA 2XWXA 1KN4H 2SODB 4ILDA 5DQDH 2DJMA 3CPUA 3IB4A 1HEZB 3DDFA 3AT9A 4RGMC 3RDTA 7TAAA 3FUJA 1MAKA 2BSDA 1E8WA 1Z9NA 3OL2A 4P2RA 3SPIA 2VDRL 4FQPA 3BGMA 5I0ZA 1IAIM 3V4LA 3WNNA 2QELA 3FU9A 3LKPB 4FHBD 5JW3L 4K55A 4WO4C 1SY6A 4C57C 1SJXA 4POZC 5SWSA 4F58L 3JWDC 1KSRA 1FNSH 1QSFD 2W07B 2FWLB 3NABL 4Y16D 3PDOB 4YDLC 2NW2A 2BFVL 3EUUA 3WOVA 1JZIA 3I74A 2PXYB 4MJ6B 4ZTPH 1OALA 4G9FE 2TSBA 3HE7A 1EPFA 3H9SA 4K9EL 1SVZA 3NAAL 4XBPB