4QRBA

Structure and specificity of l-d-transpeptidase from mycobacterium tuberculosis and antibiotic resistance: calcium binding promotes dimer formation
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
351
structure length
339
Chain Sequence
LLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,d-transpeptidase LdtB
publication title Structure and specificity of L-D-Transpeptidase from Mycobacterium tuberculosis and antibiotic resistance: Calcium binding promotes dimer formation
rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 85
structure length 339
sequence length 351
ec nomenclature
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 4qrbA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qrbA02
5DC2A 3VYOA 5DZJA 4A1JA 4GSUA 4JMNA 4LZHA 3U1PA 4Z7AA 5K69A 4K73A 4JMXA 3VAEA 3VYPA 2MTZA 5DUJA 3ZG4A 3ZQDA 5DCCA 4XVOA 1Y7MA 5DVPA 5E1GA 5LB1A 5D7HA 4GSRA 4A1KA 3ZGPA 4HUCA 5DZPA 3TX4A 3VYNA 4LPQA 4GSQA 5LBGA 2HKLA 3TURA 5DU7A 5E5LA 4QTFA 4A1IA 4QRAA 4A52A 5E51A 3U1QA 4HU2A 5E1IA 4QRBA 1ZATA 4ZFQA 4QR7A
chains in the Genus database with same CATH superfamily
3A3YB 3BZ4B 5ISZA 3NJJA 2XQYG 2H1PL 3JVGC 5GHWL 3SKMA 1WAPA 4W81A 3ZKMC 3LRMA 3FB8B 1FHNA 1UFGA 3P3UA 4N87A 5EU6E 1KN2H 4S1SL 2APWA 3IPFA 3RIAF 5JPNB 3DO4A 4NGHL 5DS8A 4AY0A 3JSSA 4MA1C 3VWJA 3LYRA 1U8QA 4YXLL 4HQQL 2QGBA 4JFXB 3Q2VA 2WMPA 3NGBC 3UGUA 1T5WB 4AYFB 3QIWD 4ERSH 4MNQD 1V54B 2VSKB 3OQ3B 1DR9A 4M5SA 1BFOA 3GMQB 3VXNB 4ZMTA 1HI6A 4YUEH 1NFAA 4JN1H 2CHDA 5DURD 4BGDA 3MLTB 1AZVA 5D1QD 3JWOL 1UZ8B 3MKGA 3LZRA 3V52H 3G04A 3ZHKA 1ZLSL 3G5VA 1V5JA 4LPTA 4JCMA 2E6JA 4O58L 1A4KB 5C0GB 3T0DA 4FXKC 5LWYH 4LOEA 1TZHA 2D3VA 2QLVB 3GNMH 4Q9QH 3BT0A 2V5SA 1T3FB 1WFIA 1MCSA 5CEYB 5DGRA 1MKFA 2ZSVA 4B9ZA 4LSQL 1I1RA 1J1XH 4AVHA 2IAMA 4OCRL 3MC0A 2DN7A 1D5XB 3CFCH 3LKRA 3C5XA 3NFNB 2JTYA 4RH4A 4XNUH 4BKLA 2ADJA 4R83A 3DX1A 4GI8A 5AB1A 5ESAB 3APNA 4YHKH 4KK6D 5DFTA 1LE9B 1JXFA 3PJLA 2BOCB 4QHKI 5MI0B 5I73C 3CBJB 1MY7A 4YHPA 3SE8H 4TOYH 5E56A 3GS7A 3NIGB 4KX8A 3FRPG 2F1EA 3EHBC 1YY8A 2DQFA 3U46A 3MCYA 2JJWA 2ZD0A 4WCYH 3GTNA 2Z8WC 1Q94B 1QFWM 4P4RA 4R4FH 4AUYA 4M8RA 3KYNA 1EUUA 4C59B 1BQHA 1GIGH 2ZSWA 4XPTL 3BGAA 2XETA 5LAPA 4PCTA 4U1NB 5EF0A 3BRFA 4X5WA 4KI5F 1M71A 1SVCP 4LGSB 4OF7A 5E94B 5HYSA 1OVZA 1TQUA 3HNVL 2APFA 3I6SA 1E4XL 1JZJA 1KCSH 3C6LC 3E7JA 4B3EA 3DYMA 1AHKA 5EUKB 5F9DC 4OBRA 3MYJB 2VDNB 4OZHE 4A63A 4KTEH 4OCWH 1HILA 3RGVD 5KOVC 3ARFD 1U3YA 4G3YH 4Y19B 1ZANH 3HBZA 4M6OL 2QV2A 3L4YA 5T1JA 1S9WB 1Q9LA 4XMVA 2IOIA 5DJCB 1MW0A 5BUGA 5EU3B 3MRLA 3OF6A 3BPOC 3S5LG 3FTWA 4JZJC 3T6WA 5FB8B 4AQ8A 2QHRH 5D70L 4A52A 5E1HB 1NCNA 2IPKA 3KNBA 4H26B 3JT0A 5CGYD 2CLVA 2AHIA 1ADWA 3I6KA 3FCSB 2BWIA 3SO3C 3K4AA 2FGWL 3S9DB 4N0FB 4NO0A 1HINL 2JV6A 3GPEA 1FCCA 1J0JA 1R3IL 2EC8A 4WFHE 5F3HB 3RG1C 4ZFGH 1LO4H 2NSQA 4NZTH 4XVOA 2WO3B 5L4JA 3QJUB 2J12B 2WWMD 1T1XA 3R06A 3C60B 3IBOA 3ZGHA 1OAXH 1U6AL 2B9AA 3RFZB 5IB5A 3KCWA 3PAVA 4BE5A 4AQAB 5ICYB 4N0UA 1NC2D 2A73A 1NGQL 4K7PY 1IBZA 1P7QA 4Z78B 3IBEA 4PJEE 4PVMA 3SDXA 1HH6B 1ZE3H 4QHUB 2BNRA 5CGBA 2ZAIA 1KCLA 2ERJC 4KDTA 2NY3C 1AG0A 4LL9A 5IFJA 4LHUD 3QH3B 4F8PA 1ZEAH 1P9MC 1X6NA 3OHMB 3UO1H 1OARL 5HHME 3ULVF 4ZMVA 1OW0C 5I6PA 2NT0A 4WW2A 1OAUH 1XCQB 3MCKA 3MRFA 1XGUB 4OLXL 5E4EC 4IRZH 5E7BA 1KENH 3WYRA 3NAAL 3CFDA 4Z76B 4ZMLA 5A7EA 4KHXH 2P47B 2C7FA 3QWNA 5JR1L 1PKQE 3Q5TA 4PSRA 3B9KD 1O5DT 4NKMB 3T1WA 3Q2NA 3SKOA 5K69A 1DBMH 1YNTB 5E5MB 3WEAA 4JPQA 1U58B 1A1MA 1A1NB 4JM4L 2Y5QA 1RU9L 3BDYH 3EGXB 4G7YL 4UAHA 6FABL 4OI8A 2HTKC 3QG7H 1NMBH 4Z1PA 2EDQA 5JXED 4HLEA 5C09A 2X2UA 1IAOA 3BI9X 3HI1A 3CQFA 3GLAA 1SOSA 4HWZA 3HZYB 3LS5L 2IANA 1OD7A 3O2VL 4ODXA 4DKEL 5A16A 4P2QD 3VWKB 2F58H 1LVEA 1V7ML 4RVBA 4WKZA 1DJXA 3NFPA 2Z91A 3VQ2C 5FUOL 2MTAA 1CLVA 2D3NA 2LU5A 4B96A 1N8OE 4L37B 1DO6A 1XCTA 3LZOA 3R4DA 2CU9A 3KPNB 5FHBL 1AO7B 2Z9TA 1MFMA 3L45A 3M46A 1QLFB 5E2WH 3CVDA 3ME0B 5ISZE 1PCXA 1H5BA 4FDWA 1E4XI 1Z9SA 2V7HA 3E0GA 3JWNG 3GO1L 1BG9A 3H9SA 2CM5A 2A9MH 3QUMA 2IDCA 5F93C 1KDJA 4YWGH 1RV6X 5I8EA 5LDSA 4P5TB 2YQBA 3PFUA 1TVHA 5DD1H 3MOQA 1E3FA 1W72B 4FX5A 2FUTA 5TH2A 1OL0A 4FTVD 4XCNB 1T1YA 1TOXA 1E2VA 4JY4B 4NXKA 2ZP0T 5T8IA 5L2JA 2Q7YB 3NYKA 4Q0XH 4Y4HB 1ZVHA 2C9RA 2B3IA 2IJ0C 1KCRL 3MCLL 4BBWA 5I1EH 5I6OA 4JFDD 4PJ5E 5CUSH 2B1OA 1ZKAA 3Q3GA 1KYOK 5ILTL 2XWBA 4ODSL 1QWNA 1Z5HA 2QQLL 5BXFA 1KN4L 1NEPA 2HRPL 1DDHA 3UG4A 4RMWA 2CPCA 4APQA 4MXQD 5SWZE 1IAIL 3WUWA 1ASOA 2G75B 4ZSOB 3Q9PA 2Y2YA 3C87A 2QFPA 4UM9A 2X0VA 3KBHE 2W0FA 1IV8A 4QXGL 4URTB 4YDJA 1HJBC 2AJSH 2VLKA 4RZKA 3UYPB 1I85A 1ZDSA 3O41B 1IGYA 3RY4A 3LZLA 4Z3FA 4LE8A 5TFSH 1U8PA 3VRLE 3T8XB 4A7QA 2ZNWA 3UPRB 5IM7B 3T0EA 3WY1A 5I0XA 4FKKA 2G9KA 4HHWA 5C2BH 2EVJA 5A3IC 1S5HA 1PKOA 4KKLD 3RL1A 1BF8A 3PP3H 2AEWA 5HGGS 3NP3A 1IAMA 1DVFB 2V3FA 1DJSA 4GKZA 5C3LD 4TF4A 1C16A 1UM5L 3CWGA 5J1AA 5INDA 1CICC 4J1UB 5IJVA 3CC5A 5FUZH 5C3TA 2YAQA 3ULUE 3MV8E 5HHVH 1DSYA 1MRFL 1IKOP 3PHOA 3K6SA 2QVKA 1TKWB 1CLYH 1PY4A 2GJ6A 1T20A 2J8UB 1TG8A 3EH4B 1CD1B 2WKOF 4LEBA 5DRWA 4XP1L 4X4KA 2DW5A 2EIDA 3D87B 4D8PA 1JMZA 1G7JA 4XNQB 3U0WL 2Y1AA 1WEJL 4ZTPH 3DRQA 5E2VL 4K71B 4ZFOA 3CFJA 4DESA 3TOPA 1XGZA 1A6WL 1FORH 1S7XB 5F9JA 3WU1A 3DX6B 2V9UA 1VSCA 4PJCF 4UI2A 1NGPL 3NRFA 2EDNA 4ZFOL 2PP8A 4LARL 5KBKA 2HCZX 2HXAA 2OM5A 1YG9A 1W0VB 4YC2C 5EC2A 4FZ8H 4PTUA 4WI7A 4YGVA 4RMVA 3S7GA 4R96A 3UJIL 4K07A 3QEQD 1NQBA 4LLVB 4WUUE 3GJFA 2NW2B 1PDKA 1XO8A 5L8LB 3ULUC 2V3EA 4Y2OB 2EDHA 2VR4A 4P9HH 4P5KA 5G5DB 2XV6B 4JRXD 2JKWA 3HJEA 2VC2L 4BFRA 3DX8B 3L4TA 2UYLB 1AD0A 4X80H 5FR3A 3LH9A 3S8WA 4PJBF 3STZA 4KRMB 5E9AA 3Q5YA 2A6IA 4R5XA 4FN0A 1E9PB 3TIEB 1Q0XH 3QQDB 3NJGA 4P57B 4KQ0A 3CFUA 2EEAA 1AQDB 1L6ZA 5DJAB 2WP3O 3L5WB 4F7MB 3E8UL 1X5KA 1OP3H 3MOBH 1DVTA 2R69A 3OD3A 1Z5LB 3HFFA 3MRQB 3QIUD 3DO7A 3BP6A 3QEHA 3QWRD 4HJGB 5ICUA 2ATKA 4HIIB 2GUYA 4J8RB 2R69L 4PVLA 5IKCA 5E5UB 1M1SA 2H7WA 3TTYA 4CSSA 3SGEH 2PPAA 3NCJL 2FL5A 1YA5A 2WUBL 5JIIA 4KH9A 4UQ9A 2IPUK 5GSRB 1IAII 2XX1A 3DIFA 4U4BA 1GSKA 3WDIA 1HSAB 2G60H 3OJDB 4MMXA 2XG4A 1MF2H 5I5IA 1CUOA 3OAYH 3PHQA 3H9HA 4CC4A 5K9OA 5T5FA 3IJ9A 3IWVA 3H56A 3NJNA 4JQXA 1XQ4A 4GEIA 1ZT1B 1IGTB 1I9JH 1PIGA 3GJFK 1NTDA 5B4MD 5CLXA 4O4YH 2YN5A 5EU4B 1M2VB 1OTTD 1T1ZB 5T5FL 4XO9A 1ZGLA 2IC2A 4AXWA 2ATAA 3KYMA 3BZ4A 4E41B 5C09E 3TH4T 4G7VH 3D34A 5DJ6B 2GITB 4YXHL 2EABA 2BVQB 4YPGB 5E99H 3F7KA 2IANE 2AGJL 4HJ1A 2OJ1A 2AV7B 2QT6A 5DTFA 3CC1A 1HDMA 4HFUL 1W2KT 4NN6C 5AZEL 2PNDA 4HUMB 1WV7T 4HJ0D 4AI7A 3BSZH 5ACMA 1B6DA 1MCPL 1S7VB 4JFXA 5IMOA 4AYFA 1A6VH 2N1KA 2WM0A 3T2NL 5L4FA 3T6ZA 4PJ9B 2NXZC 4N25A 5KYWB 4RGND 2P8LB 3GMQA 3VXNA 4CBPA 4DGVH 4NI3A 3S36L 4QHLB 3AITA 1Q72H 3VE0A 4ZUTA 1UZ8A 4MNQB 4KDVA 5I0ZA 1E4HA 2NUTB 3QC6X 1OO2A 2R1WB 2QDVA 5CP3A 1RK0B 3DNKA 4S1QL 1T7WA 1BGXH 1YN7A 4D9RE 2X6UA 3T0XA 1NFDB 5ID0B 3O6FB 1FVDB 1G1CA 1UA7A 3ISYA 1IU1A 1JI1A 3RURA 4U6TA 3HMWL 4LQ1A 4YFLF 3HBPA 3P0VH 1MVYA 3DX3A 3EJUA 1AC6A 3LDBB 5CEYA 3NIDE 4K3EH 3BH4A 1U8IB 4P49A 1D5XA 1UFUA 2F8VA 3D69B 4DN3H 1NCCH 2OZNA 2IBBA 5ESAA 4KZEH 1LE9A 2R0WH 3KGRA 3ILQC 1H5BC 2V7NB 2YPVA 1H0DA 1ITBB 4ZPTB 6PAZA 1Y7MA 5AOIA 1IGCH 1IUZA 5JDSB 3CHPA 1KTCA 3TV3H 1VAHA 4O2EA 2OMXB 2PW1B 3S3DB 2YPVL 5D7IB 4MAYA 4X6BB 1NIBA 4M5YH 1HL4A 1ZV5A 1QBMH 5CJQH 2OI9C 5IQNA 2P1YA 2Q3AA 3S2CA 3D9AH 4X42A 4FULA 3AUVA 5EDSA 4G1EB 5E94A 2E6PA 3ARGB 2ZUSA 2JJVA 4ZNEE 2OMZB 4OZGB 5JW3H 3GSQB 2BS9A 4XOBA 2MIZA 3V0AC 3ZL1A 1OM3L 4QRQB 3RPIB 5HGBA 1N3NA 3KAAA 3MNZB 4YEEA 3MYJA 1B4RA 3PL6A 5CCHE 2BH0A 5CWSA 4HAGA 3DJ9A 1WK0A 5TE6H 4Y19A 3N1MC 3QNXA 3ZDYF 4OCLC 5HI4C 4NC0B 4Z0XA 2XRAL 3CDCA 3LS4L 2GJ6E 5MERA 2VDNL 4U1LB 4P06A 5B7FA 1KCVL 2YAHA 1SBBA 3PRZA 4IRJB 3PWNB 3RGVB 5DJCA 1B3JA 3TA3D 1QABA 1V3LA 5T1DH 2VMDA 5KSAC 3CFKB 3ZL2A 2A9AA 4L1TA 2A4CA 2V2TB 1YECL 4JEGB 3LH2H 4LAJH 5AZ2H 1OPGH 3FCGA 2FYYB 4H26A 4KKAC 5CLZA 3NPSB 1B0GB 2ALAA 5T1LD 3FCSA 3OR7B 4PS4L 3PUUA 3RE0A 4YR6B 2WZAA 1D6EB 1EBAA 3QORB 5IHBA 3VQLA 3VD0A 3KM1A 1OT1A 2X9XA 2XTJB 5F3HA 1THCA 2OZ4H 1IAKB 4MJ6B 3ZE0E 1TXKA 1W6LA 4DGYL 1NLDH 3MODH 4QHMB 4WWOA 1HL8A 4AQAA 4Y4KD 4WSGA 5ICYA 3CVHH 1AFVH 3FQ4A 4OZFG 4TSAH 2JKTM 4ZMQA 4Z78A 5I1CH 4Z3TA 5D7LE 2DIEA 4LEEA 4CUCA 3ML8A 1G7PA 4QHUA 1BLNB 2ZXEB 5KS9F 2ITCA 4H8UA 1FH5H 1FFQA 1FDLH 3Q8AA 3QZNA 2OMTB 3UXFA 1MNUL 1RCYA 3ES6B 5IZ7A 5FW6A 4XTRC 4UIMB 1PAMA 1XCQA 5KJRL 3L4VA 1XGUA 1Z5YD 2UY7B 3OKLB 3MREB 1E40A 2DLHA 4XNXL 3CN2A 3Q7JA 4KH2A 5D93B 3QRGH 4FP8L 3LRKA 4DFHA 4KVCH 3C2AH 3PQYE 5DO2C 3U9PL 3T3MF 2ROYA 1HEZB 2NQDA 3DUSB 4N8VB 4XE0A 5E5MA 5SX4H 2Y0SA 1U58A 3I9IA 3QZMA 3PY9A 3TZVC 1A1NA 3O6KL 3EGXA 3X11B 2DZEA 4BEIA 2YOCA 4QT5B 1ZV9A 4BH8B 2QVMA 5E6IB 3MRGA 1K3ZA 5GS0C 1NJ9A 2BNUB 3H8NA 4WU5B 5JW5B 3GSXB 2WQVA 5GGSB 3QIBD 3VI4F 3CHSA 3HZYA 4N0RA 1TJIL 4XCEB 1CT8B 2ICEC 3NSDA 2O1AA 3VWKA 4FLOA 4RZCA 4B27A 5HYEA 1VEPA 2LV4A 4YL4A 3KVPA 1SHWA 3ESNA 3FTXA 3WJMB 1XSIA 3CXDH 5B8CB 3G5XA 2EINB 4P2QB 3ECQA 3KPNA 5KBPA 1AO7A 2KQMA 4ODUA 2ZWNA 3ME0A 1UUNA 3O3BB 3W5MA 3L5XL 5EOCJ 5FAAA 3QXDB 4FFYH 4GUQA 2L8AA 3KXFD 2O5XL 2OCCB 3BH9B 3TBWB 4PGZA 2OMUB 4I77H 1MWAH 3GKZA 4UINH 4ZFFB 2FHCA 4P5TA 5B1AB 3GXMA 4NQXA 1IE4A 4HLZG 1W72A 2WXOA 4A2LA 1JPTL 4HK0B 4FE9A 3CAFA 4L4VB 4YSPA 1OSPH 3ZXAC 1JFQL 3FH8A 1IGIH 3IU4H 3DMMA 4GIOA 4Y4HA 5EUOA 4ALAL 1W72L 1J86A 4G6AD 2MNJB 3CFEB 4N1HB 2YPLD 1GRWA 5BOPA 4M7ZB 4MSWB 3BO8B 4HBCL 1AXTH 1S4IA 3RIFF 3ROOB 4AEHL 2NTSP 4C4KO 1C5DA 4JFDB 4QKXB 3WXVL 1F6FB 4ZSOA 1XH1A 4QLWA 5CBEB 1D7FA 5D71H 2ZX8A 3IAPA 2FD6H 1GTFA 5HGDB 2K0RA 4R6UA 1JXJA 1NAMH 4LVEA 2W1NA 5JPNC 4PG9B 3O41A 4HU8A 3GLEA 1LILA 5D55A 2VDQH 2UY6B 4XMUA 3NZSA 4QRPB 2NLJB 3DX7A 5TF1H 4YBLC 2ZOKB 1XHHA 1L3WA 3CDFA 5D6CB 1E8ZA 1O6TA 3WTXA 3IT8D 3NIGE 1KLUB 3P4NB 5D7JC 3IXAB 4DIXA 3IEAA 1ZATA 1DVFA 3CZFB 3EYUH 4JLRB 1I31A 4NKOB 2OA9A 4M9PA 5F89A 3B3IB 1JPGB 4DEPB 1MCHA 2R4SL 3FKUS 4IOSD 1G7IB 5EN2B 5LAXB 1LD9B 1BEYH 1RIVH 4K8RD 5I6LA 1G9HA 1NSNH 3U79A 5I15H 4H5SB 3SD2A 3NIFB 4XPAH 5CSZB 4MXVF 3EIFA 1WIPA 3KPOB 1P4BL 4YHOH 3CSPA 3UYRL 2R8SH 1TKWA 3GTVA 3II1A 1NBCA 1FZMB 2J8UA 1MFAL 4KY1L 3HE7A 2C9XA 5HI5C 4R8WH 1CD1A 2DQUH 1BXVA 2BWQA 2QJDA 3RVUD 4HOZA 2QTEA 3FO9B 3MFFB 4P3CL 2JELH 1HKFA 1XIWA 4AGLA 3CFMA 4ZMNA 1T0MB 4V33A 5EF1A 4QCIB 4RIRA 1JNLL 3T2OA 3DYOA 4DKFH 1AXSB 1S7XA 4Z7UF 1NFIB 2Y2TA 3AY4C 4RDBA 4Y19E 1LK3H 3W2DL 1IE5A 3C5JB 4EDWL 3CK0L 4JKNA 2A1WH 2X87A 2MQCA 4AL8H 2ZCHL 2CO7A 4GSRA 3OX8B 3L16A 1JV2B 1W0VA 2GSIB 4G43B 4OIAA 5C1MB 1NUNB 3AXHA 3HG3A 1I8IA 2X70A 1FAIH 1PNCA 2ENPA 1QZNA 2N7BA 5DJZA 1XR9A 1KN2L 4U1MB 2MQ0A 4Y2OA 2D0FA 4JY6B 1FZOB 5C70A 1R1CA 1E65A 3O9WD 4WQOA 1F1AA 3QEQB 2V5MA 4ZOCA 2XXMB 2YAFA 4DH2A 3DX8A 2UYLA 4U3SB 4Y9EA 5CCKL 1VJSA 4ERSL 2IDFA 2XQ0A 3U2SB 5HYQA 5G4NA 2XXCB 4YO0B 3TIEA 4POUB 2E9WA 4YUEL 4AYEC 3QUYD 4JN1L 3QQDA 1M57B 2Q6WB 4P57A 1HC1A 5GZND 1VGKB 1RFDH 4EBQL 1AQDA 1BVZA 1UJ3C 4JB9H 5DJAA 3V52L 4A2FA 3L5WA 4DO6A 4EDXB 4F7MA 3NZUA 4DVBB 5LWYL 1LP9A 4IRSA 3GNML 4DOHB 4HIIA 3BPCA 4Q9QL 2C5DC 1K2DB 1F3JB 5EOCH 4LMQI 3K8MA 4CJ1A 1AS6A 3DECA 4J8RA 2VO8A 3FTGB 4Q6IA 1BWMA 2ZXDA 2ENQA 1J1XL 4IDLA 1EJOH 3RWHB 2H9GA 3QPXH 1YYCA 2OTPA 3CFCL 4XNUL 4P2OC 4ZZKA 3TLRA 1HL5A 3L9EA 3BVNB 4YHKL 3ZHLA 2B8OT 4ADJA 1EHKB 2I5YH 4N20A 4UOJA 3SE8L 1L7TH 4M3KB 4ONGH 4TOYL 4W9DC 2WBXA 4HSCX 5ID1B 1HQRA 4JHWH 3EBAA 4JFUA 3C60C 1HEHC 4G8IA 4HAKA 3R1GH 4WCYL 2RALA 1ZT1A 1IGTA 3RFZC 1V05A 4I0CC 5FGCB 4KGLA 4R4FL 1QP1A 2D7QA 2DKSA 4X9IA 2HFGH 3MLSH 5EU4A 4FI8A 4NSKB 3US1A 2AV1A 3LRHA 5HY9B 4G70B 4F8LA 3U9UA 3WXWH 1N70A 1ZLDA 2XZZA 4E41A 2ITFA 5CU5A 4RGMB 2BVQA 2LFEA 2XACC 4YPGA 5ECGA 5DHVH 4KKCD 1ROCA 1LMIA 1KCSL 3VNYA 1U3HC 1CS6A 5B1JC 3MRPA 5DFAA 2LE9A 5KVGH 5CGTA 1TCMA 5C9KA 9CGTA 2NOYA 3V0DA 4F8NA 4FFWC 4O5LH 3BH8A 1AO7E 4IS6B 4KTEL 4OCWL 4PB0H 4PJAF 5JOPE 3SGDH 4G3YL 4EZLA 5I8CA 1ZANL 3VD7A 4PJ9A 5KYWA 2VT0A 3QUKB 2P8LA 4HV8B 1BVNT 4QHLA 4YIQB 2ZZUT 3NFSH 5DJ8B 4RGNB 2NDFA 3NK3A 4J3XA 1RK0A 4KNSA 3UTZA 4WU7B 1XBDA 5JPMB 1RHHB 4NQUA 2QHRL 2RTTA 4LMQE 1S6NA 3O6FA 4H44C 4HEPG 1FVDA 3FCBA 1CDYA 4HIQA 3UAJC 3ZR5A 1YEJH 3MYZA 3CSGA 1ZT7A 2APXA 4JDTH 3UL4A 2DQCH 3QUZC 1BVKB 4GFXA 4ZFGL 4KI5D 3LEYH 2CM6A 4DP2X 3B3BA 1LO4L 4GO8A 4UBDD 1IBFA 1SJHA 3U2JA 3MO1A 4NZTL 1Y6MR 4NHCH 3C08H 1S7QB 1VIWA 3IJHA 1WS8A 3GDBA 5BOZG 1OAXL 3Q1SH 4MGXA 2X6CA 2HJFB 4UM8B 4MAZA 3TONA 3B56A 2IXQA 4LESA 2V7NA 4XZUB 4ZSOE 3WS3B 4E9QA 4LSDA 1XH3A 4ZPTA 4HW6A 1GL4B 3N44B 5IHHA 5AG8A 5JDSA 4Z7OF 2H1XA 4A66A 1HHHB 3F00A 5I82A 3FF7A 4NAQA 5DUBA 3MROA 1XGRA 2OMXA 3ZLQC 2PW1A 4D9LH 2ZUVA 3OC8A 1K4CA 4X6BA 2X53A 4JN2B 1H3GA 3QJZA 4J4PA 2BK8A 4WJ5B 4ALAC 2NX5D 2C4XA 4XO3A 1E67A 2DKUA 1IAIM 1IT9H 4IRZA 3EAKA 1TR7A 3W3BA 1ZEAL 3UO1L 4U2YA 4Y5VA 1B6UA 4G1EA 2X4RB 3ARGA 4TUJB 4OZGA 1J0KA 1OAUL 4X5PA 4ZRGA 4F33A 1NGWB 1RLBA 4IRZL 1JZ2A 3GHEH 1KENL 3GS0A 2MCPH 5FFOA 1DZBA 4KHXL 4W4OA 2I07B 3RPIA 1NIAA 3FUNA 3HN3A 2VLLB 3MNZA 2E0PA 4UYQA 2BSCA 3BD3A 1DBML 4DTGH 3ESMA 4QNPF 4HCRH 1QA9B 3BDYL 5AAWA 4TTDD 5F8RC 4DPCX 5C92A 2J8UE 4U1LA 3BUDA 1NMBL 2BX5A 3QG7L 1X5MA 2OTUB 4WO4D 1QUNA 3PWNA 1BJMA 1S8DB 3VFGH 1QR4A 4GKSB 2D7PA 4CRPA 4YSRA 2F58L 3S5YA 2C34A 4RFEB 1IKFH 2W38A 2YXWA 4Z7QF 1BDYA 1VFBB 3JWDH 5AAMC 2XWEA 4A7GA 4NNXB 3TF7C 1QSEB 4GAYB 4AIOA 1B0GA 4PGCB 3MNMA 4U49A 2VR7A 2AABH 2FWOB 1NMCC 4JPWH 4P8QA 1D6EA 5E2WL 2ZYRA 4TNVK 2QBWA 1MWAB 2DH2A 4XPBH 1DANT 3ULVD 5T1LB 4NAJA 2ZPKH 2XY1A 2B08A 2A9ML 4GUPB 4XWOD 4ABVA 1OAQL 4YWGL 3QXAB 1QBLH 2DWXA 2YRLA 3VGFA 2OYKA 3OB0H 1AY1H 1MJ8H 3QCTH 5DD1L 2BZ7A 2FR4B 1WUNT 4XOAA 2IF7A 1KMGA 1UKSA 3K7UA 2UUDH 2FBOJ 4K94H 2X4TB 4FABH 3RZCD 3U4BH 1UHVA 1EZVY 4K71C 4Q0XL 2Z31C 3V6OE 3KDMA 4B9CA 3QG6B 5I1EL 4PGDB 4PGEB 5CUSL 1ZPUA 2OMTA 3KJ4C 2V5RA 2WLLA 1BZOA 3FPYA 1Q9OB 3ES6A 1S78D 4KDWA 1NEZG 5F6HJ 3RX8A 3OKNB 1DQTA 2YMXH 1NAMB 1EGJL 5D7KD 3F62A 2BP5M 2GAZB 3B37A 3Q48A 3CSYB 3K0YA 5K1JA 1MREH 4LFHG 2NNCA 4H8VA 2AJSL 4P2CG 1J8SA 1HEZA 1SJEB 1AGDB 4N8VA 3Q2CA 3BZDA 2NQCA 1OIOA 5TFSL 4QT5A 4X83A 4POYA 5TD4A 5C7XH 5E6IA 4GI6A 1IM9D 5C2BL 2XVBA 2F2HA 4TPRH 3BESR 4KMQA 1UYWH 4MQSB 4MXWH 5ENWB 4MVBD 4WFGE 3V6OC 4WJG3 1CT8A 4BUGA 3VD5A 1DSFH 2CALA 2Z8SA 4X4YB 5B1CA 1BQUA 2VDMH 5B8CA 1W0YT 3VXOA 3SPVB 5FUZL 1HCYA 4R7XA 3B2UC 1JXKA 5HHVL 2FSEA 2GK0B 2X89D 4E41E 5J13C 1FG2B 1J9QA 4XCCH 3DSNB 1CLYL 2OSXA 4KMLB 4UV4H 3BT2H 3QARA 1KXVC 3JZYA 3HIZA 1ZV2A 4OZHF 5DJ0B 5K59E 4LPXA 3V5HB 2H3KA 2F7OA 3DK2A 2OMUA 4MRCA 4GRLA 1PX4A 2OXHA 5D7HA 5CSGA 1Q9KB 3D18A 1A7PH 4G80B 3T6QC 4ZTPL 1EJ6A 3LHAA 4OJAA 4ZMYA 3NEEA 5DDHB 1ADQH 2WBWB 4KO5A 1EO7A 4G6FD 4ZS6C 1OF2B 3T9WA 5TDOA 4DKTA 3F84A 1FORL 5AB2A 1YMMD 2R1YB 3BYTA 2BS71 4OIFA 3L3GB 3W11C 5IY5B 3RDTB 4NUPA 4UIKL 2PTVA 3X1BA 1ZGLM 3L7EB 2I7OA 3ZPDA 4BHUA 2PO6D 4P46B 1TQTA 3BQVA 2CD0A 3CFEA 5C0AD 1EUTA 4MNQE 1QW8A 1QFUH 3BO8A 4JKWA 3PP3K 2NY1D 1P5UC 1NFDE 2ADYA 4P9HL 3W37A 2YPLB 1U8JA 1P7BA 3ZBMA 3AAZA 5CBEA 3K4ZA 1SQ2N 4DP1X 5F7UA 4OIBA 4QHNB 3VVVA 4P2RB 4PLJD 4OCNC 4X80L 3FQTB 3EH2A 4TLUA 1B3IA 3T5WA 2H41A 4PG9A 4OGYH 3HZVB 4BFFA 5F96H 2WLMA 1Q0XL 4BQBA 3VA2C 2UY6A 3II3A 3F7QA 4HS8H 2OW7A 4QRPA 1ETA1 2WLHA 2WVVA 1BOYA 2OXGA 5DD3H 4WTWA 2ZOKA 2RR3A 3KDPB 4FG4A 4PJ9C 3MOBL 3UC0H 4D0DB 4NO3A 1FNSH 4YVNA 1CBJA 3IXAA 1V3JA 1JN6A 2K7PA 4JLRA 4NKOA 2BSED 3QZWB 4NQED 5GSVB 3GZKA 4AW4A 3MLWH 5D7IE 1GZHA 1ZRUA 3LKNB 5EN2A 1RZKC 2AP2A 1LD9A 1KXTB 5D1QC 3LXBA 4A7VA 2X2JA 3QXWA 1HHIB 2EKSB 3IRCA 4MNGA 4KUCD 5CSZA 1F2QA 3KPOA 3TVMD 4XMWA 3H2QA 3DIVA 1S7UB 3LDBC 4OZGE 2G60L 1RVFH 4V1DB 5AOJA 2E4TA 2DQGH 4GRMA 4JFHD 5CJXC 1MF2L 2VR6A 4U33A 1T83C 4O51B 5GGRA 3BX7C 1KTDB 1XCWA 1OT4A 2N0MA 4E9TA 3MFFA 2P49B 3EJQA 1UEYA 1IVTA 5IMMB 2VO5A 2WLKA 3F2LA 5CS7A 1MCKA 2N59A 5I17A 2QMJA 5LBVA 4QCIA 1NDTA 1B4LA 1AXSA 4OTXH 4Q58C 4O4YL 5AL8A 4OM1H 1AIFB 5DHVB 3C5JA 3U83A 3HHSB 4KK6C 2GT9B 1S9VB 1GS7A 2M1KA 2MTZA 1PLGH 4G7VL 3SDAA 2KLSA 3HG1A 4G43A 2GSIA 3VX0A 1LGVA 2CJSA 2FZ3B 5E99L 3EJJX 3BSZA 5HI3D 2HUEA 1OP3K 3T0BA 4U1MA 5LGJB 2E47A 1N5AB 1FZOA 2ZYIA 5CP7B 3UJJH 3L54A 2ZXCA 1MHCA 4NO5B 3EG9A 1WH0A 1CD9B 3V5KB 5L4MA 5H8DA 2ICES 2F6AA 2FJFA 3BSZL 4PGBB 2HLAA 3TEUA 3QDAA 3UDWC 3WY4A 2O61B 4U3SA 2ODHA 3GD1C 5IQ7H 4P99A 1A6VL 3Q05A 1XR8B 2XTJE 4DGVL 1BBDH 3W0WB 1JUFB 4K5MA 3BUBA 2P44B 4GW1B 2Q6WA 4OAWB 3NACH 3Q8CA 5AD0B 4CVXA 1Z0MA 4WTXA 5G55A 4BH7B 3W38A 4EDXA 4I3RH 4PJHB 2DH3A 1BGXL 3OAYK 2LAAA 5DI8B 4IRJC 4DVBA 5EWIH 3RGVC 3JTTA 3ARFC 3APDA 4AGOA 2NZ1A 4O2FB 1K2DA 1F3JA 3CLFL 3GSNH 3FFCA 3P0VL 3L2NA 2FHFA 2WGNB 4AM0B 3VAEA 1TLMA 3NJIA 3RWHA 4UNIA 2VN4A 3IFNH 2HX8A 1T4KB 3V8CA 1FUNA 1F4WH 3KLLA 1OEZW 2B59B 4DN3L 1NCCL 3KLAB 3ABKB 4Z3GA 3BVNA 1OCZB 3L3IB 3QORC 4NQDB 5I5MA 4KZEL 2R0WL 3RY5A 2AW2A 2WYIA 1J5OH 1YPZB 2XTJC 4M7JH 5CGYC 4M3HA 1J8KA 3EKCA 1IGCL 1QUPA 5ID1A 5I1LA 3UZEA 1RZPA 3SYCA 3TV3L 1O9ZA 5C97A 3VU2A 5D1ZD 4NFCA 2N0KA 1EHXA 3QT2A 2WWMC 4M5YL 5J3HD 1KBWA 3CIQA 1QBML 5CJQL 2WBJD 5HY9A 1UGNA 5ACLA 4HKBA 2OMBA 3RNQB 3D9AL 2IALB 4X8XA 2KZ1B 4LPQA 1IRAY 1UOKA 3QP3A 1ILSA 1I7UB 2AEQL 2P45B 4JJHA 5GQBA 5JW3L 5BMFH 1AR2A 4XH2A 3J8F7 2RHEA 1YZZA 3BHBB 1FGVH 4X7DC 5KOMC 3SGEI 4DJMA 5K39B 1OY3B 2ZOLA 4P2QE 2CLRB 3TN0D 4G2AA 5CD3B 2GI7A 4IS6A 3E9UA 3G5ZA 2X6BA 1YEFH 5TE6L 5IBLD 4OCSH 1LL1A 1LO5B 2MTPA 1N64H 5HHPB 1ORQB 1AZBA 3QUKA 5D93C 4JFQB 4HV8A 4GPVA 3I6GB 1QRKA 2H6PA 1XMEB 4YIQA 4K3DL 4M1GH 3DX9B 5DJ8A 5T1DL 4N90D 2VITA 3BLPX 4Q2ZB 1H8SA 1S46A 3B9KC 4WU7A 3UZVB 5J11B 3FU6A 1WZAA 2VLJB 4J3WA 3KPSD 3LH2L 3RI5F 5AZ2L 1OPGL 2EIZA 3ATDA 4JUSA 4L4VE 3RWCA 2CUMA 2OZ4A 3E6HB 5F2FA 3VXSD 1LQSR 1J9SA 3WTWA 1JHKH 5JXEC 1BVKA 1HQ4A 2FNWA 4Q52A 4WNJA 3ZDWA 5DA0B 4X9BA 3JVFC 5H4YA 3ZKSD 2DM7A 2J6WA 2OZ4L 4L8SA 1LMKA 4CN4A 3CVHA 3KEHA 2DB8A 2YC1B 5L88H 2H8PA 4YLCA 1S7QA 1BZQK 1M6UA 4GBXA 1FL5B 1NLDL 2MHAB 3TEYA 3MODL 2LOEA 4JFDE 2HJFA 4JW3A 3MJWA 4NQCD 4UM8A 2IMNA 2F53D 1TVBA 4PJIA 3JTBA 3CVHL 2WN3A 3ZZ1A 1AFVL 2NT1A 4NQVB 4M00A 4QY8B 2PTTB 4TSAL 4M8VA 1AZUA 5GZOD 1HHHA 3HG4A 3FCTB 3OKMB 3QZLA 4LXFA 2AK1H 2AVGA 5I1CL 5AVTB 4LPUA 4JN2A 4PJGF 4JO8A 3U4AA 2CUAA 1VFUA 2VDPH 4HP5A 4ISVB 2CCWA 2BHFA 3CDZB 4UMGA 4QRPE 1FH5L 3SDXF 3D0LB 3A6CL 3ZYOA 5LVEA 4P05A 4JGNA 2YSSB 4LQFH 3VXMB 4TUJA 1NMAH 2NX5B 4JPVH 2Y9RT 3OAUL 4S2SB 2X41A 4W9IC 4JGJA 5DF0A 5D6DA 4QXVA 3DX0A 3WIFB 3K2KA 3BVVA 4BD4A 3S96A 5MHSD 2RFXB 2HFFB 3C09B 3P40A 1SUJA 2I07A 4MJIB 4OFQA 2B1AH 3QRGL 4JRYB 4WW2F 3TT1H 2DMKA 4KVCL 4YHYC 4B41A 3C2AL 4S1DD 1J05B 1MAJA 4TNFA 5E6ZA 4XVSH 1RJYB 3NIFE 2X2IA 2ESVB 3TNNB 1YQ2A 4X0KB 3SGJC 4MXQC 2QELA 3MRMB 5EO1B 3H55A 4NN7B 5CBAB 1H15A 4QKTA 1S8DA 2ZUYA 4FNSA 5EIIB 4GKSA 3QJFA 2VDMB 4PRNB 5C08A 2CA4A 3QNFA 1GY1A 5M95B 4OF0A 4IU2A 4RFEA 4KV5E 4LLQB 3UMTA 1VFBA 1QSEA 2AEIT 3CXDL 1TUPA 4GAYA 4W9HC 3AXIA 4FFYA 4KRPB 1RZ8A 2FWOA 4LP5A 4A04A 1NCTA 4LFHD 3UO8B 4B97A 1QQDB 2ZXBA 3NABH 4Z7VB 4L2LA 3VH8G 4KKLC 3O45A 3P4OB 5DUPH 4L23A 1MQKH 2R23A 3ABGA 4XN9A 4X7FC 3CBRA 2XNAA 4BFEA 4PJ8D 5JTWA 4A7TA 4FFYL 4AIZB 4IIQA 1WD9A 1M7XA 2PMZA 4GUPA 1YYLH 4PRHD 1JGDB 1MWAL 4I77L 1AKJA 4GLRI 4G9DB 4UINL 4A1JA 3O2DH 4F92B 3CZSA 3QEQE 3GBLA 4KPHH 2Z92A 5DLLA 3ZQDA 2ZXWB 3VXUD 3WN5C 3KW7A 2YLHA 5AKVA 2QLYA 1IC4H 3FH7A 4EUPA 2O93L 2G0LA 1FPTH 1OSPL 2X4TA 1TZOA 2E7MA 1IGIL 3X1FA 3IU4L 1IEBA 1RLWA 2VB5A 1TJGH 3C8KB 2ZXAA 3KWWA 1NIDA 1NC4B 3ABZA 5ETUA 4YX2H 4XNDA 2OMVB 1G87A 1LM8V 1EHLH 3MZGB 2VR9A 3L3HA 4YK4B 1AXTL 2HKFH 3NIDF 4ZPVB 1Z9MA 4LBAA 4FERA 1HXYB 2CDGB 4H8WH 4JRLA 4W4NA 4FKHA 5D71L 4DOHE 2MH4A 2FD6L 3HNSH 4F2MB 3L9RB 5AW6B 1K5NB 3UX9B 3CSYA 1BZ7A 2WKGA 2XN0A 1IJNA 3D39D 3PWPD 4KI1A 4W9CC 4RFNC 1NAML 5BQ7B 2YGQA 1JDDA 1SJEA 1AGDA 3ECBA 4OIIH 4YE4L 4ESKA 2A2QT 1TITA 2E9BA 1AHWC 2VDQL 2W07B 3OKKA 3V2AR 4AW7A 1L0PA 4RMSA 4P2AA 1L9SA 3ENEA 5TF1L 4AIXA 4I89A 4UTCA 1UM6H 1BYNA 1EAJA 1YLBB 3UTSD 5TE4H 6CGTA 3TO4D 4A55A 4RAVA 2VLRB 1BZ9B 1LEGB 4CU8A 5I1HH 4ZTEA 2BW4A 3EYUL 4P4KA 3K8LA 4Y0GA 3S97C 4W9EC 4WTZA 5FGCE 1JDCA 4ZO8A 1KXHA 5F88B 3AG2B 3HPJA 4ATTA 1VFAB 1BEYL 1RIVL 3FAWA 4GS7C 2HRHA 3V95A 1NSNL 5I15L 4LEOA 3BQUD 5FO9B 1HYSD 2ZF9A 4XPAL 2GK0A 3AMKA 3IJ7A 3FQWA 4KJQC 4YHOL 3FK3A 2R8SL 2F54D 3DSNA 2OTWB 3WKPA 4B9JA 5DJ0A 2OR9H 4OF3A 3CXFA 3NCFB 2AERT 1S9YB 1HZKA 4R8WL 2DQUL 3K1KC 5IB3A 2C9AA 4JREB 3S4SG 4LLUB 5EA0H 1Q9KA 2JELL 4IBVA 3SBPA 5AVYB 5SX4I 1XZ0B 2LU3A 5DDHA 3ZQXA 3AQZA 2J1XA 4CGUB 2F74B 1KGCD 4DKFL 3FBQA 2B16A 2R1YA 3PWJB 1Q0YH 2X88A 3UMNA 1LK3L 3L3GA 1MUJA 2GUOB 1C9SA 4L4JA 1OHZA 3ATFA 2A1WL 2KYIA 4KKQA 1A7QH 1J8RA 2WNKA 2X4UB 1KXQA 2C3HA 4LCCC 3UPAA 3LN9A 4AL8L 4E0RB 5JW4R 3FSWA 4P46A 1CMOA 2HPOA 1FYHB 4XAKD 4POZD 3ZIYA 1FFTB 4LSVH 4XI5C 4RGNE 1EVTC 2OKMA 3MUGB 1MI5B 5EFIA 3V7AE 1FAIL 4F9PA 4FFZH 3D25B 4KK9C 1USZA 2VMFA 2ADIB 3EO1B 3NH7H 5C0AB 5B4MC 2NZ9D 1X5HA 3QXTA 3PWLB 3ZE0F 1OTTC 3DTUB 2F5AH 4QHNA 2BZCA 4P2RA 2XCMC 5T3XH 4BZ2H 2XN1A 5L0QB 2UXTA 5FA3B 3LPPA 4JM2D 5IHWA 1TEYA 1QWUA 3FQTA 1IKNC 3BAJA 3SDCB 3U0TB 1NM4A 5D2LA 1IQDA 4D2NA 2ZUXA 5EDXA 2NY0B 2ADGB 2CJTA 3PNWB 4JB9L 4XHQA 2XN9B 4Z7IA 1KELH 4M29A 2V17H 4IGBD 2DIAA 4PJIE 5KWYC 2DEWX 3IVKB 5E2TH 5E9DB 5LB1A 5EBGA 4PRID 3RWIB 2R2CA 3QZWA 5GSVA 1UENA 4X9YA 4RGNC 1U8HB 5EOCL 5ACZB 3A21A 3BVXA 3T1FB 5JPMC 4DN4H 2Y36H 1IGJB 4G72B 3FQYA 2C7UB 2QVIA 1EJOL 1HHIA 3QPXL 4AVIA 5K9KA 3MMEA 4PJCB 3C9NB 5ITFB 1U8LB 4KO7A 4XXWC 4V1DA 1TJMA 1V8HA 1BJ1J 2I5YL 1MELA 4O51A 3TVMB 1L7TL 5E1GA 4ONGL 1JZFA 4QRUB 4EQ2A 1KTJA 2AK4B 4JFPA 5GXBB 4JHWL 5IMMA 4L1HA 1RURH 3QFJD 3R1GL 4IMLB 4KAQH 1WWCA 2VAJA 3B9EA 3ZR6A 2HFGL 1JWSB 3MLSL 1AIFA 5DHVA 2DYPD 1ETZA 4PJBB 4P0DA 4Z7NB 4R26H 3WXWL 1S9VA 1D9KD 3PAZA 1J0ZA 4CMHB 2OULB 4L8BA 4PW4A 3X3FH 3PFQA 3OJ2C 2Y22A 1DN2A 4X9HA 2XWZA 2MRYA 4KY2A 2CK0H 2RH0A 4YZFE 4I4WA 2A38A 1N5AA 1FHGA 5D1XB 5CP7A 4NPYB 5KVGL 4NO5A 4NOFA 4XO8A 1QSEE 2D7NA 1AOHA 4J6RH 1B90A 4HK3J 3V5KA 4DVRH 4WHCA 4PGBA 1JTTA 4O5LL 4CDHA 2O61A 3FUDA 3KJ6H 3MNVA 4Y5YC 2JTDA 3ARED 4PB0L 1OGPA 3T0WA 1XR8A 2WTRB 1J5CA 3PJSB 4ZO7A 4BKTC 3W0WA 3UTTB 4H4NA 3S88H 2X3CA 5E8NB 2EYTB 4UQ3B 3NFSL 5AD0A 4UQ2B 2IDUA 4ZMXA 3OV6A 1VACA 4PJHA 2Z93A 4BSJA 4OM0H 5HDLA 4YGAB 1OAYH 2ZTBA 4HMCA 5IB4B 3OAWA 3VXQB 3LKSA 3MZTA 3U1QA 4I48B 4O2FA 3DPDA 4OLEA 5CJOH 1KSRA 3I2CH 1YEJL 4FXGB 4JHZA 4PWJA 3L8QA 1KB5H 4JDTL 2DQCL 2WUCH 4AM0A 4HGWB 1YUKB 2Y69B 5FWQA 3LEYL 5AW9B 3TA3C 2QEJA 5IEKB 2FJGB 1QHQA 2H3NB 4OZ4A 1E2ZA 3C08L 2PXYB 4JANB 1MCIA 4NHCL 5SWSD 3P3RA 1T7YA 2HT4D 3KLAA 3Q1SL 1Z7JA 4Y2NA 3QFGA 5FM4A 1KPRB 1MIEL 4I0PA 4EVNA 1JAEA 1YPZA 3QYMA 4JG1H 1NCWH 2ADFH 4ELDA 5FKPB 3T65B 1N59A 4XR8C 5AW4B 4F5CA 3PIQA 1UCBH 4D9LL 4FS0A 4QRRA 4XNMB 4JDVB 2M26A 1X5ZA 2NR6C 2F1AA 4MB1A 5F0MB 5TPWH 3QDGD 4JFED 3HZKA 5AQ0A 1IT9L 3P2TA 3RNQA 2IALA 1RUMH 4KKBC 3KPRB 5FW7A 1IIIA 2X0WA 5HPOA 3A4DA 1XF5B 4LCUA 4ZD3H 4ELMA 4BCZA 1LNUB 1T2JA 2P5EB 2ZKWA 2GC7C 3GHEL 3SE3C 4HCRA 3EDKA 3BHBA 1XSOA 2MCPL 2BDNH 4ORGA 4DFIA 3D3VD 5K39A 5KANG 4XMTA 1EWHA 3BE1H 3K81A 1PFCA 5IBUG 2OS7A 5I1IH 1HOEA 2PYED 1UA6H 4FLQA 2EYRB 5CD3A 4DTGL 3T8VA 2AJVH 4NNYB 1BQHG 2C1OB 4HCRL 1HCVA 1HFUA 2FJHB 4KJPD 4W9LC 1LO5A 2VTFA 2VAAA 3JWNC 5FECB 4JFQA 5CNHA 2WHVA 3HE6B 2Y6SD 3VFGL 5I24A 1MCFA 1XVSA 3CZNA 4HWBA 3VW3L 4Q2ZA 1R75A 1DEEA 2D8KA 1RZ7H 3ZKND 5DMGC 1IKFL 3FFDB 2VLJA 3T4YB 5C0FB 5ALBL 3JWDL 5JXAH 3N40P 5MP6H 3DX2A 5C0CD 2AABL 4JPWL 4ODHH 3SDDD 4EAEA 3RNKB 4JKPH 3KPSB 1ED3B 1KZYA 4QO1A 1BJ1H 3UCQA 5ITBH 5F7NC 3G6AB 3QIBC 2EVHA 1X6LA 4XPBL 4F7CB 1KGYE 3OHXB 2OSLB 3DOSB 1NOLA 2A6KB 4G82A 3GLZA 4N6RB 2D03H 2YC1A 2ZPKL 4LSPH 1YEWA 2FT8A 1X5LA 1QASA 2Y1ZA 3LEVH 4FJZA 4LLMB 1QBLL 2WVSA 4JY5H 2YPLE 4PI2A 5GGVH 4IMKA 1DUYB 4B5EA 1AY1L 1MJ8L 2P3YA 3K2MC 3QCTL 3SQRA 5LG6A 4P2RE 4Z9KB 4B6ZA 2P80A 2PTTA 1IEAA 3CHOA 4QJ3B 3OKMA 2B20A 4K94L 4FABL 4DEWA 2P52A 3U4BL 1C7SA 1GOFA 4PVNA 4PG2C 2IDSA 4AL8C 4S0SD 4I7ZC 2VN7A 1EJFA 1JFHA 5DQDH 3ZDYB 2PPDA 3D0LA 1SLWA 5PAZA 3D85D 4U05A 1AHMA 3BJLA 3HAEB 3RDTC 3ZIMA 2YMXL 3RJQB 4S2SA 3NJLA 5IQLA 4QGYA 4RRPA 1EZSA 1KC5H 1XB6A 5EU6D 1F11A 4NJAH 2HFFA 4MJIA 2Y5TB 4AQEB 1XF2B 1MREL 4G6AC 4DF9A 9PCYA 2EDDA 1J05A 3LZFH 1PX3A 1LO2H 1A6TB 3BAIA 3AWFA 4MMZC 3X14B 3TV8A 2HVKB 5ESQB 3CZEA 3TNNA 4X0KA 3C75A 5C7XL 2GTZA 3MRMA 4LRIA 5JZ7C 1AGFA 4V1DE 1WFNA 3APMA 4LSRH 3IDIA 4HJIA 4TPRL 2AS5M 1CZ8H 1UYWL 3LAFA 5F1OB 5EIIA 3QHTC 4MXWL 1IM3A 5IROD 5C0BA 3V0FA 3DBXB 3OB0K 3DROB 1DSFL 2V5YA 5E1AB 2VDML 4YDZA 2UUDK 2EC9T 3J07A 3LOWA 3KWTA 3TCTA 1BJ8A 3ZG4A 3MBED 1TYRA 5IESH 1KPVB 3AACA 3ULSA 3EUDA 1T6WA 4Z7VA 4HDIB 4DO5A 3P4OA 4XCCL 4RDQF 5KS9B 3IFPB 2BC4A 4UV4L 1A6AA 3C6LD 3BT2L 3EZJB 5C0ND 3HPLB 4AIZA 1ADQA 4F7PB 5CLWA 3GZOA 1PG7W 1I82A 3P4MB 4UZSA 5J6SA 4Q97A 4E9XA 3IDYB 4JG5A 1JGDA 25C8L 4BRVA 1A7PL 4NZDA 4U7KA 3TM6A 3UZQB 4OW6A 3OLGA 4F8OA 1ADQL 1BREA 1SMOA 3FO0H 4E5XG 3WE1A 1KACB 1EANA 3RL2A 2YQ2A 4G8EA 3IF1B 3REWA 4HSQA 4N68A 1AQKH 1UWEH 4Y16A 1MXDA 3PREA 4FG6D 5IFHH 4JFFB 3T3MB 1C08B 1R5IB 3W0WE 3AS3A 4UDUA 1U4FA 2E6QA 4OB5H 4UOW1 3RVUC 1NWPA 3RVTD 5HJ3B 4KU1A 1OB0A 5L9DH 2PYFA 3S37X 1BMWA 1QFUL 4OLZH 3VXPA 4PJHE 4ZPVA 4K3HA 3DUUB 5EUOF 3HLAA 2EE3A 4CU7A 3VI4B 3IDJB 3BWAB 1X9UA 1NPJA 2GW5A 4Q89A 2APSA 1MWOA 3L9RA 3POHA 2DJUA 3EUUA 3GXFA 4N9GB 5AVWB 4FQXD 5BQ7A 4M8UA 4OGYL 3GIVB 3RWEB 5DK2B 2JXMB 5F96L 5B39A 1R5WB 3LNHA 4XN5A 1ZTMA 4C8XA 4N28A 2W07A 4HS8L 3O81A 4NQDE 4W6XB 3K0WA 3SHSA 3X17A 1N12A 1U2CA 4M8QB 5DD3L 4QRBA 2WJ5A 1YPZE 1UKTA 3OG6B 4H88H 1CJYA 3WUWG 2X2HA 4H8PA 3UC0L 1AGBB 2VLRA 5DC0A 5GS2H 1FNSL 4WLCA 4BUHA 1P6AB 5JIHA 4F5CE 3MLWL 1OWRM 3QQ3B 4WV1B 4PJDB 3G6JB 1MXGA 5F88A 3TO4B 4UQBA 2WB1A 1MZYA 1HS6A 2C3WA 2R2BB 5GZNC 5E23A 4HS6B 2YXFA 3AW5A 5FO9A 5EPMB 1FG9C 2OTWA 4AVJA 2QSQA 1YMHB 1GYWA 4WFHD 5FK9B 4DPBX 7FABH 2HRLA 1RVFL 1UZGA 1S9YA 2DQGL 3D0VB 1IFRA 5I1DB 4X8CA 3QNYB 1K85A 4LLUA 3RTQD 2J8UF 4Q7DA 2XIBA 1T89C 5LNGA 1HHKB 1XZ0A 1II4E 1W9XA 3DK0A 3NCWA 3WE6A 1I8AA 3IU3B 1ORSB 3VVWA 3X3GH 3WIIH 4OTXL 4OM1L 1DEDA 4EN3A 2I9TA 4N9OB 2P8PA 5AALA 5JYMA 3EDJA 2X4UA 3G5YB 5HHNA 1PLGL 2CO1A 2RD0A 4HUVB 3BP5B 3LNIA 4NZRL 2YAPA 1N0LA 2RAMA 3RRQA 5IR1B 5CLTA 2QHLA 3MUGA 1KY7A 5I74C 5J89A 2GIYA 2VLJE 3D25A 1TMQA 2AZUA 2GHZA 1INEH 4Y5XA 5HHMD 1W8OA 5KVFH 3NJMA 1AP2B 3G5WA 3UJJL 2YO3A 3OBAA 3QA3A 3ARRA 4MRBA 5FF6B 2IPUG 4D94A 3R8QA 4EPSA 4AQ1A 3GMMB 3H3KA 5FA3A 4GAGH 2F8OA 5IQ7L 1SF5A 4P04A 1GYAA 1A8JH 3U0TA 4ZFZA 5BS0A 3H7LA 4QTFA 2IBZX 1WIOA 1PD1A 1ZWIB 3DVNB 2R51A 3T6VA 5AW3B 4OD2A 2VW7A 3B1TA 3WDHA 5HYIA 3ATAA 1FVCB 5JW4N 3FRUB 5I16B 3NACL 3QULA 3U48A 4RX4A 2ADGA 3PNWA 4KVNH 2XN9A 4XE5B 3AG4B 3COOA 2R0KH 3GSNA 4I3RL 2PWGA 4RQQB 3C6EA 4XXCA 4YLQT 4Y1TA 5JO5B 3GB7A 5E9DA 2Z64C 4AM0Q 5EWIL 3CNKA 1CGWA 1GJWA 5C07B 2X44D 3RWIA 4F91B 1DVQA 1Y07A 2P5PA 3GSNL 1Z3RA 4HOMA 4CVZB 5J11C 1JD9A 1R0AH 1IGJA 4OUOA 1LP9F 2C7UA 4Z7UB 4BJLA 4U3XA 2EO1A 3IFNL 1G7LA 2ZOWA 1F4WL 4GEJA 3ARDD 5JQ6H 4I18B 3QIWA 5ISZD 4R7DB 3VXME 2NX5E 2BNQB 5AG9A 2A0LD 1J8HB 4NO2B 5LBSH 1J5OL 1MVUB 4GKOA 4M7JL 3S37H 2V9RA 4QRUA 5CCJA 2AK4A 4MJIE 3TF4A 3BN9C 4JRYE 4GT0A 4I0KA 3ZGPA 4IMLA 3DRTA 4KI5C 1ND0B 4Y8DC 3P0GB 3VWJD 4IMKC 4ZS7H 3WNKA 3LVTA 2ESVE 4HEME 5AUMA 2VSDA 2WXJA 1P0SE 2AXHA 3BAYA 3WHXA 4ZJ9A 3P77B 2BOBB 5A3ID 2KC0A 3EDFA 2GSMB 3EGSA 2DYPB 2EDFA 3D6GA 3ZTJH 2VKXA 3P73B 2YLKA 1UXLA 2E5EA 3ETBF 3ZN6A 5BMFL 1O0VA 3IS1X 4J8QA 4WHTB 2FECL 2YRZA 3U6XA 3OR6A 3VX1A 2QSTA 1FGVL 1LQBC 1MJJB 2JJTC 2NY2D 4JDEA 3WJLC 3LEXB 3Q8BA 1YEFL 4Z7VE 1CQYA 4OCSL 1ZAGA 4GP4B 1O7VA 1N64L 2LT9A 3Q8FA 3H4HA 2IAMD 2MKWA 1OGAA 2ZKHH 1A2YB 2AJ3B 4NDMB 3UTTA 4IKNA 1RUKH 4GINA 5HPMB 5BZWA 5E8NA 2BS8A 4XWGH 2K8QA 4M1GL 3RJOA 3H0TB 3NQIA 5JNYB 3HC0B 1EXUB 1NLBH 2V2XB 4E9WA 2YD3A 1BQKA 3DVIA 4CN6A 4L3CA 3FW6A 5IB4A 3QZPA 3VXQA 3N9GH 4JO5A 1U92B 3VXRA 5JUEH 4CADA 4LDOB 4IKIA 3L3DB 4TTDC 5IG7A 1G0YR 1JHKL 4WO4C 1JYXA 3BFWA 3ZHNA 2W60B 1HCZA 4J23A 4K5PA 4M93B 5DC4B 3ULUD 2H3NA 5L88L 4MHHI 4JANA 2PXYA 2YN3A 3BD4A 4HT1H 4R90H 2FQFA 5E00A 1XF3B 2IMMA 1AQ8A 1ZIBA 4U6XA 1KPRA 4G71B 2VM9A 5HYJB 4OVVA 2VERN 2QKIB 4BK4A 5FO8B 3T65A 1SLUA 5FS5A 3ELQA 4HK3N 2AK1L 1CE6A 2WLNA 1K8IB 2NNRA 4BWTA 3ULVC 3OGCB 4TNVF 2QGDA 3NN8B 4ZMPA 2VDPL 1QO3B 1Y18B 3EFOA 3EJYC 4PJAB 2MFNA 4DP9X 1U4EA 5JHDA 1A1OB 3OXRB 4HUNB 5HHXH 3DX4A 3HR6A 2X1XR 4LQFL 1NMAL 3K6NA 2VLRE 1L0XA 3E8VA 4JPVL 1LNUA 1CGYA 1EBPA 3ETSA 3QQ9D 2EO7A 1NGXB 4ZTOH 1I3VA 1UD8A 3EOTH 4WUUD 3RBSA 3RZCC 5EC1B 1WCBB 1DO5A 4MBRA 1J9RA 2MPAH 2LLGA 4YK4C 3I75A 2B1AL 3TT1L 1U36A 1K8DB 2V2WB 4G42A 2EYRA 2I9LA 4YAQB 4XVSL 1WC7A 4NNYA 2C1OA 4L4TA 5HXMA 1S78C 4ZOEA 3D3VB 4NO0D 1QRNB 2O6DA 1E5ZA 2OBGA 4MCNA 3HE6A 2V8MA 2B14A 2NTFB 1KLGB 1CDBA 1RK1B 1TNMA 1VADB 2VZ1A 1UXSB 2J8OA 4UAOB 3FFDA 3T4YA 4OUUB 1WBZA 4PJXB 3NSJA 1ML0A 3QSKB 1L9OA 5KVDH 5E08H 1P7QD 4Z7OB 1HYRC 2YMOA 2EADA 1EX0A 1SYVB 2EO9A 3OLEA 3NABL 1KBKA 1ED3A 4A7GF 3G6AA 1BVLB 5DUPL 1I8UA 2G5BB 1U3JA 4ZQTA 4XAWH 3O2DA 4H8QA 4F7CA 1F18A 3HS0B 2A6KA 4Z3JA 4MVBC 1FN4B 5C0CB 4HZAA 3RWGB 3BGFC 3SDDB 3EYOB 1MI5E 5AOZA 1COBA 5EZPA 1YYLL 3WEXB 3ZE1F 3CSTA 4G8GB 1TTAA 5C0AE 3M1BB 3O2DL 3U4EB 4F24A 1EEQA 1DUYA 4AKPA 3ATBA 4KPHL 3TYFA 3L9YA 3PGCA 3S3PA 4K3GA 5AVUB 2HVJB 1IC4L 1N4XH 3QUXB 1SVBA 1E7VA 2VZUA 2NXZD 4IOIB 1MLBB 4GG6A 1FPTL 2PPEA 4JREC 2NW3A 1D7CA 2NYYD 8FABB 1WAAA 1SGKA 2AQNA 1NDGA 1UT1A 1TJGL 3DGDA 3UBXB 4LASH 4CVUA 4YX2L 2CDFB 2XN9E 1F42A 1EHLL 4Q9RL 3LKPB 2HKFL 5C09D 5T5NF 2IH9A 3BDXA 5E9DE 1VZHA 2BXYA 3FOLB 2IAND 4H8WL 3GGWB 1DQML 3EDDA 4NUQA 2HT2C 1GSMA 1GW6A 3HNSL 4LPVA 3P30H 2DPKA 2FGZA 2VKWA 2Y5TA 4AQEA 4Z7QB 4N0CD 4M6MH 1K4DB 1M1XB 4P3DB 1Q1PA 3WELA 1GPOH 2B1HL 4OIIL 3T09A 5BUPA 1E5UI 4PJCE 3V6FB 3BIKB 1A6TA 2ZCKH 4IYKA 3X14A 1RI8A 4LKXA 5L0QC 2NY1C 3IN2A 5FGBC 2ZJSL 4ODBD 1L6PA 1XXFC 2WC7A 1S9KC 2R27A 4OKDA 3SDCC 1UM6L 4LVOC 2LABA 5TE4L 3GMLA 4PLJC 4JQVC 4FLHA 2AK4E 4H40A 4HKZA 5F1KC 1HSBB 4NNPH 5MEPB 3TBSB 5BO1H 3DBXA 2XZCH 1RD6A 1FJ1B 3V9FA 4HXAH 1CXEA 1V27A 2XUWA 4D9RD 3DVGB 3CBKB 4X8JB 4XXCC 4PJBE 4Z7NE 2NUPB 1KPVA 4ZUUA 5D96C 3KHQA 4XHJC 1BBJB 4HDIA 4H1LB 3BCDA 4XT1C 1R3KB 4FLSA 3IFPA 1CD0A 3FT2B 1IIKA 4NC1E 2ZP9A 3HPLA 1W91A 4GW4B 4F7PA 3INUH 3P4MA 4PYGA 5BVJB 2H32H 2QADD 3MV7B 4U1IB 5G4MA 5AKRA 5D1XE 1UXWB 5EA0L 1C5CH 4HWUA 4EI5B 4HLZH 4I3SH 2IH3A 5B1BB 4UM9D 2IQ9H 2CCLA 3QJOA 4D0BB 4PGJA 1G84A 4Y9CA 4XVTH 3TVMC 1Q0YL 3EGDB 3JTSA 5DEZA 5BW7C 2DTSA 2VLKD 4JFFA 3VFSB 3N06B 1A7QL 4IKLA 2UZYA 1R5IA 4BXVA 1O6SA 4FFZA 3M17B 5DYOB 3UTTE 5B7MA 5J9PB 1IGMH 1J0HA 5HJ3A 4ZUWB 1BM3H 1RZGB 4LSVL 3C8HA 2EVIA 4BZ2A 1MG3C 2DMCA 3FPXA 3JUZA 2X3BA 2I60H 3DUUA 5GIRB 2YMTA 4XNZB 1YEIH 4FFZL 4BWWA 2P4AB 4JG0H 2J43A 3IDJA 3NH7L 3EOBA 2F5AL 1RIUH 4TQIA 4NC1C 5T3XL 4BZ2L 3B7UX 1UVQB 3FB5B 4N9GA 1CIDA 3ROLA 3EO0B 3DXAA 1A3QA 5D1XC 1A4AA 3FZUD 1BLIA 4B50A 3RWEA 5DK2A 3EJCA 1KBBA 1R5WA 1HKLH 5HI3C 2L7QA 1UH2A 2J4WH 5B38B 4JHBA 1XMWA 5GISH 3GRWH 1MDTA 3Q2WA 2D73A 1FZJB 1KELL 2GJ6D 1MVFA 2PCPB 2V17L 4M8QA 1INQB 4OZHB 4PLOB 5GRVL 2EUVA 1UT9A 1U8OA 2VL5A 4MZRA 5E2TL 1XH0A 3FT4B 3OZLA 2G5UA 2Z35B 4HUUB 4HHGA 1T4WA 2P24A 3RGBA 5DMIH 3QQ3A 4WV1A 4PJDA 2AXGB 3G6JA 3U9WA 4A7UA 4FC3E 3KVDD 3MRDA 2Y36L 4AC2A 5E70A 4DN4L 4DZ8A 3HZ3A 3BEVB 3UAFA 3ZT5A 3X1NA 3S8GB 2ZX7A 1T22A 4HS6A 3F3HA 3LNGA 3IRPX 1MCDA 4XXDA 1EZUA 5EPMA 4FXGC 4MQ7B 3QUMH 5IJDC 3WGUB 3KPRE 3ERXA 5FK9A 2WVTA 2XU9A 3NIFF 3BPLB 3D0VA 3HKZA 2P5EE 5I1DA 1Q9WA 1MHPH 3L17A 3F12B 3LV3A 2KMWA 3GSUA 4FA7B 1CCZA 1S7RA 1RURL 1DANU 2XQYA 4KAQL 3NCBB 4FZEH 5E2JA 3IU3A 1YN6B 2CKBH 2P42B 4BIKA 3RTQB 3QIUA 3VFPA 2VYRE 3ZT7A 2YXMA 5F1IB 1F6AB 3H2PA 1HOCB 3QWRA 4MWFB 2EUXA 2E9GA 4KV5F 3WNNA 3ZKXB 5BV7H 4R26L 5D4IA 3G5YA 3EXLA 5EBLB 1TVDA 5AYQA 4DUVA 4RESB 1ZS8B 4KWUA 1NBVH 5FOBB 4HUVA 5ECJE 1RKRA 2ARWA 3X3FL 1YEGH 3K1DA 5GS3A 2A5UA 4FI6A 3DV6B 5GRVK 2DKMA 3MUJA 3GEFA 1R3LB 2CK0L 4MA8H 4ZAKB 5TE7H 3VDAA 5EBWB 5D1ZC 1AP2A 3UOAB 3WFHB 4PS7A 3I02B 4FNQA 1JCKA 5J3HC 5TTRA 4J6RL 2EEXA 2KPWA 4DVRL 2WXNA 1QPXA 2WBJC 3LRLA 1NH6A 4RWYH 1KBPA 3KJ6L 1A6UH 3HKFA 3MA7B 4MD5B 3KPSE 4CW1B 2WWOA 1MCOH 3MGOA 5CZXD 2DWSA 3M6DA 3L2LA 5EN3A 1ZWIA 1U30A 3DVNA 4PV8B 3MHZA 2HKLA 3CV5A 3TP4A 3MGTA 2YJQA 1FVCA 3AG3B 1ZA3A 3FRUA 3OM3B 4HSAC 5I16A 3S88L 1LDPH 4H13C 1H6EA 5I28A 2UZXB 4YFDB 4YJZL 5EZJA 2X09A 1KB5A 2O5ZH 5JO5A 4OM0L 4FFVD 2G9HA 1OAYL 1DQLH 1ASPA 3GMOA 5C07A 5IBLC 5CJOL 4JFYB 3I2CL 3O8XB 2Q86B 4IBUA 1KB5L 4F20A 2FEJA 1WAAE 5DVPA 1IL1A 4KVPA 2CIIB 2HLEB 2WUCL 3A4EA 3RIFK 3UIZA 4CVZA 3OZKA 1MSPA 3M7OA 5FYKU 2DQTH 2ZWKA 3ZDYE 2XQYK 3FRPA 4J3TA 2IH8A 4I18A 4LBEB 2EDEA 2BNQA 4DGIH 5EEUA 1AD9B 3HW7A 1J8HA 4JZOA 1MVUA 3OHXC 4JG1L 1NCWL 2ADFL 3TJHD 1U8KA 4ONOA 4F57H 3QZOA 1E4KA 3KLQA 4IBTA 4YHZH 4N5UA 1DBAH 1AMXA 3VGAC 1F4AA 1I1AA 3IGAB 2V37A 4QAMB 1UCBL 1ND0A 1PF3A 5AKSA 2ID5A 5GGSY 3BUPA 5B1KA 1A7NH 4IQHA 5TPWL 4GXUN 5DS8B 3AABA 2BOBA 1U8QB 1CI3M 1HWGB 2DM2A 5LQBH 1RUML 4KO6A 2FTAA 3Q6FB 4HIPA 2WMPB 4NP4H 1LWJA 1N18A 3FQ1A 5GZOC 3Q2LA 4F9LA 4ZD3L 2EEDA 1OLLA 1AJ7H 2JCCB 3AQYA 3PDGA 5IUSA 1SLVA 4LDEB 1BFOB 1OSZA 2YAMA 4WHTA 4WHDA 4RRPM 2BDNL 1MJJA 3B7RL 3ZL4H 4AYID 2X2YA 4JQIH 3FXIC 3BE1L 3G04B 1TZ8A 5I1IL 1ICTA 3G5VB 1UA6L 3DOHA 2BIMA 3ARTA 2AJVL 3SOBH 2WXLA 3S5LA 2RBLA 5KS9E 4GQQA 1DFBH 1TZHB 1NKOA 1A2YA 1CXIA 2AJ3A 4NDMA 5HPMA 1BZEA 4YSTA 5A2LH 1ZK5A 3H0TA 3FUIA 3HC0A 1EXUA 5JNYA 1E28A 4GYBA 1VKXB 3QHFH 3PAUA 2V2XA 4NRXB 5BPPA 1BQSA 1RZ7L 4S1DC 2P28B 3LKRB 3B9VA 3MUHL 3P11H 2VQ1A 4AEEA 3UP6A 1JD7A 2Q0ZX 3F7YA 2DDQH 5JXAL 1U92A 2WXQA 2HJKB 5MP6L 1MG2C 4PQXA 1OAZH 4C47A 4JFFE 4ODHL 3T3ME 4JKPL 2W60A 4MAYD 1D5ZB 5ITBL 2AQQA 2O4EA 5ICXA 1Y6NR 4B7LA 1YY8B 3U46B 2BCKB 1WJ3A 3X13B 2DIBA 2D03L 1SHXA 4LSPL 5T3XE 2JIXA 4HG4J 4HZLA 4I87A 4P4RB 1KEMH 1PCSA 1O7SA 2BVTA 1XF3A 3VI4E 2VQUA 3KYNB 3LEVL 2ETWA 3CX5J 2ZSWB 4JY5L 4R9HA 5GGVL 3VACA 3WFEH 2BIOA 2H4EA 1VHPA 2WXMA 3G6DH 4IHOA 2VERA 2NY5H 2X05A 5I18H 1P2CA 5HYSB 2ENYA 1K8IA 1AYOA 1OPOA 4AENA 2F1BA 4PJIF 2HG0A 3PL6D 4LRNH 3NDZE 3OGCA 4PJ8C 3NN8A 7PCYA 4XPHH 4YHNA 4Y19D 5DQDL 1O7DE 1A1OA 1XEDA 3OXRA 2V4LA 1TT6A 3K72A 2WAHA 3PGDA 2XWJA 3TEWA 1HILB 1GA2A 1UZ6F 2EP6A 4PFEA 1KC5L 5EC1A 4F7KA 4K55A 2Z4QB 4NJAL 4PJDE 3G6JE 4ZW7A 4PY8I 3TX4A 3EYSH 4TQHA 2OW6A 1A6PA 2XBZA 1K8DA 4Y4KA 4J3OF 1JS4A 1GCYA 3CVCA 5KYUB 1NOFA 1W8NA 3MRLB 2EECA 3GRBA 3LZFL 5FOJA 1JZHA 2WVUA 1UURA 1LO2L 1TYJA 5IMKA 1QRNA 2VE6A 2WLIB 2IPKB 3N1PC 1IC0A 3DHUA 5CN1A 3GMRB 3GM0A 1T04B 4XBEH 4LSRL 5K9QG 1PLBA 1VFOA 1CZ8L 2BMKA 3KPPB 5B3SB 2X1QA 4NO0B 4TKWA 3C60D 1KLGA 2Z1KA 1VADA 3NJFA 3RY6C 1UXSA 4AV0A 4JCLA 4IIZA 5FYLH 5EF2A 4OUUA 1I8MA 3O0RH 4N2MA 1T1XB 4PJXA 4K9EH 5JIPA 2W9LA 1DSWA 2DI8A 1KCBA 3FU3A 4FQIH 5IESL 4YZFF 3TBVA 1M53A 1SYVA 4N0UB 1U2HA 2A73B 4PJGB 1D7DA 1KGCE 1UD2A 1BVLA 1F00I 3WL9A 2FQDA 1P7QB 5IK3B 3TO4C 2JKIS 3QJTB 2BCMA 3RWGA 4N2DA 1G4RA 3EYOA 3SDXB 5F3FA 1CL7H 3SE4C 3AFLA 2BNRB 3L3OA 2A74C 3F83A 4BCYA 1J87A 3M1BA 4MS8D 1U9KA 1T6BX 2D9CA 3FO0L 4TNEA 5JIQA 2HVJA 3QUXA 4J2QA 3U36A 1HYSC 2PP7A 3FC8A 1MLBA 2CO6B 1NDMB 3N85H 4WW2B 3BFQG 1AQKL 1UWEL 1XCXA 2WD0A 5IFHL 1O75A 1GC1H 4U1JB 2NPLX 8FABA 2X0UA 3CFDB 5EU7E 1CFSB 3O3DB 4OB5L 4AGPA 2LQRA 3S0PA 4X9GA 2OYLA 4QTIH 1XB3A 2VXUH 5L9DL 2G2RA 3SKOB 4OLZL 3LKPA 4MDIB 5GS1A 1A1MB 1WGOA 4OV5A 1WUZA 5DVNA 5C07E 4HETA 5AYUH 3VWKD 3KXFA 5EBMA 1EFXA 2Q8BH 2R2HA 4HBQA 4HWZB 3N43B 2VJ8A 5TJWK 4CVWA 4Z7UE 1K4DA 2WZ6A 1M1XA 3O6LL 3UBFA 2F7PA 5T5NG 3UTQA 4K3JH 3V6FA 4HOWA 1AO7D 3BIKA 3ETTA 5KSBB 5L8KB 5LXGH 1LWRA 2EDLA 3EJZD 4IBLT 5JOPD 4DUXA 2BNQE 2NZ9C 3FH5A 1J8HE 4H88L 4PVBA 2E27H 1SN2A 3OXSB 5EB9A 4GAAA 1KJMB 1W0WA 1HSBA 1D2OA 3TBSA 5MEPA 5CEZH 4P5TD 1TQCB 3H9SB 4M4PA 2BPBA 4R0LB 3MNWB 3QUMB 3GTTA 1TCRA 3IGLA 3C12A 5J12C 1OOWA 1TVHB 2MNWA 3HR5B 2MCMA 3ZZQA 3FB6B 5JLZB 4JRWA 2I24N 4XNYH 3QJVB 4Y4HD 5TH2B 1JRHI 2YR3A 7FABL 1FO0H 1WVZA 1CDGA 1UWYA 5CSBA 4UILH 2QQNH 5L2JB 1SHMA 2ED7A 3DO3A 4PMFA 3MV7A 4UT7H 4Q4EA 2MOGA 4TS6A 4B9FA 3ZYZA 4EI5A 1A14H 2FLRT 5BV7B 3SBWA 2D7TH 1UB6B 4LU5H 4Q9CA 2E7CA 2QADB 1ZTXH 2FIRT 5BXFB 3X3GL 1DDHB 4X4ZA 3WIIL 3ILPA 4LLDB 1DUZA 4APQB 2P5WA 4UQEA 1YJDC 1EZVX 2R0ZH 3EGDA 1XDTT 3VFSA 1TTBA 1SOQA 5DYOA 5CIPH 3M17A 4ILDA 5AZUA 3LB6C 5J9PA 2HUHA 2JJSA 3P3SA 1ODAA 2W0FB 3OZ9H 4ZUWA 3GI9H 3HS9A 3ZRSA 1RZGA 3OKOA 2VLKB 4EZJA 1CB4A 3HC4H 1RUPL 1IGYB 3AWEA 1JMXA 4O00A 5KVFL 1INEL 3LY6A 1U8PB 5D4HA 4I8DA 3FO1B 3T0EB 3EOYG 3SKNA 1DVFD 1UVQA 5DHYA 4GAGL 1S5HB 3KYAA 4Q74A 3VFVA 1D9KC 1I3GH 4YZWA 3GEWB 1UCTA 4ETQA 2CHZA 3K6FA 3AB0C 2HH0H 5JW4Q 5J1SC 1LK2B 5K33A 5INDB 3V9CA 1F3RB 4HJSA 4QWWD 4DK5A 3HRZB 4BGLA 2FDBP 3C6SB 2VUKA 4PR5B 4KVNL 5D2LF 1FZJA 1CFMA 1DJWA 5HYJE 3LCYA 1HAUA 1JXDA 1NCUA 2Y07H 1X9LA 4DNLA 3PHOB 2J25A 1YUHA 1T20B 4HUUA 4ABQA 4U0QB 1AE6H 1UOVA 4OGAD 3L4WA 4KXZH 3JT2A 4AG4L 5DRWB 3MTXA 4QGTA 1GVIA 4D8PB 1R0AL 1XL6A 3L7FA 3O9WA 2AAAA 1A66A 1G94A 1UACH 3N5AA 4PJAE 3BEVA 1KUMA 5LBSA 3WLWC 2P9RA 4NM4H 3ZSSA 4CSPA 4I3GA 3KLKA 4MQ7A 2OL3H 5JQ6L 1M7UA 4B9GA 1J5IA 4DKAA 3N42B 4N4YB 3IJYA 5LBSL 2M83A 4DK6A 3QUYA 4D3CH 3GS4A 4OKVB 3S37L 2WYZA 1I53A 2ZWYA 4K2UH 3A24A 5EC2B 1RZJH 3BKMH 4PTUB 4YGVB 4Z0BH 1MRDH 4B9YA 4HPHA 2H1LM 3GXTA 1YN6A 3GJFB 1PDKB 4ZS7L 4QJ5B 4RA3A 2QKIC 4N86A 5F1IA 3D3VE 1HOCA 5DD0H 3VD1A 1QRNE 1A65A 2HT4C 4P5KB 5CEXA 2TRHA 4PBXA 3KPLB 5EBLA 5FOBA 1DVYA 3CCHA 4JBSA 1P7KA 4XC3H 4RCAA 2PTUA 4KK5D 1KCWA 2AEPH 3STZB 2WLJA 1A21A 4N8CH 1NL0H 2A6IB 3BP4B 4AJWA 1R3LA 1JZ5A 1BPVA 4R5VA 4ZAKA 5HDQH 5EBWA 3IK2A 1JIBA 3U1SH 5KVMC 3TASA 2EUZA 4PJXE 3WFHA 5IHZA 1JPEA 3LIUA 1A0QH 4Z7OE 2FBJH 5DC2A 3GMNA 2QPUA 3MA7A 3AZUA 1CR9H 3BUIA 5DMKA 3DO7B 4GQZA 4Y2DB 3LH8A 4PV8A 2ATKB 2ZKHL 3DC0A 1JVLA 1RUKL 5I1JH 3EF7A 2YBGA 4G8GE 4XWGL 5INCB 4ATWA 1NLBL 2UZXA 1MH5B 4WFFE 3TJEH 2IDTA 5IVZB 1C7TA 5IBTH 3DIFB 3L6FB 3PDOB 3IE9A 1YRKA 4YFEA 3N9GL 4WFGD 4KJPC 2E7LC 3FQXA 3QEGH 4NKIH 1QPPA 5JUEL 2FJUB 3O8XA 2Q86A 4MMXB 4PJHF 2F0CA 2VDKH 4U6VH 1PX8A 2JLPA 3MRRA 4AC4A 4AGQA 2CIIA 4UAOC 3ESOA 3PHQB 4QNPE 2CRMA 3H9HB 5K9OB 4MJJA 2WKLA 4LGRB 3QWOA 3ZKNC 1EV2E 4HT1L 2KERA 4R90L 4E41D 1BIHA 1EHNA 1AD9A 5H35B 3SY0B 3QI9B 4L48A 4PJFB 5K1VA 4DPRA 2E3VA 3HS0C 4AXWB 3Q5OA 5DJ2A 1NGZA 3SDDC 2X6AA 2Y3AA 2CR0A 4Z7QE 1PZDA 1GR7A 5DVMA 1KJ2H 1YPZF 3IGAA 5D2NC 2NNXA 1BD2A 3DVFA 1V7NH 3TH3T 5DTFB 3KMDA 4ZT1A 3QK0A 4NHUB 5AAPA 1HDMB 3BZFB 2D7OA 4LB8A 1FE8H 4TVSa 2HPTA 1DCEA 3EJPA 4QRSB 4PJ9D 3CN0A 2EVFA 5H2BB 5HHXL 7TAAA 3MLVH 1UASA 3SYOA 3Q6FA 4F37K 5IMOB 4C56B 2XA8H 3TFBA 3VG0H 2DTMH 2JCCA 4ZTOL 1G4MA 3EOTL 2FNBA 1DJGA 1E30A 2MPAL 4AJVA 3WTSA 3EFFB 3VE0B 4ZUTB 3O6FD 4ELMF 3VFNB 1LJMA 2WSDA 1QD0A 1G9NC 3ALPA 2WTPA 4OLWH 5EO0A 4ZMWA 1YN7B 5I23A 1PD0A 4HUCA 3H4FA 1INDH 4NOBA 1ET7A 1XBRA 1F0LA 2FO4A 1F58H 2QFRA 3M86A 4KHTH 3V9EA 1DJHA 5DHXB 4X0NA 2QQKH 3CE1A 3MV7E 3T4AB 1VKXA 4A6YH 4NRXA 1SXNA 1KGIA 4JFWA 3SD5A 5F7DB 3E3QE 1UJTA 3PHSA 4XBMA 1WT5A 4N3TA 1S7WB 5J6GA 1BWWA 5KVDL 5GRWA 2HJKA 4DGWC 3AQXA 5E08L 3MACH 4YXKH 1H0DB 5IREA 5F6IC 2LR4A 3MOAL 2O5NA 4ZDHB 1D5ZA 1M6OA 1QHOA 5KVFE 1I8LC 2BERA 3OJVC 2OYPA 3W39B 3WLBA 3N04A 1W6WA 2BCKA 3X13A 5IROC 1E3XA 3GQFA 4O2EB 5AB9A 2DY2A 4MCYB 4MB3A 5HDOA 4MAYB 3V7AG 4GAFB 3ARGD 2BSBA 1SJMA 1R6VA 4BDVA 2Q10A 4TSCH 3TFKD 3MBEC 4GMTH 4R4BB 2AQ3A 2CK2A 1JCVA 4OLVH 2YD9A 1N4XL 4I2XB 2EIEA 4BFOA 1XGTB 4G9FB 3ECVA 4K9JA 1E42A 5E6RB 2X1WL 5C0NC 3B2MA 5DZOA 3E3QC 2JB6A 4NJ9H 5EO9B 1U0QA 2C3VB 5HGBB 1N3NB 1IFHH 4FHKA 4LASL 1QI4A 3EYQD 2YA0A 3PL6B 1QYGH 5CWSB 4IRJD 4OCXH 3VGDA 3QNXB 2H6UA 4Z0XB 5MERB 2YAOA 3PAYA 2ORBH 2APBA 4G83A 1NCJA 2E76C 4FG6C 2Z4QA 3P30L 3NJHA 1CYWA 5F7FA 2XICA 2K7QA 4XNZC 1YEDA 2QPSA 4M6ML 5KYUA 3RVTC 4L0ZA 1GPOL 1OHQA 1PPIA 1MFCH 1P1ZB 5DJYA 2ZCKL 2H6OA 3QORD 2WLIA 3ZUNC 3F7PC 3UC2A 4LPYA 2XTJD 2X4OB 4HX1A 3GMRA 4MLSA 1T04A 5DK0A 4B0MB 3KPPA 1L7IH 2F7QA 2VZOA 1FZKB 1R24B 1T66D 2FJSA 3PLYA 4NNPL 4JM0A 1OWWA 4GMSH 5BO1L 4FQXC 5BOJA 2XZCL 1FF5A 2D31A 4D7PA 3MRCB 2OQJA 2J71A 2BRRL 4PREA 1OB1B 4UZUA 1FO0B 5TQ0H 2BFVH 1MFEH 2VXTH 1DQQA 4GIAA 3M7FB 2H32A 3KLHD 3P3TA 4MBOA 4PJGA 3N2JA 1E5AA 2YJLA 1XAUA 2XZAH 2XDHA 1A7RH 5IK3A 3LKOB 1FYTA 3N3EA 1FQ9C 4WI9A 1Z9LA 3INUL 4Z7VF 3EF4A 1G7PB 3FJTA 1SOXA 2ITCB 1T1WB 2Y4SA 1C5CL 5B22A 2BIPA 3SGKC 3B43A 2IFFH 3VI3B 3MV9B 2YEVB 3ZMNA 5CIPB 1DLHB 3NMEA 2IAAC 3BPLC 1A4JB 2DIJA 4XVTL 2CO6A 1NDMA 2OPCA 1P53A 1WWWX 2NCEA 1SN5A 4GSDH 3CHXA 4U1JA 3IDMA 2UVFA 3T2QA 4LSUH 1CFSA 3O3DA 3RI5K 1IGML 3RTQC 1BM3L 4NZJA 3DHJA 5E6ID 2H3XC 3MU3A 5ADPH 3ZKXC 3CFNA 4YSCA 2I60L 4MDIA 3MJ9H 4Y4FB 1YEIL 2UZPA 4JG0L 1ZJBA 5DA4A 4JDZA 2R4RH 4MD4A 4BA0A 1N5YH 2QV4A 3BMWA 3D09A 2PKDA 3MRGB 4NRYB 1NJ9B 3WJJA 1TTFA 4ENED 1RIUL 2DQMA 5CN2A 1OE1A 4R84A 4QXWA 4XVJH 2Q5BA 3PPSA 3GRWA 4FRWA 3FN9A 1M3IA 1THAA 2WSPA 4OV6F 4Z77B 2V0AA 5LG1A 4LL1A 1HKLL 3MRKB 4RZCB 1UM4H 2J4WL 2WNWA 5KSBA 1YMMA 3WMSA 5GISL 1S7TB 1YQVH 3GRWL 3G5XB 5KAQF 1GTNA 1CVRA 3R7QA 4FQ2H 1RPUA 1OP4A 4U7MA 4ODUB 5JW4M 4P5RA 1TJHH 2PO6A 3OXSA 3V55A 5HGHA 3RWFB 3QXUA 4A1RA 1KJMA 4GRLD 4N85A 1IVLA 1BD2E 4R0LA 5DMIL 3MNWA 2OL3B 3H3PH 1L5GB 4LNRB 2JH2A 1S7SB 4L4VD 4NQXB 3MRNA 3HR5A 2JVUA 1SY6A 3FB6A 5JLZA 3O8XC 1PZ2A 3QUML 2ALWA