4QRQA

Crystal structure of hla b*0801 in complex with hskkkcdel
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
276
structure length
269
Chain Sequence
b'GSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDARAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-8 alpha chain
publication title An Extensive Antigenic Footprint Underpins Immunodominant TCR Adaptability against a Hypervariable Viral Determinant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 76
structure length 269
sequence length 276
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qrqA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4qrqA01
5C09E 2ZP0T 1BEYL 4JZOB 1R3KB 3BDXA 4HJ0D 2WM0A 1KACB 1KPUA 5F7KC 4N0RA 3T2PA 2XNAB 3T3PE 4MHHG 3RVXC 1ITBB 1ND0B 1S7VA 3W9EA 4FFEX 3TO4C 1CE6B 1C5DA 1WBYB 4OSUL 4NC2B 5C08A 4PJ5A 3PDOA 3W11C 1I8LC 4I2XB 4ELME 1JHLH 2PF6A 2VQTA 2UUDK 1IGTA 2OJZL 2UZYB 3LKRB 5D7JC 5AUMA 4HS8L 3D2UB 3VGBA 5EC1B 4JN2B 3SE8L 3Q3GA 1T03L 1I7RB 2NPLX 1HKLH 3O6LL 4TSAL 5IOPA 4P3WA 1YQVH 3O3AA 3WE6A 3EAKA 5HI3C 2VL4A 5ITFB 2EDWA 4P9HC 4U05A 2MKLC 3DHJA 4HXBL 3BIKA 3QDGA 3N85L 4IRSA 4O00A 4HX1A 2BNRB 3IDNB 3IRPX 5HHQB 3O4OC 3VD7A 3CU1A 1J8KA 4X5WA 5HHNA 1CLYH 4CBPA 5B4MD 3UPCA 4L29B 5FDWB 1CD9B 1R3HA 3Q0HA 3HC0B 3RL2A 2NZ9C 1QR1B 4IHOA 2DQGL 3LKSB 5J9PA 2AGJL 3BP5B 1PKQA 1PBYA 2EC9T 5IVXF 4OGXL 5F7YC 3I9GH 4KGLA 3MV9B 2YD3A 1DBMH 3CZFA 1ZLVK 4M8VA 5DURD 4GAJL 5TF1L 1OY3B 3NABH 4I0PB 1ACYL 3KLHC 4M6MH 4JAMB 1XR9A 4D8PB 2IAMD 1Y18B 2WMPA 2VZUA 2X70A 1FNAA 5TDOB 4LPUA 1UB5B 4HGWA 5F72S 5CSZB 5C07D 1YN6A 5DMKB 4L4TE 4OM1L 2P5WE 1X5YA 4AENB 2UZXB 3V79C 4JRXB 1ZT1A 2AK4D 3P77A 4QHNB 3V6OA 1FVEA 1MCRA 3W9DA 3DHMA 4NSKB 1U95B 3FHQA 3CD4A 1WZ1H 5HHXL 3QEQA 1IKNC 3PV6B 1KCVL 2VH5L 2HFTA 3PWVB 2QKIA 5J6GB 4C4KT 1NCWL 3CDCA 2R0ZL 4PRPB 3VMNA 2LFGA 4OZFB 3OR6B 2ZOLA 3FQWA 1DQMH 3OAUL 3V4UH 5CCKL 4JFFE 4AG4L 1S8DA 3CFCH 3VXQB 1Z5LA 4KK8D 1W8OA 1MY5A 1IGCL 3QDMB 2XY1A 4BZYA 1MJ7L 3D39B 2Z35A 2O93L 5C0DA 3H7BB 1LD9B 3DX7B 4ZUTA 5DWUH 3TA3D 5C9KA 4U2ZA 3PABB 1OLZA 4GXVL 4IMLA 1SY6A 3SE3C 4BZ2H 4FXGA 2ADFH 4ZPTA 3GMMA 4P9ML 4PJFB 1IFHH 1IL1A 2AK1L 3CFKB 4LRIA 4UT9L 2XN9E 4S2SB 1LNUB 1GZPA 3WNNA 2OL3H 1WZLA 3ALXA 4P57A 1K5NB 3DECA 3VGFA 2YPLA 3LRSB 3DYMA 2WINA 1WCBB 4R26H 3RI5K 5I74C 1S78D 1CXEA 1DL7L 1QPXA 3CLFH 1NFIB 4G6JH 4JY4A 3PWNA 3B5GA 3QO0B 3SGEI 4F9LA 3DETC 1V3LA 1I1CA 2R1WB 2G60L 3LEYL 4NO2A 1WV7T 5I1CH 2NY6B 3MLXL 2R56L 3KPMB 1DUYB 1E4JA 1T66D 2B39A 3L7EA 1KJVA 4LCCB 3K81A 1MF2L 1OT1A 5K9KB 3RVTC 5BQ7B 5CJBA 3MV8D 4L1HA 3QIWB 1UQSB 1HDMA 4G8GB 1A4JB 2VISA 5BZWA 3CLEL 5ITBH 1GGIL 2CRZA 5F1IB 1F3DJ 1RZ8B 5JOFB 4JDVA 3V5HA 1FYTE 4GW1B 4JB9H 5C0CE 4LEOA 3N1MC 3MRGB 1RUPH 1ZXQA 1EERB 4JREC 5JUEH 4LLYA 4PB0L 4X4XA 1F00I 4LFHG 1A21A 4P9HH 4U0QB 1JNLL 3ULUD 4X4ZA 1LQVA 2NX5B 4WEUD 4QOKD 2Q86B 3HE6B 5EORL 3SCMD 3WEXA 5IGXL 4OV5B 2FCBA 3D9AH 4KK5C 1OVZA 3V8OA 4FFYH 3V4PH 2IFFL 2HKFH 3X3FL 1BIIA 5KSVA 3T0EA 3P3YA 1LE5A 5GZOC 4S1DD 3TT1L 4YDIH 3GBMH 3UEZA 1NCBH 3NCEB 3U30C 4GKOA 4MJ2A 1HQ4B 5GGTL 3LS4H 3T0BA 4XPFL 4JANA 5EU6E 4HIHB 4HH9A 1LGVA 3P0YL 4C54A 4X7SH 5BV7B 1XGRB 4Z9KB 4R4NC 5C1MB 4PTUB 4ELKA 4PY7B 3WJLC 1BX2A 5TE4H 4EDXB 4JQIH 2EE6A 4YHLH 3PWPD 2ZUYA 4MDJA 3S4SA 5BMFL 1M6OA 1AXSA 5J3HD 2DD8H 3ELAT 3NA9H 1NMCB 4ZTOL 2JELH 4KKBD 4PB9H 2VB5A 3MBEC 4FTVE 2JB5H 3B3IA 1XGYH 3P4NB 4UINL 4LPTA 3LDBB 4NO5A 3B6SA 3JWOL 4OZIF 3P4MA 4JVPA 1EV2E 3PWJA 1FG2B 4HJGA 2A0LC 3MRNB 2PKDA 1OPGH 3O9WA 4MDIB 5DUBA 1A7QL 3TNNA 3TPKA 3SKMB 4KK6C 1NC4D 3MA9H 4GG8A 1A7OH 4K7PY 5DJAB 3BKYL 4ONGL 3DSNA 3L7FA 4R7NA 4P5MA 5F8RC 2X89A 2EDOA 5GXBB 5D7IB 1Z0MA 3MCG1 4WFEE 2FJHB 1F58H 2HT3D 3LKQB 3OG4B 4YZFF 1NAKH 1NMAL 5FM5M 1K3IA 3D1MC 4MJ4A 3ARYA 3AU1B 5CWSA 3VWJB 5J6HA 5E5UB 4M1DH 4XP4L 5F6IC 3IJSB 2FGWH 3MC0A 4J4PA 3O6KL 2PUQT 4LRNL 4PJDE 3KPOB 5CIPB 1NBVL 3U82B 1T2JA 4FQ1L 4J3VA 1MHCA 3AM8C 3VD5A 1NCAH 1U8QB 2V7HA 3UTQB 3UJTL 4XMKL 4NGHL 1MCNA 4BKLB 1GHFH 4MCZA 3OKDB 5L0QB 4RWYL 3RIFF 4JY6B 2CXGA 1KTLB 2LE9A 2AP2A 6FABH 3IFOB 3WJJA 3QB7C 3GSOA 5H94A 5A3ID 5J7CC 3VFNA 3ARGD 3MRHB 3T3PF 1PSKL 1TVHA 2FO4B 4KTDH 4ODSH 1UZ8A 2AXFB 4NHCH 4OF6A 1CVSC 3FT4B 4OQTH 4FXKB 4KKAD 1T4KA 4G9DB 4J23A 5T1DH 2FYYB 4ELMF 5T3XE 5DEFA 4R3SB 3MJ9A 4IEFB 4OZ4A 1VFAB 4TSCL 3FOLA 3LIZH 4HH8A 3C8KB 4MCYA 1HCVA 1JYXA 3V0WH 3BP6B 4GRWB 4QCIB 3L3IA 1UC6A 1MFEL 2VDNL 3KXFE 2WBJA 3DURB 4OZGB 4OKDA 4YDVA 3ARDD 5AZEL 5IHLB 4KK9C 3DXAE 1A6VH 1IAOA 4ZOBA 1JGEB 2P44B 4Z95H 2G2RB 4P0DA 1DEDA 2W9DH 4KI5D 4KQ4H 2Q6WA 3S97C 2VWEE 4YHPB 1MRCL 2EZ0C 5C0BA 2HRPL 3EOAB 4TTDC 3KNBB 2H2SD 2O61A 1KGCD 3MLTA 3VD4A 3UZEA 2WUBL 5E8DL 4ORGA 5HYQA 2C3XA 2N7BA 1OCWH 1IC1A 1PLGH 4XMLH 2ZUSA 2Y6SD 2YN5A 3WIFA 5KOMC 4P2QA 5GJTL 1QSVA 2F19L 3QRGL 1SYVB 2XTJC 3OAYK 1MFAL 4ISVB 2BY3A 1B4JL 3OTTA 4NPYA 2Q7YB 5ISZD 4NWTL 1YJDC 2W65B 1ZHLA 2YPKA 2VRAA 2XKSA 4GAGH 5I8EA 1FDLL 3SDAB 3GI9H 4YNYA 3DYPA 3PHQB 3I3DA 1NEUA 1ORSB 5D1QD 1LK2B 3UP1A 2FX7L 3PIQA 1AR1D 2XPGA 3QXWA 1MHHA 2CH8A 4QXTB 1LEKA 1CGSL 4XXCA 1RJZA 2F5BH 3GB7B 3VRIA 3W0WD 1T1XA 4OUOA 1GYAA 4Y19E 2R4SL 1EHNA 4X9BA 4OZFG 4LPCA 3I6GB 1RUAH 2G5BB 2E8ZA 1T1WA 5IWLA 3TF7C 4DK6A 4EEEA 3FO9B 1FFNB 3FFDA 4BSVA 2ZOKB 4JFDD 5KBNC 4DVBB 1LP9F 4FQQB 1U8PB 3BEVB 3O3BA 1G7IA 3DVGA 1J1OH 1F02I 4N1CA 1AE6H 1FIGL 2VZ1A 2C3WA 1FGVH 4UT7H 3L95A 4PD4J 4DW2H 3GRWH 4G5ZH 3IFNH 5TQ0H 5AG8A 1KIPA 1YEFL 1MI5B 3O6MH 1Q94B 4GKSB 1I7ZB 1GAFL 5BXFB 4K8RH 5IBTH 4LU5L 1IAIH 3OWEA 4NO0A 1BZQK 1K85A 3V0AC 4PYHA 2Y9RT 1XCQB 4APQB 1DP0A 1MLBA 4GMTH 1ZE3C 3CSPA 3LPGA 4E42B 5B8CC 4X8JB 3IJHB 3TNMB 5GRWA 1AP2B 1YEEH 5DK0A 4CDGC 3EZ8A 1FNEB 1BVKB 1TLKA 2E9JA 3ULVL 2B2XH 1MAMH 1TQBB 1GZQB 2NY0C 2VR9A 3M45A 3PGCB 1TXKA 2AJXH 4JFOA 1D9KC 2YA1A 4JO1L 4F3FA 1FNSH 3AB0B 2ED8A 1RZKL 1DEEA 1D3CA 1OP3K 4YBLC 1VGKB 3WUWB 5IVZA 4Z77A 4POYA 1W72H 2RHEA 1C08A 4OZHA 2APFA 4M7ZB 2DLTA 4X4ME 1LK3L 3OKLB 4LIQH 5EU5B 3EOBA 2IAMA 4GW5A 4I5BA 3WV0A 1PFCA 2I9LB 3BSZH 4L8SA 4OJFH 5TPWL 1DBJL 2NXYB 2DLFH 5T33H 4DN3H 3BISA 1BQHA 4NQDE 5HPMB 5BS0D 3AREC 4R96A 5C07A 3L5XH 4XCFL 2J8HA 4Y5VA 3S9DB 2I07B 5C0GA 5C0IB 1SVCP 4MNQD 5ILTL 3HCVA 1WWWX 2HVJA 1P84K 4MAYC 4M8QA 1HNFA 3E8UH 3L3JB 4TTGA 4HWEL 3GSNB 2X1WL 2JJSC 4CU6A 2B7DT 5E99H 5F9JB 5AYQA 1BOGB 3NN8A 1ZOXA 2QSTA 3HR6A 3LEXA 5IB3B 2FECI 4GBXD 5F9OL 1Z9MA 2P8MB 4HK3J 3UXFA 4J3XA 3ARBA 1RHHA 2AEQL 5GIRB 3KLDA 1L4IA 4KJWD 5HGAA 1LVEA 4JQXA 1AO7D 2AEPH 1XH3B 4AIOA 1C12B 1RK1B 1N64H 3WO3B 4U6VH 2DBLH 4ZYKB 1VADA 4N0CD 1NFKA 1BFVL 4I4WA 5GJSL 4XNZB 3V6BR 4Q9RL 3BGMB 3TA3A 4XVJH 4PLOB 4J8RB 5KSAC 4UTBL 3QPQD 3V8CA 1ERNA 2VABA 1KJMA 1EPFA 2J6EL 4OLXL 4HIEB 3OKMB 1I1YB 3GI8H 3RWGA 1CF8L 1M1SA 1XT5A 2R15A 3UC0H 3QUXB 3WFBH 1I4FA 3SO3B 5DA0B 3UBXA 3D2UD 2AJZA 5DO2D 3JBG7 4YQXL 1MFBL 3PHOA 2HA1A 1L0XA 1DVFB 3N9GH 3U4AA 5L88H 3SDDB 3HI5H 3DMMB 2R1YA 32C2A 4K7PX 5TFSH 1I3RB 1KBGL 1C1EL 4ODXB 4EI6B 5C6WH 1S7RB 2QQKL 4X6CE 5D7LD 4UQ3B 3DX6A 5D2LA 5E2VH 3X11A 1VGEL 1CDGA 4XNMB 2O5ZL 3MV8A 5FO7A 1JHKH 3X17A 4YBHA 4ENED 5I19H 3OXSB 1CE1L 4Z78B 2UYLA 4U1JB 2AEWA 2GKIA 3MZGB 1P5VA 2YRLA 1JYWA 3MV9D 2FWOA 4FABH 1BHGA 2R0WL 3UO1H 5IJKC 3GSQA 1IGYA 1F6LL 3QUYB 1GGBH 4XP5H 5EPMA 3W81A 3G6JB 3RIAF 5IW1A 1AGFB 4CJ1A 4YC2B 2NW3B 4QOKA 3UTPD 4JPIB 3E2HA 3PG2A 4HULB 1SBBA 4ZXBB 4EQ2A 4JJHA 4LQFL 4A6YA 2PNDA 1A2YB 4JFYA 1JI2A 3V6OC 5LAXB 2UWEE 4JRXD 2FSEA 2B8OT 1J1PH 3LD8C 1A3QA 2F5AL 5GGQL 4WI8A 4X6BB 1KELH 4TUKH 4ZD3L 3MJ6A 3T04D 2AXJA 5CEXA 3UPRA 3F7QA 4AEHL 4ETQB 2CLVB 5F3BB 2YD2A 1TZGL 1YNKH 3P9LB 3MXVH 3G6AB 4PJDF 1FORL 4P3CL 5F7DB 5D6DA 1TVDA 4DGVH 1PX3A 4NO3A 4C56E 1Q38A 5I16B 4RMVA 4WHTA 1OL0A 3TJEL 2JJVA 3PWPA 3K7UA 1RJLB 4UNTA 5F89A 2VN7A 3QDMD 4PV8A 3D39D 1PZ5B 4W6WB 3P30L 4LLVA 4IDLA 3ETBF 5IQ9A 1FLRL 5IFAL 1BQUA 1MFCH 4KVCL 3TCLA 1G7LB 2ERJC 2XRAL 1MCJA 2DTML 4H1LB 1HILA 3NH7L 3U9UB 4NJAH 3WNOA 5C9JA 4QXGH 4RBPH 3OB0K 4WFFE 5SWZE 2V2WA 4D9RE 2CKBH 2EYSB 4P4KC 4M3JA 4O9HH 5KANI 2BSTB 2AJSL 5J1AA 2UZIH 3QULB 2HLAB 3OAZK 2RJMA 2VAAB 5EWIH 3O8XB 2O5XH 1A0QH 3FFCD 3WIIL 1XF4A 5KVFH 2DMBA 3D25B 1W8NA 4FP8L 1NC4A 4F9LC 5L9DH 4UAOC 1HHHB 4GS7B 4KKCC 5CD5D 1JGDB 2Z8RA 5I1DB 1IM3A 3SKOA 4QY8B 1CL7L 3QQ3A 3H9HB 4LKXB 3U46B 1P2CA 4BQ8A 2D7TH 4WUUB 3S3JA 1U3HB 2NY6D 3AS3A 3NFPA 2BVTA 3CIQA 1RIUL 2IANB 3O2VL 3IU3A 4RFNB 3MREA 4TOYH 1BGXL 3QIWD 4MHHI 1KCUH 4LPWA 2VZVA 3HUJE 1T83A 4G8GD 4O4YH 3S36X 5D7SL 1BECA 2ICEA 3ULVD 5HVHC 4NJ9L 3V6FB 1J0YA 5HDQH 5IEHB 3O3DA 5F7EH 3X13A 1MEXL 1XGQA 3Q5TA 1LDSA 4QTHA 5GGSA 1MJ8H 1NCTA 4BSWA 3C5ZB 1QBML 3K3QA 1AC6A 1RZJL 1LO2L 2CMRL 1MH5A 4FQCH 1CYGA 1H9VA 4KJYB 4LASH 4UV7L 2NX5D 2VXTL 4M6NL 2V5TA 1EEZB 3M1BB 4LSQH 3VE0B 1YEIH 3NCMA 1DDHB 3HMWH 4OIBA 2NW2B 3S96B 5JLZB 5CZXC 3T0EC 1DQDL 2A74B 2VLKE 3LQAL 1VEMA 3H3KA 1U91A 3HRZB 1K2DA 3LQMA 5EO0A 4ODVH 3PXHA 2W07A 3AUVA 3ARDA 4X99A 5DUML 4MA3B 4XAKE 3DUSB 3NZ8A 3QNZA 3MUHL 5DJCA 5HXMA 2A73A 1XCTA 1CFVH 1ZSDB 3Q6GL 3WUWG 1IAII 4AH2B 3DUUA 1EZVY 1Z3GL 4MWFB 3GSNL 2JJUA 1QSFB 3N1PC 4X9HA 4OGYH 4OLUL 3VG9C 5ADPH 4U6HA 1UJ3C 3DV6B 2JIXD 2Y7QB 3UJJH 5JQ6H 4I77L 4PJBE 1RZFL 5ISZA 3MUGB 5I1LB 4F7EA 1KPVA 3WFDH 4TPRH 3EYSH 4J6RL 2Z4QA 3VFPA 4JR9H 3UDWA 1MQKH 2E7LA 4XP6L 1HQRB 1SJHB 2NY3C 4PG2A 3W0WA 3KPSB 2J8UB 5KS9B 3HTLX 4C55A 4R2GC 1AFVL 1YQ2A 4Y5YC 2JCCA 1S9WA 1PD6A 1QOKA 4PGZA 2VUOA 3VCLB 1X9QA 2X4OB 5IP4A 5FGRA 4JFDA 2BRRH 4ZUVB 5JA8B 2DLGA 5IB4A 5E6IB 1NFDA 4K7PH 5I8KL 5BO1L 4PR5B 2DWDA 2P8PB 3T2NH 5E70A 3SDXA 2D7OA 2RCSH 5DTFB 1ZHKB 1IQWL 1MCBA 4YWGH 4W68A 4XAWL 1JV5B 1JGUH 1F97A 5KZCB 5CEZE 2Z93B 3PWLA 4J4PC 3U9PH 5I1JH 1JZ8A 2KL6A 4OF7A 5LJYH 3LKPB 3ES6A 3QQ9C 4LSPL 3EO9H 5E00A 5FGSA 5JXED 2P5ED 1A6ZB 1I3GL 3RVWD 4EJ1C 1RZ7H 3WJJC 4JZJC 1A1NA 3FQRA 5DQJA 3GMLB 3S6CA 1PZUB 5C8JB 2AEIT 4ONFL 3QO1A 5C0EB 1MCDA 2AAVA 1DQJA 4D94A 1OTTC 2FIKA 1MWAH 3FCTA 4WWKB 4PRAB 2AI0H 2QHRH 4IBLT 2PXYA 3I75B 3MLUL 3AGVA 1YN7B 3DRTA 3QA3A 1M7DA 4KHXH 1U8NB 4OFVA 5FYKE 1LMKA 5EUKB 5BVJA 4Z8FL 2EH7H 1CT8B 4O58L 5MI0B 2ADJB 3BDBA 1ZVYA 2WBJC 3BHBA 2LV4A 4XHJD 1I1FA 4NC0B 1QSEB 1F90L 2VLRB 4B41A 1U8MA 1YY8B 3IXTB 1IAKA 4OV6F 2VIRB 5GGTA 1JFQH 5BS0A 4HUWA 5ACMA 4YAQB 3Q6FA 1I3UA 3ARWA 3CK0H 2GSGA 3IKCA 4MNQA 3CMGA 2ADGA 4X6CF 4G9FE 5FKAB 2J4WH 4QXUH 1A22B 3CZJA 3VXNB 4HWNA 4JO4H 1OTSC 4E41D 5BV7H 4PJGF 4NKMB 4D0DB 2EIDA 1N59B 4OD2B 3S35X 1LO5B 4KDWA 4WV1C 1YMHA 4ZPVB 4MS8D 2HAZA 2EXYC 2YBRA 3UTTA 4PRBA 5C7XL 1WGOA 4QGYA 3VMOA 5GHWH 4H8WL 2DQCH 4GBXA 3MCLL 3GMOB 4I0KA 3SE4A 5LQBL 4PJEE 3SDAD 3B8SA 3P4OA 4JRYD 3B5HA 1T1YB 1F4WH 4XXCC 3PDDA 5E8PA 4MB5A 3ARFB 4XPAH 2A6IA 1AO7A 2CLRA 1CU4H 3PQYB 1I9RL 4HJ0C 5D9SB 4JHWL 2E27H 4E9LA 1YDPA 2WAHA 3IXAB 4JZOA 1R3KA 3CVHB 5LBSL 5D71L 5IWLC 3VXOB 1H8SA 4IS6B 1YEGL 2UWEF 4U4BA 4P2RE 1RVFH 1MRFL 6CGTA 1CE6A 3GIZL 1A1MB 1WBYA 4ZAKB 5IMMB 2ARJB 1TPXC 4I2XA 5HY9B 3IAGC 2AJ3B 3VWKB 2FH8A 3LKRA 4PD4K 1PYWB 3UTZB 1NLBL 1TJIL 4X6EB 3UYRH 3D2UA 5EC1A 4JN2A 4W81A 2VDRL 4HBCL 5BCAA 1I7RA 4NUGH 1V3JA 4H1LG 1UM5L 3GSRB 3EFDL 4PY8J 4BZ1H 4Q9QL 4O51B 1N2RA 1FZMB 5C0FB 3O6FD 3S36H 5ITFA 5KTEH 1TJGL 4U1HA 4APQD 1YMME 5DC0A 4HMDA 1FN4B 1V5JA 4R90L 4XMPL 3O11A 3FJTA 4X0KB 4U1IB 5D7LA 3DARA 5HHQA 2BNRA 3IDNA 5I71B 1D7FA 5CIPH 1DLHB 2MFNA 5B4MC 3NAAL 3ILPB 4PGCB 1EGJH 5DT1H 2AERT 5IHUH 1KENL 1X5AA 4U7SA 3ISWA 2E7CA 12E8L 2NZIA 3HC0A 5IVXB 1QR1A 5JW4M 3BP5A 4DUWA 3I84A 1HZHL 1Q72L 3MV9A 3X12A 1NKRA 2EDTA 5MHSD 2IAMC 4L8SC 2R0KL 4I0PA 3TBVB 1JHTB 4D8PA 4JAMA 2YMXH 2HKHL 1OAUH 4JVUA 4F80A 3U36B 4GT7A 3MNWA 1Y18A 1FH5H 2NXYD 4GRWH 1HXYB 5TDOA 1UB5A 1OT2A 3VFWB 4S1RH 4WU5A 1ODAA 2NTFB 4LBEA 5DMKA 2Q8AH 4OF8A 4YGVB 2Y1VA 5JXAL 4AENA 2QADB 2JKXA 4JRXA 3WSQL 1OP5K 1XZ0B 3PHSA 3G5ZB 2R2EB 3LB6D 1JGVL 4KQ3H 5IMKA 4X4YA 3WKMH 3VXSB 2HJLB 4NSKA 1T22B 3NACH 5E5MB 5I18L 3HUJF 2FIRT 1G6VK 5A16B 3PV6A 3PWVA 5J6GA 4Y4HD 4PRPA 4PUBH 3QEHB 5GRVK 4NZUH 2XG4A 3OR6A 4OZFA 5DD5H 2VDPH 5CJOL 4KK8C 3R8QA 4JQXC 3VXQA 4I3SL 4UDTA 3LRHA 3FQNB 4AL8H 5T3ZH 2ENYA 2MQ0A 3H42H 3CPLB 3BPLC 2IJ0C 3QDMA 3RHWK 4EOWL 1QYGH 2IPUK 1EX0A 3CVIH 1ZLSL 3D39A 1S9VB 3TA3C 4EN3D 3TWCH 3H7BA 1T80A 1LD9A 1HEZA 5K9JH 3DX7A 1EHLL 2XTJE 4XBEL 3PABA 3B2VL 4CU8A 4L3CB 3PGFH 4JG1L 3JV6B 1ZAGA 1EUUA 4L3EB 1S7TA 4FZEL 4UIKH 4PJFA 3K4DA 4X7TB 4XWOD 3CFKA 3QDAA 3QUXD 3VXMB 1KIRB 3QCTL 4S2SA 3TLRA 1LNUA 4KUZL 5E4EB 5A43C 1K5NA 4RMTA 1N5YL 3LRSA 4CAGA 1S7WB 1WCBA 3RDTB 5HHPB 3FFCA 1ONQB 2HWZL 1OSZB 5IESL 4WW1B 3IFLH 1J0JA 1NFIA 1J7VR 5FUZL 3SDDD 3DMMD 1V3MA 3ARUA 3EJJX 4KUCF 3QO0A 2R1WA 1T66C 5CSGA 2EIEA 3QIUB 3V95A 3NCFB 1YYLH 2BHYA 1DUYA 1S9XB 3HAEB 3KPMA 1MAJA 5I1KH 5AZ2H 3QJHB 1MAKA 4LCCA 1KOAA 4P59H 5K9KA 2D7NA 5HGBB 3K2UL 4M6OH 2QTEA 1WAAE 1OGTB 4OLZL 3QIWA 4PJBF 3MJ7B 1UQSA 4WGVB 3SBWA 4G8GA 1A4JA 1FO0B 1R24B 3H8NA 1MIMH 3KG5A 4OCWH 2EDFA 1RZ8A 4NYLB 5JOFA 3F8UB 3D6GA 5DD0H 1QFUH 1MCOL 3G04B 4JHZA 5E2TL 4NN7C 1UB6B 2CLZB 4MA1C 3NCCB 1YEJL 3KPTA 3QUYD 5IJVB 3VMPA 5B3NA 4ZO9A 1MHEB 1UH2A 3SCMC 5FYJH 2ZCKL 25C8H 4DAGL 2NX5A 2Q86A 1JPGB 3RWJA 4OV5A 4S1DC 5A2LH 4GOSA 3STLB 1A9BB 3CDGB 1VB9A 2H9GB 2B1AH 1ORQB 5JW4N 5HYJB 1FFRA 1FCGA 1BM3H 4X80H 3BH9B 2OR9L 4WNQB 1IC4L 1G1YA 1JZ3A 1AD9A 3EJYD 3I50L 4D9QE 3S35H 4TULH 3EZJB 5D6DC 1EFXD 3QDJE 4K94H 3WDIA 4FQ2H 2BVEA 2LAAA 4WTZG 3WXWL 3NGBC 3LZFL 1XGRA 1KXQE 4EXPX 4PTUA 4ZS7H 1CICC 4HWBH 1ZGLM 1INDL 1MELA 3KJ6H 4EDXA 4TSBH 3OPZH 2Z9TA 5C70A 1N26A 1ADQL 4K07A 2H26B 2PW1B 3K0WA 5JA9A 4KKBC 4XH2B 5DHYB 3PWUA 3VGAC 3THML 5FV1L 5DFVD 4WI4A 3MFGB 4IOSD 1P7QB 3P4NA 4N90D 1A6UH 4OZIB 3WXVH 1OAQL 1GH7A 2J6EA 1RQ5A 1II4E 3OKYA 4YUEH 1FG2A 2GK2A 5EBMB 1CGTA 3MRNA 1XF3B 3WO4B 4RAVB 4UT6H 5GRJH 3O8XD 3DO3A 1RFDL 1P7KB 1CFNB 3NFNA 3SKMA 2MSPA 3ZLQC 1I1AD 3FONB 3QUKB 5D1XC 2DQFB 1IJ9A 5FEBA 3MLYH 5EN2B 2YD8A 1A5FH 5D7IA 1JFMA 2X40A 3DGGB 3Q48A 4WUUD 5F7UA 2HT3C 1U3HD 3SKNB 5IQ7H 2GT9B 4KZDH 2FJHA 2IAND 3LKQA 2CJUL 1T83C 2VLMD 4OF0A 5FUOH 2MCPL 3VFGH 4ZFGL 4JPVL 1RAMA 3MLRL 5D93B 3TPUE 3GMPA 3S34L 1BMGA 4XCNB 4PJEF 3VWJA 2HFGL 1BVLB 3EDJA 3MRJB 1RUQL 3IJSA 4N8VB 5L2KE 2NY1B 1FYHB 5JXEA 4YHKL 1U8QA 5C09B 3UTQA 4KVNL 5A3IC 3OKDA 2DIJA 3ARGC 1S5IH 4JY6A 1KTLA 1MFDL 1QVOB 3I3BA 1ZT7A 4YR6B 2ZUQB 3QJFB 43C9B 3C9NB 4KKAC 4Y1AE 3MRHA 2EDBA 3C5JB 2OI9C 4F33B 2FO4A 2AXFA 3FT4A 4FXKA 3D85B 3M8OH 4ELMB 4G9DA 4MQSB 2QSCH 4RAHA 1A3LL 2DYPB 1FJ1A 2DQIL 1VFAA 5DC4B 5CKGA 4O2CB 3C8KA 2A77L 3ARDC 4QCIA 5C2BH 4Z7WE 4OZGA 4K3HA 3OJDB 4Q6IB 5EG6C 4MXWH 4C58B 4P46B 5DQDH 1JGEA 2G2RA 1EH9A 3SDYL 2X42A 4UILL 4YHPA 2H2SC 4K3GA 1NCUA 3FMGL 2X10A 3EOAA 5DI8B 3MRCB 3KNBA 1NL0H 4XB7A 1QEWB 1MIEL 3V6OE 2Q8BH 3EIFA 1IVLA 1QSFD 4WIQA 5L8KB 5EA0H 5EO9A 4YX2H 4N0YH 1FNHA 2BVOB 4PS4H 1VFUA 3W2DL 3ZSSA 4MS8A 1RURL 1QKZL 3FB5A 4D3CH 4WI5A 4ISVA 5DUPH 2NY2B 5EZJB 1ZLUH 5EIIB 2Q7YA 3HZMA 1HHIB 2W65A 3F6LA 3UDWC 2E7LC 4QF1B 5D1QC 1AR1C 1V05A 3SDAA 2FB4L 4PG2C 4YHNB 4H1LH 3PHQA 1E6OL 1ORSA 1TTGA 1LK2A 2FHBA 3QI9B 4RGMB 4WW2C 3WS6A 4QXTA 4DUVA 2WWKT 1KIQB 3GB7A 3HLAB 3KPSD 1NGQH 1VA9A 5DJDB 1E4WL 4XCYB 4L4TB 4MJID 2P5WB 4CVXA 2A1WL 1WC7B 4M4PA 3MLZH 3I6GA 4K3EL 2G5BA 2DDQH 3FO2A 3KJ4C 3GJFK 4JGUA 4XXDB 3FO9A 2HT2D 3BWAB 1X4YA 1LP9B 2ZOKA 2Y07H 4BH8B 3DI2B 2RQ8A 4BFIB 1XGPB 4DVBA 1NBYB 4FQQA 1U8PA 3BEVA 4DTGL 3NZHH 3WNLA 5E6ID 2I5YL 2YPLE 3RFZC 4ALAL 5ALCH 4LMQE 4RISH 4KMQA 5DYOB 3F7YA 1AQKH 1Q94A 4GKSA 1I7ZA 2DQUH 4ONHB 2LU4A 3WD5H 3B9AA 3N1FC 5BXFA 5KZCD 3SO5A 3HI6L 5DJZB 2CGRH 1KN4L 1FP5A 2ATPB 4P23B 4APQA 1XCQA 4KROD 1ES0B 5DDHB 2D31B 3R06B 1AC0A 3LOWA 4V1DD 4E42A 4X8JA 2DLEA 3L3HB 3IJHA 3TNMA 1C5CH 1AP2A 3FN0L 4JPWL 4S1QH 5I15H 1FO0L 3AC0A 1YNTB 1U2CA 2FR4B 1KLFA 1M71A 1FNEA 2BHUA 5J13B 3N85H 1BVKA 1CK0L 2VZSA 4JM2C 1GZQA 3PGCA 2IQ9L 4NHUB 1BBJA 1JPSH 2XWJB 1EFQA 3CMOH 4L4VD 1D5IL 4M7JH 2XN9B 1GPOL 2EO1A 3G08B 3HMXH 3WUWA 3HAEG 4EVNB 1X5FA 3I6LE 4XCCL 1MJUL 1QSED 5EU5A 3SY0B 2I9LA 1QP1A 5I17A 3VA2C 5HPMA 3WFEH 3JVGC 2HTLD 1BFOB 3K4AA 1G9NL 2I07A 5C0IA 4BYHA 1I9JH 2BY1A 5DGQA 2F54D 4PBWD 3P0GB 3ME0A 4YXKH 3L3JA 4I3GA 3VJ6B 1WAAF 3GSNA 1G6RL 3P2TA 2OJEB 3TT3L 3HR5B 5F9JA 4Q74A 5E8EB 1N6QL 1FYTB 4GBXC 4N9GB 3IVKA 3I6KB 4I18A 4V2CB 5CP3H 3LKOA 2VITB 4Y4HA 3SE4C 2FD6H 4J3SA 4HWBA 2P8MA 3DSFH 1JMXA 4XPBH 1F3RB 4KJWC 3T2QA 1UYWL 4JFZH 1CXLA 1SJXA 5GIRA 4JY5H 5CUSL 4F57H 4KTEH 5BW7A 2GTWB 1IAIM 4Z18A 3IAPA 1J88A 4F9PC 4N0CC 4CVZB 2X4UB 3PQYD 1WIUA 5EOQL 3RUGE 1C12A 1RK1A 2PN5A 1GJIA 1IZJA 4Q2ZA 4L9LA 4OCXH 3L3GA 3P73B 3QPQC 4O02H 3BGMA 4FMFA 4J8RA 1IGIH 2BVYA 2FDBP 1H3PL 4HIEA 3GSVB 4XB8A 4ZAKD 1FPTH 1TNNA 3QUXA 4DQOH 1QBBA 5JW4R 1ZKAA 3TJHA 5C2UB 1PW3A 2R1XB 4GXVH 3VWKD 3MBXH 4H88H 5DO2C 5EU6B 4LDLB 5DHXB 3QPXL 4WFHE 1EIBA 1KCRL 5DJYB 4JFPB 3ZL4L 4QRPD 3V7MA 4OM0H 2DQHL 1MUJB 3SDDA 3DMMA 3KYKL 1TVBA 1GVIA 3ZE1E 4LKCB 1BZ9B 5HYFA 5KSBF 1I3RA 3WUZA 3GUTB 4ODXA 1RIHL 4EI6A 1J87A 1S7RA 1JI1A 4UQ3A 5FKPB 1RK0B 1MLCB 1OAKH 4XNMA 5IMOA 4ENEC 3GBNH 1L7TH 4FTVB 3QH3A 5ALBL 3FL7A 5FYLL 3HRPA 2GJ6E 4WJ5B 5B39B 3QXDB 4U1JA 2WIIA 2FL5B 3UTSD 1IKFL 1TQCB 1D5ZA 4H25B 2P24A 4N5UA 1UZ6E 4X9IA 3QUYA 3CFIC 5IFHL 3G6JA 3HC4H 3QEUB 1AGFA 4KRMB 2NW3A 3AFLA 3EOTL 4XX1G 4Z76B 4JPIA 4KPHH 3STBA 3BQUB 4G7VH 5DRXB 4NQED 5AYUL 4N8VG 4QWWC 2X7LB 3B9VA 1NUFA 1J1XL 3HNTL 3SPVB 3ALPA 1A2YA 1HYRC 3A6OA 3BE1L 5I8OL 2VO5A 5H35B 2QADD 3TV3H 1MCKA 2UUDH 1KJ3L 3BDYH 4LP5A 2P43B 5DJ2B 5SV3A 2A9NL 2A6KB 5LGJB 4X6BA 3P9MA 2R29H 2X1XR 1RJCA 5ICXB 4ETQA 3DYOA 5K9QG 2CLVA 5F3BA 4PJDB 1EFXA 1FC2D 1F4YH 4DWHA 3G6AA 1R3IL 4LLUB 5T3ZE 5F7DA 4GSDH 3RZWA 1S7XB 4WO4B 2WUCL 1RZGB 2PO6D 2NY4D 1EBAA 1IBGL 1HXMA 5KVEL 3LQZB 5I16A 5GRUL 3MACH 1PY4A 2CK2A 4PJHA 2HFFB 3QIBB 4TVPE 1RU9L 1G7LA 1MQ8A 3C6LC 5F9WB 4UUJB 1I3VA 1I8KB 4UNVA 2B4CH 3U9UA 1YC8A 4JKPL 3GK8L 5DF0A 4ZG1A 2EYSA 1MPAH 1G9MH 2BSTA 3VXMD 4Z7WF 3DXAB 4ODHL 3QULA 1MSPA 5FGBA 2HLAA 3P9WB 2APVA 1LE9B 4PJXE 1GL4B 3VXUE 2VAAA 3U0WH 3O8XA 3BKCH 5FB8A 2R9HD 4BUHA 2D0GA 3D25A 4AIXA 4MMZC 2W9EL 3MV7D 1LEIB 1HHHA 4FHBD 4IJ3C 1JGDA 3UTOA 1J0IA 4XNYH 3BIAX 4WI3A 5I1DA 4QY8A 2NY6C 3V52H 1D6VH 3H9HA 3K1KC 4LKXA 4HKBB 3QIUD 3QUZD 3U46A 4NM8L 4WUUA 1U3HA 4LCCC 4D2NA 3B9KB 3EYFB 4QTIH 2CO6B 5IB5B 4HPYL 2IANA 3QIWC 3SBWC 4ONGH 5F9AC 1S7QB 2GFBB 2V2TA 3UYOD 4HKJA 2CDEB 5CD3B 3ULVC 5EDXA 2DQTH 3IDUA 4JG0L 2X1QA 4M9OA 3QCUL 4U1KA 3V6FA 2DQJL 4Y4FC 1RZKC 1SJVA 3R8BB 4HIXH 1WZKA 2ZPKH 1LDPH 2P1YA 4HT1H 1G7MB 5FYJE 4JCMA 3KYOB 2WY3A 3CXDH 1AI1H 4Y19B 4M7LL 1FGNH 4BH7A 5E08L 3GM0A 4ZFOB 4KJYA 3O6KH 4LRNH 4Y4KC 2ORBL 1EEZA 1URLA 3VE0A 1BVZA 1I8IB 4LARH 5ICYB 1A7NL 3MRKA 3RAJH 1FSKB 1MHPL 5ACZB 1DDHA 5F6HJ 3S96A 1NCDH 2NW2A 3VXRE 5JLZA 2D03L 1JPST 1FLTX 2CXKA 1T89A 4IDJL 2A74A 1NAMB 3F58L 4NCC2 2FX8L 2BDNL 3V6ZB 4TNWF 1JTPA 2WLYA 5ESAB 4PJIB 5SX5K 4LK4A 2G75A 3ROLB 2IF7A 1QSZA 4WEBH 2C26A 5IMLB 1VKXB 1E4XH 3WN5B 2VMFA 4MA3A 3WLBB 3CAFA 3BFOA 3DUSA 5C07E 1CDBA 3O45B 4DGIH 3TYGH 1ZSDA 5D5ME 1T7VA 4AH2A 4U6TA 2AK4E 2QBWA 1UKTA 3CH1B 3CGTA 4MWFA 2D0HA 5I66A 4ZTPH 1INEH 1MCWM 1QSFA 5DJ0B 4NN6C 4WCYH 4TRPH 1UVQB 4M00A 3DV6A 2Y7QA 1DLFL 1N7MH 3WCYA 2E5EA 3HC3L 2RFXB 3MUGA 5I1LA 4Z0XB 2W1NA 4CRPA 1K6QL 4G7YH 2VL5B 4MZ3A 3QSKB 1J8HE 4MQTB 1CFQB 4XVSL 1M7IB 3GO1L 3U7WL 1IAMA 5FDYA 5L6YH 2VZ3A 1HQRA 1SJHA 3RWFB 3V2AR 1D5XB 2Y5TB 5INDB 5EOCH 1GRWA 4NQDB 3KPSA 2J8UA 4HXAL 1FDLH 2GJJA 2XG5A 1QFPA 4MJIA 2VTFA 4MNHB 4LSRH 2ZJSL 5KVMC 2DF3A 3VCLA 2X4OA 2W0FB 3VDBA 3V0VB 3SN6N 4ZUVA 4B7LA 4Y16B 4K7FB 5E6IA 3W39B 4JRWA 4PR5A 2NY7L 4P2YA 2P8PA 5I0DA 1JPTL 5F1SA 4KRPD 1ZHKA 5DTFA 3MXWH 3ESUF 1JV5A 5FF6B 2LTQC 3PL6B 3WIHL 2BCKB 5JPMB 2XZCL 1AQDB 5FYLD 4J7RA 2VC2L 3RBSA 3WNKA 2DQEL 5JXEC 1RHFA 2ATKB 3FB7B 3DO7B 1RULL 3RVWC 4V1DA 5D2LE 2PTVA 5L0QC 3RUGF 3GNML 1YYML 1MCPL 1P4LB 3NBNA 2AABL 3GMLA 5LCVH 1WTGT 5C8JA 5C0EA 1P1ZB 3RGHA 1BZ7B 3H3PL 3ROOB 4PRAA 3WFCH 4LSUH 3QNXA 4WI9A 3I75A 1YN7A 4RRPG 5I1IH 1U8NA 1NGXB 1XIWB 3D85D 4EI5D 1TFHA 1IE5A 5EBGA 2DYPD 5EUKA 4WTZA 2VE6B 4XHJC 1CT8A 3INUL 4BFGA 2ADJA 4K9EL 2OP4H 3RU8H 3GSWB 1NCCL 3MUJA 4JO3L 4URTB 1QSEA 4LLMB 2VLRA 3G5VB 1YY8A 1AHWB 5IIEB 4OLWL 3IXTA 4P46D 2X05A 3S3SA 4U6YA 1N3NB 3RTQB 3W82A 5DD1L 4KZEH 5LG1A 1ZK9A 3K74B 4OD3L 1CD8A 2GSIB 4X6CB 5FKAA 5E9DE 4PJGB 5TGBB 3QWQB 4U31A 4DKFL 2F54A 5DLML 4NKMA 4D0DA 5I73B 1BJ1J 1UM6H 5J4MA 1N59A 4MS8C 4ZUSB 2VXQL 1EHXA 1RIVH 5T5FH 1G84A 4RAUB 2XKNB 4NKIH 1ADQA 1WLHA 3SGDH 1ACZA 4EZMA 2RGSA 4FQJH 2NY2D 1AIFB 1JWMB 3F5WA 1ZA3B 3SDAC 5BOPA 1LQSR 2IALB 3GMOA 3MJGX 1QLEL 2DMKA 4LGSB 1FRGL 3CSBA 1B2WH 1UZ6F 4JO2L 3WFHA 2YRPA 1QBLL 1T1YA 5C0AB 5TE6L 3VDCA 3G6DL 3ARFA 5F9OH 1H3GA 3PQYA 1U2HA 2F74B 4NRZB 5E5RB 4R7DA 4MAUL 3BH8A 5D9SA 3T0DA 1KC5L 1Q0YL 5T3XL 2KQMA 5CJQH 2P5WD 3CVHA 3CX2A 2J5LC 4M7KL 3VXOA 2UWEB 4IS6A 1T0MB 4N0UE 4PJCE 1NMBH 4XZUB 4NZRL 1A1MA 2PYED 4ZAKA 5F96H 5IMMA 2ARJA 2OXHA 4F58H 5FK9B 2VDLH 2AJ3A 3LV3B 4JPKH 3VWKA 4HLZH 1PYWA 3UTZA 1BLNB 4X6EA 3PP3K 5CP7B 1HH6A 4JDTL 2Z8VC 4NNYA 5HHMD 3GSRA 3N06B 2E9IA 3O6FC 4QRPA 4APQC 4O51A 4C56B 1FZMA 5C0FA 2GAZA 4GMSL 4P23D 3WNPA 1K3ZA 1FN4A 4QRSB 3KPRB 2D3VA 4X0KA 4U1IA 3BKJH 1JNHA 3H0TB 5EC2B 3D5OF 3MQIA 5E2WH 1DLHA 1RZJC 4XP9H 5D6CB 3HB3D 3E6FB 3ILPA 3X3GL 2B1HL 1NGPH 3LMJH 3K8MA 3OAYH 2OL3B 4G6KH 5SWZB 1AD0B 3F7VB 2X6MA 3HNSH 4S0SD 5IVXA 5T1KD 4H20H 5F7HA 2XN9D 1NEZB 5E2UL 1ZGLB 1DUZA 4M7ZC 3JWNC 3TM6A 5LGHL 4I13B 3T8XB 1MNUL 4PJXF 1EO7A 1RV6X 2AJUL 4L5FL 3TBVA 3T77B 1J5OH 2NXYC 1JHTA 1BP3B 3EO1B 4JN1L 3U36A 2W59A 3B4NA 3BP4B 1HXYA 3D0LB 4OI7A 2RIKA 1OHQA 1J0KA 1X44A 3MLWL 3IU4L 3C8HA 2D7QA 2NTFA 1NAML 1GC1L 1OGAE 4LP4A 4GQ9H 3EHBD 3LB6C 4XGZB 5EH1A 1XZ0A 3NFSL 5HGHB 3G5ZA 2R2EA 5JORB 5A2JH 3HUJB 2HJLA 1T22A 5KVGH 5E5MA 2BX5A 4I18C 4DGYH 2YC1A 4W70A 3HG1E 5A16A 3RWEB 4Y4HC 3OF6D 1FYTD 1QRKA 1TJHL 4FRWA 1BBDH 1Z9SA 2ZNWA 1JBJA 4HAGA 4ODWB 3RGVB 3QEHA 5DHVH 5I9QB 5J8OA 5IG7B 2P7TB 1KGCE 3MODL 5BW7C 5FOBB 1FAIL 3O4OB 1L6XA 3FQNA 4MD5B 5TH2A 4EN3C 4RFOL 2FH6A 4L9LC 5JIHA 3IDXL 3I85A 2CDFA 1S9VA 5EZOH 1YA5A 1X5HA 1V8HA 4G6FB 2CPCA 4L3CA 3J7HA 1R5WA 3C2AH 4HAFA 3JV6A 4U1GC 4XWOC 1OP3H 4HK0B 1JGLH 3QUXC 4XPTL 1ZANL 3DX9B 4MVBD 5IB1B 2E7LE 3EUUA 3SO3C 5IFAH 1FLRH 1RMFH 4X7TA 2ZKHL 3VXMA 3BD4A 2BVUA 2AKRB 5J1SC 4XRCB 5HYSB 5EU6D 4M62L 1P4BH 3L1OH 1S7WA 4R97C 3RDTA 2XZAH 5HHPA 4WENB 2JCCE 1OSZA 4WW1A 5D5MF 5IW3A 2AJVH 1JZ4A 2CK0H 5C86A 2R23B 2HJKB 2I60L 4JFDE 1OAZL 3QIUA 3QUZA 2BNUB 5DVMA 4OCRL 3QHFH 4D9LH 1JL8A 3HAEA 1S9XA 1JJUA 3QJHA 2MCG1 1V7NL 4PJBB 4M48H 5HGBA 2GEEA 1OGTA 3MJ7A 4FTVD 1FO0A 2ESVB 4EUPA 1R24A 3QFDB 5T1MA 2H8PB 3UAJD 4OTXH 4NYLA 1NKOA 3NCJH 2WIMA 3G04A 4NIKB 4W4OC 4WY7H 2HN7B 5GGRY 5C3TA 5F93C 2X4PA 1UB6A 4JDZB 4B5EA 2VNCA 4AT6A 4TUJA 4AM0B 2HJFB 5IJVA 1JHLL 3SKUD 1MHEA 3SQOH 1E27B 3QHTC 3RVUD 4XNUL 1JPGA 3QDGD 4CADB 1PDKA 3BQUD 7CGTA 1LO2H 1YQVL 2GHWB 4WFED 5D70H 5TDPB 1IC5H 1GOFA 3S3PA 3STLA 2J1KA 3CDGA 3NPSB 2H9GA 3A6CH 4ETYA 1ORQA 4YHYC 5D72H 2EXWD 1KULA 3EJYC 1UWEL 4FG6D 3BH9A 5GS0H 4WNQA 3U1SH 1G7JA 4OUUB 4PBVC 3FKUS 4CN1A 1L0YA 1UXWB 1CLYL 1JP5A 3Q1SH 5BS0E 4H8WC 5FCUH 4WUKH 4WWID 4WO4D 1C8PA 5D2LF 1KV3A 3IAQA 2IADB 3RZCD 4MLIA 3I9GL 1A3RH 1UEYA 1DBML 1KJ2H 4I9WD 2VQ1A 3F12B 2H26A 1S7SA 2E6PA 2PW1A 3NABL 4M6ML 5EFIA 1SBSH 4NT6B 4XH2A 1PQZB 5DD6B 3T0AA 3ERYA 5DHYA 5DFVC 3HKFA 5T3XD 3MOQA 3BN9D 1NSNH 3KPQB 3NOIA 4X5LA 1Y6MR 4OZIA 4JREB 4OLVH 3VD3A 3QEQD 4IRJC 3VG0H 1UEMA 4NWUH 2APBA 2NY5H 3DXAD 1W2KT 5EBMA 1V3KA 2DKUA 1XF3A 2XY2A 4FNLH 2Q76B 3EJZC 3GDBA 1DFBH 2YS4A 1I1AC 3VFTB 1P7KA 4K3DH 5F71A 1CFNA 3TFKD 1A7RH 2I24N 2QL1A 3QUKA 4G9FB 5IM7B 2JJWA 2DQFA 3STZA 4UTAH 3QUMH 3T4AB 4X98B 1VESA 3OGCA 1KT2B 1AFVH 3DGGA 1DQML 3V4UL 3VXTA 4RFNC 3B9KD 3M17B 4POUB 3LPWA 2GT9A 4NM4H 4F7PB 5LGKA 3GJEB 2C7UA 1CXIA 1G7QB 1M05B 4NDMA 4WTWA 3SGDI 4Z7UA 4JLRB 4XCNA 4DZ8B 3MGOB 3FRPG 5DWUL 1BVLA 2IH1B 3MRJA 1KPRB 4N8VA 4BZ2L 1YEKH 2ADFL 3D69B 5D7LE 2V5SA 4DN4H 1IFHL 2VERN 3NCYP 3TP4A 4HKZB 3LN5B 5JPNB 2OL3L 4EQ3A 1QVOA 4AQOA 4YR6A 4PRID 3QJFA 43C9A 4R26L 4PJCF 4HKXB 3CLFL 3OB0H 1ETZB 2BSRB 3D85A 4ELMA 1JWUB 4G6JL 2DYPA 1CLCA 2W38A 5EB9A 4OCSH 5FA3A 5H37H 1GGCH 3OAZH 4O2CA 5I1CL 1N6UA 1AGCB 3OJDA 4Q6IA 4UMGA 4P46A 1YMMB 2KH2B 2IGFH 2YD9A 1NEZG 2FECL 5ITBL 5CS7A 4ZDHB 1K8DB 2EEDA 4JRXE 5DI8A 3MRCA 1U93B 3MNVB 2F53E 2V9TA 4JB9L 1F4XH 1EAJA 1K4DB 1RUPL 3OKNA 3KDMB 5JUEL 3H9ZA 2BVOA 1W72B 2FRGP 3RX5A 4LF3B 1CDHA 3IDGB 1F3DH 4P9HL 4YIQB 1C16B 2EH8H 3UJIH 5EZJA 1KB5B 5EIIA 4LHJB 3C60C 1HHIA 1X4XA 4QF1A 3D9AL 4FFYL 4YHNA 3KPLA 3V4PL 2X9WA 1QLRA 5LXGH 5KJRH 4HS3B 3S5LB 3L6FB 3QI9A 5L7XH 4ZUWB 4DKEH 4YDIL 3GBML 3O2DH 1KIQA 3HLAA 3HFMH 1NCBL 2C1PB 5JIKA 2D4FA 4XCYA 1KCSH 4L4TA 2Z91B 4ZQKB 2DM3A 2P5WA 1BJ8A 2G9HB 3LS4L 1WC7A 3WLWD 1J05B 1EXUB 2HFEB 2JB6B 2BHZA 2HT2C 3AAZB 1I9RH 4YDLB 4JHAH 4XXDA 3ARTA 3ILQD 3BWAA 1B9ZA 1LP9A 5F8QC 1HINH 4BH8A 4BFIA 1XGPA 1NBYA 4Y16D 5TE4L 4JQIL 4YHLL 1QFWM 3FN3A 5FOJA 3FFCE 5D2NC 1NGZB 3U2SB 1NC2B 4R0LA 3BI9X 2DD8L 4RFEB 3N1GC 5IF0B 3PL6D 4ONHA 4QNPE 1ED3A 1IT9H 5DMGD 4KROC 1AXIB 3NA9L 1R5IB 4YHOH 5FHAH 2ATPA 3WYRA 2JELL 4PB9L 4P23A 1ES0A 4P49A 5DDHA 5DA4A 2D31A 2JB5L 3O9WD 3R06A 1XGYL 5CEYB 4N0FB 3HA0A 5HYSG 3L3HA 4BA8A 3SHSA 2QHLA 4FOMA 2XTJB 4LDOB 1YNTA 2FR4A 1FFQA 1OPGL 3BUYA 3ULVE 4F37F 3MLVH 2XXCB 4NHUA 2XWJA 5GISH 4F8TA 2EYTB 3EGSA 1T21B 5T1KA 3MA9L 5HVWA 3O3EB 1A7OL 2XN9A 4FFZH 3G08A 1WTLA 3RJQB 2L7JA 1LO3H 4EVNA 4WW2F 5J06A 2EDHA 5JOPD 2KPNA 4KMTL 5IROA 4OIIH 2NX5E 4UOW0 1F58L 4YBQC 4GKNB 3SY0A 2HTLC 2D4DA 5CKAA 4J2XA 1NAKL 2EICA 2ZG2A 3U7YH 4HG4J 3WS3B 1PG7W 2UV3A 1BFOA 2PTTB 2R4RH 3B9DA 4M1DL 2YHGA 4UDUB 2FGWL 15C8H 3TZVB 4OD1H 2UY7A 4IIQA 2ZSVB 3RY6C 2QSQA 3ABZA 3VJ6A 3EYOB 1HSAA 1NCAL 3DVNB 1VFBB 2OJEA 3HR5A 1GHFL 3A6BH 2FHFA 3NIFE 4H26A 5E8EA 1IQDA 4HSQA 2QV2A 6FABL 3DX8B 1FYTA 4PJ9D 1MCIA 4K2UH 4N9GA 1OM3H 3I6KA 1JGVH 1AGBB 1VACA 2VITA 1HI6A 1N0XH 1QFOA 5DR5H 3B9EA 4KTDL 3LY6A 4ODSL 3UROR 5B8CB 4NHCL 4OQTL 2XT1B 4HC1H 1M4KA 5T1DL 4PRDB 5C0AD 1H3TA 4PIRF 5JO5B 1EAPB 3LIZL 4CVZA 1LO0H 4AK1A 3V0WL 4LCWE 3VFVB 4QT5B 5MERB 4JM2F 1D9KB 3GMNB 3P73A 1A6VL 3SQBA 3QXAB 2OK0H 1ZS8B 4AIZB 4Z95L 2W9DL 3D18B 4KQ4L 4YBLB 4MVBA 3GSVA 1FNLA 1T7YA 3VWKC 3R0MA 4HWZB 5SWSE 3MCKB 1D5BB 2A6JB 2VQUA 2IEPA 4X9FA 5HHOD 5EU6A 1OCWL 3CSYB 4JG1H 3IDIB 1PLGL 4XMLL 4HIIB 3QDJB 2FATH 2B5IB 3SJVB 5DJYA 3QFJD 4JFPA 1CFTA 4OLEA 1F42A 4KDTA 3R1GH 1FQ9C 3TYFB 4XCEB 2I9TB 3FOMB 1X7QB 1MUJA 1WFOA 3WIHA 2VR5A 4RRPA 5KSBB 1ZLWK 4LKCA 3KPRD 3FQXB 1BZ9A 2D2OA 2Z8WC 5JZ7D 3GUTA 5EBLB 2PYFB 4GAGL 5KN5B 3O0RH 4EBQH 2PETA 1EMTH 5FKPA 1RK0A 1R3JA 2CKBB 1GOGA 5E95B 3TBSB 4K23H 1CI5A 2F5BL 4FTVA 2LU3A 1EO5A 5IFJA 2C3VB 4U33A 5J11B 2P8LB 2HVKB 4RDQF 4WJ5A 5B39A 3QXDA 4HZAA 2FL5A 2VDKH 1RUAL 4HUUB 3UPAA 4QEGA 2YEZB 4ERSH 4H25A 2P5EE 1R3LB 2EKSA 3RWDB 5D96C 5BRZB 5I30L 4NO0D 3WFZA 1P6AB 3QEUA 4UB0H 1J1OL 1AE6L 1KPUB 3ZT6A 1FGVL 4UT7L 2C3GA 3ZKQD 5KSAB 4Z76A 4DW2L 3GRWL 4G5ZL 3IFNL 5TQ0L 4Q7DA 2VZOA 3O6ML 3BQUA 4K71C 2X7LA 4K8RL 5IBTL 3SPVA 1IGTB 1IAIL 4LCYA 3GGWB 2GK0B 1U8HA 5BOZG 1QUNA 4N5ED 1UWGH 4GMTL 4PRHB 4QHUA 4HDIB 1P9MC 5JR1H 3T1WA 5DJ2A 4OZGE 5IOPB 2QLVB 5HD8C 4NNPH 4J1UA 5LGJA 2HP4A 2ZWLT 3TPUB 1YEEL 4PP1D 4CL7A 1A6WH 5ICXA 3LN4B 1CG9B 4PJDA 2B2XL 1RD6A 5L2KB 1MAML 2PO6C 2NY4C 3RGVD 2AJXL 5I8CA 1S7XA 3IFPB 4M5ZH 4WO4A 5T1LB 4W4NA 1RZGA 4E0RB 7FABH 4UBDD 1FNSL 2OBGA 3BGFC 2AV7B 5HHNB 4E41E 3RZCA 2VLJB 3LQZA 4D0CA 1IGML 1W72L 3TN0D 5JIPA 2CIIB 5C0RH 4Y1AB 4S0TD 5LWYH 4LIQL 4IHOB 2HFFA 2Q1EA 3BSZL 4G6FD 4OJFL 4RBPK 4KAQH 2DLFL 5T33L 4DN3L 4BQ9A 2GIYA 4UUJA 3A67H 3WHXA 3ZHDA 3RI5F 3L3OB 1NJ9B 1DQLH 3HZYB 4JRYE 4HCRH 3L5XL 5MEPB 2MTPA 2DB8A 4Z7WB 1HH9B 5E4EC 2F8VA 1Q9KB 3DXAA 1H15B 4HGWB 3THMH 1LE9A 3E8UL 1YN6B 2R9HC 2XFXB 1JNNH 4YHMH 5HDLA 3ARBD 5E99L 4R8WH 1WT5A 3TFKA 3P77B 4LVHB 1LEIA 4KUCD 2DWEB 2XZQH 1FL6A 1E28B 1IC7H 1QHOA 4F7TB 3W9DB 3QUZC 1OP5H 3LD8B 2ITDB 3S5LG 4EKXA 4HKBA 2X4QB 5F70A 1DBKH 2P4AB 3B9KA 3EYFA 3JTCA 1U92B 1WUNT 2H6PA 2QKIB 3ECBB 1T2QH 3KWWA 4PBXA 1S7QA 2GFBA 3QHZH 4I8DA 2AEPL 4Y5XB 2FJGB 3AXLB 5CJXC 4KRNA 5CD3A 1N64L 1WISA 1AJ7H 2DBLL 2ESVD 4U6VL 5GRZA 5AD0B 1NCNA 1RZIB 3Q2CA 4LGPB 4XVJL 3LVEA 4HUKB 5MEND 1CBVH 5E94B 1XGTB 2O5YL 1TMCB 3OJVC 4NQCB 1G7MA 5C0DB 3GI8L 4M43H 1U9KA 5L2JB 3PNWB 3UC0L 4Y19A 3WFBL 5GS1C 5A40E 2CKNA 4NZJA 2Z8SA 4ZFOA 4LQ1A 1P69B 4KGJA 4PRIA 3GMMB 3ZYJA 1KYOJ 1I8IA 4YHKH 4H5SB 4AMKH 4AY0A 5ACZA 1UFUA 3ZKXC 4QYOB 5FO9B 4P4KB 1G9NC 3N9GL 4KJPD 5L88L 1NAMA 3HI5L 4P57B 4RA0C 5CLWA 2YPLB 2Y5EA 1I8MB 2WINB 5MHSE 3UZQA 3V6ZA 5TFSL 2BOBB 2NXZB 4PJIA 3GKWH 4YE4H 3ROLA 5I1GH 1VKXA 5IMLA 2NR6C 4NOFA 5E2VL 3REWA 5FGCE 4QNPF 5ANME 3ZTNH 2VXSH 4UAOB 3WLBA 1AXTH 1SHMA 3OV6A 1JHKL 4HZLB 3DETD 3O45A 3MR9B 1KEGH 5I19L 4Y7MA 3L7EB 3OHXA 1B0WA 4MLSA 1MWAB 5DD3H 3CH1A 4RMRA 3RWCA 4HF5H 2VISB 5DJ0A 3RVTD 4FABL 3UO1L 5MEQB 1U0QA 3AS1A 3TIEB 2DL9A 1GGBL 4XP5L 3ULVF 8FABB 1FAKT 1J10A 5JNYB 2RFXA 1OF2B 1JVKA 1SEQH 2I26N 2L4OA 3SDCB 4X4XB 2VL5A 4X4MA 4TVSa 1CFQA 4P2OD 2FO1A 3I2CH 5AEAA 4PGEB 1M7IA 3VGEA 3CFDB 3K4ZA 3WEXB 1J1PL 3RWFA 4FS0A 1D5XA 2Y5TA 4RMQA 5INDA 1QZ1A 1JF6A 1NPUA 1KELL 4KK5D 4MNHA 4TUKL 5EZIH 2DKMA 5ESQB 2NMSA 1TTFA 4QRUB 4IRZH 1YNKL 1KF9B 3GIVB 3MXVL 1JRHH 2EDDA 3EOYG 2W0FA 4DGVL 1Q8MA 2E9BA 3V0VA 5GZND 4TQEH 5CSBA 3ARXA 4Y16A 2OQJB 2FZ3B 4K7FA 3OXRB 3V4VH 3W39A 2X09A 4KRPC 3DVFA 5TE7H 4P5KA 4GKZA 4ZFFB 1XEDA 3LEVH 4J3UA 1IILE 1OWRM 3PL6A 1X5ZA 1MFCL 5JPMA 1AQDA 2B0SH 1CQYA 1M6OB 3D3VE 3DO7A 5F3HB 4NJAL 2V17H 1AY1L 3LH2H 4QXGL 1GGUA 4PJ8B 3RUGB 4Z7VA 4AEEA 4PREB 3SOBH 2CKBL 4LCIH 3VG9B 4BJLA 2XXMB 1UJ3B 4O9HL 5EU4B 5B3JE 3VFRB 5DRNA 1P4LA 2UZIL 2BFVH 3MFFB 4GJTB 5FM4A 1BZ7A 2Z0BA 5EWIL 4JJ5B 3VA6A 2O5XL 3B6SB 1A0QL 3ROOA 4EI5C 3FT2B 3SGJA 1MCQA 5KVFL 2FBJH 3U83A 1NGXA 1CXFA 1XIWA 5FYJU 4ESKA 3OSKA 5L9DL 3K80A 5AAWA 3TBYB 4P5TB 4K8RD 2VE6A 3MA7B 2NY3B 5DUBB 4ZODA 5DSCB 3TNNB 3GSWA 3ZTJH 1SQ2N 2D7TL 4WDIB 4POZD 1JNJA 4P46C 4R2GB 3RA7H 3VFUB 1AHWA 3NCYS 4Y5YB 1KTRL 5IIEA 2Z31D 3OKKB 2Y36H 3L7FB 1HWGB 4P5MB 4L9DA 1L9NA 4FMKA 4TOYL 5CEZH 1KCUL 3MUZ1 1ZVSB 1N3NA 4O4YL 3RTQA 4XCCH 2VXVH 4HQQH 3F62A 4X6CA 2GSIA 2R39A 5HDQL 4BQBA 1OARH 5F7EL 4PJGA 3HZKA 1CS6A 2JLLA 3GMQA 3K8KA 3E3QA 4HUNB 2N56A 1MJ8L 4RZCB 4F15C 5JW3H 4OT1H 2NY2C 4M5YH 2GJ6B 4RAUA 2XKNA 4FQCL 4CMMA 1ZT4A 4PJ9A 2BSED 1AIFA 1JWMA 4LSQL 1YEIL 2CRIA 5FYKH 3HMWL 4HUMB 1ITCA 3ORJA 1HHGB 5CLTA 1UA6H 2SEBB 3DRQB 4JZJB 5C0AA 3BWUC 4YHZH 4Q9CA 1TDQA 2D7MA 1P53A 4LAJH 4S1SH 5JHLH 4PJHE 2F74A 4LSVH 4Y0GA 4ODVL 4W6XB 2YD4A 3MRMB 3BESR 1EDQA 2ICCA 2UWEA 4OZ4B 2P48B 2A38A 1T0MA 3OR7B 4N90E 3FRPA 4XZUA 4XNXH 5J0BA 1CFVL 3BPNB 2WBJB 2J12B 1KN2H 3IKKA 4UOW1 2FEEI 3EDEA 2CO7B 4LNVA 5FK9A 3LV3A 5HHOA 2Q6WB 4R0LC 1S5HB 2H32H 1NUGA 3G5YB 1BLNA 3MGTB 4LLWB 4OGYL 5CP7A 1XGUB 4RGNC 4AEFA 1NC2D 1TETH 4YO0B 3QFJA 4M4RA 5ADPL 5IT2H 3OZ9L 1MRDH 3MLTB 3UJJL 5JQ6L 5IW6B 1A7PH 2J88H 2N1KA 3U0PB 4ZSOB 4QRSA 5CJ8A 1EO8H 2GYSA 3KPRA 1JZ5A 1KXTB 3WFDL 4TPRL 2IG2H 3EYSL 4UU9B 3HB3C 4ZS6C 4JR9L 3VXPB 4WV1B 1MQKL 5SWQB 3H0TA 3MYJB 2XTLA 4XP1H 2VLME 5DQ9B 5J13C 5D6CA 1PKOA 3E6FA 2XTJD 2YPKB 2OL3A 3RKPA 5CINH 5SWZA 1AD0A 1NDGB 3F7VA 3FT3B 3RRQA 4HJJH 3PIQB 2PCPB 2XPGB 3IDYC 1NEZA 2XQBH 1YEHH 4XPHH 1RJZB 1WVZA 1T1XB 4PJXB 4LFHD 5IROC 1KCKA 3T8XA 4YH6A 3VXUB 2OLDA 2BRRL 5DJXA 1MCLA 2DI8A 4K7PL 3EO1A 4QHKJ 3T2NL 2MOVA 3MOAH 4HG4K 3DROB 4YWGL 3EHBC 1OB1A 1JGUL 2Q3ZA 2ITCB 3GHBH 4U6XB 4HIJA 2BP3A 3O3BB 4YPJA 4LNRA 3U9PL 5I1JL 4IIQC 3C09C 1TPXB 4K3JH 4XGZA 4N5EA 2YK1H 3CJJA 4NQTA 3T2OA 3TZVD 3EO9L 5HGHA 5E1AB 5JORA 2Q20A 4NOBA 2PXYD 2HG5B 1UXSB 1RZ7L 3P0VH 1DSFL 2F8XC 4QLRA 3RWEA 5I6XC 5J12C 2XI9A 4NBYB 3FHAA 1XF5B 1MWAL 1FVDB 3RGVA 2AI0L 2YWZA 2JE8A 2BC4B 2OZ4H 2QHRL 4KHXL 4HGMA 1U8LB 1KB5H 2ZCLH 3GSUB 5FUCC 1YNLH 4DVRH 5FOBA 1EVTC 2VOTA 1QSFE 3LHPH 4JFQB 2EH7L 3BPOB 3ZYZA 4Q0XH 4MD5A 3TN0A 2F58H 2H41A 1OQXA 3H9SE 3DLQR 4CDHA 1Z2KA 3VXRB 4WHDA 5KW9H 3B5TA 1DEEB 1RY7B 2KUTA 5A2KH 1WCQA 3RVVC 5IVZB 3OKEB 4Z0BH 1VFOA 4MVBC 2DM2A 1SMOA 2X9YA 1JFQL 3NMEA 4G42B 2NTSP 1OD9A 4HK0A 1A6TB 3ARRA 3DX9A 5IB1A 1G7PB 1GIGH 2IAMB 4GW5B 3EYQD 4I5BB 3CK0L 3UTTD 2J4WL 4QXUL 2MQCA 5HGGS 4M61B 2AKRA 1HKFA 4JO4L 4XRCA 5HYSA 4D9QD 3KPSE 5BV7L 3JTSB 5D1ZC 1TENA 1B88A 4R96B 5C07B 5MP6H 4KDTC 5IK3B 3QDJD 3SJVD 4MJIE 5F21B 3HNVH 5D5MB 4G8FB 4XVTH 3VI3E 4I1NB 2AK4B 1IGFL 1WBXA 1HYSD 3TH4T 5GHWL 2R23A 1K9TA 2DQCL 4NQVB 2HJKA 3MLSH 4BELD 1I7TA 2X44D 3O4LE 4X5XB 1F4WL 3JSSA 4UNUA 2YA0A 4TNVK 3FO0H 4XPAL 4PJBA 1CU4L 1NGYB 4QRRE 4KI1A 5EIVA 5D2NE 2ESVA 2P45B 5CGYD 3QFDA 2E27L 2H8PA 3RX8A 1J8HB 1NLDH 1TQCC 5HGAB 5MENA 1JZ2A 1YJDH 4V1DE 1RVFL 2HN7A 4P2CG 3HZVA 2XV6B 4JDZA 4K9EC 4L8BB 2VKWA 1QQDB 3C8DA 3MRRA 1Q9OA 5BRZD 3QEGH 4AM0A 3RVUC 4J3TA 5TF0A 4NRYB 1E27A 1KSRA 3FQTB 3DNKA 1QLFB 4IRSC 4WVRA 3UYRL 5DZLA 1KG0B 4DFIA 2BJML 4CADA 4L4VE 4NUGL 2BNRD 4JKLA 1MCFA 3FN9A 4BZ1L 2E3VA 2PR4H 5TDPA 1VCAA 1ZEAH 2VDMH 3IRZA 3S36L 5KTEL 2EXWC 3VW3H 1JRHI 4PRHD 1QSEE 2ZUXA 1SM3H 4PJ7E 3JUYA 4DEPB 4M1CD 3ZDXE 3U6RB 4OUUA 4ODTH 2R1YB 32C2B 1SVZA 1UXWA 1UG9A 4RMSA 1EGJL 5DT1L 2QQLH 2AV1B 5L2KD 1LWRA 2BNQE 5IHUL 1KCGC 5D2LB 2GTZB 3RZCC 4I0PD 2X4SB 2N4IA 5M95B 2F54E 3BT2H 2IADA 1WIPA 2VLJD 5FO7B 4OQTA 3S8WA 4I0CC 2H1PH 3F12A 4JM4H 4MNGE 4Y1AD 1CN4A 4DK3A 1GCFA 4ZO6A 1OAUL 2MQ3A 3BN9C 4PGDB 4NT6A 5DD6A 1FH5L 1OLLA 2M1KA 4C83B 3TCXA 5K9OA 4NN7B 4S1RL 1W0YT 4QKXB 5EPMB 3GHEH 2Q8AL 4MA1B 4P2OA 3RWHA 2EDLA 5KSUB 1F6FB 2JTDA 1TITA 3SCMB 1G0XA 4KQ3L 2E9WA 4PRPD 3WKML 1WT5C 2Q76A 3TFKC 3VFTA 1X5LA 4JFYB 1CGUA 2HH0H 5GGUB 1UENA 1A14H 3BAEH 4MD0B 1E4KA 4F7MB 5IM7A 4LSSH 1E6JL 5E9DB 4GG6E 3G9AB 3T4AA 1L7IH 4X98A 3KS0J 4PUBL 1HK6A 3B9KC 3FB8A 2EDKA 2K3TA 4NZUL 1KT2A 3O2WH 4JFEE 4HS6A 5DD5L 2VDPL 4OF3A 5GS2H 3CCHB 3UPRB 2ZJSH 1BREA 3S37X 4G6AD 5GGVY 4AL8L 4OGAC 5T3ZL 4F7PA 3H42L 3GJEA 4KHTL 4LHUB 4LRIC 1QYGL 3CVIL 4QRPE 2AJYH 3TWCL 2ZUTA 3TGXA 3OBAA 5K9JL 1EHAA 3NGBB 4JLRA 4NRXA 4WHTB 3MGOA 4DZ8A 3BVNB 1CICB 2IH1A 3BRDA 3WJLA 4MB3A 4PV8B 3PGFL 4NQCD 2VDOL 1F2QA 4MA7H 1WFNA 1CDYA 4UIKL 4PJHF 5IQ9B 4D0BB 2I27N 1ZA6B 4HKZA 5JPNA 4EXKA 5CILH 4FQIH 1R0AH 3BN3B 4LSTH 1KYOK 4N0UB 4PJCB 3UX9B 3FTGB 2V2WB 3VGAB 4ZO7A 1DE4B 1YY9D 2WBWB 3GNMH 4G8EB 1GC1C 3GRWA 3T65A 3UTSE 3IFLL 1ETZA 4GQPH 2BSRA 3KYMB 1JWUA 1T20B 4IOIA 3KR3H 1T7XA 5D7KD 4Z7NE 1NGWB 2NXZD 4U1LB 4YXHH 2VDQH 4NZDA 1NC4B 5I1KL 1AGCA 5AZ2L 2BK8A 2Z31A 1CDCA 1OAYH 3MROA 3P40A 4P59L 5D1XB 3QQ3B 2FHCA 4M6OL 4KKCD 4FQLH 2W0PA 3QG6A 3ZKND 4JKMA 4NQEE 1OP9A 4JO3H 1MIML 4OCWL 1XF2B 1X3DA 4ZDHA 1VPOH 4ZNEA 3IT8D 5DD0L 1QFUL 3V5KA 3MREB 3E0GA 4OFPA 1U58B 5JHDE 3VRLE 3HE6D 2HT4D 3KYNB 5B38B 1K4DA 3KDMA 1W72A 2Q7NA 4LF3A 1F3JB 1ZLUK 3O3DB 3IDGA 3KLAB 3QG7H 5FYJL 4YIQA 25C8L 1C16A 1LEGB 1MREL 3VGHA 4LOUD 3TEUA 3X14B 1F2XK 3KHQA 3SDCD 4UV4L 3AM8A 2FX9H 1MH5B 5HHVH 3RQ3A 1S3KH 1ZTXH 4YJZL 2P47B 3NTCH 1QFHA 3S5LA 3L6FA 3ARGB 3QCVH 2CRMA 2Y06H 2B1AL 2C1PA 2HRLA 3WLWC 1JYVA 1BM3L 2GUOB 4X80L 1OGAB 2OI9B 2Z91A 1J05A 1EXUA 4WU7B 2HFEA 3S35L 3ILQC 4TULL 3AAZA 2C9AA 4K94L 3TVMB 5ELIA 2YN3A 1O7VA 1KC5H 4FQ2L 5EUOE 5CZVH 1OWWA 5SX5H 4ZS7L 4GW4B 2WK2A 5C6PB 1MY7A 1I9IH 4HWBL 3HG1B 4RNRB 5JMRA 3QNZB 3KJ6L 4XHQA 2CUMA 4NQXB 4TSBL 3OPZL 4O5LH 5DJCB 1WFUA 4NZRH 1F4HA 1DBAH 3ZT5A 1NGZA 2XA8H 5DMGC 1NC2A 3U2SA 1UCBH 5IF0A 3MV7E 3NVQA 1R5IA 3O9WC 5CEYA 5IBUB 1W0VB 4PJ8D 3FZUD 4N0FA 1GGTA 5AAMA 1A6UL 3JWDC 1R5VB 3V7AE 1MCWW 5D8JH 3WXVL 4PPTA 1BPVA 4YUEL 2OX5A 2YKLH 3RWIB 1SEBB 4U7KA 3HI1A 3BYYA 1HIMH 5AWNH 3U4BH 4X7DC 4WHYH 4F7EB 3GSXB 3SGJC 2K1MA 4UT6L 4WI6A 5GRJL 4GLRH 3VFPB 5C0ND 1SY6H 3S98A 1T5XA 3BD3A 5D1QB 2EYTA 1T21A 4F2MB 2IBZY 3O3EA 1P6FA 5CGTA 4PV9B 1S7UA 4PTTB 1T7WA 3U79A 4P5TD 5CMAB 4WW2B 3MLYL 3C08H 2IC2A 1A5FL 5ADOH 1AHWC 1U6AH 4V3EB 5IQ7L 1FBIH 4KZDL 4YK4C 3VWJD 3VI3F 3VFGL 5FUOL 4H0IA 1WICA 4JFDB 3TF7A 1C5BH 1EK3A 2HTKD 2QQNH 2PTTA 3E3QC 1MCSA 4X6DE 3LN9A 4UDUA 1DBBH 2IPTH 3MSPA 3TZVA 4NZTH 2ZSVA 3EYOA 2J3SA 2QR0B 4FXLA 3EFFB 4PJ9C 3DVNA 1VFBA 5C92A 5GGSY 2GJ6D 1SYSB 3RY4A 1S5IL 3DX8A 4GUPB 1KLUB 4QHMB 4YDJB 1YECH 3UCRA 1O0VA 1AGBA 1AGDB 2DQDH 3Q5YA 2DJSA 1YC7A 3FQRB 3M8OL 5DQJB 4G6MH 2QSCL 2ILLA 4PRDA 4QXWA 3HPLB 5JO5A 4M93C 4AYFA 2Y23A 1RUMH 5FHBH 4JM2B 5C2BL 4QT5A 1HHJB 1FAIH 3GMNA 4HGKC 1EEYB 4MXWL 3QXAA 1ZS8A 2X4NB 5DQDL 4AIZA 3D18A 4E5XB 2OM5A 4RGOH 3IYLW 1U8MB 4HWZA 3P11H 4MJ6B 1EVUA 4PJ7F 1IAKB 1NL0L 4WI7A 4Z7OE 3MCKA 3ZDXF 4U7MA 2Q8BL 3ESVF 4I3RH 2ZZUT 3CSYA 5BS0B 3IDIA 4HIIA 3QDJA 3SJVA 5EA0L 5T3ZD 4YX2L 4N0YL 2YSSB 4U2YA 4PS4L 2GSGB 3S37H 4PY8I 2Y72A 3TYFA 2EDRA 4XCEA 4D3CL 2I9TA 3FOMA 1UACH 1X7QA 5DUPL 5F1NA 5I1AB 1VDGA 5JZ7C 1F8TH 2ZCHH 4BQCA 5KSBA 5E6YA 3FQXA 4NNXA 1YMHB 4OI8A 3BKMH 5EBLA 2PYFA 5KN5A 5KAQF 2JK5B 1U3YA 2JJSA 3LS5H 3TBTB 3UMTA 3QQNA 2CKBA 1AR2A 4XTRD 3TBSA 2XNAA 5I75C 1KTDB 1ND0A 4Q97A 1NGQL 4Z7UE 1LHZA 3S7GA 2C3VA 5FYLE 1CDUA 2P8LA 3CDFA 5E8PB 3LRGA 2A6IB 3MLZL 2EIBA 1FFPB 1EJOH 2DDQL 4LVNC 2WWMD 3N1QC 4LAQH 1R3LA 3VXUD 5E8OB 1MI5D 1H0DB 1YDPB 2Y07L 4M9PA 3RWDA 5BRZA 1CGWA 1J0HA 4LHUG 4M1GH 3NZHL 1B0GB 5ALCL 4ZMAT 4NFBA 5KSAA 4RISL 2A2QT 3JWDH 1AQKL 4GG6F 1Q1JH 2DQUL 2WQ8A 3WD5L 2R8SH 4N5EC 2KZWA 2XA3A 3GGWA 1H5BB 2GK0A 2CGRL 3MUY1 1DJSA 1D6EB 4XNUH 4BM7A 5I1HH 5KG9B 5J57B 2KZ1B 4PRHA 4HDIA 2DRUA 5MEOB 4L29A 4PP1C 3PP3H 5FDWA 1C5CL 1N2RB 3TPUA 4F8QA 3LKSA 4S1QL 4PLNC 5DS8B 5I15L 4U1HB 1JMZA 3RGVC 5HVGB 3GMRB 1CZ8H 3RHWF 3LN4A 1CG9A 5I9QC 1P7HL 1NQBA 3O11B 5L2KA 5FYJD 4UBDC 5DRWB 5D7LB 1UWEH 1AKJB 3QDHA 1JPSL 3IFPA 3OMZA 5T1LA 5CZKA 4E0RA 3CMOL 4JFHE 1CVRA 2ARJQ 4M7JL 2AV7A 1U8KB 3TN0C 2VLJA 2MKWA 4Z5RB 3HMXL 4F7CB 1CR9H 4MX7B 4Y5VC 3BO8B 3F7PC 5CSZA 2CIIA 1FFOB 4Y1AA 4PP8C 2X1OA 3VXRD 3SKJH 1EJ6A 1KEMH 5BVPH 1N5AB 4QHNA 3X12B 3L3OA 4P3DB 3WFEL 1NJ9A 1U95A 3HZYA 5E7FA 3GM8A 3MJ9H 4Z7NF 2GY7B 5MEPA 5IJKA 4Z7WA 5B38G 1HH9A 1PGRB 35C8H 3MNWB 1Q9KA 1I9JL 1H15A 2YRZA 1UH4A 3ARBC 4WU5B 4YXKL 3EYVB 2XFXA 4LBEB 4B0MM 1XMWA 4AEIH 4N8CH 2F53B 2DWEA 5IMKB 1E28A 4X4YB 4F7TA 3MX0A 2FD6L 1LP9E 2PYEE 2ITDA 5GRYA 3VRLF 3DSFL 5E6ZA 4NUJB 2X4QA 4QHLB 4XPBL 4YGAB 2ZUWA 4JFZL 3JUZA 2MHAB 1U92A 4JY5L 2LVEA 3ECBA 2AS5M 4F57L 4KTEL 5IBLD 1QRNB 4Y5XA 2FJGA 3RPKA 3AXLA 5HHME 4RGNE 3ET9F 4TVPH 3EYUL 5AD0A 1J8HD 4OCXL 1RZIA 1ZMYA 4UDTB 4O02L 2H2PD 3TJHD 4C59B 3VD9A 1IGIL 1Y0LB 5E94A 1XGTA 3B2UD 2ICWB 5A2IH 1S78C 2YOCA 4NQCA 5EU3B 1TMCA 2YPVH 2YD5A 1BD2E 2J8OA 2R0LH 1PEWA 5L2JA 1HEZB 3PNWA 1FPTL 1OSPH 3UYPA 4DQOL 1DVFD 5LKNA 4MA8H 3MBXL 4H88L 4BFEA 3QWOB 3AVEA 3C6LB 1S7TB 2XQYG 4NHUE 4H5SA 5DC9B 4KJPC 5F9DC 2YR3A 4QYOA 4ORZC 5EUOF 5FO9A 2ADIB 4P4KA 4OM0L 5IBUG 3NPSC 3VFSB 2X4RB 3EKCA 5BQ7A 4OCYH 1T0PB 1I8MA 2IBZX 5DXWA 5F7MC 3FFCB 2A9MH 2BOBA 1Z0NA 4OGZA 4UZGA 4ODUB 5F1IA 1OW0A 1OAKL 1BF8A 2MWCA 4GW1A 5IVOA 2ZNXA 4L8CB 4X7CC 2OXGA 3GBNL 1F6AB 4IJ3B 3MRGA 1L7TL 4HZLA 2A6DB 1OTUD 3MR9A 5GSRB 3ULUC 4XC1H 1JK8B 1MWAA 4TN9A 3H6JA 3E2HC 4XC3H 2WLZA 1W0WB 3HE6A 1FE8H 3JTTB 4CN6A 1Q0XH 4HD9A 4ZXBD 3K46A 5MEQA 3TIEA 1CDIA 1BAFH 4YPGB 3PP4L 8FABA 3HC4L 2E7BA 1CLZH 4IOFD 4Y4FB 3CUPB 5JNYA 3TH3T 1JTOA 1OF2A 1ROWA 3DOSA 4GLRI 4KPHL 1N4XL 4P2OC 4G7VL 3RNKB 3AMLA 3SDCA 1HQ4A 4LVOC 5I2IB 5FUCE 1WBZB 4PGEA 5F44A 3CFDA 3TV3L 1WEJH 2E7MA 4HIHA 3QYCA 1DQTA 4FZ8H 3RWJB 3BDYL 5IR1B 1X5IA 4Y4KB 3L5WB 4Q58C 4PJAE 3ZE2E 4KMLB 3B83A 1E4KC 2R29L 2V7NB 4LMQI 4WFGD 5ESQA 4PY7A 1QNZH 5C6TH 1YPZE 5J3HC 5E9DD 4X6DF 4QRUA 1F4YL 3GIVA 3BW9B 5K93A 5GZNC 4TUOB 1LO4L 4GSDL 4KU1A 1AD9B 1U8JB 3BPCB 1I9EA 1KLGB 2OQJA 2FZ3A 5EBWB 3OXRA 3MACL 4UQ2B 5I1EH 2F9BT 4LHUD 4ZFFA 4KWUA 5HSFA 4RMUA 2WP3O 2P42B 5GGVH 3C6SB 3PV7A 1CICD 1UM4H 4NP4H 4G3YH 5F3HA 2B4CL 3CVHL 5EU7C 2JIXB 4MDIA 4PJ8A 3RUGA 1RUKH 4PREA 4NN6B 4LCWB 1MPAL 1UJ3A 1G9ML 1H3WM 1ZV5A 2R69H 4X83A 5EU4A 3VFRA 4LLQB 2JF1A 3PWUB 5DJAA 4X7FC 5IKCB 3MFFA 1FNFA 5C08E 3U0WL 4JJ5A 4PJ5E 1FCCA 3BKCL 1H3UA 2OR8A 4XPGH 3BD5A 3FT2A 1VEPA 4K8RC 5SWSB 5DMIH 1JTTA 5JTWA 4Z7OF 3TBYA 4MXQD 4P5TA 4XNYL 1U3ZA 3MA7A 1B0RB 3V52L 4POZC 1D6VL 1CXHA 5DSCA 1ZHNB 4ZFZB 2BVQB 4WDIA 3NFNB 2Z31C 3SE9H 4QTIL 3AU1A 2IPKB 3VFUA 4Y5YA 3OKKA 4KY1L 3QDGE 4RDQG 3D0VB 1A6AB 5D1XD 3KPOA 5CIPA 5DVOA 2XWTB 4EDWH 3KPNB 1ZVSA 2DQTL 4YEEA 3C5ZD 4KMTH 3H7LA 1EGJA 4BKLA 5FO8B 2EDXA 3WL9B 4HIXL 3IFOA 2ZPKL 1LDPL 4HPOH 2BOCB 4HT1L 3K8LA 1IEAB 2AXGB 4RZCA 3GMPB 4FA8A 5E24E 3BZDA 3CXDL 1AI1L 1PKQE 4OB5H 1FGNL 4Z7UF 2LTQB 2GJ6A 3H2WA 5GRXG 1QFWH 2FYYA 3S88H 3OX8B 2ZSWB 4R3SA 3FAWA 3KLSA 1X5XA 2VLLB 2P5EB 2DIAA 3VH8B 4LARL 3RAJL 3BP6A 3DVIA 1NCDL 5CAYB 3DURA 1U8OB 1UGNA 1HHGA 1L6ZA 4KI5C 4G43B 1ZT7B 2SEBA 4OCMC 3DRQA 4I9WE 4JZJA 1P4IH 4R4FH 3DTXB 4KXZH 3ULSB 2VXUH 3ULUH 4WEBL 4Q9BA 1OGAD 5DEGB 2E7HA 1E4XL 3HHRB 3MRMA 2Y25A 1FJ1B 4YDLC 4A6YH 2Y6SC 3OR7A 4XWGH 1C7SA 3TVMD 3QAZB 4DGIL 4GH7B 1KFAH 3O3UN 3QEQE 5DFWH 3TYGL 4OLYH 2P49B 2W9LA 1SYVA 2CUIA 5DHVB 3HG1D 4ZTPL 1INEL 1S5HA 3G5YA 4K55A 3MGTA 4LLWA 1IMHC 4HK3N </