4QRQA

Crystal structure of hla b*0801 in complex with hskkkcdel
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
276
structure length
269
Chain Sequence
GSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDARAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Extensive Antigenic Footprint Underpins Immunodominant TCR Adaptability against a Hypervariable Viral Determinant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-8 alpha chain
total genus 76
structure length 269
sequence length 276
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qrqA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4qrqA01
5DRZA 5IMKB 3B4NA 1DVFA 3QNYB 3NFNA 1A6VH 5C07E 4AT6B 5CZKA 2ICWI 2LVCA 2DDQL 5FDYA 2VLKE 5C6PB 3N50A 4XWGH 4YDIH 4HIIB 5IW6A 1C5CL 2CDFB 4OGYL 3VFVA 2R1YA 1OSPL 4U49A 1E28A 2VR9A 3MUY1 4NHUB 4QGYA 4AEHH 2BCKA 3CC5B 5LBSH 1JZ5A 3F12B 3SJVA 3UTZA 4HJGB 4YH6A 3BGFC 1LO3L 3FB5A 2OTWB 2P8PA 3F5WB 3L3HA 3QFJE 2ATPA 5I1IH 1R24B 4V1DE 2NLJA 3IFOB 2V9QA 4U4BA 3HZVB 3BZDA 3ZHLA 1N5AB 2F5BH 4OJFH 1U8HB 1TXKA 2R0WH 4IMLA 3MRJA 2VLMD 4LSUH 4U2ZA 3MBEC 1HHHA 3RGVB 4O2CA 4JZJA 1I7ZB 4HW6A 1CQKA 1TQCC 3F7PC 4TUOB 1KIQA 1YQ2A 5GXBB 4JHZA 1I8MB 3FO2A 4JRYE 1UXSB 1MJ8H 4PJEF 3TH2T 1BFOA 2BNUA 1EV2E 1GVIA 4YHKL 1KIPB 4APQD 4Z7QE 1TETL 2PETA 2CIKB 4LEXH 1QO3B 4TQEL 4NRZA 5C0IA 1MFAH 3TF7A 1GHFH 1PAMA 2DD8H 4XNUL 3UTOA 2NXYC 4RAUA 4EN3A 1C12B 4KI5D 3Q6FA 3L7FA 5IV2B 3WHE0 3UZVB 3FO9B 4OLWH 1IKFL 3BDYL 3M45A 1DANU 4F37F 4ODHL 3T09A 1A7PL 2AJZB 9CGTA 5CEZE 4OI7A 4LK4A 1YPZF 2ZCHL 4EDWL 1WLHA 2DLFH 5CS7A 4YWGH 4KUZL 1X6LA 5A16B 3SOBH 5FYKH 3SE4C 2PYEE 4PJFB 5DYOB 3WE6A 4PS4H 4FTVB 5F7EL 4JLRB 3ULSB 5FAAA 3Q48A 1XGPB 4KJYA 2GY7B 2YN3A 2NY3B 1OSZA 4HHAB 2ZCHH 4LLDB 1V3MA 3DO7B 4JB9L 4OCSL 5GQBA 4RA3A 3LIZH 2YKLL 3RZCB 4DEPC 2PW2B 5EIIA 5F7EH 4Z7UA 5ACMA 3H3KA 3CFJA 1PG7W 5HHVL 4WW2A 5HYJD 1IC7H 3QBTB 2VDLH 5KANI 1SYVA 5ADPH 5T1KA 1I8LA 4GUPB 4J3WA 1JNNH 4X7EC 1FGNL 4JANA 4XP5H 5HHOD 3OMZA 4JG0H 4XWOC 1T7YA 1Q38A 2QEJA 1MHHA 3BQUB 3BYTA 3LPFA 1ES0B 4S2SB 1RZFL 1HINH 2AI0L 4OT1H 3ZYZA 1U91B 1F6LL 2IFGA 3S96A 1CXFA 3GM8A 4MX7B 3OGCA 4X6DE 1QBMH 4Y4HB 1CLOH 1FFPA 2APFA 3RTQD 3KHOA 4GLRH 1WFUA 2FX9L 1G6RB 4M6OL 1FGVL 4XPBL 5GJTL 2Y6SC 2EDKA 1EAPB 3DURA 3M07A 3U4BL 5I1CH 1KCRH 4PUBL 5AZEH 3PGFH 1T5WA 4M6OH 1RUPH 5F96L 2MCG1 5JZ7C 4NBYB 4TSCH 1FH5H 2VL5A 4KQ4L 3KXFD 5GS1C 4KGLA 2W60B 4KJYB 1IGYB 1IT9H 1YEEL 4OLYH 4FOMA 2X4SA 5JMRA 2Y06H 3LKRA 5FM4A 3RWFB 2A6KB 3PNWB 5F1KC 1CT8B 2R1WA 4I0PD 2DQJL 2NY0C 3FO0H 4TN9A 1IGTA 3SBWC 4M6MH 2EYRB 3QT2A 4WHCA 4HV8A 2CQVA 4Z7VB 2GT9A 4RAUB 5A43C 4HG4J 1KB9K 2V5SA 3BP5A 5IHUL 1UM4H 3EDKA 2DLTA 4GXUN 1NCUA 4HWBH 2J8OA 1DLHA 2VLLA 5D71H 5DK0B 3G5VA 2F54E 3O3AA 5ENWB 2BVEA 4NN6C 2YWZA 1ND0A 3K74B 5HHXL 4ZYKA 3DXAA 4QRQB 4BUGA 1FYTB 5D7LE 4MNGB 3SQOH 4S1QH 2CXKA 2DLHA 4D9QE 1GPOL 5E2UH 2EDNA 4R4FH 3MREB 4PB0L 4Q9CA 2VXVH 3DRTA 3RL2A 2PO6D 2IJ0C 3G6AA 3EYVA 4JHWL 1QVOA 3PDOA 1SVCP 5EU5A 4L4TE 3O3DA 1OCWL 5LCVH 2ZCLL 2R9HD 1UGNA 4OZ4A 4WVRA 4L8BA 1RURH 2CJUH 2IH1B 3HZKB 1MHEB 1X5YA 3CDFA 4O58H 4ACPA 4P9HC 1UWXK 4GRWF 4EXKA 3B3IA 5IW1A 1F2XK 4I8DA 3SDXF 3T0DA 3OKYA 5C0CE 2GYSA 4ZQKB 5HVHB 1AQKH 3W82A 5IK3B 3RWDB 3IF1A 4OQTL 1GOGA 1LHZA 1P1ZA 1INDH 1KIUA 4K55A 1KCLA 3MRKB 1LO0L 4OZHA 2NLJB 1VGEL 3VWJD 1HHKB 1AO7D 3VG9B 4XNQB 4WFGD 2HKHH 1BM3L 3RY4A 2J7LA 5TGBA 5E6IB 4G80B 5E94B 3AS3A 3T2PA 2LAGB 3MLRL 3MOAL 4J6RL 1FNSL 2ICEA 3TZVB 2EYSB 2FWOB 4DGYL 1F6AA 5E08L 1H9VA 5T1DH 1I9RH 4M43L 4N8VA 3MOQA 3VDCA 4X4YB 1AC6A 4RRPA 4JQIL 5E4EB 3O9WB 1G7LB 1YC7A 3UDWA 2LU3A 4KDTA 3DUUB 5FO8B 5ACZA 1YN6B 4U6HA 3FFCA 5I1GH 3I2CL 3ULUC 4Y2OA 2UY6A 1QSEA 2W1NA 4F9LA 1XCTA 1E6JH 3BWUC 4WI5A 2Y36H 4FG6C 1UCBH 4S0UC 5D1QD 3SGDH 1KN4H 5ACZB 1U8KB 5DD1H 4AIXA 4CJ0A 2AK1L 5GRYA 3C6LA 3O3BA 5E00B 5ID1B 3S37X 1FORL 2V7NB 2X10A 2F8VA 5DHVB 2X9YA 4LP5A 5K93A 1CR9L 3RWEB 1CFBA 4YFEA 5DD1L 3VJ6A 4RNRA 2E8ZA 1UB5B 1C5BL 3I50H 4AIOA 1E4JA 3GI8L 1P7QD 3LAFA 3MYJA 1A7NL 5JA8B 5CILL 4KVCL 2EDTA 2CO6B 3DX9A 3WDJA 4AG4H 2DMBA 5TQ2L 1RJZA 4G6JH 5E6IA 1TJGH 1J88A 1NUDA 2RR3A 3R06A 1NCWL 4JCLA 5DUPL 2C1OB 3C60B 5DD6A 2VTFA 3UTTA 3UJIH 1OGAE 2AKRA 3J7HA 1UWGH 4F7TA 3U6RB 1T7ZA 3X3FL 3D85B 4E41E 4PJ9C 3U7YL 3V6ZA 3MTRA 1LNUA 5BV7H 1OWRM 3DV6B 5KVGH 2IBGA 3SCMC 5E8DH 4X7SH 1R0AL 2HMIC 3F7RA 1W0VA 3KLHD 4HS8L 2NXZC 5IBUB 3FT2A 4H8WL 1M7XA 4FFYH 3FMGL 3RIFF 4ALAL 4XP4H 5KVMC 2IH3A 4U6YB 4QF1B 2XKNB 4HF5H 4HMEA 4Y19A 1JPST 2OP4H 4F3FA 2HLAB 4ZS6D 4BSWB 4GKNB 2W0LA 4JM2B 4X4XA 1OM3H 3LH2L 3MV9D 1KLUB 2B5IB 4X9FA 5D7SL 4JY6A 5H35A 3TJHA 2JF1A 2DOCA 2EIBA 4HS3A 2XWTA 2ZKHH 4UTBH 2VDNL 3PP3H 4P9HL 3QXTA 3HE6C 1KCUL 1XIWC 2BY2A 1AKJD 4HUNB 4L8SB 3OAZH 5C08A 3JSSA 4BA8A 1ZSDA 1RJZB 4U1IA 3LQAL 4G8IB 4PJBF 4NQVB 2HWZL 1KCVL 1YECL 4BQ6A 3EFDL 1IGTB 3DX7A 4D0DA 2UYLB 4MA8H 4R7DA 4ONGL 4KI1A 4NM4L 5I75B 3OTTA 5GISL 4JDZB 4JREB 3RUGE 3H42L 4AY0A 2DAVA 3VJ6B 3IFNL 2J88L 1RZKC 3ZT7A 2UZIL 4QWWD 1XF4B 3Q0HA 1NPUA 4M1CC 3FHQA 3VXOB 4G5ZH 4APQB 3O2WH 4LPTA 3DHMA 1OAKL 3LDBC 2X4QA 4LKXA 5L9DH 4XP9L 2C1PA 4U7MA 4EUPB 2KZWA 1FZMA 3PP4H 3BXNA 4I0PA 3GNML 4K71C 1H0DB 2PTTB 2CR6A 1OPGL 5H2BA 1DZBA 3ULUL 3TP4A 1MF2L 3O8XB 5J56B 1UJTA 3BIKB 3W9DA 2V17H 1FCGA 2EH7L 1JYWA 1OGTA 3BGAA 2DM2A 2DI9A 1NMCC 1CD1B 4Z7WE 5FCUL 1CE1H 1HHJA 3OKKA 2X42A 1T6WA 3HUJB 4DVBB 5B21A 4PRPE 5DMIH 4KQ3L 1BJMA 5D96C 1DQTA 5C71A 4QF1A 2VQTA 5CD5C 5HHQB 2WIIB 4QOKA 4PJFA 2ICES 4W4NA 4PJ8B 4PJGB 3NIGF 3ERYA 5BRZB 4KC3B 3HS0A 4PY8J 1P9MC 3WSQH 5FYJL 2VDQL 1PYWA 4ONOA 4LSTL 3PXHA 3P4MA 5ESVB 2I9TB 3PWJA 3WN5C 1ZLVH 3O45B 3U9UA 1Z0NA 5CEZH 1EUUA 1OF2B 4XXCA 5EZLA 4GRWH 1LILA 5DRWB 4LLMB 3SKMA 1NGXA 1NLBH 5FGRA 1OL0A 3M8OL 1JCKA 3WHXB 3MACH 4JRYB 3VGAC 5E99H 2CKBH 1DCLA 4MNQB 3HI6H 4JFHD 3O6LH 1RUML 1T1ZA 2FGWH 1B88A 4GW5B 2XXMB 1N5AA 1WZLA 4FFWC 3MV9E 4XMPL 3OB0K 5TPWL 3MRJB 3QIBD 3ZYIA 5D9SA 2C3GA 5JW4Q 4ODUB 1WGOA 4UIMB 3E2HB 5D70H 1MUJB 1BQUA 3KLAA 1IC5L 2Y23A 4WJ5A 3TN0C 4YHOL 2EH8H 5EUKA 4D9RE 1GCFA 1I9JL 5JO5A 1JF1A 1NKOA 1CDIA 2X70B 3WJLC 2HJKA 3DVNB 1KENL 1ROWA 4NHCL 3IRPX 5E8OA 1FH5L 1E0OB 4JDZA 3NPSB 4QXUH 3QPQC 2AJXL 5J1TC 2I5YL 2R1YB 1FN4A 4PJDE 3IDUA 4NFCA 3PABB 1A6UH 3VXQA 1HE7A 2CK2A 3H3PL 4K2UH 4NKMA 2VC2L 4M61B 3HMWH 5I8OH 2IFFH 3WFCH 4EUPG 5DRWA 4LIQE 4NO5B 5TDNA 1F4WH 3ARED 1SJXA 2HFFA 3WNMA 3HMWL 2VERN 4IMKC 4LPCA 2DQDL 3JWDC 4JKWA 4Z18A 3C5SA 1CXKA 1CT8A 2R1WB 2Y4SA 5DO2C 1A14H 1RU9L 3LEYL 5DWUL 4M93B 1BQHA 4OJFL 1MRCH 1T2XA 3KJ4C 2I9LB 4P57A 2ZG2A 2E6PA 4GKOA 3HCVB 4JPVH 1FZOA 3IDNA 5DA0B 4GO6B 5EO9A 1ZE3C 4XXDA 3ZE2F 1XCQA 5EZOL 3OG6B 4MDJA 4AL8L 4HULB 5SWSD 1NGWA 3ZE1F 1K2DB 4ZYKB 1UYWH 2DQUL 4XCYA 4JHWH 1I7ZA 4E5XB 1WICA 3ZKMC 4O02H 1I3VA 4PLNC 2W9LA 1IM9D 4GRLD 4OLWL 3BDYH 4OZFA 5DD3H 2GITA 3PGCB 3RNKA 4Y4HA 4FQIL 1P4IL 2JK5B 2XTLA 5I0DA 1YEFH 5EOCH 1QVOB 3WNPA 3DYPA 4KJWC 4KUZH 4Q9BA 3T2OA 1IQDA 5ID0A 2VAAA 3MXVL 4PB9L 4KJQD 1D6VH 1LO4L 5J6HA 1A6PA 1BLNA 1YNKL 2F9BT 5HI3C 2VAJA 3GSNA 2VN7A 3HE7C 4MNQA 2HN7A 5I30H 2PNDA 4OQ1A 2X4UB 3SCMB 1SY6L 2FR4A 2HJLA 1D6VL 4KHTH 2G75A 5I16B 3SGKC 2IANA 2YPVH 4WHYH 3TNMA 4MVBA 2VLLB 1XAUA 4ZUSB 4IS6A 4WI3A 5H37G 1BZ7A 5I30L 4BH8B 3CGTA 4G9FB 3M1BA 4PGBA 1EEZA 3EO0A 3IDNB 3OKNB 1OGAA 4S0TD 4DUVA 5BW7A 2AAVA 1WBYA 4XBPA 1HN1A 5C3LD 4RMQA 4PTTA 1PX3A 4XP5L 2DYPB 3BUTA 3TNNA 4N0CA 4O4YH 1JYVA 3H8NA 4XNZC 3HZYA 3S35X 1ZTXH 1YEHH 5TDPB 4ODWB 4EUPA 5MHSD 4HUMB 5J3HD 3IU4H 1ACYH 3TH3T 4OT1L 4KVNL 1BREA 3TESA 5T33L 1T3FA 4KKLC 3QDGD 2ICWJ 1FIEA 1I7UA 1MNUL 4U33A 2IGFH 1AIFB 4LLYA 2WQ8A 5DD0H 3WO3B 3RNKB 1MLCB 4PJCE 1K6QH 4ENED 2AW2A 2YK1L 1A47A 5J12B 4A6YL 5JXAH 2V5TA 5LQBL 3T0EB 4NZUL 3Q1SL 3MRHB 3FN0L 3FQXA 1T2JA 5F88A 5F9OL 4GG6B 4R2GC 3MGAA 3MNZA 4C59B 5FKAA 1AR1D 2W0FB 3ARXA 3K80A 4U0RC 4QRPA 3QQNA 5B38B 4XAWL 1S9KC 2WM0A 5FDWA 4DOHE 3MOBL 3HPLA 3I50L 1C5BH 1S7VB 4FQJH 1F90L 3EFFA 3QWQB 4GQ9H 4XRCA 3EJYC 4UQ3B 1YEKL 1XF1A 5BQ7A 2DIAA 2UZYB 5D5MA 3FQUB 1KBGH 3I6KB 2EICA 1S9YB 3RVWD 2FSEB 5FUZL 4JKMA 4WWKB 1WT5C 3O0RL 1EJ6A 1EHAA 2DBJA 4G7VL 5IESH 3FQTA 3VCLA 3VFNA 4DKEL 2OK0H 5GRVL 1QR1B 4MD4A 4WGVB 5BRZD 4OZHB 5D71L 4F57L 4DZBA 1KTKE 2JIXA 5KVGL 3QZWB 3NFSL 4KTDL 3GB7A 4Y5YB 4JFDA 2KBGA 3I6LE 4IOIA 3EYUL 4FXKA 1S3KL 4WEUD 3ZDYF 5IIEA 2GKIA 32C2A 4QTIH 2CLVA 3ALXA 5H35B 3EO1A 2WMPA 1X4XA 3NCJL 4R26H 1FO0B 4QEGA 3EGSA 5D6CB 5FK9B 4HBCL 4Q58C 1XMWA 5AUMA 3W2DL 1FL3A 5KSBF 2AQ1A 3VRIA 1BF2A 3UZQA 3AU1A 2X41A 4PJCA 4RNRB 3NTCH 4UUJB 2ZJSH 5M94B 4X7TA 4MNQD 5EU6A 1AI1H 3LS4L 1CCZA 2GSIB 5DYOA 1IAIL 5I8KL 4FZ8L 4HPYH 3MGTA 2DICA 5B38A 1AGBB 1LQSR 2CDEB 4PJBE 1OTSC 1HZHH 5F9JB 2YBRB 4QHKJ 4ZNEE 2C1OA 2EDQA 4TNWF 4CVUA 1RZ8B 4NC1C 1Q9KA 4ZQKA 1WTLA 2NY5L 3FQTB 5E03A 3VCLB 5DD5L 3L1OH 3QQ9D 4OKDA 2HJFA 2ZUTA 4LRNL 4ELMF 4LCYB 5CIPH 1FE8L 4JFHE 3UYPA 1CYGA 2GI7A 4L8BB 4NQDB 1IEAB 1MHEA 3NIDF 4G7YH 4OZIF 1T0NA 5BVPH 2IANE 2BX5A 2W92A 3QNXA 2PCPA 3QCVL 5DJ2B 4MX7A 1KPUA 4OFPA 4UNTA 1HQ4A 2CKBA 4NQED 3DRTB 4LDEB 1QBLL 4HBQA 2DS4A 4HWUA 2R4SH 5D1XA 2EE9A 3CXHJ 1WCBA 4LOUC 4KRMB 5DTFA 4TTDC 3UXFA 1HHJB 1OWWA 2PO6C 1T1XB 3OJMB 2XACC 1CTOA 1PKOA 5SWQB 4LVNC 3ZDZF 3NGBC 2FIKA 4HWBA 1YY9C 5EB9A 2BXZA 1DSFH 4ZFOB 4Y8AA 1NQBA 2FWOA 1Q9LA 2YPLA 2H8PB 1T7WA 4JDVA 4PJIF 4TOYL 5CD3B 1H3PH 5CGYC 4KKBC 5HHMD 5I16A 4P4KA 5KSAB 3RVUD 3T3MF 1HHKA 3B2VH 4B7IA 3MRNB 4V1DB 4DKFH 1NLBL 2YEZB 4YUEH 2OL3B 4QRSA 4MQSB 5K59F 5E6ZA 3F58L 5A40E 1DBML 4G9FE 4PBXA 4HAGA 2AABH 1EH9A 2EO1A 5BMFH 5ITFB 2HFEA 4LVEA 2QR0B 3LN4B 4ODTL 1YUHA 1BQLH 1LE9A 3BDXA 4IM8A 1K8DA 2OR7A 3GI9L 4P2RE 5FYJD 3MV9B 5KANG 3GUTB 3QPXH 2EDOA 1MCHA 1EBPA 3L5JA 4P5KA 3GI9H 1T22B 2DMKA 5EU5B 4PJDA 3VXUA 5GRXG 5EN2B 3I9GL 1UWEH 4RWYH 4GLRI 2VN4A 2YMXH 3B9KD 4PP1D 3WKMH 2IALA 2NXYB 3VXUB 3HKFA 1R24A 4YHNA 5T5NG 2EEBA 2VLKD 4QHUA 5DJYB 1A1NA 3QDGA 4DN4L 4X6CE 1TLKA 4YX2L 4HJ0C 15C8H 4HGKC 1LNUB 4RMWA 5SWQA 4NQVA 3CFKA 4I2XB 4O51A 1R6VA 1JV5B 3QUKA 1GC1H 2JCCA 5GHWL 4MS8A 4JRYA 3KR3H 4HS6B 2HWZH 4NN5C 1LQVA 4O2CB 5TE6L 1JHKH 3E6HB 1QPXA 1RJCA 1MIEL 5HJ3B 4PJHE 2NY5C 3KPPA 5F7FA 1RUKH 4PY7B 1CGXA 5E6YA 4XH2B 4OD1L 4UDUB 5HHOE 1JP5A 1U3JA 4Z7WB 2XWBA 2GAZA 3O2WL 1NBQA 2WBJC 3O41B 1NAML 5EZOH 1MIEH 1IAOA 1V7NH 3ZDXE 4YDLB 5DR5L 2HLFC 4HK3N 3HMXL 1D6EA 2RQ8A 4LSUL 4XGZA 4Y4FC 4JKLA 3GNMH 5SV4A 2X9WA 3QEGH 3NABL 2I07B 4M62H 4ONFH 2VXUH 4NO0B 3LCYA 5FA3B 3QSKB 4MA7H 4Y4FA 3O9WD 1OQXA 1FLRL 4QOKE 2B1HH 1BOGB 5D7JC 5AUMB 2FJGA 5BOPA 1YEFL 1ZGLM 4P2QA 1X9QA 3BZEA 2BY1A 1BBJB 2NW2B 2JIXD 4KRNA 1WQVT 2YKLH 3OPZH 5ESVA 1U58B 1OP5K 4RGNE 3QP3A 2D7QA 1U8JA 4AEFA 1CD9B 1X3DA 3A6BH 3L3DB 3PHOB 3CFDA 3IAQA 1NCCH 3IFPB 5SWZE 1NDMB 4K3JH 3G6AB 4WU7B 4LSTH 4P2RA 1UB5A 1MAKA 1JNNL 1H15B 4JDTH 2KL6A 1Y18A 3LV3A 5F1IB 2F8XC 3D5OF 2EECA 3L95A 2JLLA 4XMLH 2LQRA 1DN2A 4LBEA 4XHQA 1CFSA 4OLUH 2V5RA 3LSOB 1O7SA 2X5PA 5KVEH 5IWLA 4KAQL 3FO2B 1S7VA 3VWJC 3HI6L 4P2OD 5GS1B 3DGCR 1UA6H 2IAMA 2V2TA 1CLYL 3NAAL 4KKBD 3EJZC 1MHCB 3OR7A 4BSVA 2CH8A 2BNRE 1D7FA 1TENA 4ZFFA 3W9DB 3PQYD 3RPIA 4F8TA 2HT2C 1CXHA 3MNVA 4R90L 3IJYA 3NACL 1I85C 1F02I 3KJ6H 1IGCH 2ESVD 2EH8L 3SKOA 1K6QL 4UV7L 3OV6A 2H3NA 1CD0A 3RI5K 5EC2B 3TBYA 1WIPA 3H0TB 1EZVY 1TITA 1DE4B 4OF0A 1UVQB 3HPLB 3EYVB 2GCYA 4XNMB 3P2TA 4JQVC 1INEL 3SY0B 2FL5B 2WLZA 1RI8A 2YC1B 4K3HA 2JE8A 4DGIH 2F58H 3H7LA 3MOBH 4PBWD 4IRJA 3MRHA 4HXAH 1INEH 1DQJB 2UWEF 4JJ5B 4PREA 1U0QA 4CDGC 1BQHG 4H1LB 5JW4R 5MENB 3PHQA 1IT9L 4HZLB 3REWB 4PTTB 5D1QA 1CU4L 3GHBH 4TNVK 4CMMB 2EZ0D 4DK6A 1G0XA 4QRUB 4QT5A 4D9QD 3RZCD 4Y4KA 1T03L 1BIHA 5BV7C 2MNUA 1A7BA 3ZT6A 4MD5B 4V3DB 4JFFD 5HDQH 5DUMH 5TE7L 1BFTA 1KC5H 1FFPB 1EHLL 2IAND 2VXVL 3BDBA 5HVGB 2CMRH 5GS0L 3RKDD 3A67L 4XBEL 2X1XR 1Y0LA 2Y7QB 2AJ3A 5EA0H 1LEIA 3OX8B 3WBDA 1QZ1A 2XWJB 5GGSY 3I75A 3N1FC 3HFMH 4MJID 4ZFFB 4ODVH 5HHMB 1KJ2L 3KPQB 3SDYL 4GAYB 2DJSA 3OKEA 2XRAL 4XC3H 4C83B 4JRXA 2A83B 5HD8C 3TO2A 1S7UB 5IMOA 3UP1A 3FCTB 5HY9B 1G7HA 1MQKH 1A6TA 4JZNB 1VESA 3ZKND 5IEKB 2YA0A 2ED9A 1W2KT 5BVJB 1U8PB 3OKEB 4LSQH 3MFGB 1DJSA 1QLEH 1KN2H 1TVHA 4XNXL 3KS0H 2VABB 4FQ1L 5KS9A 4I48A 1OT1A 3ZKNC 1SJEB 4PV8A 5ADOH 4ZUSA 1A1OA 5KSBA 1UJ3C 2VH5H 2BP3A 3L3KA 4WNQA 2NXZB 3Q6GH 4ZAKA 5ECJE 4D3CH 4ETQB 5GIRB 5ESAA 2YOCA 4IJ3B 1XF2A 5FOJA 3V0WL 4MD5A 2QJDA 3FOLB 4Y88A 2NY7L 3QDJA 5F89A 3AM8A 5DT1L 4E5XA 3MNVB 4AEIH 1YYML 1E6OH 1G9EA 4ELME 1FBIH 5CEZD 3HG1E 4G9FD 4OB5H 1YMMD 3ZHDA 4ZFZA 5IB2B 3U0WH 5F9DC 4L4TB 5CJOH 3VFPA 2GJ6E 4FTVD 3MLXL 1JFMA 2X4OB 4XVTL 3BPNC 4HPOL 1AXIB 3ARDC 2EYTA 4NNPH 2PXYA 3SDCB 5HDBE 4XHJD 4OAWA 5CSBA 5CSGA 1OAQL 2ICEB 1T1XA 3K3QA 3K46A 4HT1L 3V8CA 1LDPL 5EU3B 3UYOD 1M71B 2DMCA 1KN4L 2EC9U 5EUKB 2AV7B 3OBAA 1HI6B 2Z31C 2W9EH 2OJZL 5DRXA 2VQ1B 3U48A 3VFTB 1F4XH 3O81A 1KGCD 1Q9LB 1CFVH 4KJQC 5FYJE 2CGRH 2E7HA 2R0KL 3MRCB 4B50A 2R69H 5EBLB 4HZAA 3VGHA 3S3PA 1N59A 2VYRE 1J10A 2DTML 3ARRA 4FNLH 1N8ZA 2NW3B 3BP6A 2PYFB 3O6ML 4D0CA 2PW2A 5EIIB 3MRBA 1OP9A 5E0QA 3HMXA 2QBWA 5K9QG 3EDDA 4U1JA 4ISVB 3BHBA 3ULVF 1F11B 4PJ5E 4DKFL 4J4PD 1MJJB 3BPCA 2QKIA 5T1LA 2AEQL 3JTCA 1UZ6F 1WZ1H 3O0RH 5DVKA 3EO9L 1KTRL 3TV3L 4JQXC 3SGJA 1ZLUH 3HS0B 4R97B 4JY4B 4LNVA 2IH1A 3PL6C 1TJGL 4OI9A 5C0EB 3O2DH 4APQC 3PWLB 4F7EA 5E4IA 1H3WM 1IC4L 2OYPA 5CINH 5BS0A 1A8JH 1VFAB 2VIRA 3BESR 1BZQK 3IAGC 1AD9A 3RIAK 3UTSB 5D7KE 4L9DA 3O2DL 4Z6AT 1FVCB 1KNOA 3ZZ1A 3RVUC 4P9HH 1JYXA 2BNQA 1EAPA 5DEGA 1UJ3A 3SPVA 1KCUH 5EBWB 2IPKA 3MROB 3K7UA 3HI1B 1OGTB 3L5IA 1CTNA 4FFZH 4XI5C 1MPAL 4PYHA 2C9AA 4PP2A 3D25B 4P2OA 4YE4L 1JF5A 1BAFH 1NC4B 4DKAA 1IGFH 5BO1H 4Y2DA 4DN4H 3STBA 4LNRA 1NC4D 5DHYB 4TPRL 1JGVL 3FT3B 3NCEB 4N68A 3RVVD 1YMME 2P5WD 1IM9B 4Y16A 3QJFB 3HG1B 2VZTA 3QI9D 1JGLL 2VDNH 3KR3L 1XIWA 4U1JB 3VXPB 1A3LH 2JJTC 2NY1C 3SDAD 3UTZB 2W07A 3TFKC 1G7QA 1N6QL 1OARH 4CNIB 5JW5A 5ISZA 3LVEA 4WEBH 5T3XH 4XWOD 2YPLD 1JFQH 5F3BB 3BHBB 2YUWA 1RSFA 1S9WA 3G6JA 1X7QA 3C6SA 1YEIL 5CZVH 5DUBA 1J0IA 4RMVA 3BZ4A 4K7PH 4OI8A 5I1EH 1I7RB 4YDVA 4OUOA 1KEML 5K9KA 4RFNB 4TQEH 2CR3A 1XF4A 1NAKL 3ARSA 4CVZB 2QADD 1TNNA 4Q74A 3OXSA 5CFHA 2Q3AA 5EFIB 4Q97A 2H32A 4M7LT 4E0RA 3OR6B 4P46D 4TSBL 1NBZB 3AUVA 4Y5YC 5J89A 3PWVB 1KLUA 1J11A 1S78D 5CP3H 4MJ5A 4DAGL 2PYEA 4UIKL 5AEAA 2LFGA 4M02A 2DBLL 4WI9A 3V0VA 2GTWB 4KK9C 3W39B 1C12A 1MHHB 2VB5A 5IQ9A 3FT3A 4LPYA 3N85H 2P5ED 1WWBX 2HRPH 5D2NC 1UKSA 3A6BL 3GSQA 3ARUA 4XP6L 3ISWA 4L8DA 2QSTA 2PO6B 1BPVA 3SDAB 4PGDA 5LVEA 4LSDA 4Y4HC 4OLXL 3ECBB 5EPMA 2X4NA 4TYUA 4XP6H 3GSQB 2Q1EA 4QHNA 5ETUA 4NHUE 1FYTD 2G5RA 3KPLB 1RZGB 4CBPA 2Z31D 4L8SA 4NC2B 4D9LL 3VD5A 2H26A 4NRXB 5E99L 4EXPX 3BSZH 5HGHB 2HLAA 5HI4D 5C07B 3U9PL 1FNGA 1PVHA 1GOHA 4KHXH 4P4KB 4NRZB 5KSAA 1G7PB 3SGKA 3VW3L 4KXZH 4UOJA 5KN5B 1ZA3A 4R7DB 4UMGA 2E5EA 5CCKL 1AJ7L 1JGDB 2F19L 3PWPD 4YAQA 3HI5L 1VEPA 5KSAC 3KWWA 3TYFA 5HHPA 1QFWM 4NQCD 4F7CB 3VI3E 1GGBL 2GY5A 2B39A 2IG2L 4HH9A 3WFHB 1LK2A 2HFEB 4K8RL 2GQHA 3LOWA 3PWNB 5BZDA 4DN3L 2EDXA 5E5UB 2G5BA 4JLRA 4PJFE 3CSPA 3SDCC 1A6UL 4I2XE 2AXHA 1X5IA 2AQ2A 4LLDA 2F5AH 3HUJE 2DLEA 4YK4C 1S5IL 5F96H 4LASL 5T3XE 1LWRA 3MBXH 5IQ7L 4XCEA 3S6CA 2C4FT 4TRPL 4GG6F 4LIQH 2AGJH 1G9NL 12E8H 1WFTA 4L5FH 3SJVB 1DE4A 1WBZB 4CU8A 3MBXL 5IQ7H 5KJRL 4NFDA 1JPFA 3UBXI 5A1AA 3DIFB 3L3JB 5D2NE 5LJYH 4B0MM 2H45A 4YX2H 3T0XA 5E94A 4P23B 3OZ9L 2E27H 1KG0A 2W65B 1U3HD 4K2UL 3W11D 5D7LD 5C8JB 1F8TL 2R2EA 4MQ7A 4YLQT 2ZNWA 5DQJB 5IFAH 4JFYA 1CG9B 2BFVH 1FNLA 3CVHB 2VUYA 4NKIL 1CXEA 3I3BA 4K94L 1QYGH 3TIEA 3JV6B 3GEWB 1HHGB 1KV3A 4RIRA 3S5LG 3BH8B 4AEEA 1FAIL 1NFDF 1DEDA 4LARH 4R4NC 5EA0L 2HKHL 4G6KL 2C3WA 4WJ5B 2ZCKL 1N4XL 1U8IB 4CMHC 3MLUH 5D9SB 4R6UA 3WIHA 4IRSA 1R5WA 4ODVL 3IDJB 4HWZA 4PJ5B 4J3XA 4Z7QF 2IQ9H 4DGYH 1G6RL 1HWGB 4HIXH 3O41A 2H41A 2D4FA 4MGXA 5JO5B 1BEYH 2ZNXA 3THMH 2F74B 4F7PA 3QXWA 4NGHH 5T3ZH 2FH8A 1T7XA 4F9LC 3BGMA 4EDWH 1FRGH 3R8BB 4ODXB 4LLMA 4JPKH 2X4TA 3S3JA 4CRPA 4Z7OE 1EXUA 3PL6A 1D9KB 1CFTA 3QYCA 3C9NA 1S7RB 4PFEA 4U3HA 3TA3A 1BZ7B 1QTYT 2I9TA 4NN7C 4P2YA 2X4TB 4IHOB 1I1RA 5GGSB 3UJTL 3QUXA 1G7MA 3QIUC 3WUWB 1MEXL 1VHPA 4F7CA 5AYQA 5KS9F 4QTHA 4M1DH 2E9JA 3QWRA 1CICA 3QIBA 2A0LC 4I3SH 3S4SG 4P23C 3ZE1E 3I6GA 3TJHC 2X4PB 3KYAA 3CCHB 5DDHB 5IT2H 2GAZB 4YXLH 5E1HB 1S7TA 5E08H 1SM3L 1N3NA 3UAJD 2BVQA 4NDMA 1FVDB 4NNPL 5D2LE 2ESVB 2BVUA 5FA4B 4AENB 4DQOL 4D8PA 4O4YL 4HAFA 3VXME 4GXVL 5KVFH 1EGJH 25C8H 3Q1SH 4HIHA 1E4XI 1XGQB 4G43B 4ZS7H 1ZV5A 4G9DA 2OTPA 3D39D 4OSUH 1JN6A 4XXDB 1Z3GL 4ZFGH 1A9BB 2ZUUA 3O6KL 4DZ8B 5C8JA 3H0TA 3NIFF 1M7DB 4NWUL 4P5TA 4TVPE 3UO1H 3S8WA 5C9JB 1DFBH 4QGTA 1MNUH 1WEJL 1N7ML 1HOCB 2YS4A 3G04B 1F3RB 5CJ5A 3DV4A 1WISA 5C1MB 2ZSVB 3ARGC 2E9BA 1VFBB 1JMXA 1T1WA 1OTUD 1UXWB 2LABA 1YY8B 4PJ8A 4OF3A 4NWUH 4RGMB 3O2VL 5CLWA 1UVQA 3QIWA 4WTWA 2QSVA 4C54A 2D0HA 3CK0H 4I18C 4C56E 2DQFB 1TVHB 2WQRA 4RBPH 1HH6A 3TFKD 1B2WH 2R8SL 1RUQH 3DMMD 1NSNH 3DX8B 4LDLB 2WUCL 3IAPA 5F21B 4AMKH 1P69B 3G9VA 1WBYB 4XBPB 4K94C 2HTLD 1Q9WA 3EYUH 3WEXA 1NLDH 5DZNA 4M48L 3BGMB 4P5MA 1JTOA 3B9AA 4S2SA 1KEGL 5DS8B 1RJLA 3SE3A 4U1MA 4LPVA 4RISL 5BJTA 2ITDA 5F7MC 5DMKB 2OK0L 2VDKL 3V4UL 4S1QL 4XZUA 5F8QC 1OOAA 4HBCH 1P5VA 4PRIB 1OVZA 1VADB 2ZUQB 3GSNB 5DJ6B 1IKNA 1MWAH 1T7VA 3FJTA 4UIMA 4UOW1 3GSXA 3WDIA 2BHUA 1FFOA 2PR4L 2XZAH 3CMOH 4P3DA 4XTRC 3ARGD 4JO4H 3WFBL 5J7CC 4OZIE 4S1DC 3MLTA 4OM1H 4ZUWA 3JTTA 5GPRA 1F97A 1VB9A 4OZIA 4N90E 3SPVB 1MPAH 5FGSA 1RK1A 4PG9B 2A9MH 4FMKA 5AG9A 1J05A 4NO3A 2EDDA 4ELKA 3P30H 4G8FA 3W2DH 5BO1L 3DX6A 3MCLH 4Z0BL 5EZLB 2HN7B 1L7IH 3VXUD 2A9ML 1DBBL 3UTTD 2BVQB 4NDMB 1JGLH 1R5IA 5CBAB 2OX5A 3F6LA 3RZCA 5GGTH 3E6FB 1NEZG 1RIHL 4RX4D 2HTLC 3KPSB 4HX1A 2ZUWA 1J0YA 5ABDE 2WIMA 4K7FB 1N6QH 1S9VA 3FTGA 1PZUB 4U1NA 2ZPKH 4AEIL 1I1AC 2W38A 4MCZA 2P49B 4U1LB 1MI5E 1UWXH 2WIIA 2OSLB 1A3RH 43C9A 1RZKL 3OXRB 2L4OA 4UV4H 2CIKA 2CSPA 1BQHB 3K81A 3FONA 3W81A 3LEXA 2IC2A 3QB7C 2VOTA 4ZDHB 1RULH 3FO9A 4L1HA 3T3ME 3NA9L 3BO8A 4C56B 2Y25A 2PF6A 4LRNH 3FAWA 5T1LD 2VKXA 1IE5A 2CKBL 1WC7A 4HQQL 2D7TL 2NY6D 4C4KT 1WV7T 3CFIC 3PE9A 3DVIA 1RK1B 2BY0A 4TSBH 1PQZA 4I0PB 5HD8D 5FKPB 1TCRB 4IBLT 5KZCB 4ZUWB 2AK4E 3QULA 4X7DC 5A2LH 3ZSTA 3MRCA 4L29A 1MI5B 3AGVA 1LO5B 5JIHA 2C7UA 5EU6B 3RWGB 1XH3B 2MQ3A 4PRPD 4NQCE 2FEDD 1WWWX 4WO4A 4WHTA 4NNYA 3KPSA 3VD7A 3WNOA 3P73A 3GSRB 4ODSL 1KXQE 2V5MA 3VH8B 3X17A 2X4OA 3V52H 1HCVA 2NZIA 4OIIH 4FNLL 2FECL 4EVNB 5CEZL 3JWOC 3WLWD 3RWIB 3VU2A 5DLML 1ONQB 3D0VB 4NM8H 4LCYA 2XA8H 3SE3C 3P9MB 5E8OB 1A6WH 3BSZL 2K3TA 3OJ2C 5J06A 2CXGA 4I3GA 4O51B 3RJQB 3KPOB 5E5MA 1BQLL 5HGGS 4GAGL 1WFOA 4IJ3C 4CL7A 3IJSB 5DFVD 4DOHB 1FFNB 2PTTA 2AK4D 1QRNB 3S88L 2MTPA 3HZVA 1NEZB 4U6XB 5HHOB 4PG9A 4HUXB 5DQDH 3S36L 3DIFA 1B0GA 3GMPB 5JHDD 5TF0A 1GZPB 4Z7UE 5CWSB 2O93L 4R96B 5CJXA 3S88H 1YJDL 2O5ZL 2P47B 2C4XA 5C0RH 1T0MA 2Y9RT 4OD3L 5FHAL 1J7VR 4NZJA 3QFDA 4YHOH 2DDQH 3EOBB 3CH1A 4U1KA 4XAKD 2YMXL 5I74C 3KYOA 2FIKB 5EWIL 2XQBH 1J1XH 2A83A 5FO7A 1A9BA 4NKQB 2PXYC 1JGUL 3U2SB 1BMGA 1PKQA 5A2KH 5JHLL 5HDOA 4XI5D 3M17A 2ZOLA 5D7SH 4UOW0 4TRPH 5CEYA 1U8PA 5TFSH 3BPLC 4FS0A 4MMZC 1G7IB 4Y5XA 2XG4A 1NGQH 4J23A 1UWEL 4LLUA 2P4AB 3TO4A 2W91A 5I8CA 4ODBD 2VZVA 4GS7B 1N0XH 1I1AD 5GRUH 1XT5A 5GGUB 3GRWA 1YYLH 4FQXD 5GIRA 5LBSL 1YNKH 4K23L 4HEME 3PIQA 4L3EB 4WY7H 2GJZA 4H8WC 4K94H 1MVUA 4ONGH 3EYOB 3OB8A 2J8HA 4U1GB 1MSPA 2CRIA 3EDFA 3W9EA 1E27B 3MREA 3RKPA 1TZHA 4PRAA 1JFQL 5IFHH 5MEPA 3IJHB 1OLZA 4JZOA 5DURB 2FBJL 5ICXB 4K9EC 3E8UL 3EOAA 5I1EL 2NY1B 3B83A 5FIEA 2C3VB 1QHOA 3MLSL 2EXYC 1A7PH 4KK6C 5EG6C 4EQ2A 1MELA 4WU5A 3OF6D 4XNYL 3X14B 1JWUA 4Y2DC 1SYSB 3MCKA 4PRBB 5ICXA 3OPZL 5CJQL 3BJ91 3L3IB 4LCCB 3NABH 5CP3A 4Y2DD 3VE0A 2QADB 2Z4QB 1JE6A 1L6ZA 1T0MB 3L5HA 4UIKH 1I7TA 1MRDH 4DVRH 4JFXB 3SE9H 2H2SC 1FLRH 3GMRB 4LGPB 3S37H 1NCNA 4WWKD 2X4RB 4P0DA 1T89A 2E7CA 4JHAL 3AY4C 4C56D 1EEQA 2VL5B 1IKNC 3M17B 1B0GB 3GMOB 2E6QA 2R2HB 4M4PA 4UNVA 3ZYOA 3NBNA 4LBEB 4WUKL 4YDKL 3MODH 1KTLB 4OFYD 1N3NB 1U8NB 4YDJB 4CKVX 1ZXQA 2OJEB 2XZQL 3NH7H 2BOCB 2YRZA 3D18B 4Y16C 4J7RA 1F4HA 5I1LB 1FCCA 1YEKH 4X4YA 5I66B 5SV3A 1MWAB 1QBML 2VLRD 1CICB 4Z77A 3V2AR 1DQDL 5I9QC 3DUHA 4X5XA 5HYIA 1R3KB 3ARDA 4PJXA 4J12A 2LVEA 4JN2B 4F7EB 4L1DA 2GITB 4BZ2L 1PSKH 3RQ3A 1KCRL 2X9XA 4LLVB 4N0UA 1OAUL 4K8RH 2VAAB 1OD7A 3V4VH 2J8UA 1CGUA 3D69A 4OV5A 1IEBB 3W0WE 3QULB 4PJBB 4Y5VC 3BQUC 3PHOA 5CIPA 4P46C 3DARA 3FN0H 3RJDA 3TJEH 3MX0A 5FHBL 1T1YB 4OGXH 2DWEA 5CAYB 2Q6WB 4Y4FB 2DQJH 2J8UB 1I8MA 4YDLC 1IGJA 3E3QA 1D5IL 1EAJA 5DQJA 3CAFA 3MV7A 1MCLA 1Y6KR 5EU3A 4BFGA 2X6MA 4JFXA 2YD2A 1TZIA 4MQTB 4Z8FL 4L3AA 4ZD3L 1HEZA 1OP3H 3D6GA 3SCMD 1NDGA 4PR5B 4M4RA 3SO3B 4Z77B 3VD3A 4XRCB 1Z9LA 3QWOA 2VLJE 1HIML 1S5HB 5AD0B 3BUYA 1EO8H 1OLLA 1A4JB 4XNQA 4XCNB 5DJAA 5F9WC 1U8NA 2J3SA 4YDJA 4H26A 3QG6A 4G8EA 3BP6B 3V9FA 3B5HA 1R5IB 5CBAA 3TBTA 2ZOKA 4YAQB 5C0GA 5L88L 4L9LC 4DGVL 4AH2A 3MRDA 4WI6A 2KDGA 4XP1H 5MP6H 1U2HA 1CIDA 1RHHB 4NKMB 3V4PL 4JO2H 1MCBA 4G6FD 3FTGB 4NO3B 1RURL 2CJUL 4OTXH 4PGEB 5E2JA 3HAEH 3UTSD 3PWVA 1SJEA 4PV8B 6FABL 3MLTB 3MXWH 2AK4A 4Y8DC 4NO2B 4JVWA 1KCKA 4POUB 4OCYH 2ADIA 4XC3L 1CIUA 5HHNB 3BD5A 1FRGL 1LK3L 1D3CA 1U93B 3CD4A 2BSSB 3DVFA 4D3CL 5BQ7B 1JJUA 3PUCA 2XI9A 4D0DB 6FABH 1ZLWH 1QKZH 5E70A 2H2PC 2B7DT 3TPUA 1KB5A 3CVIH 1X4YA 5GGRB 3C2AH 1KN2L 4NC0B 4OQTA 2VLRE 5IBTL 3QUKB 5FUCC 3U0WL 4HIJA 1UM6H 1ZOXA 2VH5L 1NKRA 4ZDHA 4TNVF 4IRJB 1A2YA 5CEXA 3MUJA 2NY5H 5HPMA 2G9HB 2DQTH 4H26B 3MC0A 3BXNB 3E2HC 4EKXA 2DQFA 3WDHA 1UM5L 3FFCD 1JIBA 3BYYA 1HH6B 1U92A 5DURD 1GZQB 4PJ7F 1FZOB 3LKSA 5E2TH 4Y16B 3NPZB 5ID0B 4P3DB 3QIUA 2XWJA 5I8EB 3OKKB 4DWHA 4ERSL 1A7QH 3NVQA 4NBZB 2C3VA 1ITBB 3LRHA 3DYMA 4X80H 3MV11 4JQXA 5KVFL 5IJKC 3FAXA 4JJ5A 4PREB 2YN5A 3P0VH 5BJTB 5DMGC 2PXYD 2YD4A 1AHWB 1FVEA 2CGRL 1YPZA 1DEEB 4JQVA 4QHMB 2NY0D 4I0PC 5F3BA 4XPHH 3J8F7 2OMNA 2E9WA 3KPNB 2C4FU 3SN6N 3QDMB 3GBLA 5J9PA 1MHPH 4GAYA 2FLBT 3ET9F 5HI3D 2BMKB 2JB6B 4D0BA 1IBGL 3O9WC 5BOZG 2I24N 3RWFA 3V7AG 4IDJH 2L7JA 1KJMA 3LMJL 3CLEL 1YMMB 2FX8H 5CMAA 2FO4B 5HPOA 4NKOA 2OTUA 3ARVA 1ODAA 1R3HA 2CUMA 2DM7A 4RFOH 5T5FH 3H9SE 5F97E 2M26A 2HTKD 2FJHB 2IPTL 3R8QA 4HUXA 1ZSDB 2UY7A 4LVOB 4QT5B 1A9EB 1B6UA 2UZXB 1A22B 3PJSB 2E7BA 4Q6YA 3DXAD 3NCMA 5C6TL 3MBEB 3MV01 3VG9C 1M7DA 3DI2B 1CVSC 2AJYL 1E4KA 4OUUA 1RK0B 2CRYA 2EIZB 4JN1L 3ALWA 1D5XB 3IETB 4P23D 3S35L 5FOBB 4U6VH 4NN7B 2N7BA 3UTSE 1KJ3L 2EXYD 4Z76B 2YD3A 1MCPL 5FHAH 1S3KH 1UZ8B 1G0YR 3QPXL 1XGRB 3T3PE 5IROC 1YEJL 4XPGH 3TT3L 5EBMA 3GMPA 5C0EA 1TZGH 4KU1A 4PGCB 2XZAL 2QV2A 4FABH 4PG2C 1MCPH 1T89C 1UADC 1J1PL 3CFDB 4F7PB 1VDGA 3B9DA 1QSFB 3C5JA 5CD3A 4X7TB 3CU7A 2P5EE 3ULVE 5FB8B 4FABL 3G08A 4ZPVB 1K5NB 4R3SB 4OCXH 1AH1A 1EFXA 5DEGB 4OM0H 4YFLF 3OAZK 2A2QT 2OR8A 2Y6SD 3RX7A 2DLFL 4YWGL 1A4KB 2C3XA 5L8KB 5EO0B 4YHZH 2ZKHL 1F6FB 3HC4L 1TTFA 1JUFA 1BVLA 3B43A 4IMKA 2FJHA 4KMLB 1CZ8H 1EGJA 2IQAB 2CLZA 2HVKA 4P2QB 2R23A 3EUUA 3OAUH 3LIZL 3R06B 5CZVL 3IDYC 1KCVH 4MQXD 3GMRA 4NT6B 1DN0B 1A3LL 4C4KO 4PV9B 4JFED 3AAZB 3SDXA 3AY4A 2EYSA 3JV4A 1DR9A 2VDLL 1X5JA 1H8NA 4K7FA 3K4DA 5DMGD 4WCYH 2ITDB 5DR5H 2NTSP 2EYTB 2FIRT 3P9LB 3V6FA 8CGTA 4GKZA 3NIDE 5FCUH 4YNYA 1UZ8A 3E3QE 3DROB 5DXWA 3ME0A 1T80A 1JWMB 4KAQH 5EOQL 1CG9A 3MJ7A 6CGTA 4TUKH 5SWSA 2PYFA 5J12C 1AXTL 2WUBH 4R8WH 3LQAC 1S7UA 5IMOB 1T83C 1XGUB 3S98A 4GRMA 1LK2B 4HJJH 1KLFA 1YDPB 1WC7B 4WUUE 2P7TA 3KYMA 3GMOA 1EERB 1A9EA 2HKFL 35C8H 4P46A 1LVEA 3HAEG 2X1PA 1JRHH 5C0AD 2MMXA 1JV5A 3FB8A 3HC3H 5EU6D 5SX4H 2BNRA 1MQ8A 3S4SB 3HAEB 2DBLH 5EN2A 3JUZA 1PY9A 1X5XA 2NX5E 4PJFF 3RVTC 1PLGH 3ZE2E 4MJIB 4LHUB 1WWCA 4LCWB 3QDME 2E7LA 4Y1AE 1FZKB 5I76B 3UTQB 4W4OA 1L0YA 5FFLA 2XYCA 4BSWA 1MWAA 1WBZA 4PJIE 4Q7DA 5MERB 4HIJB 2QHRH 3B2UC 4JHBA 3OKDB 2VDQH 2A6IA 1W8NA 3QHFL 4PLKC 3SGJC 3AB0B 3LN9A 2WWMC 2XPGB 1G1YA 2I60L 3GSWB 2NR6C 2WLYA 1HKLH 3VFSB 1KTLA 1RZGA 3RAJL 2ERJB 3UX9B 4OLVL 5DMYA 2N1KA 1DANT 1T2QH 3L9RB 4YGAB 5D70L 3VI4F 2BOBB 3HTLX 4R7NB 4C83A 1GGUA 4HS3B 3QZWA 1CLYH 3NAAH 1MLCA 3MACL 5L2KB 5HGBB 4U7KA 4XPTH 3TBWB 2X05A 2XN9A 3TWCL 4GAFB 4ZXBA 1B90A 1YJDH 2O5ZH 3O6LL 5C0RL 1C5DA 5H94A 1QEWA 3DMMB 4N9OB 1BFVH 5EORL 3VRLF 5IQ9B 1JGDA 3UAJC 3DSFH 4WFFD 1BVZA 4M9PA 3VGEA 3TBWA 3IT8D 1FNEB 4CVZA 3RU8H 3NGBB 3UPRB 3KXFA 4QY8A 1NMCB 3DSFL 2DQIL 4WW1B 4QCIB 5IB1B 1JF6A 1OTTC 1KIRA 3HAEA 3U4EA 5KAQG 5E00A 4LKCB 1OCWH 5LCVL 2DKSA 4GOSA 3QIWC 3D87B 3BWAB 4LU5H 1H3UA 4O58L 5EPMB 5I1DA 1QLRB 3V6FB 4LIQL 5EOTB 1OAYL 1KPVB 5GHWH 1Q0XH 5JXEA 4LLQB 1KELH 4LU5L 1MFDL 2DLIA 4PRID 3EOBA 3IDYB 2GJJA 4OQTH 2AQ3A 2R0WL 2HJFB 1ZK9A 1J0JA 2P5WE 4Y4HD 5IFAL 5T1MA 5TE4H 3JWNC 5DUBB 2WP3O 3BOVA 1YYMH 1AP2A 1E6OL 2PYED 2RAMA 1D9KC 4BFIA 4FP8H 3HLAB 1RQ5A 5CD5D 1IZKA 3KPMA 3HMXH 5T3ZL 4RIRB 3VG0H 1WFNA 3ZDXF 3QO1B 1RIUH 1RPQA 2OZ4L 2M1KA 1Z9MA 2DJ4A 3OWEA 3GSUB 4WUUA 4OLZL 5GGVL 1F4AA 2HJKB 4DK3A 1BOGA 2IAMB 3P4OA 1Z2KA 1AGBA 4TVSa 2BNQB 1UYWL 2DQUH 3TZVD 1F58H 2F15A 2IQ9L 3TN0B 7FABL 3SDDA 1MCDA 4JGJA 5ALCL 3K2MC 2P46B 4CMHB 3BVNB 3VXNA 3MYJB 4AQOA 3O3EB 1CLZL 3ZKXB 4XCCH 5EC2A 5C9KA 3C8DA 5K9OA 2CIIB 2WWMD 5KW9H 2VXQL 4MHHI 4JPKL 3P4MB 4ZUVA 2FRGP 3T04D 2BOCA 2GK2A 4YXHL 3T77B 3Q6FB 5L6YH 1CLZH 1Q94B 1A7OL 4Z9KB 3O3EA 3V6BR 4NQUA 4ODUA 1E4WH 1KXTB 2XZCL 1M1SA 3O11A 1IVLA 3HE7D 4YXKL 1EEYB 3HR5A 5IK3A 3TCXA 2OL3L 4W4OC 1NBYA 5C0BE 2Z35B 5IR1B 3RGHA 4F33B 3KYNB 3QI9C 5HI5C 1WJ3A 4P3WA 4ZUTB 4ZOAA 3DGGA 2N56A 4YQXL 1IFHL 4QHKI 3R0NA 1EA9C 1N8ZB 3U30B 1H3GA 2AEQH 3I84A 3B8SA 3HLAA 3JTSA 1QSZA 3FRPG 1AGEA 4PJAE 5LAXA 4YXLL 4CVWA 3VXRB 4LCIL 3PWUA 3RPKA 1JZ2A 4PRBA 1R3KA 3T0AA 3WS3B 4U0RB 5E8NB 5DEFB 1Q1JH 4JKPL 4GH7B 1I7TB 4HWZB 4NCC2 1M71A 2NQCA 4GKSB 5I71B 3VFVB 4GQ9L 1S8DB 4MCYB 1RJYB 1A7RL 3JWOH 1PDKA 4JKPH 4YGVB 5DO2D 4H25A 3QUZB 2GUOA 5C0DA 1QPPA 3UTSA 1T5WB 3O11B 5GSVB 2MPAH 3QUML 4XHJC 2IANB 2QLVB 4KJPC 3BRGC 2MFNA 2R29L 1JHLH 2UWEE 5HI5D 4CJ1A 2EC8A 3VWKC 1MI5A 5I75C 1TFHA 2YR3A 4XNZB 5J6GB 4WO4D 1WZ1L 4HJGA 4GUPA 4JAMB 4M3KB 4ZSOA 3WN5B 4ETQA 4IRZH 3PWPB 3T4YB 4PRIA 1Y6NR 2IBZX 1QA9B 1EBAA 3GMNB 2ARWA 4Y89A 5F1SA 5JOFA 4UINH 1ES0A 3HR6A 1F3DJ 4KTYA 4NM4H 3VXSD 2SEBB 4ZTOL 4P5KB 5C92A 4F9PA 3M1BB 4PGBB 4PP1C 1MCQA 1RFDL 5JIPA 3L6FB 4HWNA 4G9DB 4NWTH 1NGYB 4PJXF 3B9EA 4M48H 3TNMB 2ERJC 5TQ0L 3TT3H 2XOTA 2G60L 3TNNB 1TZGL 1YEIH 3AROA 4MAUL 2ESVA 2G5BB 1T21B 3I3DA 3OKNA 4GMTL 3BQUD 5HY9A 2HFGL 4Q2ZB 1MF2H 5KTEL 2J8UF 3IS1X 1FNEA 2XKNA 3UBXA 3MBED 1ZKAA 3PWJB 3WD5L 2YSSB 4L3CA 4CN1A 4LHJB 1CI5A 2X4PA 5JQHC 4J4PA 4DEPB 3VFWA 2P5EB 5C08D 5KTEH 4R0LB 2JJUA 3OXSB 3GKWH 3DHJA 5TDPA 2D03H 4P2OB 2X2YA 2G9HA 2ZPKL 4NQDD 3WEXB 4S1RL 2WV3A 3GKWL 3ZLQC 3BGFB 2NNAA 4NQEA 2AERT 3RDTB 1SEQH 4CW1B 3VGAB 5FM5M 4JZNA 1JWMA 5TH2B 3HE6D 3QG6B 4G8EB 4HC1A 4K7PL 1J18A 1U93A 1A3RL 4TTGA 3GK8L 5JOEA 1XCQB 4FMFA 3TPUE 2X40A 1MCJA 1TTGA 2CLRA 3BKJL 1TQCB 2CRZA 4WHYG 5MEOA 5HDBF 5JOFB 5EULV 1AR1C 1IL1B 2MQCA 3RGVC 1C1EH 3C09B 1AJ7H 5SWSE 3H9SB 1T0NB 4PGEA 1WUNT 4H1LH 5IVZA 3PHSA 5E2VL 1NC4A 4Q2ZA 2H3NB 5A2IH 5TF1H 5J4MA 1YEGH 2OJZH 5SWSB 1E6JL 5FO8A 3QA3A 4HKJA 4RDQG 5D96B 4YDIL 4U6HB 2ADJA 3V7AE 4M7KL 1CFTB 4IOIB 2AP2A 2B4CL 3WIHH 2R15A 3RX5A 3SQBA 4G59A 5T5NF 2ICWB 4M7KH 1LD9A 1AGFB 4PGZA 4X4MA 3VXSE 1WITA 4Q6IA 4KVCH 2L7UA 3RWEA 4WWKA 4YZFE 4PLJD 5A2FA 5ALBL 3P9LA 4H0GA 3D1MC 3AU1B 4LAQL 2AV1B 5I1HH 4GW4B 4JR9L 4NFBA 5DI8B 3ROLB 4WV1B 2J6EL 3H9HB 2HVKB 1DBAH 1XGRA 3IYLW 4UT9L 1ZEAL 3GIVA 2BK8A 4P3CL 3DV6A 5D7KD 4RFEA 1UC6A 5DWUH 5M95B 1BX2B 1GOFA 1GRWA 3ILPB 3TWCH 2AABL 3QUXC 4X99A 1JRHI 2BERA 4DFIA 2YPKA 1ZHBA 3WS6A 4OUUB 3DUUA 4W6XB 3Q5OA 4JFYB 4P3CH 3BZFB 5KSUB 4G6AD 2FHCA 4OIBA 1FP5A 2O5XL 4CU6A 5FB8A 3CZJA 5FGCE 5EC1A 3G6DL 1AFVH 4NNYB 1ZHNA 5I73B 3G08B 1Z9OA 4PJXB 2UWEA 5B8CA 5C0AE 4BH7B 5EU4A 1BAFL 4TNWK 1CL7L 4GSDH 4IRSB 4UAOB 1IMHC 2EXWC 1B4JL 3FFDA 3ARPA 2R23B 4WY7L 4JB9H 3MV8B 1RUAH 5I74B 5C0FB 5DJ0B 1FG2A 1LO4H 1UEYA 2Y07H 4AEHL 2R56L 2D9CA 5KSVB 1Q72H 1ND0B 5TDOB 1OTUC 15C8L 4PJHB 1P5UA 4QHLB 5F6HI 1DQQA 3NIGE 5GISH 2NY4B 4XPAL 4TUJB 3BE1H 3I02B 1YMHB 2EE2A 4ZFZB 3TBVB 2R2EB 2KQNA 3QAZB 4GXUM 3EJYD 5DK2A 5T3XL 1K9TA 5TE6H 2CUIA 5IVXB 3SKJH 5L0QC 1V7MH 2V2WB 1G7QB 2WWKT 4KRPC 1UACH 4JE4B 4PJAA 3PP4L 4LPXA 3H2WA 3W9EB 4ODHH 2EDBA 3KS0J 2IH3B 4U6YA 3RWCA 4KXZI 1NGPH 1WK0A 4OKVA 4EUPH 5C2UB 1CFNA 1U3YA 1V8HA 1VFBA 3BP4A 4YDVB 4PS4L 3T8XA 5JDSB 4LEXL 3V5DB 1DEEA 1NCBL 4KZDL 3P4OB 1J8HE 4A6YA 3ARBC 3U4BH 2O61B 3KDMA 1BJ8A 3GBML 3PGFL 1FVDA 3FKUS 1IAMA 2IGFL 3N85L 5EOTA 1FYHB 2PO6A 3HRZB 4Q6IC 4KZDH 5D7IB 3ZTNL 2ZSWB 3V5DA 3VWKA 3WFEH 1QR4A 3L7EB 3GM0A 4OFYA 2Z8RA 3T1FB 3WSQL 2A6IB 1MAML 3QQ3B 5BV7B 5IB2A 3FOMA 1KIRB 2OTUB 5I1KH 3ESVF 3REVB 1T22A 4X5WB 4P2QD 4MWFB 2VLRA 3L3OA 4M8QB 4JFQA 4NQSB 2X4UA 3F6IA 3VDAA 4IHOA 3C6LD 1HOCA 5HGHA 5HHNA 1J8HB 2AXGB 4NKDB 3BT2L 1IM3A 3EDJA 4MDIB 5IT2L 3RDTA 1UA6L 4W70A 5DK2B 5I17B 5B3JF 2DB8A 4PRHA 1UB6A 5LXGL 1X7QB 3C6SB 2P7TB 4QNPE 4QXTA 1DBKH 5CEYB 3S9DB 1FL5B 1SMOA 1QSEB 4LCUA 4E42B 1ZT4A 3HB3C 3B9KC 2Q86A 2VZUA 4GXVH 3T2NL 4XCNA 5DJAB 1GPOH 5KN5A 3MRRA 4WENB 2ZOKB 1KIQB 4QY8B 3T8XB 5IVXE 3MO1A 1PSKL 1YNLL 1FIGL 2OQJA 2RHEA 3T2NH 1CS6A 2GW5A 5E8NA 4L4VB 3GMNA 4G3YH 4LSSH 2CIIA 2EDEA 2APTA 2V9TA 3HNSL 4R26L 3BKYH 4HXAL 4BK5A 3KJ6L 1A7RH 3JWOL 4IIQB 2ZSWA 5D1ZA 4ZD3H 5J0BA 1V3KA 2J2ZA 4MJIA 3UROR 2GUOB 3TN0A 3B6SB 2VLJA 2X89A 4R7NA 3FOMB 4L8CA 1HIMH 1AQKL 4ZUTA 3G9AB 1VCAA 3RWCB 1LO0H 2BSRA 2CMRL 1XGYH 1QUNA 3CSYA 3MV7E 4UI2A 5FA3A 4O2FA 4Z8FH 1GGTA 4U7SA 1QYGL 4EN3D 3U7WH 1Q94A 4LLWB 5MP6L 4NQCB 3MJ8A 3IFOA 2DWDA 4MQ7B 4JFPA 2XN9E 3FHAA 4BQBA 1IAOB 1UM4L 3VD9A 2Z8VC 2A1WH 1NFDE 5DD5H 5GS2D 3GIZL 5T1DL 5TDNB 4P2RB 4HIEB 3GJFH 4NQCA 1MQKL 5MI0B 2PR4H 2NY0B 3V6OE 1ZVSB 5AG8A 3PWNA 5BZDB 1RIUL 1Q0YL 4PJ8D 4PP2B 2A1WL 3TEUA 2DQEL 2PXYB 2Q76A 3MRFA 4HIXL 3SDCA 4EIZC 1BIIB 4LFHD 1KIPA 4AH2B 1LGVA 1DVFB 5I2IA 2OXGA 3W0WB 3L3GB 4KMTH 2EIDA 2VISB 3QR2A 4NNXA 2R1XA 3LEXB 1F58L 1D5XA 1QFUH 1U8MB 2XIDA 3EGSB 3QRGH 4FFVD 5HYJE 4WFEE 2NY6C 5EOCL 1BD2E 2L0DA 3CJJA 4M7LH 2Q6WA 4MQXC 4JM2F 3EDEA 3MJ9H 2P5WA 4PRHE 4Y16D 2NY2C 3MXWL 1JMZA 1GGYA 1JYNA 1J05B 4PJ9D 1VGEH 4QXTB 3ZT5A 2ADFL 2AXJA 2VXQH 4PJCF 4PRNB 1G1CA 3NZHH 1HEZB 4OLEA 3U9UB 3F8UB 2XG5A 3BMVA 1B0RA 4CADA 3CFEB 1J0HA 1A7NH 4XCFH 1MFCL 3U0TA 3LY6A 3MLVH 2DWDB 1AE6L 2A0LD 3E6FA 3BP7B 1OW0C 3D2UD 3MJGX 1H3PL 2BSTB 4HPOH 4WWKC 4WUUB 5EO1B 5FECA 3KYNA 4DCQB 2GTZB 5F9AC 5D72L 5DJCA 3BKCL 2Y5TA 1OAQH 4HLJA 2Q20A 1MY7A 4PTUA 1QRNE 1ULVA 3DVGA 3N9GL 2OBGA 3P0VL 4GAGH 1YPZB 4UNUA 3OG4B 5D72H 3A6CH 4OZIB 3MLXH 2CD0A 4Q9QH 5ENWA 3B6SA 3F7YB 3QEUB 3C8KA 1DQJA 3FMGH 4ALAH 1A1MA 4HCRH 1HSBA 3K0WA 3LDBB 1FO0L 3SDXE 3T65B 1DL7L 1U91A 3BP5B 4QYOA 3ZDZE 3MV8D 1IBGH 3VFGL 1A02N 2BHYA 2FX8L 2VABA 1KFAH 4ODWA 2W0FA 3GI8H 3C08L 5JQ6H 3QFJD 4Q6IB 1F4XL 1T4KB 2Y36L 4PD4J 1VGKA 4UQ3A 1DLFL 3PHQB 5DLMH 1XGTB 4DTGH 3NOIA 2H2SD 5IEHA 2BVYA 3EFDH 3U2SA 3QIBC 2JTDA 3D85D 3KPQA 2GHWB 3CLEH 2SEBA 4I4WB 1H3TA 4AMKL 3IDMA 4MZ2A 2IWGA 1IC4H 1QA9A 4MDIA 5D5ME 1CFSB 4XAKE 5DJDA 1L7TH 4UT9H 5DSCA 5ANME 3U1SH 2DQHH 3FFDB 4LCWA 5D6DC 3DV4B 2F5BL 5IVZB 3VFOA 1DN0A 3JV5A 4ZTOH 2E6JA 3L3KB 5I8EA 3L3IA 2EZ0C 5F72S 5C0ND 4QRPE 1NEZA 4LCWE 1JZ7A 4EOWL 2H2PD 3S35H 1PGRB 1C08B 3F7VA 1UT9A 3BZ4B 4LVHB 4C58B 5J9PB 2O5XH 2XQBL 3IXAB 3X13A 1ZT7B 4YHML 1YEDB 4JO1H 4HHAA 2BDNL 5BS0B 3QQ9C 4BFBD 4XP4L 1A4KA 4P59H 4BZYA 1QNZL 1NCAH 1NGWB 3CH1B 4U1KB 1JGVH 2X44D 5JW3L 3WD5H 5DC4B 1OM3L 3VWJA 4RGOL 3HC4H 3LS4H 1ONQA 3D0VA 4GAJL 1QNZH 4FQXB 4FFZL 2EEDA 5D2LA 1U3HA 4K7PY 3MLPA 1OARL 3UPAA 4UUJA 2HJLB 1U8KA 1XH3A 4YR6A 1I1AB 4MNGE 4GW4A 1IGFL 2D9QB 3MRIA 2UZIH 3DMMC 4P57B 5F9WB 1OAXH 1D5ZA 4LHUG 1MCCA 3BW9B 1TVBA 2ITCA 5LGKA 2FX7H 2VITA 4I0KA 5FCSH 1RVFH 3I02A 4EIGB 1BVLB 1NAKH 1MCFA 2YPKB 3N1QC 5IEHB 1OPGH 4M1CD 3LB6C 3H42H 5AYUH 1JPGB 2QQNL 3C2SA 5BXFA 5E5MB 1FC1A 2KKQA 3B8YA 2HT4D 5ISZB 3D69B 3FRUB 4OV5B 3D39B 1KOAA 1VFAA 4ZO9A 4RZCA 4HMCA 5MEOB 3EW3B 4WV1A 1M7IA 3QHTC 2Z31A 4K07A 5D1QC 5K59E 5DMIL 2QQNH 4E41D 5JZ7D 3WYRA 2J4WH 4HUKB 3S34H 4F9PC 5J6HB 4WFFE 3VI4E 1G9MH 4I13B 2YUVA 3GJFB 1UKTA 3GBMH 1AXSB 1K4CB 3SE9L 4FQXA 1IL1A 3BPCB 1OAUH 5DFVC 5E56A 5EBMB 2R2BB 5GJTH 3VFRA 4QRRD 1TZIB 3WFEL 3MRMA 1RJYA 1CDYA 1XCTB 4DW2H 4D9LH 1RUPL 4JM4L 4BQ9A 2YBRA 2YA1A 1IARB 3QA3B 2I60H 4OGAC 1FVCA 1DLHB 4HWEL 4LSPL 4YHYB 1A4JA 2NX5D 1BBDH 2NY2B 1BD2A 1CICC 1JPFB 1YZZA 3VH8A 2F54D 3B2VL 4YJZL 4JFZH 3BP7A 4PGCA 3OXRA 4PV9A 5JDJA 3WO4C 3LV3B 1VPOL 4CN4A 1MCEA 1T3FB 1DBMH 4M5YL 2XN9D 3V6OA 1GGBH 2IG2H 1PG7X 1GXEA 1G84A 2YZ1A 3D18A 3I6KA 3MV7B 5I1LA 1C16A 3ZKXC 3GMLB 4KDWA 5JW4N 3GO1L 4JGUA 4PYGA 1NFDA 4JPWL 1G7HB 1ZT4B 4R2GD 4OLVH 5KOVC 1EHLH 4OD3H 1OB1A 1KJ2A 4PJHF 2BRRL 2DQGL 1LP9B 5GRJH 3SKUD 3HI5H 4FTVE 3EBAA 1ZLSH 4DZBB 5JNYB 1XR8A 4O02L 5GZNC 1P4LB 4N5UA 5FYKD 3UMTA 3VWKB 5HDLA 2WW8A 3DGGB 2VLJB 4G8GD 1URLA 4LF3B 1XR9A 3ARWA 3V5HB 4M7JH 1FZMB 4OGYH 1KGCE 3FT4B 1XF2B 5DGRA 3CDYA 1H0DA 3IVKB 3KPSD 2P8MB 1F2QA 4NQSA 1CL7H 4GSDL 3GSVA 5D2LF 1JK8B 3ARZA 1J8KA 3QJFA 4I9WE 4G6MH 3I85A 2ZUVA 3OJDB 1RY7B 2Z8WC 5JORA 2AXGA 5K9JL 1A14L 1RU9H 5EZIH 2Z9TA 4FQ1H 3QEQE 4QRTA 4WW2F 3ABZA 3MJ8B 4PJDB 5K9OB 2HRLA 4F2MB 5ADOL 1U3HC 4P5MB 2VE6B 3L7EA 5F7KC 4PGDB 3WFCL 4H1LA 4XVSH 3VA2C 5DRNB 5DMKA 3C2AL 2WP3T 2GSGA 2MSPA 5JXEC 3RHWF 1I1FA 4M7ZB 4U1HA 4XB8A 5IVXA 3CXDL 2N4IA 3DX7B 3IKKA 5DQ9A 1ERNA 1W0WB 4JGMA 3W39A 5DT1H 1YUHB 1RZJC 1OB1B 4NYLA 3GSUA 3BUYB 4X6CA 1SBSH 3QDGE 4HDIB 1MRCL 1ZGLA 1W0YT 4QHMA 4YHKH 2QQKH 1J5OH 1TETH 3O8XA 1F3JB 4KVNH 2YRPA 1NGZA 1HQ4B 2CKBB 5MEPB 4OTXL 5ICYA 2OZ4A 3SE8H 3BP4B 4Y19B 4F3FB 1FFRA 3D0LA 2QQKL 2EDJA 4H5SA 4JEGB 4L9LB 2A73A 2FECI 1F3JA 3C6LC 3P11H 4ZXBB 3FT2B 1MREH 3LKSB 3VDBA 3SE8L 3MCKB 2FYYA 4M00A 3WFDH 1HWHB 3MJ9L 3K2UL 3MGOA 2ZWLT 4ISVA 1XF5A 3RNQA 3ULUF 4UQ2A 3KYKH 5B39B 5HI4C 4OCWH 4UB0L 3WJLA 3ZTJG 2O61A 1NAMB 1I3GH 3MJ6A 3PL6B 2NCMA 2Q8AL 4ZO8A 2OS7A 1KB5B 2ZG3A 5TDOA 5I17A 1PD6A 5C3TA 1IC7L 3GSVB 2Q7NA 1J8HA 4NKDA 1W72A 2Q87A 2OL3A 5DJ2A 2JJSC 4FTVA 1MJUH 4DQOH 5ESQA 3INUL 1U8JB 5CEXB 2ZG1A 2V2WA 4XC1L 1NFIA 5KVEL 4MXVE 2BNUB 2H9GA 1TJIL 2JB5L 2VXTH 3QI9A 1NCWH 5DUPH 4PJ8C 3TCLA 4LHUD 4MXQD 4FQQA 3W0WA 1CF8L 43CAB 1HHHB 3RGVA 3QPQD 2HG5B 4XC1H 1K85A 4NZUH 4PTUB 4M9OA 2B4CC 4JFOA 5GS0D 3LKOB 4AIZB 3NFNB 3CFCH 1QQDB 4PPTA 2BJMH 4MD0B 4PJXE 2A77H 4TSCL 3VFRB 5ILTH 1BIIA 1Q1JL 2YK1H 3UJJL 2R29H 3O4OB 5IB3A 5IP4A 5F6IC 2E7LE 4OLYL 4S10A 5FF6B 2BJML 1R5WB 3ARDB 2OTWA 4NT6A 3QUMA 4YE4H 3K8LA 5C0AA 4HIIA 3IJYB 4WEMB 3CLFH 4Z78A 3HG1D 2EDRA 5IB3B 5EUOE 4XAWH 1S7QA 2IAMC 5IW3A 2BCKB 1HYSC 4FQJL 4K9EL 3CVHA 1FLTX 4HD9A 4NO0D 3RVVC 5F7HA 1HCFX 1JPTL 3JV6A 4WI8A 1U9KA 5GGRY 1U8HA 1JHLL 5IMLA 3U36A 1D9KA 3S97C 1NJ9B 4JN1H 1CDJA 1Y6MR 3JXAA 1FE8H 1ZVSA 3TCLB 3CMOL 4W68A 3WNKA 5HVHC 1WF5A 5C0CB 1RAMA 3WUZA 3GIZH 4WFED 2EDFA 3D3VB 1D5ZB 4F57H 3HFML 4QXWA 5GRWA 4XP9H 3C5ZC 4W6YB 5DVNA 5JA9A 3NFPA 3LKQA 4NWTL 4JO1L 1CVRA 2XKSA 3CX2A 4V2BA 4XTRD 2QQLH 2F53D 3MCLL 3JV4B 5I8CB 5KSAD 2ZCLH 3U7AA 3MV8E 4QXGL 3NCJH 1I9IH 3ZHKA 2IMMA 4OCMC 5IW6B 5CBEA 1NC2A 5FKAB 5KS9B 4MNGA 2GJ6B 5FUOL 4XVJL 1OF2A 4GAJH 3TVMD 3MRPB 1T20B 4AT6A 2B2XL 4YHZL 4NJAH 5FYLL 5DJZB 2VITB 3AXLB 3QDHA 1S7SB 2E7LC 4Z78B 1I1AA 1KG0B 1AIFA 2VSDA 1OTTD 3MLYL 43CAA 4NJAL 4OCLC 5FYLH 1JI2A 1R5VB 4JFEB 5IB4A 1MFCH 3LN5B 3VFOB 1MRFL 1MCWW 3KAAA 1DDHB 4TULH 1BJ1H 1X5AA 3QCVH 5I9QB 2ZSVA 5KBNC 2EYRA 5GZOC 4WU5B 4FFEX 5GJSL 1KYOK 3ARFA 4YHIB 5D7JD 4KTEL 1TCMA 4P2RD 4LHUA 3PV6B 3UPCA 3FB7A 3QEUA 5J6GA 1RZKH 4UV4L 5D1XD 5KSBE 3IDIA 3P77B 4LSRL 3U9PH 1JNHA 3AMKA 3AVEA 1DQLL 4KPHL 4MB4A 1KCSH 1S9WB 3VRJB 1GYAA 3ULVC 5IOPA 5ANMA 2ED7A 5D1XC 4E9LA 2WUBL 4RBPK 4R8WL 4HT1H 1A5FH 4LSRH 3V95A 3QEQA 1MFEH 2HVJB 1JNHB 4YFLI 4Y7MA 3LHPH 4EI6A 4P4KD 1BHGA 4RA0C 3BN9C 1JNLL 2B4CH 1BJ1J 1XZ0A 3HZKA 2H32B 3MJ7B 3WIHL 5EH1A 1JZ4A 3DLQR 1FFOB 5FYJU 3H9SA 1G6RA 1NBZA 4J3UA 2FNBA 3VFWB 4WUUD 3QIWD 5E9DE 2YC1A 1IGYA 3UTPE 2IEPA 4FFVC 4O9HL 5I6XB 1L4IA 1BF8A 4FHBD 3SGEI 5D7JB 2DQCL 1QEWB 5GSVA 4O5LL 1ZLVK 1R5VA 4JFEA 5D4QA 5IWLC 4YO0A 2FO4A 2I5YH 4YUEL 3QEQD 1WAAE 5E8PB 1DLFH 4UBDD 2A38A 4X4ME 3VXSA 2IPUG 1RMFL 4LLUB 4L5FL 2JKXA 4CW1A 2VC2H 4HUWB 3L5XL 4KK8C 3C8KB 4F7MA 1NCDL 2FCBA 4NZTL 1EEZB 1HKLL 3EO0B 3FB7B 4C55A 4MA3B 1YPZE 3LS5L 4MDJB 3O8XC 3BISA 4X98A 2RFXA 1A6WL 2GJZB 3SJVD 3TGXA 2PKDA 2IMNA 1VKXA 4HFUH 1HXMB 3BQUA 4NKIH 1JGEA 5M7QA 3MJ9A 4LAQH 3GMLA 3O2DA 1KLGB 4X6FB 1U95A 3NA4A 5GSRB 3UTPD 4K8RD 2PUQT 4F2MA 3G6DH 2HT3D 5J1AA 1ZEAH 3F7YA 3I3EA 4RWYL 2F53B 1YEJH 4XPGL 1OP3K 4AYFA 2ZCKH 4GG8A 2CK0H 3EYQD 1R3LA 3NZ8B 4N5EC 5BS0E 4X99B 1AY1H 2P8MA 3QG7H 5IVOA 3QH3B 5AAMA 4KUCF 5IHLB 4OFDA 1AKJB 4EBQH 3CDCA 5MI0C 2OZ4H 5MEQB 2QSQA 2VO5A 4ZPTA 1K8IB 3SKNB 5C7XL 1J1XL 4ZG1A 3X3GL 1L0QA 1MIML 1BD2B 3VGBA 4K23H 3LEVL 5KVDL 4EBQL 4H88L 5EBGA 4K3DH 5C07D 2LTQB 3RWGA 3RWJB 3N1PC 3BE1L 4CVXB 3LD8B 4HXBL 3T0ED 1NGQL 4BH7A 5DHVA 5D5MB 4RAVB 3DX9B 3SO3C 4D94A 4KGJA 3P4NA 4KHTL 1TCRA 2Y07L 2C7UB 3T0VA 1TDQA 3VXNB 3JV0A 4BSJA 5BS0D 4K8RC 1NJ9A 4RGNB 1H5BB 3HZMB 3QEGL 1M7IB 3P9MA 1I3RA 2YD5A 1J87A 2OL3H 3MUZ1 2OLDA 3FRUA 4NPYB 4X6DB 3S5LA 4MA3A 3RIAF 1AGDA 1P4LA 4S11A 1HINL 4EVNA 5CJQH 2AI0H 3OSKA 2ESVE 1N5YL 3VFPB 3EJZD 1MRDL 4DVRL 5MEQA 2CDGA 2OI9A 3B3IB 1T04B 4XPBH 1FGNH 1AXTH 2J4WL 4X6CF 2NZ9C 4MAYB 3DWTA 1WAAA 1N5YH 4JFEE 5DFWH 1LO5A 5FYKE 2QQQA 2VDMH 2VQ1A 4R4ND 1GGCH 2VXUL 3G5XA 2DIJA 1IKFH 1RZFH 1KACB 4P4RA 4Z5RB 4FFWD 3REVA 3PDOB 3VD4A 4BUHA 3UO1L 1BGXL 4OF8A 2J5LB 1FL3B 4ZSOE 1YC8A 2YPLB 5I15H 4JFOB 2FB4H 5ETUB 3WXVL 2BVTA 1E4WL 2XZCH 1CD1A 4XX1G 2Z31B 5IW1B 1AHWC 1NAMA 1MAMH 1TVBB 2H9GB 4NQTA 3QUMH 3O4OC 2Q86B 4M6NL 3TZVC 1REIA 4F7TB 4QWWC 2D2OA 1NSNL 4YHNB 3WCYA 1YJDC 5TE7H 5F7DA 1MVUB 1CE6A 4IIQC 2F19H 1AGCB 5AWNL 5HGBA 4M6ML 3CUPA 5I66A 2XY2A 5IG7A 3F65A 5HYSB 5H94B 4YEEA 1UKQA 4ZUUB 5INDB 3SGEH 3NIFE 3WIFB 3CFCL 5LKNA 1CLOL 2D3VA 1YEDA 3A0OA 1LE5A 1D5IH 4LP4A 4G43A 4N0FB 4J2XA 4HC1H 4KK5D 3V4VL 1X5GA 5DJXA 1CFNB 4MAUH 4N5EA 4LKCA 3DI3B 3WFBH 2X4RA 3H9ZA 2APVA 5DZOA 4G3YL 3KWWB 3TYFB 3IJHA 1PYWB 1ZMYA 4GKSA 4RQQA 4KK5C 1CDCA 4JFQB 3MV8A 4RGNC 4JY6B 5B8CC 5B3JE 4YO0B 1YEEH 4DGIL 1J9CT 4WW2C 2VLRB 3L3OB 4U1GC 1W8OA 1OAYH 3OKDA 3LKNA 3ROOA 3KXFE 1JK8A 3GKZA 3RUGA 5JOPE 5FYLE 3TM6A 4IRZL 2XXCB 3H9SD 4ZAKC 3LEYH 1AGEB 1ZA6B 2IBZY 2V6HA 1A6AB 3SDXB 4GBXB 3VE0B 5BW7C 1K4DA 4FQLL 2UVFA 1HH9B 1XIWD 1RHFA 4HK3J 5JLZA 5DRNA 4UU9A 1WCBB 1Z9SA 1EMTL 4OV6F 4Z7UB 4YNYB 1INDL 3ILPA 2G60H 3C60A 5DD6B 4ZXBD 4GT7A 3EYSH 3FRPA 3ARGA 3S36X 1BM3H 3FO1B 4POYA 1TNMA 1IEBA 3TJHD 4WO4B 1EFXB 4Y2DB 4FQQB 4BJLA 1QACA 4ONHB 5FF6A 5EIVA 1A21A 4YBQD 5B38G 1LP9E 4GMSH 4MXQA 1B9ZA 2NY3D 4LLVA 3QUYB 4N0UB 4JM2C 3SY0A 3U46B 2XQYG 1UCBL 2BNRB 3RVXD 4JN2A 4YBQC 2V5YA 2R0KH 3H6JA 2NY3C 5C08B 4OFVA 1DTUA 4B7LA 4WU7A 4UDTB 5JHDB 2MJWA 4IDLA 4WTZG 3T3PF 3PDGA 3RWJA 1FG2B 1J1OL 1QKZL 3KPRE 2VL4A 1T20A 3L3DA 2YHGA 1JTTA 3H9HA 4ODSH 3U79A 3VXMD 3BKCH 4HK0B 3IXTB 2HTKC 4XVTH 2FJFB 2F8OA 2XPGA 1SEBA 4WFHE 4ODXA 1CDHA 1DDHA 5H37H 1A6AA 2FL5A 1FZJB 4LLAA 3HCVA 3W5MA 4XCFL 1RZIB 4YIQA 3X3FH 4I9WD 3NFPB 1V5JA 2BSTA 4HCRL 5EO1A 5ERWB 5FECB 3MLZL 4KRLB 3GBNH 2ILLA 1PW3A 2EO9A 5GGSA 3HUJA 4QRRB 4DVBA 3MZGB 1EZVX 2I25N 3GSNL 3VFMA 5T33H 1DBAL 1JTPA 1QQDA 1NBVL 1CFVL 3N9GH 4OBSA 3S7GA 4Z76A 2B8OT 3LHPL 5I2IB 1Z3GH 4ZFGL 5J13B 3QXAB 4OD2A 3GSNH 1K3ZA 3HE7B 3U0PB 3D48R 4J3OC 2ARJA 2R69L 4UTAL 3FFCE 1EK3A 4MJIE 4Q0XH 1N7MH 5I1GL 2EE3A 4POZC 2YXFA 1F45A 1IQWL 5DRZB 1QBAA 4UTBL 5IMKA 2W9EL 4EI5D 4J4PC 1CD8A 5AZ2H 5JMOC 3QUZD 4JFFB 4JFDE 2F53A 3QUMB 3HNTH 4FQXC 1F90H 3G5ZB 1U6AH 4XH2A 1BLNB 2ORBL 2P5EA 2XFXA 1L9MA 4QRTB 4LQFL 3P3YA 4XT1C 2O5YL 2BSRB 5ALBH 2WBKA 2NX5B 2ICWA 3GRWH 2WUCH 1YYLL 2V7HA 5GZND 5GGQL 1U6AL 2B5IC 4IEFB 3RI5F 3F5WA 4XMKH 3QJHA 2CLZB 2J6EH 4PJ9A 1RIVL 2P48B 2P42B 2W9DH 2JCCF 4AG4L 4IS6B 1W0WA 1FYTA 4P5TC 3EOTL 4M6AA 3CPLB 4M93C 1SYVB 3LQAH 1FL5A 3SKMB 1N6VA 1L7TL 1U41A 4L3ED 1AKJA 4P5TD 3U1SL 3VXUE 1IEHA 1T66C 3C5ZD 1X44A 5IJVB 3QZWG 2VMFA 4R97C 4POZD 3U4EB 4GG8B 5BCAA 1SQ2N 4H5SB 5GS3A 2CLRB 4JKKA 1ZS8B 4XNYH 4NQEE 2VNCA 1GZQA 1CGYA 5HPMB 4PLKD 5BZWA 5C7XH 5JR1H 1C16B 1MJ7L 2ZUQC 1A1MB 3G6JE 5IBLC 2ZJSL 2BMKA 3LH2H 4KKCC 5HGDA 2HFFB 2HRPL 4X5WA 4HUVA 1A1OB 1ED3B 4X0KA 5CHNA 3C5ZA 3DECA 1L6XA 5CGMA 1CGWA 1CN4A 2ZUSA 3DVGB 3L6FA 1QLFB 4EJ1C 1XR8B 3JVGC 3OHXA 5GGTA 5B22A 3PABA 1P84K 2WNGA 4LSVH 3TIDA 1XF3B 5J11C 3EKCA 1OSZB 3DO7A 5AAWA 1QFWH 2FEEI 3PJSA 4U3CA 2D7OA 3C09C 1BP3B 3WL9B 1YY9D 3FQWA 3UBXB 2FD6H 3B5TA 3TYGH 1RJLB 5FYJH 1QFWL 1WZMA 5IHBA 1C8PA 5J1SC 4N1CA 4GBXD 2FX7L 2OI9B 4HJ0D 2FGWL 2OQJB 1SJHA 2JK5A 4OLUL 5F3HA 4MWFA 4JFFA 2AEPL 1C1EL 1KEMH 2EC9T 4MJ6B 1IGJB 1VFOA 1QHPA 4RZCB 3UTTB 4LDOB 4V2CB 1YA5A 2V17L 4D8PB 2AEPH 1ZAGA 4OLXH 1D5MA 4NSKA 4NJ9H 2XKUA 1PG7H 3VMOA 3BN3B 4QXUL 3MMEB 1YNLH 4P4RB 4MCYA 3WFZA 3BO8B 3GSRA 2PCPB 5TPWH 4C56A 5DHYA