4QRQA

Crystal structure of hla b*0801 in complex with hskkkcdel
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
276
structure length
269
Chain Sequence
GSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDARAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-8 alpha chain
publication title An Extensive Antigenic Footprint Underpins Immunodominant TCR Adaptability against a Hypervariable Viral Determinant.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 269
sequence length 276
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qrqA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4qrqA01
4L4VD 4LRIC 1BP3B 3P11L 4QXGH 4APQB 4JY6A 1YNKH 4NQUA 4QF1B 3VCLA 2AJ3A 1U8MA 1QSFE 4MD0B 3BZ4B 4I48A 3OQ3B 3SEPA 1WT5C 3PWJA 4MZ3A 1GGCH 1A2YA 3AVEA 3CGTA 2VXSL 3MRBA 3WNLA 5JLZA 5ERWB 3DYPA 1UH2A 1BOYA 5I8CB 4OF3A 1BAFL 3NCJL 4GMSL 1GAFL 5D72H 5I8OL 4X0KA 4P5TA 2CDFB 4BQ8A 1DVFD 1NCWH 2PW1B 2H2SD 1OWRM 3VGHA 1JTPA 3DMMB 4JG0H 1QLFA 5J13C 3BGAA 1KEGH 3DXAA 3E3QC 1GZQA 1DEDA 1CIDA 2Y6SC 2WBKA 2OTUA 1MJJA 3LZFH 4A6YL 4CMHB 5GQBA 3HKFA 1SJXA 3CVIH 2UZYB 3QUYA 1OM3H 4ZYKA 3ZYZA 5F7EL 2Y36L 4ZSOB 2OI9C 1P4IL 4KTDL 5MEOA 4NKOB 1BM3L 2NW3A 3VWJC 3FB6A 4LCIH 2D4FA 4X6DF 4X6CF 3IU4H 1OOAA 1DANU 4BYHA 4CN1A 4LCCA 4J4PA 1JRHI 4HAGA 3JTSA 1G7MA 1EO8H 1JNNL 2QBWA 4LSUH 1A7OL 2DQTH 4OLZL 2VH5H 3DBXA 1W72A 3QIWA 1QFWL 4A2LA 4PJGF 3KXFA 4Y8AA 4N1HB 2XYCA 3C8HA 1SM3L 4HQQL 3M8OH 1NGQL 1FH5L 4Z0XA 4FFWC 4RGND 4NM4H 1HEZB 5I17A 3CMGA 4JB9L 2EE9A 1Y6MR 3FQXA 1MAML 3WHXB 4X99A 4PRBA 1NMAH 1KC5L 5INCB 1EH9A 4P5TC 1U58A 2FX7L 2LU4A 4NHUE 2XQBH 2P24A 1LWRA 1T2JA 3QJHB 1BAFH 4XZUA 1GVIA 1R5WB 4GMSH 1VKXB 2DWEA 3L3KB 1IQWH 2EDNA 5IVXB 3DTXA 3QUYC 3ARFB 1YNTA 3MODH 3IVKB 5GRXG 2CDGB 4RMTA 5DJXB 5I1HH 2AK4B 3BPLC 3FT2B 5KBNC 4AT6A 2AJZB 4H5SB 4B5EA 4YDKL 2OP4L 1UCTA 1VFBB 3WNOA 3HE7D 3GHBH 3UJJH 4JDVB 5BJTB 4GUPB 4H25A 4I5BA 2CIIB 5F1OB 1G6RL 4MB3A 3I85A 3WUWG 4J4PC 4GQPH 4QRSB 2GCYB 2GW5A 5IOPA 4BM7A 1B3JA 5C6PB 1IILE 4TUJA 1W0VB 4L4VB 1N6UA 5I1DA 2VTFA 3MRMB 9CGTA 5C08B 4AEIH 1TFHA 3QEUB 3QIWC 3V7MA 2VLRA 5C0CA 4RDQF 3OKEA 5AZEL 5F1IA 2ADGB 4HG4K 1OQOA 1IGJA 1KIRA 2OJZL 1NBYA 4LIQH 4L3CA 1CGUA 5LXGL 1R24A 1JUFB 4U1NB 4XC3H 1FGNL 3STZA 4B7LA 4LVHB 3FO2A 4HDIB 4OV6F 3IDGB 1JYWA 3GMRB 2QSQA 4FNLH 3HNTL 4XVTL 1KPRB 4JFHE 5F6HJ 4ZDHB 3F58L 4AY0A 5DZOA 3C6SA 1F3JB 4HGKC 4N0UB 3C5JB 1QEWA 2YPVH 5GGVY 4R6UA 3SDCC 4AEHL 2DLFL 2DKUA 1CE1L 1DVFB 5D1XA 3HC0A 5KSBA 1NH6A 4LHJB 1VGEH 4G43A 1KC5H 5I1IL 4S11A 2E9BA 1E4XH 2VAAA 2CRYA 4Z7VE 5IV2B 4RAHA 3VJ6B 1T7WA 2EXYC 5ANME 5FGCE 1JWMB 5E8DL 1QVOB 5FO8B 2AEPH 7CGTA 1FO0L 4OBRA 4OZGB 1KV3A 1R5IB 3GB7A 3N9GH 5C0AE 3ZKMC 4UNTA 5DURB 3JUYA 2EYRA 3D85D 1NSNL 1UB6B 2WK2A 5LBSH 5ILTL 4OIIH 1Z9SA 2EIEA 4YDKH 2ATPA 4JCLA 4WW2F 3O45B 2VZTA 8CGTA 4JZNB 3F7PC 3AAZB 1TCRB 4CL7A 1KB5H 3ZDXE 3MA7A 3BEVB 3H3PH 3AU1A 3LEVH 4OAWB 1H3PH 3BAEL 5FM4A 2A83A 2DYPA 3SQBA 3TA3D 1N0XH 3GMOA 2F5BH 1OL0A 1PG7W 2FGWH 4JRXA 5HY9B 4GH7B 2JELL 2M2DA 1GGYA 1MFCH 2AQ2A 4LCUB 1CDYA 3GMLB 2NY4D 1JNJA 5T1MA 4RGNB 5GS0H 4NN5B 1L7IL 1C5BH 2ERJB 4HS6B 4LASL 5HHMA 3EOTL 2ZG2A 4NSKA 4XXDA 1HI6A 3BUYB 3ZYJA 2D9CA 5TPWH 1Z9LA 3IT8D 5LXGH 1KJVB 2ICCA 5KOVC 3MX0A 5C09D 1P6FA 3VFWA 3L1OH 3V4UH 1NAKL 3DO3A 5JO5A 3QH3A 3OPZL 3T4YA 2GAZB 4PFEA 1WTGT 1UM6L 3RWCA 1EBAA 1A47A 2ARWA 1DBKL 3V8OA 1U8JB 3FQTA 3VXTA 1EAJA 4NGHH 2YEZA 4LOUC 43CAA 2IPTH 1FZMB 3C8KB 1OAQL 4YDLB 1U92A 5FUCE 5B38A 1LO3L 3WIFA 3RL2B 1P4LA 3QDME 1FFOB 3TJHA 2RHEA 1P7HL 4UOJA 3WL9A 1GZPB 1HH6A 3Q1SH 4JJ5B 3O0RL 3RVTD 3VFUA 2H1PH 2OR9L 4OSUH 5HHNA 4BJLA 1M05B 3R8QA 3T0EE 4DW2L 5J9PA 3GBML 2BNRA 2VXTL 2VOTA 3STLA 5I1AA 5HI5C 4OD3L 3KR3L 1OT2A 4U1HA 2ZUVA 4M61B 4PP2A 5KZCD 2Y06H 5KS9B 3ULVH 2UYLA 3A6OA 3GHEH 2JCCA 5M7QA 4M7KH 4LCWD 4XVUD 5KW9L 4L8BB 2EDFA 3GSOA 4N8PA 3WHE0 3TYGH 4GRWH 1BBJA 1G9ML 2BHZA 3IFLH 1PVHA 3DRQB 2ADJB 4HCRL 1MCJA 4ZD3H 2W0LA 2D03H 4R7DA 4PBWD 2E9IA 1DCLA 3MV9A 1TNMA 3OF6A 4V3DB 5JPMA 3ARWA 2COQA 5IEKB 3ALPA 3O6FD 2X4OB 3L3IA 4O51B 2XPGA 5C0IB 4YXLH 4P4KA 3ZO0A 1L7TH 4QHMB 4LLVB 2Z91A 3UO1H 3TJHC 4PGEB 2ZNWA 5EZIH 3RUGA 1FVDA 4CVXA 1EEZA 1Y0LB 1UWXH 1XR8B 4NN7C 4NBYB 2VSDA 5DI8A 1VPOL 2BCKB 1XGPA 4YHNB 1G7JB 3G5XA 1NUFA 3D85B 2L4OA 4XVSL 3WXWH 1UM5L 1E4KC 4MQXD 3NFSL 2Q76B 5GGUA 1FN4A 4WCYH 4KMLB 3QEGL 3WLBA 1ZLUH 2NY5H 4I2XB 4M8QB 5EU5B 3T3PF 4YHPA 3B9KA 1X5XA 4RNRB 3TA3B 3ZDZE 5GZND 1VGKB 1V3JA 1CG9A 4K3DH 5CJQH 2R2EA 3RWIB 3ZL4L 4R4FL 2MQ0A 4QRUB 5KTEH 5IFHH 5EU4A 1DN0B 3SBWA 1CD8A 1AD9B 2NY4B 4D0BB 1KLGA 1NPUA 2R56L 3F12A 1YEEL 4F7CA 3FT4B 2LU7A 3C2AH 1XF4A 3T8XA 5I6XB 3WIHL 3IDIA 3C09C 5C09B 1KCSL 1TVDA 2VLKE 5GGSB 3VU2A 2I26N 3KLDA 4X6CA 4X6DA 3NIDF 4NQCD 4PLNC 1LK3H 2ED7A 1DUYA 1FFRA 4OIAA 2BK8A 4P4KC 1XGYL 3MRGB 3QJFB 3RWEB 3VA6A 2WZPD 5C0JA 3FQNB 4ZUVA 1K8IA 4QOKE 1LK2A 1FBIL 3NPZB 4OV5B 2ZCLH 2XNAB 3GK8H 2XN9A 3VXUE 4PB9H 2QSTA 4Q9QL 3U83A 1JWUB 3ARVA 1DLHA 5FYJD 3F7VA 3P4NB 4UU9A 2VWEE 3MRNB 1OTTD 1TETH 4FQXD 3S88H 2ORBH 4JKPL 2ILLA 3BO8B 4POZC 3WXVH 2FEDC 3LS5H 3TF7A 2XWJA 3ZTJG 1YEJL 5E94A 1MH5B 2MQCA 3H9ZA 3O6LH 1ZVSB 2HTKC 4NFDA 5JMOC 1Z2KA 3MXVL 5IB2B 2V2XB 1OAXL 4P5MA 4TNVK 5FKPA 5J6HB 4JHBA 1IL1B 1T66D 1U8OB 3HLAA 3CCHA 5KZCB 4Y19E 4B50A 3SBWC 4F80A 5KN5A 4PB0L 4Q0XH 5C71A 2BVUA 4LCWB 1W0WA 1T2XA 4X7FC 2FR4B 4KUCD 4PG2A 2DQIH 2O5XH 2VISB 1P6AB 2WBWB 5ISZE 4ONGL 4JFED 4R4FH 1M1SA 3O3EA 4WENB 3QQ3A 2BVPA 3QQ4B 3VXQA 4GSDH 3OKMB 4ZUWA 1MNUH 3HNVL 2P8MA 5HBBA 3TNMA 1G7QB 5DK2B 2ENYA 4Z8FL 3PE9A 4NQDD 2XZCL 3ZT7A 5ID0B 3MRIB 2VL5B 1IAIL 1YC8A 2OLDA 3V0WL 4NKMA 4O5LH 4LAQH 2FO4A 4L9DA 1I7UB 5J06A 3BZEA 3TVMD 1X5HA 1A21A 1OVZA 5CLTA 5D96B 4LU5H 4JGMA 3MGOB 4M7LT 5HGAA 4WTXA 2VN4A 1Q38A 4DZBA 4X7TA 2YBRA 3WIIL 2A73B 2Y6SD 2WMPA 3MRLA 1ADQH 3MV8D 3C6LA 4X6FA 1GC1H 5FDWB 5CEXB 5J1AA 3UYRL 4ISVB 3GJEB 1EJOL 3TF7C 3RJDA 1S5HB 4E5XB 3GNML 4GW4B 4MCZB 5K9QI 4YFLF 3ZE0E 5IQ7L 3RPIA 2DQGH 3NCEB 3BP5A 4M6NL 15C8H 1XMWA 3O3BA 5H94A 4CJ0A 4ELME 3BD3A 2YS4A 3V8CA 1IAKA 1EK3A 4UQ2B 4A6YA 4LPCA 3KPRD 5DD6A 5TGBB 4LMQI 1KCKA 1N6QL 4YHLH 4PG2C 1C5CH 3A67H 3B9AA 4NRYB 2I9TB 5EO9B 3I3DA 2VYRE 4HX1A 5C0ND 4LFHG 5EA0L 5T5NF 3MLYH 1FAIL 4QRPD 4Z0BL 3RWDA 3U36B 1X5JA 3G6AA 1YJDH 4PJAE 4OGYH 5FXCH 3FAXA 1A9EB 1JHKL 4FFWD 3NZHH 4NQCB 1LP9F 2P8LB 5BV7H 3V7AG 1AKJD 4GBXD 3TPUA 4BSWB 5KVMC 3THMH 3R1GH 1J5OH 1IBGH 1KCUL 4OUUA 4HIXH 2F53D 4JFFD 5F71A 4GKZB 5CKAA 3KPOA 4LHUB 4GAYA 3LV3B 4MGXA 1AH1A 1YPZF 2CUMA 4EUPH 3INUH 1OSZA 1KCLA 3C6LC 3IJSA 4I3RH 5MI0C 4I1NB 3C08L 3BGFB 4KK6D 5TDNB 1HCFX 1TZGL 3LN4B 4D2NA 3ZHDA 1UC6A 3FT3B 3WN5B 1MRDL 3N50A 1A1NB 1EGJH 4Z7QE 4FQXB 1LE9A 4HULB 2BRRL 3W9EB 2VDOL 1H5BB 4X5XA 2BNQA 4EI6A 1CLZL 2VXVL 3CVHB 2AI0H 1HOCB 2QR0A 5JNYB 3MV7A 2PYFB 4P2QA 3MLSH 4NBXB 2BOCA 4ALAH 1ORQA 4Q6IC 4DEPB 5F3HA 4JM2D 3M17B 2FIKA 1U93B 4PGBB 3CXHK 4M5YH 4PRPE 3NBNA 1NCDH 5JHDA 1X6LA 3FB5A 2HJFA 1LDSA 2JF1A 4EXPX 3VXMA 3KXFD 4NRXA 3KJ6L 3HHRB 3T77A 3HS0B 4HSQA 1G6RA 5HHVL 2VQ1A 3DVNB 5CMAB 4JFEB 1EUTA 1A6ZA 2R2HA 4UZGA 1U8HA 4CUCA 3OMZA 4GJTB 4P4RA 1DEEA 5JDSA 3QFJA 2P5WA 2MQ3A 4M6MH 1PFCA 1BIIB 4RIRA 3O8XD 1KCRL 1KB9J 1P53A 2X4PB 3UBXG 3RGVD 4H1LH 3LSOB 2D7PA 2VE6A 4NQDB 2WNGA 4L8DB 2N1KA 3OXSA 4WW1A 3ISWA 3K4ZA 4GKNB 3U2SA 1TQBC 4KQ3H 2X4NB 3MOBL 3QUMH 1XF3A 4M1GH 1QBML 3QFDA 4GAGH 5E4EB 2HT4C 2IAND 4PS4H 3CAFA 5J13B 4M6AA 2XA3A 1M6OA 4XP9H 2DI8A 1KPUA 1F3DJ 3GI8L 3LRHA 4XP1H 2E7HA 2HFEB 3ZE2F 2YUXA 5SV3A 3UJIH 2LABA 4DKEL 4KROD 3RHWK 3H0TB 4HHAB 3QUKB 3MRJB 1TJIL 4JREB 5IVZB 3AY4A 3B2VH 2OI9B 3S3SA 4MJID 4Y4FA 1B2WH 2PO6A 3VXPA 3V5DA 1CXKA 2J5LC 3AC0A 2R23B 4FQHA 5ID1B 2R1YA 3PIQB 1RZ7L 4QXWA 5DJ0B 5F7DA 2NZ9C 3G9VA 5C0BE 1QO3A 3NAAH 1DQML 1BVZA 4PD4J 2JJUA 4OI7A 3KPRB 2AJ3B 4IMLA 2HMID 4AMKL 3CH1A 3DSFL 4XNYL 5DO2C 5C0CD 1R3IL 4LSSL 5BZDA 32C2A 3JV5A 3MXWH 4HF5L 5FYJU 3PWJB 1F00I 3LHPL 5J12B 1V7ML 1XCQA 1P5UA 4X80L 2JJSA 3IKCA 1R3KA 4QRPB 5T3ZL 5IB5A 5IW6B 4DTGL 4GG8A 2VQTA 1WICA 2JK5B 3MRBB 5F9JA 2C3HA 1P1ZA 3R8BB 5JLZB 3TWCL 2W92A 4JR9H 1YC7A 2RAMA 4NP4H 4O02L 4POYA 2EDQA 5GS0C 1MCDA 1AKJB 1N26A 1EXUB 3BP6B 4GBXB 1KUMA 3HUJF 3O11A 5D1XD 3CDFA 4G59A 4YZFE 5KOMC 1CGXA 4J8RA 3WSQL 3VDBA 4LLWA 4CAGA 5HXMA 1MCWM 4JFFB 5I8EA 5GGRB 3UP1A 3MLWL 1DBMH 3MJGX 1GZQB 1Q0XH 1I85A 3B5TA 4M9PA 3WFHA 5JUEH 2NY2C 4M3KB 5KVFH 4X6BB 5GS3A 4NNXA 3G6JE 2R0KL 2DQDH 4X8JA 5EPMB 5EOCH 1Z3GL 4ZYKB 3WLWD 2VDKL 4CGTA 3AY4C 3HC3L 4Y4FC 3E0GA 2PO6C 3BPLB 2NW3B 1ZLSL 1KLUB 3PHQB 4ZFGL 4IM8A 5DQ9B 3BDYH 2Y9RT 1MI5A 5CD5D 4LCCB 3N1MC 2GYSA 2IBZY 4KI5E 3SN6N 4XPTL 2DM2A 3LRSA 2BY1A 4OD1L 4I77L 1G7MB 4NM8H 4FABH 2W9EH 4KK8C 1D5ZB 3TZVA 5D9SB 4JM2B 4FXKA 2XZQL 4GW1A 1MJ7H 4GS7C 4KRNA 1W72B 3QIWB 4JRXD 2MFNA 3TCLA 1AGEA 1OLZA 3MLTA 4TN9A 3KXFB 5DSCB 1F58L 4EN3D 4WI5A 1U8LA 3RTQA 3ULUD 4PJ9A 4ZS7H 3ULVC 2AQ3A 1OWWA 3UYOD 5ADPH 5I19H 1BGXH 3RNKA 1YN6A 4P59L 4XBPA 1GGIH 4JHAL 4PRBB 4M1DH 3KG5A 3TNNB 4X80H 1V3LA 2CR6A 1U58B 4C56E 5HPMA 5IHLB 2HJKA 3UZQA 3CSBA 2GSGA 3IJHA 4I3SH 1K4DA 1I85C 4OD2B 1AY1H 5DXWA 1D5XA 2E8YA 2W9DL 5D7LE 5IROA 2ZSVA 1MCBA 2IANB 4NOFA 3HR6A 3MCLH 4QWWD 3VRJA 3DTXB 5F7LB 3W9DA 1YNTB 4D3CL 2RGSA 1H8NA 1S7WA 2I5YL 3RWFB 1FQ9C 3P73A 1MHEB 2OTPA 2AJSL 4AT6B 5D6CB 2WM0A 3TJHD 4LLMA 5K33A 1YYMH 3H2WA 4KROB 4BKLA 1PKOA 4PJCF 2CGRH 4WI2A 3MACL 5MEND 1MRCL 4JN2A 3HB3C 4MJIB 2IEPA 1IKFL 1RIUH 4LCYA 3UAJD 5JW4R 3OGOE 3TZVC 4ODUB 4LSRL 1NMBH 4P46D 3V52L 5C0CB 4DN3L 3OKEB 4YPGA 3S34H 5F1IB 3FB8A 3MOAL 5CEZE 3CLFH 1KIRB 1DDHA 2APTA 4OCMC 1ES0A 1CL7H 4FQIH 1Q9KA 2IAMA 1NBYB 4PJ9C 1YEDA 1FL5B 1KIPB 5D2NA 5BOPA 4L3CB 2HFGH 1IQDA 1NEZG 3STZB 1IM9A 2OXHA 3O3AB 5FYLE 5E24E 3D69A 3O2VL 5C9JA 1HSBB 1CD9B 4OZHF 4EQ2A 1CS6A 1I7TA 3GIZL 3IKKA 1OCWL 4RISL 4KK9D 3K7UA 2CD0A 1QSEA 1QEWB 1HINH 3HI5L 3ARZA 4LPXA 3IU3A 1VHPA 5E5RB 2R2BA 2X70B 1RUQH 4P59H 2E3VA 3GEWB 1A6UL 3DGGA 5DRNA 5D1XB 5KSBB 2I27N 4F37K 3LCYA 3MV9D 5IROC 5DTFB 2D7TH 4G43B 5J8OA 4W6XB 1MCOL 2LTQC 5B4MC 1RUKH 3MBEA 3OB0K 4R2GC 1NFDF 1KIQA 3M1BA 2QHLA 4DZ8A 1GGBL 1M7DB 2YWYA 3W82A 2FGZA 4UNUA 5KAQG 3WIHA 1YY8B 2GKIA 1V3MA 4CNIA 5HVHC 1JGUL 2EYRB 3BOVA 4XRCA 3KNBA 1KXTB 4NHCH 2WW8A 4NO3A 4UIMA 3OJ2C 3PV7A 4HC1L 1T22B 4ZUUA 2ATPB 3T1WA 5GS2D 5DJZB 1MSPA 4MMZC 2F8VA 3SDYH 1ADQA 2EDKA 2EIZA 2FEDD 4PJEE 5LAXB 5FA4B 3W2DH 1I3GL 2IAMC 3AU1B 1A3RH 3MR9B 3ES6A 5D2NC 5K9JL 3B9KD 2J8OA 2IGFL 4Q2ZA 1YPZA 1NUGA 2Y23A 4JRXB 4KUZL 2BOBA 1ZVHA 2BDNL 3RZWA 4LSRH 4X7EC 1E4WL 3EOAA 5E8PA 4EN3B 4MHHG 4UBDD 2ESVD 1NC2D 3GSNB 4XNXH 3TO4D 3VRLE 4Y89A 5EBGA 1NUNB 5T1MB 1NAML 3ARGD 5HHMB 4NSKB 2QQQA 1HI6B 1SVZA 4P3CH 3T2QA 1MJ8L 3BHBB 5DWUH 3P9WB 4UOW1 4ETQB 4U6XA 4U1MB 3WO4C 3C8DA 3NH7H 2Y25A 4OLXH 3NPSB 5JO5B 2PYED 3QH3B 4JRYA 3T4YB 5FV1L 1XGTA 4V3EB 4FQLH 4EIZC 5GJSL 5IESL 2B4CH 1S7SA 3DVFA 3MBEC 1SQ2N 3REVA 3VXTB 2CK0H 4NRZA 43CAB 1YMHB 4KJPC 1I3UA 1IAOA 2VC2H 5C6TL 5A40E 1U92B 2YA1A 3VXRA 5D7IB 2Q8BH 4MJ4A 4Z7UF 3V5HA 3MRKB 5F8QC 3WIFB 3KLHC 4NQED 3L5XL 4YQXH 5DVOA 4YUEL 1INEH 5DEGA 1JPSH 4JY5L 5DUBA 2XXMB 3RHWF 3QAZC 3WL9B 1HH6B 1JYVA 1WFTA 2BJML 3VFUB 5DLMH 3BGMB 2XA8H 5D6DA 4EUPA 1GC1C 4PJXF 4KZDL 3VE0B 1DQDH 1WIOA 4XAKD 1FVCB 4NFCA 4X7SL 1JGUH 5A16A 3SDXE 4P46B 4RBPH 4YBQC 2CKBH 2X40A 2ZUSA 1XGRA 4G8GE 4LGRB 3AS2A 1U95A 4CVZA 1FL6A 4PP2B 3X3FH 5CWSA 2WUBL 2Z8RA 2UYLB 4ZPTA 3BE1L 2JCCB 2YRZA 1UQSA 4P2RE 3SO3C 2OS7A 3U7YH 5EOQH 2FBJH 3CSYA 4IEFB 1HQ4B 5EWIL 3LPFA 4ZFOL 3VI3F 4JN1L 4JGUA 4Y19D 3ROLB 1KG0A 4R7DB 1WUNT 3MV9B 4FG6D 1BQLH 5FECA 4PJFF 4K3JH 3L3IB 3BZFA 3EYSL 3PGCA 5BV7C 5CLWA 4XP4L 3U1SH 2IADB 4U6HB 2DQEL 4OJFL 4YWGL 2QQLH 2Z91B 3U7WL 3H6JA 4WUKL 4CADB 2VQUA 1UXSB 4PBVC 5I0DA 1FVDB 4CVXB 1EUUA 2D0FA 1EEZB 4WTWA 4DKAA 3LN9A 4DKFL 5DI8B 2AV1B 1FE8L 5D6DC 3ZKND 2X1OA 4TSCH 3QUMA 2A6JA 1OTUD 2F74A 3B83A 1A6VH 2FWOA 1CQYA 1MIEL 4OLYL 2DLGA 3UTSE 3VFPA 5JW3H 1RK0B 3LS4H 3EYVA 2G60L 5GGUB 1FN4B 5MEPA 1KFAL 3OWEA 5E2TL 3O4OC 3WLBB 3EFDL 3S9DB 2BFVL 3IDXH 4XP6L 4Q9RL 1HSAA 4YHPB 4OFIA 3B9KB 4WI8A 1QBLH 3FRUA 4OKDA 4YHOL 1CG9B 2R2CA 1ITBB 4NHUA 2WQRA 4MNGE 2IFFH 1FFPB 2Y5EA 3NVQA 3MJ7B 5SWQA 5EU4B 3BPCA 3MLXL 3TO4B 4F33A 4RMUA 2RR3A 2HLFD 1J18A 3L3HA 5F72S 3DLQR 1DL7H 1VERA 3IDIB 3FTGB 2NYYC 1BLNA 1SEBA 1RU9L 2EZ0C 4X6CB 4X6DB 3GBLA 1S3KH 3O2WL 3QCUL 3QNYB 5KVDL 1DUYB 3MZGB 1FIEA 1J8HA 3HRZA 4N0RA 1OPGL 1MF2H 5C0JB 4FFVD 3V7AE 4B0MM 2FCBA 1K8IB 5DQJB 4KKCD 4WGVB 1WISA 1IRAY 3D0VA 4NJ9L 4OTXH 2XN9B 4N9GA 3ILPA 4PJGB 3RDTA 3SOBL 4NQEB 1OW0A 2FD6L 12E8L 2MMXA 1DLHB 5AAWA 1DTUA 3G5VA 3M07A 4UU9B 4LP5A 4PGCA 4WY7H 3U7WH 3BYYA 3OX8A 3GI9H 5DD0L 3LKPB 3DUUA 4FTVD 3HI6H 4DK3A 4F9PA 4I9WD 5E94B 4MZ2A 2XRAH 4HWEL 4N0FA 4RZCA 5IHUL 5FKPB 1SBSH 3VD4A 1S9YA 5DJ8A 3ZE0F 3HLAB 3ZE1F 3EO0A 1B0GA 1IFHH 4OZFH 2YD8A 4HWUA 1KFAH 3GKWH 1S9VA 4HIEA 3ORJA 3EFDH 4C83A 4EOWL 2C7UB 2H8PA 4FP8H 1W0WB 2APXA 3KPNA 4XP6H 3V4VL 3QG6A 5I1GH 3VXMD 3BJLA 2BVOA 1GIGL 3GIVA 2OK0L 1HYRC 1J88A 2R29H 1L8JA 3QQ3B 1S7XB 2BVPB 4WI7A 4PJCA 4BSJA 3ERYA 5ANMA 3HTLX 5I18L 3SKJH 4EVNA 4ZUWB 2P5WD 1JHTB 2P8MB 5LWYL 4PRPD 3ZDYE 1Q1JH 4OT1L 4NC2B 5C0AA 4YHYB 2X89D 4F37F 4PJAF 2GK0A 3SE4A 3IXAA 3K46A 1YY9D 3L3GA 4HJJL 4Y5YB 3WJJA 1WITA 2Q7NA 4XMPH 3EW3B 2FO4B 1S7RB 3BZEB 4L1DA 2Y7QA 3RDTC 4NUJA 5KVGH 3EO1A 4XI5D 3SPVA 1OW0C 1RUAL 5T33H 5DGQA 4JFXA 5KSAA 2FO1A 1T5WA 4FXGB 1KEMH 5IP4A 2YBRB 3FQUA 3B6SA 1MVUA 3EZ8A 1Y6KR 5B39G 4X9FA 2AABH 3MTRA 4F9PC 4MA3B 5DHYB 5IBUB 5EC1A 2DLEA 4QLRA 3CFEA 4DWHA 2B2XH 1AGCA 2B20A 2FJFA 2Q8AH 2VDML 3IF1A 1IAMA 1GOGA 3C87A 5CSZB 1G7IA 5J1TC 3SDDD 2H2PD 2WWMD 5H94B 4RWYL 3S4SA 1FDLL 3KLSA 1IAKB 5DJAA 2H32A 4NZTH 2KQMA 3CFIC 4A6YB 1YEGH 3EJZD 5DD6B 2MKLC 4AM0B 1ONQA 4MYWB 4IRZH 1MFAL 5BS0E 1SYSA 1T2QH 5JQ6H 4P9HH 1S9WA 4G7YH 1BQHB 3HG1D 4JQVA 3CFKB 5TQ0H 5JXEC 3VW3L 1FSKC 1YEKH 1QQDB 3B2UD 2OTWA 2V5TA 3UROR 1REIA 3OJMB 3CPLA 3IETB 5IB3A 3QHTC 3SE4C 1FCGA 3WJJC 5EU7E 4N90E 2A2QT 1I7ZA 2R4SL 4LSTH 4WW2B 3H9YA 1D3CA 5DR5H 4YXKL 3SCMA 3NMEA 1XH3A 1BD2E 1J05B 2ZOKA 4OUUB 2AEWA 5KSAC 5D5MF 3V6OE 5TF0A 4JEGB 3FN0L 3KPOB 5I30H 5EBWA 3Q6FA 3B8YA 2A6DB 4QHUA 1IEBA 1BFOA 3T0EA 1D9KA 2AGJL 4HJJH 4U6VH 4KU1A 4ZAKA 3MROA 3MUHL 5SWZA 1JRHL 1OAKH 2FIRT 4KFZC 1XZ0A 3DYOA 3MUJA 5MP6L 4FTVB 1FLTX 3FN9A 4X5XB 3MCG1 1LO2L 1I8IA 3IAPA 4G42B 5SWSD 1HDMA 4LNVA 4OZIE 1S78D 3QQ9C 2PF6A 1I3VA 3DX7A 1Z6JT 3NFPA 2BOCB 6FABH 1ORQB 2E5EA 4DGYL 1ZMYA 4RFNB 2GJ6D 4JQVC 1II4E 5E9DE 4J3TA 5IT2H 3FB5B 2HJFB 4PGZA 3VXMB 1E4XI 5J11B 3GFUA 3DETD 1G6RB 3IDMB 3QG7H 1EMTL 4UT9L 3RTQD 1QRKA 3OXRA 5FUCC 1ZANL 5I76A 1QNZH 2FB4L 4Q58C 4YX2H 1A6ZB 2ZUYA 2R2HB 3WFDH 5H2BB 1U8HB 4G6ML 4HFWB 3RNQA 2P5WB 2DN7A 4K3GA 1ZS8B 4RIRB 4JO2H 3H9SE 4PJXA 3SCMC 1FC2D 3RZCD 2W1NA 2VE6B 4XGZA 3EDKA 5BW7A 4YHZL 3OXSB 1A6TA 3ARUA 2EO1A 3RVXD 3SO5A 1OGAA 3U2SB 3T0EC 5HI4C 3ZKSD 1D9KC 1H3GA 2BXYA 1INQA 1HXMB 1SBBA 4ZAKC 1XF3B 3RVWC 3QFDB 1CCZA 3D87B 5F89A 4L4TE 1QFPA 3DGCR 3IDYC 4KJWC 3MYJA 4J3SA 3P30H 1K6QH 2BVQB 4LSQL 4R9HA 1KPUB 1WWWX 2DIBA 5GS1A 1AQKH 5D71H 1AC6A 4AG4H 4BSVA 2NY2B 2UUDK 4R26L 3X12B 5EUKA 1IEAA 4CDHA 4N5EA 4YFEA 3L5IA 4HUVA 2KDGA 3MBXH 3CFCL 3SGDH 2VMFA 2BSSA 1NCBH 3WFBH 5J0BA 3G6JF 4UUJA 3SDDB 4WFEE 3UTZA 2HRLA 3GUTA 1LILA 1GGUA 2MSPA 4KK5C 2R1YB 1UWEH 1C12A 4MX7A 3U0PA 2A9NL 1QO3B 5BO1H 4YIQA 1VFAA 4PPTA 4IMLB 5FCUH 3LKSA 3KPTA 5E8EA 1MCFA 2VLKA 2OL3H 3UJTH 5BZDB 1RZJL 32C2B 5IM7B 2C3WA 1LQVA 1BVLA 3ARQA 3HG1B 1J0YA 25C8L 5KANI 4K94L 1XCQB 4GS7B 5SX4H 3P0VH 1R3KB 5T1LA 1H3VA 2CKBA 4QOKA 5FHAH 4GG8B 3K8KA 4YH6A 5F9JB 5F1NA 1F4XL 1NBVH 1OAYH 2F54D 1SEQH 4OCNC 4HG4J 3MREB 3OZ9L 2GJZA 3MGTA 5BW7C 3W5MA 4JQXA 1JHLL 4JG1L 1BWMA 3NA9H 4FQ2L 4JKKA 1QRNE 3O11B 1RY7B 4FS0A 4DQOL 1DSFH 3VH8G 3CXDH 4GRWB 4J8RB 1ZA3A 3BN9C 5I8EB 5CEZH 1ROWA 4K2UL 1Z9MA 4Y1AE 5I75C 5GS1C 3DSNA 3WFHB 2X4QB 4U05A 2B4CC 1WJ3A 3QSKB 4NNXB 2HH0H 4NZJA 5D7JD 3VXNA 4N5EC 5FYLH 4X8JB 5EU6D 4KJPD 4OF5A 5CSBA 1EVUA 5IFJA 2HT2C 4JJHA 3FN3A 1B0RB 3HZVA 2NQCA 5DRZA 5SWSB 4NKQB 2ADIB 4NO5B 2CRIA 2WANA 3IFPB 4JHWL 1IGFL 2SEBA 2XKUA 1N59A 5ISZA 3LRSB 2VLJA 1QHPA 1WCBA 1INDH 3GSXA 5CBAA 1SYVA 3TZVB 1F02I 1ULVA 4FXKB 2GJ6B 3JV6A 2V6HA 3TCLB 4FQQA 1AGEB 3N0PB 1BZ9B 3MO1A 4PV8A 2XTLA 1E28A 1U8LB 4NQVB 3RTQB 4HUXA 5TF1H 4DUXA 2APBA 3SE3A 3FFCE 4XBPB 3DI3B 1D6VL 1GHFL 4JQXC 3EDJA 1T7ZA 4CU7A 1FVEB 4P57B 4R97B 3ZYOA 5IMMA 2B1AL 5AG8A 1JBJA 2VWEC 2UVEA 5BXFB 5HYJE 1N5YL 3BKML 4WI9A 5D1ZA 4JRYD 4M7JH 1F4XH 1CR9L 2GSGB 4OCXL 4XH2B 2Z92A 3QZWA 4PP1C 1BZ7B 2R1WA 3PQYE 1D5XB 5F7UA 5EIVA 2MCG1 4PRAA 4KQ4L 5E0QA 1QR1A 2ZSVB 2F58H 1FGVH 3TT3L 3VRJB 5EUOE 3BSZL 4DQOH 3W9DB 4L1HA 1BQSA 2CDEB 1S7WB 2M8XA 5TE4L 4ZO8A 1DQLL 5KSVB 3P73B 1NDMA 3O4LD 4ZFOA 2FX9H 4D0CB 1DBAH 4FFYH 4LLMB 5E2VH 3I02A 4B7IA 2ZJSH 5CGYD 1BREA 4XHQA 4UDUA 2NW2B 3OAYK 3SDAA 4AK1A 1I9RL 5CILL 2YXFA 3LQAH 2VDNH 4TPRL 4W4OA 3DARA 5HVHB 3Q6GL 5BRZD 3QI9C 4OF0A 3VFGL 4MLIA 3P9MA 2DLHA 1U3JA 4PJHE 4U1IB 4LKCA 1A3LH 1QFHA 4PJAA 2FJHA 3NGBC 5TQ2L 4MNQE 4YPGB 2NMSA 3CFBA 4V1DE 4MQTB 4GRLA 2GY5A 1J0KA 1DDHB 5ICXB 3WDIA 2D3VA 1ES0B 1YEDB 5F9AC 1XIWA 4XXCC 3F6LA 4IOFD 4WDIB 5IQ9B 2N4IA 2AJXL 3UCRA 1IM9B 5FK9A 5LG1A 3OHXB 2EXWD 3SE8H 2J8UE 5ESVB 5C9JB 5EN2B 1HXYB 3SQOH 2HTLC 4Z6AT 2BNUA 4NQTA 2F54B 4PJIF 1I7TB 5D1ZC 1VB9A 2DQHH 1ZT4B 1I7RA 2WP3O 3IU3B 1G7LA 2R2BB 2ZOLA 1Z5LB 1AR2A 4NWUL 3WO4B 2IFGA 5DT1L 1UM4H 4FOMA 2ZNXA 3ZTJH 2F5AH 1MFEL 4OLWH 4QRRE 5TE6L 5GRYA 3BKYL 3UPAA 1PZ5B 5IHBA 4MA7L 5F7KC 5FGSA 5FUZL 5C07E 5A1AA 1V8HA 2EDBA 3D5OF 1KIQB 2OX5A 3MJ8A 5D7JB 4DZ8B 5DHXB 2PR4L 4JKWA 3AS0A 1AGBA 2VDLH 1A8JH 3V0AC 1AR1C 4YFLI 3SDAC 2A77L 4K3EH 5F9WB 4CNIB 5I8KH 4W4OC 2PTUA 5CEYA 2YUWA 4X98B 4TUOB 1CXEA 3TESA 4XRCB 3KNBB 5K93A 5CGTA 3DYMA 1HNGA 2OZ4H 4NO3B 3EYUL 4UIMB 1I3RB 5B21A 3TT1L 1LP9B 4ZUUB 2W91A 1PZUB 1P9MA 4X9IA 1ODAA 5FYKL 3MRDB 3BKCH 1KNOB 3VGAC 4OCWL 1HYSD 4GRLC 4IRSD 4RA3A 3RX5A 4U1GC 2XT1B 1FC1A 4TPRH 4AIOA 4K71B 4HWZA 3U0TA 1C1EL 1XIWC 3ES6B 5AYUL 4Q2ZB 1YPZB 3CD4A 5EO0A 4HS8L 1RMFL 2BOBB 2X7LA 5DD5L 5DJYA 4N0CC 3EOAB 1I1YA 3D39E 5E8PB 3DUSB 4JKLA 1WBZA 3MLZH 4N68A 1HHHB 5TH2B 5CCKL 2CLRA 2CMRL 5J3HC 1RZGA 1BOGA 3SO3B 4P2OA 1XGQB 3IGAA 1I8MA 5AG9A 1FG9C 3R0NA 4XC1H 4YDIL 3Q0HA 4U6XB 5LKNA 1ZWIA 4MCYA 4XPFL 3PNWA 1DQTA 4JRYB 2JKXA 3DJ9A 1UACH 1CGVA 1XGTB 5E2WL 4J3WA 1PBYA 4C58B 2YZ8A 3ZTNH 1J8HD 3EDEA 5IMOB 4QYOA 4JANA 4JRWA 4M8VA 1S7SB 2VDPH 4WO4A 3QCTL 3OR6A 5CP3H 5GRJL 3REVB 4NUGH 5CBEB 1ZA6A 5INDA 1WFNA 4NQSA 2LAGB 4LBEA 2NR6D 3IAGC 1R3HB 4D9QE 4ODTL 4HIHA 4WFFE 1LGVA 3OKOA 1IAOB 3EO9H 4WEBH 3VXRB 1RUPL 3WUWA 3CZFB 1YMMD 3V5HB 5C0BA 3O4LB 3OKYA 3BKJL 3VGBA 1RIHL 5DEGB 3VFSB 3MV11 5CZXD 3W0WE 2Q3ZA 1P84J 1JF1A 5JHLH 4Z78B 5HYEA 1P9MC 1CLYL 4R8WH 4XT1C 5E2UH 5BRZB 1BEYH 1NCCL 4F15C 1T21A 3WBDA 3FHQA 3OJDA 1TQCC 1X4ZA 1KF9B 1XGRB 1U95B 3HZMA 3O4OB 1FL6B 4PJ8D 1F97A 2JJVA 4G6JH 5CWSB 2WV3A 4ZPTB 3OKDB 4GG6E 4ENEC 5C0EA 4ZTOL 1UQSB 1KPVB 5L2KA 4P2OC 2AKRA 3ZKXB 3DIFA 1XR9A 4O9HL 3BH9A 2DF3A 3V9FA 1MAJA 1RZFL 5JPNA 4P9HC 4OCSL 5DDHA 4WNQA 1KJMA 4KV5E 3NCYP 2GTZA 1IGCL 3G6JA 4ZS6D 2ITCA 2J4WL 4WO4C 5DD1H 2ED8A 3P3YA 2VN7A 2CXKA 2DD8H 3I6GA 2HVKB 4XPFH 3BZFB 1TPXC 2PTVA 1KJ2L 4S0SD 3UTQB 4O2FB 1FL3A 3V5KB 3PG2A 5EOTA 5T3ZD 3BYTA 1QHOA 4KAQH 3VRIA 5GRJH 5GGVH 3ARDD 5EOCJ 3IDNA 5L8JB 4BZ2H 1YEFH 3VXSD 1ORSA 4D8PB 4F7EA 1MELA 3QUMB 3EHBC 1EFQA 2F74B 2R15A 3SGKA 2FWOB 1BJ1H 3CK0L 4G9FD 1MREH 3R4DA 2DL9A 1MVFA 1T4KA 3LPWA 3BH8B 1LO5A 4IRSB 1KN4H 3HUJB 4W68A 4ZSOE 1CZ8H 3UC0H 1HHKA 2RCSH 4RFOL 3IFOA 1HSAB 3L7FA 1DJSA 1NLDH 4G8IA 2W59A 3FRUB 5HGGS 4C56A 3G04A 1HE7A 4MAYD 3O2DL 4JO1H 4NHUB 4ODVL 3OAYH 2R0ZL 4LSDA 5SWQB 2P43B 1MCRA 4F33B 4JFDA 1WWCA 5D7LA 3W81A 2R4RL 3FZUD 4KDVA 1AFVL 1N64L 3L3HB 4WV1A 4BFGA 3GMPA 3U9PH 2X4RA 3D9AH 4LARL 3SKOB 2HT3C 1AGFA 3DV6B 2LVEA 1K8DA 1SEBB 4ZUSA 4XPGH 1CD1A 1RJCA 2Z31A 1AQDA 1J8HB 5IJVB 4PLKD 3HRZB 2OJEB 4XMLH 4UV7L 4KJYA 3SCMD 5I1LA 5EO1B 3F7YA 1KGCD 2AJYL 4KI5C 2XKSA 4HH8A 3WFEH 4Y7MA 2A1WL 4G5ZH 1HKLH 1YMMB 2ZKHH 1KB9K 3G6DH 4G6AC 3ILPB 1UWGL 2LE9A 5GJTH 4ZAKD 1GL4B 1OSPH 2GUOA 3RVWD 1LEIB 5SWZD 4JFYA 3B43A 4YR6B 2EYTA 1LO4L 1MPAL 3IFNH 2H6PA 2YHGA 4PGCB 3SGKC 5ADOL 3S36H 1DLFH 3BWAA 3FMGH 4GXVH 4XNUL 2AJVH 5IVXE 1JFQL 1VFMA 1YEIH 2DKMA 5DC9B 1R3LA 2P42B 1UA6L 3O6ML 3V95A 2XZAL 1Y6NR 2NLJA 2AK4E 4L5FH 3D18A 5L6YL 4N0FB 4DCQB 3N1FC 1S9YB 1QYGL 3CVHL 4XPAH 4PJ8B 3EO0B 5F7WC 3KLAB 4F8QA 3I75A 1B0GB 2FX8L 5DGRA 2P49B 4HIEB 1YQVH 4Y2DA 5CUSH 1F4WH 1TTGA 1NLBH 4C83B 3S5LG 1ZHLB 3KPNB 4LSPH 3QG6B 4NOBA 4L4VE 4XMKH 2BVOB 2EH7L 5ITBL 1U8KB 2WIIA 4ACPA 1CQKA 1T0PB 2JIXD 3GIVB 1A7BA 3O2DH 5MHSD 5AWNH 4ODVH 3LB6D 4PD4K 2X4TA 4PJCB 1FNSH 1RIVH 4WWKD 2Z31C 4HXAL 4Y16C 2C9AA 3G5YB 2X1WL 2R4RH 1ZEAL 5EBLA 4TVPL 5ALBL 2V2TB 1JIBA 2XQYG 1UZ8A 4CN4A 3L3GB 3PWLA 5DUPH 1RZKL 4OLVL 1PX4A 1DBBL 1JF6A 1D6EA 2NY1C 1OGAD 4NUJB 3EO1B 5I1CL 3N1GC 1B88A 4N0UE 4U1KA 3NACL 1T5WB 3EZJB 3BMWA 3O6KL 4M1CD 1KXQE 4G3YH 3NZ8A 4PJEA 4YHML 4YXHL 1MVUB 2IMNA 1CXLA 2W65B 3VXSB 4TTDD 3CFEB 1UWGH 4OZHB 4X6EA 1AGCB 1UCBL 4Z5RA 3WCYA 1ZHKB 4G9FB 1G7IB 2E7CA 2W38A 1G9EA 4QTIL 4UTAL 1N2RB 5I1KH 3SKNB 5HDBF 4OZGE 3DX9A 4ZG1A 3FB7A 3IJYA 2H32B 3BP4A 5DJAB 4Y2DC 1OAZL 3CH8A 1QTYT 4LVEA 2VKWA 5IJKA 1U3HA 1CWVA 4XBGA 2R8SL 5CS7A 4MAYB 1ONQB 4YDVA 1MCLA 3QUZD 1SYSB 4P23A 1A9BA 1NFDB 1S9WB 2ZUTA 3MJ9L 1X44A 1JZ7A 3CU7A 2RFXA 3QDHA 1QYGH 4R4BA 2QADD 3WMSA 5FV2A 5I1JL 5ESAA 2FX8H 5FM8A 5CIPB 5T1LD 2R0WH 5GPRA 3ZSTA 1Q0YL 3QXAB 4HGWA 4JGJA 4MMXC 4H0HB 4H1LG 2CR3A 5IB3B 5JW4M 4LRNH 5IR1B 1LE5A 3KPLB 1F4YH 1I7ZB 3FKUS 4RGNE 5D8JH 1RFDL 5C8JB 3SCMB 1XH3B 4P9ML 2YPKA 2ZOKB 2QQNL 4QCIB 4NDMA 3FRPG 1ZEAH 3Q6FB 4RGOH 1F6LL 1QFWM 2PXYD 4QHUB 3NCFB 4XTRD 1CDUA 3TO2B 5C2BL 2Z35A 4P49A 4ZAKB 5TE7H 1AHWA 1RZKH 2IQ9L 3MROB 5BMFL 5SWZB 3IDYB 1EFXA 1CL7I 4G8GA 2ZPKH 4JQIH 4DVRL 3MUGA 4DOHE 3CC5B 1MHHB 5K9OA 2F15A 3GO1L 5D7SH 3PGFL 3MA9L 3O6KH 4K8RL 2A74B 3MV01 5LGJB 3QPXL 1C7SA 4Y1AD 4HJ0D 2XTJD 3N85L 5DMIL 1ZGLA 1UYWL 3QB7C 1HDMB 2UWEF 3BT2L 1E6OL 4YJZL 3TN0A 3PGDA 1PW3A 1KCGC 1I1RA 4HT1H 1U3HC 1DZBA 2VLJD 5AD0A 3LQAC 1RUML 2DDQL 4NT6B 4P23C 3PUCA 5IW1B 4MJ2A 4HFUH 4UTAH 2X9WA 1FORH 4RWHA 4Y5VA 1GPOL 4NZRL 5FM5O 2JB6B 1EO5A 5JZ7C 5CJOH 4Z7UB 2JIXB 4LVNC 1S9XA 1SY6H 4PRHD 4FA8A 1QLEH 5I76B 1J9CT 1MWAH 4Y4KA 3HC4L 5JOFB 4ODWA 4OLEA 1L6ZA 3HAEG 4WWKB 4F3FA 5KS9E 3KAAA 3KS0H 4MXVE 3RNQB 2HRPL 4OCYL 4G7VL 5EZJA 3C60A 2E7LE 2NY7L 4LQFL 4PJXB 3I6KB 1T7XA 2HTLD 5T3XL 3ZLQC 2A9MH 2O26U 4LEXH 4QNPF 4XGZB 2HG5A 1BQUA 5FOJA 4TOYH 1A6TB 4L8CA 4ZXBD 3GJFH 2NX5D 4U3CA 1OGAB 4NO0A 4D9RD 1INQB 1AHWC 3UTSA 3P0YH 3RGHA 4ZUTB 5F89B 1OAUL 3MYJB 3NABH 1MQKH 5I75B 5GS1B 3TFKA 1OB1A 4ZPVB 2P47B 1JGVL 1B4RA 4U6YA 4BSVB 3ZHKA 3MFFA 5IWLA 1JGDA 4UT7L 1IEAB 2EEAA 1A4JB 5C2BH 5EBMB 2RB8A 5FHBL 4HUVB 5JR1H 2IQ9H 4MNGA 3TN0C 4CN6A 2BSSB 4G80B 3C5ZD 5L7XH 1EDQA 4PJ5A 4UINL 2C1OB 4UUJB 2VDQL 3UTZB 4GXUM 2BSTA 1D5MA 3PGFH 4AENA 1C12B 4MX7B 3U0PB 2YWZA 3NCMA 4JO3L 1BF8A 4PJFB 1VFAB 1UVQA 4Y5VC 3CJJA 4LHQB 2OYPA 3DX8A 1KBGL 5E8EB 3T2NL 3QUZB 4S1RH 5IFAH 1J1XH 2CUIA 3JWOH 1PSKH 3GSRA 3GZKA 3CMOL 5GRUL 1NJ9A 4DK6A 4UDTA 2DQCH 1NCAH 3WHE1 1QOKA 4I2XE 4M48L 5T1LB 2CKBB 1FNHA 4JFPA 3C60C 4ONFH 3VWKA 1IGML 5F3BB 1CU4L 4IHOA 2VZ3A 2GJZB 3MGTB 4K23H 3MRQA 2EDTA 2M26A 5BVJA 5IKCB 4KGLA 3GDBA 4OZ4A 5HVFB 5IB4B 2D0HA 1HIML 1JMZA 1HZHH 1AP2B 4XCNB 1ZA3B 4NNPL 1LO0H 2WIMA 1ZXQA 3WKML 2QV2A 1XF2B 3TFKC 2PXYB 4O4YL 5C09E 1H3XA 5IWLC 3VG9C 1BX2B 1NAMB 5I66B 3GSWB 4YHIA 5GSRA 5DZNA 1U6AH 3EFFA 2YPLD 4TUKL 3Q5YA 5IFJB 2EDEA 3PP4H 5I1EL 4QHLA 3S3JA 3UTTA 3HZVB 4WU5A 2XTJB 3LEXB 4GT7A 4FFZL 1MFDH 3RWHA 1TENA 4UT7H 5F96L 4FRWA 5JIKA 1A14H 3S35H 2SEBB 5DVNA 1N59B 5ISZB 2VLJB 5T5FH 2PTTB 1S7QB 2VXQH 3GSXB 4EBQH 5HD8D 1ETZA 4Y88A 4QY8A 3G5ZB 5I9QC 1WGOA 1T6VN 3FO0H 1N3NB 5IMKA 4Z7OF 1GRWA 2X4UA 4M7ZC 4FMKA 2E27H 4HUWB 1CFQA 4J6RL 4FQQB 5EORH 3H7BA 4PJHF 4JO3H 3U46A 3D3VD 1E28B 2DLIA 4YAQA 2AJUH 4HUXB 4PRHB 3UBXA 3T2OA 4P2OD 3SJVD 1CLOL 1VA9A 3T09A 4DN4L 4RMSA 2ICEA 4XCFL 5IMMB 1F11A 4RMWA 4LCWE 3PXJA 4PJ7F 5JDJA 4CVWA 1BF2A 4AL8H 2E9WA 5D1ZB 1ACYL 2DB8A 3DO7A 2Z92B 1LEGA 3QZWB 2NX5B 1AXSB 5ETUA 2O5YL 3QCVH 2Y07L 4PRAB 3BUTA 3AGVA 1EIBA 3GSVA 1VCAA 3MOQA 4FN0A 3UYPA 3LQMA 3KHQA 1JNLH 1NDMB 3MFGB 5I2IA 3OG6B 4W70A 4ZFOB 3KYKL 4L29A 2BZDA 3I02B 2HLAB 4H8WH 1XCTA 5JW4Q 2YN5A 3C5ZB 4PY7A 1CI5A 4PRIA 1ERNA 4I13B 3P9MB 3P9LB 1KJ2A 4JPKL 4HKXA 4PJAB 5DRXA 4R0LB 1IC7L 3VDAA 4FFZH 4ZNCD 4ODXA 3VGAB 4CKVX 1DE4A 2XY2A 1V7NH 4JPWL 5E99L 1ZK9A 2EE2A 5E6IA 3TLRA 5L88H 4YE4L 1AGDA 5L2KD 4XNMB 1JTTA 3O9WD 4HPYL 3V6OA 3HMXL 1DBJH 1RAMA 2CO6B 3GM8A 2BNUB 4U3HA 4QKXB 4NZDA 1IKNC 4HEME 1I7RB 3H9HA 5FUOH 1G7LB 4TQEH 3TBWA 2ZOLB 1AO7A 4S0UC 1QFUL 3BPNC 3FHAA 3O2DA 1OARL 4X9BA 4WHYG 5J7CC 1P7QD 1MCKA 3WD5H 3L5HA 1N7ML 2HN7B 2L0DA 3P4OA 1X5ZA 5AZ2H 1S7VA 5KJRH 3KPSD 4NQCE 2QSCH 4OZIA 1CFNA 4XPBH 1Q8MA 1SJEA 1ZLWH 2YPLB 3E6FA 2R0LH 1S9KC 1KN2H 1YNLL 1AXTH 1F8TH 3HNSH 4LLDA 5E9DA 4YGVA 3RVUC 1ZOXA 2GFBB 3OJVC 3QHFH 1WVZA 4I18B 3QYCA 4F57H 4E41A 4KJQC 5FYJE 4KDTA 3UPRB 4M93B 4KY1L 1P4BH 5EU7C 1UH4A 5E6IC 3U0TB 2VABB 5D5MB 3H9SA 5EO0B 5F6IC 3GMNB 1FP5A 2CRZA 4R90H 5DJYB 4Q9BA 4OLUL 2KKQA 5KVEL 1OP3H 2V2WA 3X17A 1K2DA 1FNEA 3V6OC 1I1YB 1J8KA 4GRMA 2M1KA 2YMXL 3D3VB 4XAWH 3WS3A 1JMXA 2CLRB 2AVGA 4ERSL 1BFVH 4JFDD 3MNZB 2R1XA 4XCYA 4P2OB 1K85A 3SJVB 3IGAB 1I8MB 2ATKA 1F6AB 4BFBD 2J6EL 1FJ1B 4L4TA 4GG6F 4MS8D 4XVJH 4E42A 1ZWIB 4MCYB 5IIEA 4HUNB 3F5WA 4QXGL 1YNKL 1LDPH 2BVYA 4X4ME 1J0IA 3HMXH 3L5WA 3DX6A 3RA7H 4HKBA 4NWTH 3WJLC 2FHFA 3RKDC 3L3OA 4OF8A 4Y4HA 1T0NA 5L8LB 3I6LD 4QYOB 4JANB 4JFEE 4DJMA 5CP7B 4WO4B 4EJ1C 3OR6B 2MPAH 3BQUA 4RAUA 1ZA6B 3T1FA 1GGCL 4LBEB 4LRIA 3CFDA 5JW4N 3PDOA 3SE9H 1NGZA 4TSAH 3OKOB 1WZ1H 3DURB 4IDJH 4RDQG 3WUWB 4NQDE 4L9LA 5BZWB 5D72L 4GQ9H 4WFGD 4EI5C 1NCWL 1TJGH 2G5RA 4KDTC 5E8NB 3RY6A 1ZHNA 1MLCA 4F7TB 3C5SA 1F2QA 1KEGL 1T21B 3MV8E 3OJDB 1T20B 5HHQA 5J89A 2OMNA 4MXQA 1IAIM 4U2YA 3LZFL 1OGTB 2F19H 3VFMB 1IGIH 3FQRA 4M5ZH 1UB5B 1NEZA 3HZMB 2CLZB 3QDJA 4ZOCA 3CVIL 4LKXB 2G9HA 3G9AB 1OM3L 4NYLA 4JPVH 2PETA 5HDOA 5EU3A 3KYMB 5C0EB 5IK3B 2OMBA 4UT6H 1QRNA 2EDDA 3U30B 5L2KB 2AKRB 3ARFD 1ZT1A 1A1OB 1HHIB 4DGIL 4LCIL 1NBZA 1T04A 4FQ1H 3DIFB 1XR9B 4YEFA 1BQHG 3IU4L 1JJUA 1NC4A 3KPRE 2XKNB 5D93B 5JPNB 3HA0A 2IBZX 1KJMB 4RMQA 4WNQB 3ZT6A 4NCDA 3T65A 3LKQA 2YMXH 2B5IC 4Y4HC 3G6JB 1HH9A 1EO8L 4LSUL 4EZMA 2DQTL 3VWJA 1OP5H 2VH5L 2W0PA 2C1PA 5AAMA 3BQUC 4XNQB 4QRPE 3BEWB 3BXNA 4YDJA 3CSPA 1P7QB 2E7BA 1F3RB 5C08D 1CFVH 2Q86B 3MJ9A 4WHTA 1FPTL 1DP0A 2AP2A 2GJJA 3KPSB 2JLLA 2KQNA 3M8OL 2ED9A 4L9LC 4U7SA 1HHGA 5DD3H 4NM4L 4HZAA 3RUGF 3TBYA 4PLJD 2ICWJ 4PR5B 2IH1B 1CFSA 3KGRA 4OFKA 1NMAL 4U1LA 2ZUQC 3GJFA 2F53E 4JFFE 3RY6C 5ENWB 3QA3B 1QLRA 1RZKC 2I24N 2BSRA 4RGMC 5IF0A 3MRFA 1YDPA 3HPJA 2A6IA 2XQBL 2H26A 4MXQC 5F88A 4KKAC 4GMTH 1IQWL 2CSPA 2F8OA 2XXCB 4NPYB 4OZFG 2R69H 3NIFE 1RV6X 3MODL 3C9NA 4S1SH 3IFOB 3L7FB 5I1HL 1DQJA 3W39B 3NA4A 3ARPA 3G04B 3QIUA 1U3HD 4JZJA 4DUVA 5D2LE 4TSBH 4GXUN 4HK0A 2HVJA 4PTUA 2KPNA 3GHBL 2IPKA 3DROB 3ARBA 4N8VB 5HJ3A 3UJJL 1QPXA 3BX7C 4IBLT 1P2CB 3LQZA 4JFDB 4ODBD 5D7LB 35C8H 3WEXA 3PHSA 1KT2B 1FAKT 3A6CL 4WV1B 2PW2B 2VL4A 3GMPB 5JZ7D 2Q7YA 3L95B 2X4RB 4OQTH 2FJGB 2I25N 5EUOA 5DURD 4AEIL 4DGIH 3OKNA 4ZUSB 1BECA 3UDWA 3KXFE 4AEFA 1CD1B 1RULH 4XHJD 3SGDI 3A6BH 2Z31B 3I9GH 2NXZC 5GGTH 1PJ9A 1A6WH 3RX8A 4KJYB 4NKIH 5I1LB 4LIQL 3F7YB 3BI9X 3E6HA 4PRDA 4XC3L 4TULH 2EC8A 1WTLA 4YEEA 3FFDB 3I3EA 4IOIB 3H8NA 1JZ8A 2MHAA 3RVVC 4FNLL 3RAJH 2HKFH 5DMGC 1ZT7A 3T4AA 4PJHA 2AXGB 3ET9F 2GUOB 3EYFA 3RWJB 4JFYB 1FPTH 1GXEA 3ILQD 3VI4E 5FF6A 5DJDA 4MNQA 2YPVL 4V1DA 2NTFA 1N0LA 1L4IA 1MEXH 2IANE 4MDJB 5SX4I 1RVFH 4OCLC 1VGEL 4LPWA 1IE5A 1PGRB 3FONA 5A3IC 4PJ7A 1E4XL 1MRFH 3B9VA 3RY4A 1LNUA 5A2FA 4AIXA 1UWXK 5C0FA 3KJ4B 4OFYA 2WUCH 3QIUC 2A0LD 1MCSA 4JZJC 3SDCA 1U36A 2IG2H 1N5AB 3I75B 4Y5XC 4Z7WF 2FBOJ 2BVEA 1WIPA 3ARBC 4MJIE 4ZNEE 2AEPL 5FEBA 1QBAA 4K8RC 3N9GL 5DYOA 4P3DB 1ZLUK 4L4JA 4WFHD 5LBSL 2O61A 4Z77A 2VITB 4QHNB 1T89C 4OIIL 1I9JH 4QRRA 5F7NC 5C0CE 3UDWC 4JAMB 4Y4KD 4WJ5B 5C07A 4LLUA 2IJ0C 1OD9A 1KB5L 4X4YA 3X11A 3H3PL 3LEVL 4EDXA 1H3PL 3X3GH 3A6CH 5EBLB 2Q6WA 1N0XL 1PLGH 2F5BL 2R9HD 3K2UH 2FGWL 3W11D 3NFNA 1UZ8B 5L9DH 2ZSWA 4YBLB 3PWLB 1MFCL 3PWPA 1U8NA 5I71C 1HHJA 3AB0C 4UILH 5GSVA 1A22B 4NCC1 5GS0L 4U1KB 1I1AD 1C5BL 2AV7A 7FABH 3H42H 5TPWL 5KSBE 4GAJL 4WU7A 2NXYC 1YYLH 3L1OL 4ZOEA 4JCMA 2YK1H 3V4UL 4BFIA 2EIBA 5IBLC 4X6EB 5DJCA 3BW9A 4PJIB 3ARED 3CDGB 3D39A 4PJ5D 3QIBA 4MAUH 2VZ1A 4JFQA 4NGHL 4K7FA 3HE6C 2IPTL 3DX9B 5BQ7A 1FG2A 3IJYB 1A0QH 1J1OH 1BVKB 3PL6D 1U8QA 3AS3A 5LGHH 1U3HB 4XBGB 2ARJB 2I9LA 5I74C 1EEYA 5C0DB 4PTTB 3QWOB 1A9BB 2NZIA 2YD4A 1B6UA 1E27B 5A2KH 3Q1SL 2RFXB 3V6FA 4OGXH 1QG3A 4KKBC 2W0FA 4J23A 5CINL 5ESAB 2H1PL 4OSUL 4I4WA 3KPPA 2B1HH 3VWKD 4HGWB 1WZLA 4NZUL 5DC4B 1Q9LA 4JRXE 5FYKD 5ESQA 1QBBA 5JOEA 2AAVA 2YRLA 4MXWH 4M4PA 4LPTA 3ULUE 2Y06L 4X7CC 2EKSA 3ULVL 4QRTB 3GHEL 5HYSB 2J1KA 4CW1A 1Q9WA 4M7KL 4MXVF 2YXMA 5IB1A 2I07A 5EFIA 4H88H 5TDOA 5DUMH 4IJ3B 2LV4A 4FZ8H 3TYGL 2FATH 4YPJA 4QXUH 3IFLL 1T80A 2N7BA 4PRNB 3LKRA 4H26A 4ZD3L 2D03L 4FZEH 3QIBC 3K0WA 5DJ2B 1I1FB 1HQRB 4GG6A 3UTTD 1CGSH 4IIQC 4GAJH 5TDPA 2ZP0T 2OJEA 5D7IE 1ZGLB 4YXLL 4ZOAA 4XP5L 5DJ6B 3TN0B 1L7TL 3PGDB 3QUXD 4H8WC 4QF1A 2NY0C 4ONOA 4LEOA 3T3ME 3UO1L 5AD0B 4MD0A 3BZ4A 5JOPD 5EZIL 4F7PB 4KXZH 5MENE 2C3VA 1WWAX 2CIKA 2V5MA 4R4ND 2MJWA 3HMWH 4V2BA 1CBVH 2EH8H 2NY6C 3MGAA 4PUBH 3WXWL 1S9XB 4LLYA 3WS6A 3FJTA 1FFQA 5CJ5A 2YSSA 1XGUA 3GRWL 5SX5K 4U1JA 4PV9B 1VFUA 2B0SH 3K4DA 2B39A 4Y4KB 1RD6A 2BC4B 5I8CA 3LDBB 4WCYL 2BVTA 2NY5L 4UTBH 1JK8B 2NNAA 2JCCE 1JWSB 4WHCA 5CINH 5EZJB 5GZOD 4OGAC 4KVCH 3DMMA 5LQBH 4MA1C 4ODSL 4K3DL 2HG5B 5F6HI 4NZUH 5CJQL 1E4KA 2YN3A 5KTEL 1TIUA 4YK4C 5IFHL 5EDXA 5HGHB 4L3AA 4HK3N 5B39A 1I1AB 4YNYB 3ZYIA 4KZEH 1CF8H 4LNRB 2DI7A 1V5JA 3HMXA 3C2AL 4O2CB 4IOSD 4Z76B 2HJLA 3G08B 2VRAA 3MV9E 4ZSOA 2Z4QA 4BK4A 1GCFA 4U6YB 3MFFB 4QEGA 3D2UD 1LK3L 1I9IH 2XQYK 1MHPH 3Q5OA 5EZLA 4DAGH 1CD0A 1BJMA 3AREB 4APQC 4PJ5B 1BJ1J 1YUHA 3PWUA 4FXLA 4PRID 1D5MB 4KDWA 4AENB 1RJZA 1QPPA 1T6WA 2UZIH 2ZCLL 2HFFA 5D1QD 3GK8L 4M62H 3OBAA 3P4MA 3CZJA 3PL6B 4PGJA 2FLBT 4J3XA 2EYSB 1N4XH 3Q5TA 3DX8B 4XP5H 2KZWA 4GFTB 4JDTH 1WLHA 2NPLX 4PB9L 4BK5A 4XCEA 3QDGD 3WS6C 5I9QB 3LN5A 4G8EB 1TETL 3S88L 4ZFFA 2ORBL 4P48A 4S1DD 4UDTB 2N56A 4M7ZB 1HEZA 5E00B 5IEHB 3WXVL 2DQUH 3WHXA 3LS5L 3MLUH 4JFPB 3VWKB 3O6LL 5INCA 3ULVF 3DMMC 3NCBB 3MRQB 1NDGB 4HBCH 5H35B 2ESVE 3GRWH 4IMKA 3SKUD 1AO7D 1WV7T 5J6GA 2Y4SA 4MVBA 1JF5A 1EERB 4Q0XL 4WUUD 5B3JF 4GRWF 3WNPA 2O93L 4S1QH 5IVXA 3DV4B 3QEHA 3IVKA 2DQIL 2O5XL 4ODSH 5DJXA 3HN3A 4X6CE 2AK4A 2PYEE 1CE6B 1CXIA 3FT2A 5IBTH 2AJZA 1U9KA 2D0GA 2DJUA 4H5SA 1C08A 2J6EA 4PJDF 3EKCA 4F7MB 3MUZ1 2EO9A 3EFFB 4GSDL 5BJTA 2CQVA 4JDVA 3QRFM 4BH8B 3VGGA 2CIIA 1S7TA 1QP1A 1MNUL 4QRSA 4KHTH 1TDQA 2GCYA 4QHLB 4Y8DC 1A7RH 3UTTB 1JZ6A 4HAFA 4W81A 4WU5B 3U79A 4ZO9A 4KKLC 1CN4A 5F7MC 2V5YA 3BP7A 3GBNH 4L4VA 3RWHB 5C0GA 4PJGE 3EYQC 1RK1B 2V7HA 2C4FT 1CK0H 3QUXB 1IT9H 4LAQL 4NQEE 4O5LL 5A2LH 3T0AA 4E41D 1NMCB 1UXWA 2J2ZA 5DHVB 1J0ZA 4LU5L 2P45B 3KPQB 1JZ2A 1ETZB 1P84K 2WBJD 4PJBF 4ODHH 2QQKH 3P0GB 2IALB 2AEQH 5EIIB 1ADQL 1GC1L 4LHUD 1RI8A 2CKNA 1CFQB 4XAKE 3U46B 3IDGA 2G2RA 4LGSB 1KPRA 3S37H 2DQGL 3QWQB 4ZDHA 4OM1L 3QHZL 4X9GA 15C8L 5E7BA 2GSIA 4N0UA 3C5JA 5DFVC 2ICEB 4IMKC 1F11B 1RURH 3I2CH 3U0WL 4MVBC 5FYJH 3VG0H 1AD0A 3LEYH 4KRPD 1T03H 5DC0A 1BJ8A 3PHOB 4YHLL 2QLVB 1G84A 5DK0A 1C5CL 3A67L 4HH9B 4J1UA 2ADFH 3R0MA 4OQTA 3VJ6A 4FQJL 4Z7WA 1JWMA 3MLYL 1QVOA 3GSVB 3UBXI 2VZUA 4N8CH 4WVRA 4XCCH 3BVNA 1DFBH 1YJDL 1R5IA 4OGYL 5FB8B 5HI3C 4K7PH 1ZTXH 4PLOB 5FYKU 4L29B 3NZHL 3D2UB 5BV7L 1A7PH 3QXWA 3GSUB 3VFTA 3K2MC 1T5XA 3HCVA 3THML 3R1GL 4TVPD 1J5OL 4PY7B 2FYYA 1IBGL 3O45A 2LQRA 4HIXL 4PRIB 5CD3B 4XNZB 5D1QB 4OAWA 3EDDA 1KJ2B 4L3ED 1BIHA 3INUL 3LMJH 4I3RL 4ODXB 1E6JH 2Q1EA 1K4CA 3QDJD 3WV0A 1U8PA 1T7VA 3QDGB 4LCUA 4HKZA 5K59F 3FOMB 1EGJL 1CFTA 3V4PH 5TFSH 1QFOA 3GMLA 4U0RC 2VIRA 4HUKB 1AGDB 3MRPA 2DBLH 4ZFZA 5F6IB 3TJEH 5EULV 1AI1H 5IVNA 1G9NH 2E6PA 3BUYA 1KXVC 5JW5B 3S37X 1G0XA 2AI0L 1JP5A 2H2SC 2UV3A 1MLBA 2PKDA 3VH8A 1CIUA 2GAZA 4CMMB 3MLSL 4LDEB 4OM1H 3QHZH 1AO7B 2P5EA 4ALAL 3VWJD 1ZLVH 1EV2E 1KELH 4NO2B 1JNHA 5EH1A 4U6TA 4WUUB 4M5YL 1NCDL 5BCAA 3U0WH 1FZMA 1AJ7H 5SX5H 4DGVH 5CGMA 1S7VB 4JZOA 2FRGP 2J88H 4AH2B 2Z93B 3VFVA 1ZSDB 3GMQA 4LVOB 1BWWA 4KMTH 4KPHH 4Q6IA 1SJEB 3HE7A 1KTDA 3CIQA 3V0VB 3E6FB 4FQJH 2L7JA 4M6ML 1GZPA 1TVHB 4FQCH 1EZVY 1PKQA 4X5WB 3QULB 3U4EA 5IHZA 4YGVB 1NGPH 3WYRA 4E41B 4KQ3L 2APWA 3QUML 2Z8SA 4M1GL 4TTGA 4GAGL 3OKKB 4PS4L 4P5TD 5JTWA 2WBJB 4XP9L 1P7KB 3RKPA 4NQXA 4FTVE 1FV1A 4XP1L 4RGNC 1XAUA 4Z7NF 4NN5C 1FYTA 3DXAD 2ERJC 3H9SB 3QIUD 1KTLA 4I9WE 4QTHB 4L8BA 2GTWA 4HIJA 2OCFD 3UJIL 2V2WB 1FNEB 2X4SB 1A7QH 1T3FB 4GRMB 3QR2A 1JPTH 3B2VL 4K8RD 5GISH 2KH2B 3EYOA 1B2WL 2R1XB 3QUYD 2DMKA 5IGXH 1WK0A 2ATKB 2ADJA 2ZUXA 3KS0J 5JA9A 2OQJB 3NIGF 4E42B 5IIEB 5GGQH 2YD7A 2VLLB 3NAAL 4KHXH 1ZHBA 1F90H 4KRPB 3VXME 3L5WB 1XEDA 5IEKA 4HKBB 2UWEB 2X4OA 3JUZA 3WE6A 2VLMD 3L3OB 4J4PD 1X6NA 4YDLC 3MXWL 1MIMH 1T0NB 1BHGA 4ZQKB 4YO0A 4ONHA 3QP3A 1L0QA 4ETYA 4LLQA 2VB5A 4J3UA 4UQ3A 2E8ZA 4LLVA 4RAUB 3T1FB 1EAPB 1MAKA 1JGLH 1A02N 2P5WE 3PDOB 3HE7C 1NGZB 5HPOA 1Y0LA 3QIWD 4G6KH 2BCKA 4NJAH 4H20H 4D9LH 4L9LB 1YA5A 4JR9L 4XWGH 2YD3A 5HHOA 1G7JA 3F7RA 4NP4L 3D85A 1KB5A 3CDCA 5KSUA 3T0DA 4S10A 2V17H 1W72H 2XFXA 5T3XD 2Q76A 4Z95H 4W6WB 3ZMRA 1ZHNB 3MLRH 5GIRA 3KDMA 1JVKA 1B4JL 2ITDB 4I2XA 1PG7H 1YQ2A 2DOCA 1DBML 1JI1A 5LGKA 1Q0XL 5BVPH 4L3EB 3LKOA 3TA3A 5JUEL 4DFIA 5KVFL 3SDCD 1NEZB 3RWIA 3QEQA 2DQDL 3QDJB 5EOCL 2QHRH 4UB0H 4LPUA 3LIZH 4AIZA 5EU3B 1UEMA 1AD9A 3N06B 4N1EA 1KCVH 5M94B 3VMNA 1VADA 1NBZB 2FSEA 5IG7B 1CGWA 1K9TA 2EXYD 1YEHH 2CUHA 5D7KD 3BDYL 5D2LF 4HS3B 4AYFA 1IZJA 3TBVA 3T65B 2XWBB 5J56B 2QSVA 4NM8L 4TVSa 1HH9B 4FABL 3HG1E 2W9EL 3OR7A 1A1MA 3VWJB 3ZKMD 4KWUA 3RWEA 2C1PB 3HPLA 2OSLB 1MJ7L 4PREA 4YDJB 3H7LA 4JVWA 4JY6B 1FHGA 3VCLB 2XNAA 3B5HA 1U8MB 1NL0L 4HPOH 2VLRD 4ZS7L 4I48B 1A5FH 3D48R 2YUVA 1HHGB 5ADPL 5I19L 2ZCKH 1BGXL 3DRTA 1JWUA 3IDUA 1IC1A 3TBYB 1GGIL 4L8SA 1CFSB 4M1DL 1A2YB 4H0IA 3T3PE 2OR8A 3D25A 2UY7A 5HDLA 3ABZA 2BSRB 1CDIA 1YDPB 2FL5A 1MH5A 4I3SL 4OKVA 2A6IB 5ITFA 2R39A 1AY1L 1F6FB 3TA3C 5F88B 3K81A 3HAEH 5HHXH 5J6HA 1IL1A 3KYAA 3QXUA 1U8OA 4X0KB 1I9EA 4P5TB 3MCLL 4BUHA 2NY4C 1B4JH 1QLFB 3DXAB 4LCWA 3QIUB 2VO5A 5E6ZA 1MHCA 5SWSE 1YYML 3HFMH 2FR4A 2HVJB 2OTUB 5EC2A 4PTUB 5I6XC 3NIDE 2EDXA 1MJJB 2CGRL 3ARBB 4LOUD 4PJDA 1T0MA 2WSKA 1QA9A 4RBPK 1RIUL 3QUYB 3WEXB 1H15A 2AXHA 1IC5H 3EBAA 5MEOB 2GJ6E 1G7QA 1NMBL 3FB6B 5HVWA 3OKNB 5DQDL 3DOSA 1UT9A 4YBHA 4MHHI 3O6FA 5ID0A 3S34L 2VL5A 3EOBA 1Z0MA 3CLFL 5M95B 5FM5M 1CL7L 4FQIL 1I7UA 5I15H 3JTSB 1NGYA 4TNVF 3RRQA 2HFGL 3E6HB 4O58H 4PJBA 3MLVH 3DBXB 4L8SC 2DYPD 5HI5D 2MHAB 2A73A 2WLZA 3GRWA 3RVTC 3AB0B 3AMLA 4PJHB 3GJEA 1QR4A 1S5HA 1NL0H 3GGWA 4M7LH 3RU8H 4NFBA 4MCZA 5FF6B 1HINL 2NTFB 4Z0XB 5I17B 1RUQL 5HHMD 3FQXB 2CO7B 2D2OA 3ARXA 4X99B 3DVIA 2D7TL 4D0DA 1K5NA 3GSNH 4XX1E 3ULUH 2ICES 1U0QA 4R3SA 1RUKL 4PJ7B 1LNUB 2WINA 2DAVA 1OY3B 4BFEA 4XVUC 5TGBA 4E9LA 3OTTA 4ZTPH 3RP1A 2P24B 3SDCB 5ALCH 4XZUB 1JYXA 2DWEB 1FIGH 5EO9A 2VKXA 5C1MB 1T83A 2DMCA 3WKNA 1JL8A 4AEEA 4LSVH 3U36A 4Z77B 3MNVA 4NHCL 4BQCA 2H45A 4P99A 4Z7VF 1A9EA 5BOZG 4M00A 4NQCA 2P8LA 3O6FC 5F7YC 2WWKO 3SDYL 2HWZH 4H25B 2O5ZH 4I5BB 1EHLH 1IMHC 3W2DL 5IOPB 4EDXB 1A3RL 5D96C 4TUJB 5A43C 4KVNH 3NFNB 2X10A 5I1DB 2ZSWB 2BNRD 3VGEA 5DQDH 3LRGA 3PWPB 1TVBA 2F54E 2VERN 2VLRB 4XNXL 5GSVB 4DKDC 1IGJB 2ZCHH 5TDNA 2NY5C 2AV7B 5E5MA 4P3CL 3FT3A 5DWUL 3WN5A 4MQXC 1A1NA 1R24B 3ZDXF 4ZOBA 3NH7L 1T1WA 4OLXL 5FA3A 3FO2B 2BERA 4BFIB 2DMBA 4FQLL 1MCHA 4PG9A 1HOCA 3CSGA 3HZKA 5JNYA 3C6SB 5LCVH 2Y1VA 3QIBB 2B4CL 5GZNC 4JFQB 2CK0L 4PYHA 3O41A 1WEJH 5EU6E 2EDRA 2IQAA 4DVBA 3HC0B 4HUMB 5BQ7B 2GHWB 2VC2L 1FG2B 3OF6D 2V5SA 2Q8BL 3EIFA 1SJHA 1U93A 4PGBA 1T83C 1H3TA 1MY7A 1Q72H 3V6ZA 4P4KD 2I9LB 4YQXL 5C0RH 1EEYB 1INEL 2VAAB 5C7XH 3IRZA 4M43H 1OP9A 1JPSL 3HS0A 1LP9E 3T3MF 3DVNA 5CMAA 1CLCA 1EPFA 3QXDA 4JFEA 5DLML 2W0FB 5T1DH 2XA8L 3MNWA 1HILA 1DQQA 3VGDA 3ZHLA 3GB7B 1DQDL 3KYNA 1BIIA 5DRWA 2C3GA 1YPZE 2X4PA 2XG5A 1UFUA 5ESQB 1PX3A 4NQDA 2CKBL 1WC7A 4U1SA 1UZ6E 4X8XA 4AZ8A 3X3FL 3VFNA 3TVMA 4POZD 2X4NA 3BGFC 1Q9WB 3MA7B 5EFIB 1DN2A 2HTKD 3U7YL 2A83B 2DYPB 3QO0A 3WN5C 1OTTC 3GMOB 1S5IL 2FBJL 3ALXA 4FQXC 5EOQL 5GS2H 3MV8A 1WFOA 4JRYE 2NY3C 5CZKA 1RJLA 2JB5H 3H0TA 4HHAA 3QUKA 3MRJA 3LKRB 2DRUA 2B8OT 5E1AA 2HAZA 5IVZA 1MCPH 4KTEH 4XXDB 4GG6B 5HDQL 43C9A 3CLEH 5TDPB 1T66C 1BQLL 5ID1A 2R23A 3PIQA 4K3JL 4NIKB 5DJ0A 2XY1A 4DEPC 3VFWB 1FFNA 3O4LE 3U1SL 1AE6H 4LEOB 3KPRA 1ZGLM 2QQLL 3RWCB 3S5LA 3MLPA 2C3VB 3FQTB 2CIKB 4XPHH 2DM7A 2YEZB 4WHYH 4HLZH 3VD3A 5BRZE 1PAMA 5F9OH 5SV4A 3FO9A 3LD8C 4TSCL 4QRPA 5B38B 5IW6A 2XN9D 4CVUA 1BBDH 4LLYB 2JK5A 4HWBH 1P4LB 4TRPH 1A6VL 2CJUH 1JN6A 4XBEH 2YSSB 4WTZG 1B9ZA 1XGUB 1CTOA 4U1JB 5JW3L 1QSFA 3LS4L 2BY2A 1XT5A 1AKJA 4GBXA 1EXUA 3BP6A 4NN7B 1TJHL 4MA8L 1J10A 2NNAB 3IDXL 3VDCA 1G9NC 4UV4H 2AXJA 1UADC 1WZMA 3TVMC 5HHNB 2FDBP 1QBLL 2K1MA 3PP3K 5E4EC 2F53A 4JFFA 3QRGL 3ZE2E 5GGRA 5J9PB 5D70H 2BNRB 5FGBC 1X7QA 3STLB 2IFFL 5I1AB 1EGJA 4EIGB 3P4LA 2EIDA 4U1HB 5B39B 4M6OH 4X6BA 1X5YA 3D1MC 5EPMA 2DLTA 1DL7L 2HJLB 4JREC 1TMCA 2Z4QB 1L6XA 3GSOB 3TBSA 3JWDH 1S5IH 3ZDZF 1KLUA 1S3KL 3PHQA 1GYAA 2FECI 5D2LA 5EZLB 4MD4A 5DQ9A 2Q20A 1BBJB 1PY4A 3TH3T 1T1XA 1YUHB 3PWUB 1MF2L 4MQSB 2PNDA 5CZVH 3MRRA 2MWCA 3LH2H 3RIFK 4HMDA 1RJZB 1D5ZA 3C09B 1S7UA 1YJDC 2HFFB 5HDQH 5D9SA 5JPMB 4JM2A 4YHKH 1FLRH 5C0NC 3P4MB 3BFOA 4OTXL 2I60H 2V9TA 5J12C 3IYLW 2XPGB 4P4KB 3P11H 5DSCA 2E6QA 3GM0A 1A3QA 4XCEB 3LN5B 4WY7L 1EVTC 2X5PA 4ZFFB 3QBTB 2BSED 3RUGB 3GI9L 4H1LA 4RRPG 3HUJE 3AXLA 3HI6L 4GBXC 3C6LD 1XGPB 2XRAL 3TNNA 2BMKA 3O8XA 3G5XB 4LPYA 3RGVA 4JVPA 1MFNA 2VXSH 1SBSL 3F6IA 3FRPA 4HMCA 4OD2A 1IFHL 2P5ED 3GKWL 5J6GB 1KACB 4QGTA 3NCJH 4KK6C 1TJHH 2W07A 4MA8H 1GAFH 2IANA 4NNYA 4FP8L 5I8OH 5I1GL 3QEHB 3RWFA 3QRGH 4X5LA 2R2EB 1MHEA 5D6CA 2R29L 4QHKJ 1C08B 1J8HE 3JTCA 3SKJL 3B8SA 4A6YH 1KLGB 3F12B 5HSFA 1S7TB 4LCCC 4F7CB 4MJIA 4ZNEA 1XF4B 1Q1JL 3T8XB 3K8MA 5F7EH 2Y36H 2J3SA 1P4IH 3DPBA 4KTDH 1YMME 3BP7B 1BM3H 5C0GB 4ODUA 4XMPL 4JM2C 1BFTA 2V7HB 2C26A 5KVGL 1UXWB 5T33L 5LJYH 4GKOA 1KEML 3UX9B 3TCXA 4ZUVB 1FL5A 1KIPA 3UMTA 1LK2B 1JNNH 1FYTD 1A7OH 4OLZH 2AABL 3HAEA 3O3AA 2ZUUA 5DVMA 2G2RB 2B2XL 3O8XC 1QFWH 1HSBA 2Q8AL 2HT4D 4U0RB 3RGVC 3F7VB 1SM3H 2GSIB 1L0XA 5GGSY 4HQQH 1NGQH 1FH5H 2X70A 4U7KA 4FMFA 4JB9H 5JQHC 1UGNA 1MAMH 4X4XA 2BNQD 4NZTL 1AD0B 2XWJB 2DTSA 1YEGL 5DTFA 4IRZL 2FX7H 5DK0B 1T2QL 5JQ6L 4J1UB 1J86A 1G7PA 4P5MB 4P9HL 3MV7D 4N5UA 4G7YL 4P2QD 4PJCE 2ARJQ 3CCHB 5TQ0L 4Z7WB 4J2XA 2NZ9D 4KROC 1M7DA 1GOFA 1KTKE 1YEKL 5KN5B 3BVNB 4ELMF 5JHDD 5HGBA 1YY8A 2AEIT 5DO2D 4TYUA 3R06A 5HHOD 4U0QB 1FNFA 1CT8A 1PEWA 2DIAA 4LSTL 5DF0A 4Z7VA 1VSCA 3O3EB 3VFTB 1T5XB 3HCVB 5DR5L 1T22A 3Q3GA 2OP4H 3PV6A 3VXQB 5JXEA 2FYYB 5DJZA 5T3ZE 2HMIC 2OBGA 3RJQB 3QFJD 1G6RH 1IM3A 5LAXA 5I30L 5FA4A 3CX5K 3TNMB 3MR9A 1SMAA 3VXSE 4GKSA 4OFDA 5GS0D 4U6VL 2XG4A 4OZHE 1K4CB 3QEQD 4NKMB 1OAKL 3BMVA 1U8PB 4EN3A 4G9FE 1U41A 4HKZB 5FCSH 3GSNA 1CFTB 5AZEH 5HGAB 2VIRB 2OJZH 3MRPB 4ZFZB 2YD9A 4DZBB 4X7TB 3MRLB 3BHBA 2C3XA 4X6FB 3C6LB 4ETQA 3RPKA 5F70A 1YECL 4N8VG 2NY2D 5J1AB 4U1MA 5MI0B 5EZOL 1FGNH 5D1XC 4QHKI 4R96A 1MLBB 1XFPA 3VH8B 4ELKA 2UY6A 3HNTH 1IGTA 4XVTH 3RPIB 1NFDE 3FO1A 4M3JA 5HHPA 2MNUA 1IJ9A 2DQJL 3BP5B 3F58H 4Y4FD 2P5EB 2PO6D 2GQHA 6FABL 4HKJA 4DOHB 2MTPA 3O3BB 1JNHB 4Z7QF 5IT2L 4W4NA 3D6GA 4AEHH 2VSCA 1YMHA 2DLFH 1CE1H 3WLWC 3QG7L 5D7IA 5I1IH 4JZOB 3MRKA 1TNNA 3VFVB 3I3BA 1QNZL 3GMQB 3SY0A 4YX2L 4D94A 4KK8D 3WFDL 4Q6IB 3MZTA 2FH8A 3HE7B 1KTDB 4HX1B 3TEUA 3PP3H 3WFCL 5MENA 5CD5C 1KGCE 3BRDA 3UXFA 1PKQB 4JO2L 5E8DH 3BGMA 3RWDB 3U4EB 3G6AB 5IHZB 1FO0H 3VE0A 1TLKA 1FVCA 3ULVD 1AXIB 1OHQA 4HEPG 1NSNH 3QDMA 4P46A 5SWZE 3TPUB 5ILTH 3BIAX 4O00A 4EN3C 3P30L 1K6QL 3ULUC 4NQXB 1AQKL 1FV1B 5F1SA 3VFRA 1FYTB 4GAYB 5D71L 4AG4L 1KTLB 2NCMA 2GTWB 4HIJB 3BAEH 4MQ7A 3BESR 1OSZB 1TQBB 1CTNA 3IJSB 3MBXL 1NCBL 3WFBL 2JELH 4HXBL 3NPSC 2IBGA 1J7VR 3EYOB 1HQ4A 4HGMA 5H37G 2RQ8A 1LE9B 1UWEL 1L7IH 1CGTA 2YRPA 3L5JA 4LASH 3ROLA 3EOTH 5BO1L 2BNQB 4EI6B 1ZHBB 4NCC2 1PQZA 1EO7A 5FCUL 1YECH 3OKLA 4Z7UE 1DUZA 3WE6B 2OL3L 4QWWC 5EZOH 3UJTL 2QR0B 1MI5D 3E1F1 3HB3D 5MHSE 3LVEA 1NAKH 3OSKA 2IADA 3OPZH 3RX7A 4U6HA 3MV7B 4YO0B 4ONHB 4P2QB 2YOCA 4LLQB 1BZQK 2J5LB 1C16A 3BZDA 3PJSA 4UQ3B 1UM6H 2DQJH 2K7PA 3QNXA 5K9KA 4CADA 1UXSA 1DBKH 3TZVD 1V05A 3P0VL 5F3HB 1QD0A 2P8PA 2FIKB 4YLQT 4PJXE 5FHAL 3OGCA 2H3NA 5JHDB