4QRSB

Crystal structure of hla b*0801 in complex with elk_iym, elkrkmiym
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
100
structure length
100
Chain Sequence
MGQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-8 alpha chain
publication title Molecular imprint of exposure to naturally occurring genetic variants of human cytomegalovirus on the T cell repertoire.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qrsB00
5T1LD 1I1AA 1TENA 1CDIA 4L4VB 5C07A 5GSVA 5GGQH 3MXWH 3MOQA 3MODH 4HHAB 2UV3A 4LARH 1AY1L 1T2XA 4TUOA 4TTDD 5GSRB 1F5WA 4G42B 5B3JF 2UVFA 5JO5A 2OR9H 4P5MA 1NGWA 5D72H 3SGKA 5FOBA 3ARDA 5CSZA 1FNGA 5B39G 4XVJH 4LOUD 5D1XD 4WFHE 5HGAB 2JCCE 3C5JA 5CIPH 3FO2B 1YMHA 5E6ID 2B5IB 5F3BB 4HJJL 3VXSA 1V7ML 2P44B 1DSFH 5FOJA 4C56B 4PRNA 4OZFG 2XKNA 3N0PB 5EG6C 5FGRA 3C60B 1SYVB 4PJCB 1HDMA 4PJCE 2OCFD 1NBVL 1HHIA 1F4WH 4PJFA 4PREA 3TWCL 5TDOB 3OB8A 3Q2CA 4NQEE 4DVRL 2I07B 4YEFA 3CDCA 5ACZA 4KUZH 1CDUA 1U8QB 3PWLA 4OLYL 1G0XA 3PQYA 5GS1B 2B1AH 5EIIA 2FJGB 1AR2A 1T1YA 3H3PL 3WDHA 2EH8H 2AQ2A 5GJSL 3UYOD 1BVZA 4I48A 4XC3L 1RAMA 5DJDB 3HG1D 5BS0B 2WP3O 3ET9F 5C92A 5DVNA 1E4XI 4J6RL 1YN6A 3RKDD 1U91A 4OCRL 1ZHNB 2X4NB 3MO1A 3QNXB 5T1KB 1EEQA 1D5XA 5I15L 1CD1B 3TEUA 5ID1A 3MRPA 3U36B 3GRWL 3NFNB 3TO4D 1BGXL 4FFVD 4HKJA 1A1OA 1QPXA 3P11L 1Z3GL 3CDYA 3E3QE 4BQ6A 4FA8A 1MI5A 4KK6D 1ZGLM 1HEZA 1IC7L 2EDYA 3QIUC 5SX5H 5E8EB 2AABH 1UJ3A 5KN5B 2OJZH 5IQ7H 5EOQL 4HFUL 4MB4A 3A67H 4U1GC 5FKPB 3QDME 2P5EA 4J1UB 4GRMA 5CP7A 2C1PA 4O58H 5JMOC 4P4KD 4XHJD 3LRGA 2FATH 3OB0K 4Y16B 3C9NB 3IFOA 3TVMB 4YK4C 1NGPH 5LGHL 1S7UB 4L8BB 4MVBC 3QJFB 3JTSB 3QJHA 3EO9L 1KJ2H 3O3AA 4KV5E 4NDMA 1BBDH 5IHBA 5I1GL 4FTVA 1X5KA 4LRIA 2NY2B 5GIRA 3DMMD 3T09A 1H3TA 2ZSWB 2FB4L 5C08E 4F7TA 4LSSH 3RIFF 4K71B 5DJCB 4OIIL 4RMTA 2ERJB 1DL7H 1LO2L 3MGOB 1Z9LA 3ZE1F 3NOIA 1ZT4B 2DLHA 3P9LB 4E5XB 4OLUH 1H8SA 4LVNC 2VABB 2W59A 4HUWB 1YEKH 2FBJH 2AEQH 2NPLX 2YMXL 3HZYB 2E6PA 1MHCA 2CO6B 1U8PA 2YK1L 3VXMB 4WO4A 4CNIA 3ME0A 2Z8SA 4I0PC 3VXME 3O0RH 5E94A 2COQA 4LCWE 5E08L 3TBVB 4FQCL 4AEHH 4JFYB 3VDAA 4PTTA 2VOTA 4UT7H 1DBKL 1NJ9B 3RPIA 5FUCE 3TH3T 3V0WL 1OAKH 3B3IA 3HNSH 4PV9A 4I2XB 2J4WL 2CIKB 2HJKA 5EC2B 2EYSA 3A6BH 5E2UL 4MXWH 1YDPA 3WFDH 4LAJH 4NM8H 1MFDH 4X6CB 4UOJA 3C6LD 4UV4L 2EYTA 1XGYH 4X6CE 3QQ3B 4RFNB 3ELAT 5EPMB 4JVWA 1XCQB 4PJ5B 3DO7B 4N0FB 3QRGH 2ESVB 1DFBL 1F58H 4MD4B 3FQUA 3RNKB 5JR1L 2V9RA 4OLWH 3GSOB 3LKRB 1AXSA 1NCBH 1V8HA 3PHOB 4LCCA 3GSQB 4UDUA 4AH2A 2FHFA 4KDVA 4HWBH 4LLUB 5F3HB 3TO2A 5E2WH 1LVEA 5DQ9A 1A1MB 1AJ7H 1EJ6A 4Y4KA 1BFOB 1RZKC 2ZZUT 5GGUA 4WJ5A 5L8LB 4KQ4L 2X89A 3ES6B 3TJHD 3IT8D 1OARH 2A73B 1JPSL 1U8KB 1I1YB 3LEYL 3VXRB 4QXGH 3MA7B 1KLGA 3VXRE 1TETH 2CK0H 4HIHB 1KEGL 3WIIH 5HYQA 1JPFB 4WVRA 3U30B 4PB9H 1UVQB 2NLJA 4PJ8B 4KI5E 5TH2A 4OD3H 3PNWB 2ZUTA 1K8DA 2X70A 5D96C 1II4E 3GHEL 5AG9A 1CXLA 4NM4L 2FO4A 3W0WB 2A9NH 3IFLL 4NKIL 4M48L 4JG0H 5IUSA 3M07A 4U1NB 3DRQB 3JBG7 4FQIL 3L1OH 2V2XB 1Y0LA 1V3LA 2ZJSH 2RIKA 4HG4K 5IMOB 2WBWB 2R15A 4MJ2A 3RGVB 5IEKA 4IMKA 2QQNL 3P0VL 2EYRB 5L6YH 4GAYB 1MFBL 2QR0A 2NYYD 4K7FA 1RHHA 1LHZA 4XMKL 1JNHA 4Y4HC 3EFFB 3L3OB 1VFOA 5INDB 1RJYB 4BUGA 1BEYH 4IOFD 2XXMB 2PCPA 2YD8A 3DYPA 1A6PA 1MCLA 2PYEA 1YQ2A 4RAHA 5D7JC 3ARVA 5D71L 1NGQH 5J1SC 2YPLA 4NJAL 4XAWH 2AEWA 4PRID 4U6YB 2I5YL 2JELH 2NX5A 1AR1D 4ERSH 4LSVL 5HI5C 3OL2A 3IRPX 3HA0A 4MDJB 3WFEH 2HWZL 5E6YA 4K2UL 1WFNA 3KXFA 4YDIH 4QOKD 3PF2A 2BJMH 5AYQA 4JO3L 5ICYA 3MRRA 4G9FB 1WLHA 4WI9A 4KY1H 4G9FE 3NGBC 4NN5C 1R5WB 1UQSB 1JF6A 5LBSH 3KPOB 1MCPH 3BIKA 1FYTB 3AREC 4KJYB 1FYTE 5KS9B 2MHAA 3PDOB 3O9WA 4RGMB 5KS9E 4AZ8A 1DVFD 2W9DL 3KG5A 3QUMB 2AKRA 5DJXB 3TPKA 4JFDA 4MZ3A 4F7PB 3Q1SL 5HY9B 1LEGB 2BY0A 3BX7C 3MNWB 2AXFB 4UOW0 3WUWG 4ZS7L 3BEWB 1KLFA 3QUXA 4L3EB 4LKXA 3VFTB 2IANB 1G6RH 2ICWB 3EYSL 1YJDL 3FQRB 2LAGB 3CVHB 1X6LA 1FSKC 4K3HA 5HHMB 1QVOA 5AZEL 2E8ZA 5DQJA 1IILE 1N8ZB 3KLSA 5HSFA 5DFTA 4JJ5B 4PGJA 3H9SB 3VFSB 3H9SE 4PJDE 4ZODA 1MFNA 4ISVA 1FV1B 4OT1H 3MV9E 1FAIL 5EN2B 5J56B 2Q86A 3LQAH 5CD5C 5BXFA 4TUKH 4NWUL 2FLBT 2YXFA 4OM1H 3MJ7A 1D7FA 1HXYA 3QXUA 1FDLL 5E8OB 3DSFH 2ZP0T 1Q9OB 5FV1L 1GGYA 3DO3A 3BKYL 3V7AG 3VFGL 4FXLA 1KB5A 2AK4A 4FQLL 2V2WB 2R23A 4M8VA 5HVWA 2EEAA 4JKPH 5K9KA 3CIQA 1NFDB 4M7KH 2H6PB 5DTFB 1NFDE 1G0YR 3RWDA 1ONQB 4GW1A 3BXNB 2NNAB 4UT9H 2C4FU 5J06A 5JUEL 4G3YH 2BRRL 4IHOB 3D9AL 3V4UL 1WZKA 4KI1A 4TYUA 2HH0L 2KL6A 1NCCL 3SO3C 3K3QA 4V2BA 4JZJA 3CFDB 5TE4H 1R3HB 4MXVF 3V79C 2KQMA 3LEVH 5E4EB 4M61B 2VSDA 1CR9L 2P5WB 1U3ZA 1WUNT 1RZGA 2DQUL 4NNXA 1NFKA 5I8OL 4JZOA 4J2XA 4RQQA 2D7MA 1FZOA 1U41A 3L3DA 3W2DH 3CFCH 3I02B 3QUYB 1KN4L 5ABDE 3DX6A 2Z35B 5JW3L 2DJUA 2FX8L 4OUUA 3DHMA 4PJIE 5D1ZB 4Q0XH 4WFGE 4FZEL 3T2QA 1DLHA 5IW1A 2W07A 2GCYB 3RDTB 4PGCB 4LK4A 4JO1L 1HSAB 1RJCA 2GJZB 3MLXL 4OCLC 1NC4B 5JLZB 3G6JF 2WBKA 15C8H 5C0IB 4NC0B 2RGSA 4X6EB 1JZ2A 4FQXB 1HZHL 1YPZB 5T3XL 5TFSH 3VXOA 4U4BA 1KB5L 5F9OL 5JQ6H 4ELMB 4XHQA 3MJ9A 5JPMB 2OXHA 3BSZH 4WUUB 3RWFA 1XF5A 2AJSH 4WUUE 4D9RE 4GW4B 2P8LA 4C4KT 2GAZB 3GJEA 4J3TA 5FFLA 1GZPB 5CZXD 3FRPA 3DVGB 4I18A 3P0GB 5H37G 1AI1L 2FJHA 3F62A 4GBXB 2FBOJ 4EUPB 5CEXB 3U6RB 2C1OB 3SHSA 5MHSD 3MBED 3VJ6B 4GRLB 4BM7A 4ZG1A 3R8BB 4RFOH 3WUZA 2ZCLL 3CXDH 1KPRA 3Q6FA 4HH9A 5DC9B 3ZKND 4NNYA 2XFXB 5F1SA 2QHRH 3GMNB 2YRLA 2HVKB 4JFHD 1W8NA 3FB6A 3ZHDA 5K9JH 1A7PL 5DRWB 5DVKA 4Q7DA 2G5BA 1BD2B 3R06B 2Z31A 2J1KA 3VD7A 4OF6A 2PO6A 5IFJB 4XI5C 1QSEA 4AYFA 2DWEB 1XF4A 4ZFZA 4YXHH 5HDLA 3TA3A 5KJRH 3OAZH 3DX7B 3W9EB 5IB1B 4G8GD 2Z4QB 3F5WA 1K4CB 1KB9J 2UY7A 1KJVA 4MS8D 2UYLB 2BHYA 2PYFB 3H7LA 5KVDL 2FEDC 4XPGH 1R5VA 2VJXA 2EDKA 2JJSA 2J8UE 3GK8L 2NW3B 5ETUA 5DA4A 3PGDB 1A7QH 3U7AA 4DKFL 5DYOA 3RWEA 2VXTL 2CK2A 1PYWB 4WU5B 1ULVA 3UTZB 2VLKB 4Z78B 2CLZB 5FO8B 3NIDE 1B4RA 1FAKT 4NQXA 4YHKL 4BQCA 4IRSA 2HT4D 4JKKA 2EO1A 1KTLB 1FH5L 1X5LA 2IMMA 1CQYA 4BH8B 1OAQH 2A83B 4AL8H 2DKMA 1R24A 2QSTA 1GGBL 4LPVA 4OTXL 4HV8B 1Q9LA 2V5RA 3CFIC 2AGJH 4ZQKB 2JKXA 4DOHB 1H3WM 5D7KD 1HINH 3RWHA 4ZYKB 1MAKA 4DOHE 1U36A 3O3EA 4WU7B 2BVOA 2LVCA 4HWEL 5F7MC 5GZNC 5SX5K 3TNNB 4A6YH 2DF3A 3MRNB 4MD5A 3CSYA 4HKBB 3GHBL 1KN2H 3AY4C 4ONGH 3O6LL 3BRGC 2XQBL 1XCTA 1EFXB 1I1FB 2GK2A 3HFML 1MCRA 2VH5H 4CJ1A 1OGAB 3GMMA 3QXDA 4NWTL 3TN0C 1OGAE 1EHLL 4YPJA 1P4LA 1XT5A 2V7NA 2EDDA 1QNZL 1XIWA 4L9DA 3IDNB 1KC5L 3IETA 5D6CB 1MEXH 3L3HB 4PBXA 5BVPL 3UYPA 1GRWA 4EDWH 3NIFF 3D5OF 3G5XA 4LHUD 2ID5A 1K9TA 1F2XK 1U8OA 4NT6B 5D7IB 5FYKH 5JW4R 3NCJH 1E4WL 1MCCA 1JN6B 4Y19D 5ACMA 5E95B 3QFDB 1MWAH 2ATPA 3DURA 5DD5L 1XH3B 4ZFOA 2XZAH 5EIVA 2Q87A 4F7CA 4KRMB 2FECI 1DQJB 1MCIA 5IV2A 5MEQA 2YBRA 1JP5A 4JFQB 4L3CA 2HT2D 2D4DA 5AZ2H 3G6JA 4LVOC 2DLGA 1A9EB 1F6FB 2VR9A 3VFPA 4ZUWA 5ERWA 3V5HA 1AXIB 4KK8C 1QSFE 5F44A 1YNLH 4LCUA 3LKQA 1XF3B 4P46A 1HHJB 5HGHB 1Q1JH 2GUOB 3QIUD 1D5BB 2MNUA 4WIQA 2A6KA 3TESA 5H94A 2R0KH 1RZKH 3PP4L 3ZE2E 4CJ0A 3MQIA 4WV1C 1ZS8A 1IM3B 1FL5B 1DCLA 4K23L 2IH1A 4OSUH 4DJMA 3PE9A 1CFBA 3QI9A 4Z95H 2XQYG 5T1LA 3KYNA 4DK6A 4Z0XA 1XF2B 1PSKH 1YMMD 1H15B 2DIAA 1FFQA 3AFLA 4MVBD 1NFIB 2HKFH 4KVCH 4MLIA 1I1AB 4QXUH 1FVCA 4F9PC 5C07B 3RA7H 4M1DH 5GSVB 5LCVH 5C07E 2KQNA 5IR1B 1X4YA 4TUOB 1KNOA 4HX1A 3QG7L 4S1RL 1EIBA 1UXWA 1E4XL 3U7YL 4WEUD 3MROB 5JO5B 2C26A 4LIQL 4D9QD 5E6IA 4P5MB 1SBBA 1NGWB 3S34L 3ARDB 4HC1L 1KCUL 4L9LC 5CSZB 5D93B 5D7SH 2V5MA 5L9DL 4Y2DC 3C5JB 3EFDH 5IMLA 1YMHB 1LP9F 1PY4A 4XVTL 4ZS6C 3VXSB 5JIPA 2DDQL 3RY4A 2JJWA 4PRNB 3V6BR 4YUEL 1LDSA 2XKNB 3VXSE 3MNZA 4UT6H 1D6EA 3E6HA 1HDMB 2OXGA 1KCSL 3F12A 2DQFA 4M7LL 1HHIB 2OQJA 4PJFB 4PREB 2O5XL 4WW2F 5FYKD 4PJFE 3BP7A 1MAMH 5ACZB 3O4OB 3PWLB 3VRJB 4X9IA 3NIGE 3PQYB 2YKLH 4OLVH 4KZDH 1EERB 5EIIB 2C9AA 4LSTH 2R69L 4XXCC 1T1YB 1X4ZA 4NZTH 4XX1G 3DI3B 1ZLUH 5BV7L 1M1SA 5CZVH 3EAKA 4I48B 2B20A 1MREL 4Y5XC 3DECA 3JTTA 5C7XL 1TFHA 4KZEH 2KBGA 1YN6B 2NY3C 1XEDA 2H45A 1U91B 3RAJH 4N1EA 5DMJB 3MO1B 1D5XB 3CMGA 4QWWC 3VI4F 5ID1B 3MRPB 5FM5O 2QKIA 3B2UC 4MQXD 5SX4I 4I4WA 4HKJB 1A1OB 5CSBA 4OZIF 3VD9A 4M43L 1MI5B 1J9CT 5GS3A 3VE0A 1HEZB 2IQAA 1UM5L 1C1EL 1P4BH 1UJ3B 4G9DA 1JI1A 3VG0L 1T7YA 2P5EB 1R6VA 3BDBA 4DWHA 4GRMB 1UWEH 2CLRA 5E4IA 3TPUA 3D1MC 2C1PB 4WHYG 5DVOA 3ZT5A 1XR9A 1FNSL 3IS1X 5DRZA 4P23C 3DMMA 4HK3J 3QJHB 1P7QB 2CMRH 3O3AB 5CBEA 3S88H 2VB5A 2YRZA 1P84K 2FD6H 4NDMB 3VFRA 1RY7B 4FTVB 1DEDA 2WINA 4JFZH 2NY6B 5GIRB 4FTVE 5CIPA 1A14L 3HPLA 4Q9QL 4F7TB 3KGRA 3OR6A 2ADFL 4G80A 4DGVL 4N5UA 4WHTA 3P30H 4KKAC 1KEML 1UM4H 3E6FB 4QTIL 3UC0L 1WV7T 3LD8C 4WHCA 1QRNE 2XZZA 2CRIA 3GO1H 5KTEH 3VXUA 3UAJC 2B1HL 3MLYH 4L4TD 3OZ9H 2B8OT 5EUOE 5DUMH 3HE7C 1MHCB 1U8PB 4CNIB 4DQOL 1ACYH 5E94B 4TSCH 4PTTB 2W65A 5D7JD 1VEMA 3RPIB 4FMFA 1RUAL 5GGRA 3BUYA 3B3IB 3C6LA 2HJKB 1U3JA 2EYSB 2GYSA 1K6QH 1XZ0A 1YDPB 5HI5D 4WWKA 3FT4B 3MNVA 1V7NH 3FHAA 2VWEE 3VGBA 2OK0H 4QGTA 5GGQL 5I74B 4E41E 3MODL 5CMAA 2MWCA 2Q3ZA 4LARL 2E7LC 3FQUB 5GRYA 3QR2A 2DQEH 1AXSB 4LCCB 4MCZA 4UDUB 1S7TA 3Q0HA 3G5ZA 4AH2B 3W81A 2OR9L 3MLWH 4LHJB 5D72L 3TO2B 2R29H 5FA4A 3B9KD 4KTEH 4XVJL 1FVEB 5DQ9B 5FXCH 1R3KA 3FB5A 4KJWD 2N7AA 5I1JH 4WJ5B 1DSFL 3RZCC 4CUCA 2ADGA 1OTSC 2Y36H 4G8EA 3AB0B 4HBCH 5DJAA 4F7EA 4RX4D 3BPLB 3REWA 2K7PA 1DQDL 1OSPH 1F4WL 1PG7W 1KJ2A 1KLGB 4P3WA 4J23A 2MKLC 4U3XA 4P4RA 4XP9H 3MLUH 4KUZL 5HYQB 1TZIB 2HA1A 1OP5H 1GC1C 1A22B 4CRPA 2NLJB 2B0SH 4JHAH 2X4TA 2B1AL 5TH2B 2X70B 4G7YH 5DQDL 2EH8L 5CLWA 2FO4B 2Q20A 3IDUA 43C9B 4Z7OE 3BPCA 4JREC 4ELKA 2P43B 2CIIA 2EICA 1NANH 3PL6C 2MKWA 3ZDZF 1IAMA 1RURH 5IESH 4ZOCA 5E2VH 3K4DA 4N5EC 3CU7A 4HPYH 1T7XA 5E00A 2FYYA 1A5FH 3V6FA 2HFTA 4K3GA 3BKJH 4JN1H 5FECA 5IEKB 4P5TB 3MOBL 2QR0B 2X42A 3KS0J 4K7FB 1VGEH 4RMSA 1RHHB 5LWYH 4ZTPH 1JNHB 2X9YA 1OAZH 2AABL 2OJZL 5IQ7L 4PRIA 2PCPB 2Y23A 3A67L 43CAA 3K74B 4NC2B 2PYEB 4OZIA 4UV7H 2XG5A 3WN5A 3OWEA 2PYEE 4OCMC 2YPLB 1X5GA 4O58L 4AEIH 5C0EA 2NX5B 2YPLE 3CLEH 3G08A 2FATL 4JDVA 2NX5E 1Z6JT 2EECA 1Q9KA 3LN4A 1PKQA 1T7VA 3KXFB 3RTQD 1KJ2L 3IF1B 4HWBA 3KXFE 1BBDL 5ICYB 2O93L 2CUIA 3UMTA 2D7TH 2IBBA 1EO5A 4X7SH 4LSSL 4YAQA 4QTHA 1DL7L 2UWEF 3BIKB 2VDLH 1X5YA 4PLJC 5A2IH 3T0DA 1LE5A 5HYIA 1ZTXH 2MHAB 2ZUQB 3O9WB 2VDRH 4OLUL 1UZ8A 3B5HA 5EBMB 2AKRB 3PV7A 2VZUA 4JFDB 2CQVA 2ZNWA 1YEKL 3DUUA 2C5DC 2FBJL 2AEQL 4JFDE 3VFWA 3D18A 3OAZK 4NRYA 2ED9A 3ZE1E 3QNZA 3O0RL 3QUXB 4U0RB 2P49B 1T83C 4LKXB 1EHNA 3IGAA 5D70H 4AEHL 4UT7L 1J1PH 3S7GA 4HCRH 1T04A 4LQFH 1WIUA 3V95A 2XT1B 1QVOB 5IHUH 3HNSL 5F1KC 1AC0A 3A6BL 1Z5LA 4ODSH 2UY6A 3WFDL 1IL1A 1L7IH 1N7MH 4NM8L 4EUPG 5JW4Q 1MFDL 3U4AA 3WHXA 5DC0A 1XGYL 4MHHI 5HHOD 2ZSVA 5DFWH 4M5ZH 4MNQA 4P3CH 2C4FT 4P3DA 5GJTH 5FHAH 4DVBA 3QRGL 1F58L 2Q86B 1YYLH 2IALA 4OLWL 2CKBH 5BXFB 4GOSA 1NCBL 1F2QA 4D8PA 3MJ7B 3MFFB 1HXYB 4OF3A 4HWBL 1NPUA 3UX9B 5E2WL 2BY2A 5T3XE 1KB5B 2AK4B 2ZOLA 2R23B 1HH9A 5HD8C 4L29A 1AJ7L 5K9KB 3DARA 5JZ7D 1AGFA 2VUYA 3RWDB 1QTYT 4PR5A 1M4KA 4GW1B 4LDEB 2A1WH 4L8SC 1OARL 2BVUA 2LV4A 4YGAB 2D3VA 4QXGL 1TETL 2CK0L 3WIIL 4JZJB 4FN0A 4PB9L 1EJOH 4O00A 4MQSB 3HZMA 4U1HB 5I66A 2BC4A 1AO7D 4OD3L 5I8CA 5IJVA 1R3JA 2FEDD 4JPKH 4PJ9D 3HPJA 1RZGB 4UB0H 4NNXB 2VIRA 4JZOB 5IBUB 3N50A 4RQQB 3D6GA 1FZOB 1PLGH 3L3DB 3MCG1 2A9NL 4X4YA 2AP2A 3D0LB 1INQB 3DX6B 4JG0L 5I18H 4OUUB 3FT2A 4Z7WF 2VE6A 4DFHA 2ZG2A 2P8MB 3IDGB 3L1OL 5IM7A 3JV0A 1ZGLA 1L0QA 2ZJSL 3CX5J 1IKNA 1DLHB 5FGBA 5IW1B 3E1F1 5HHXH 4ZPTA 1G6RA 3MACH 3IJSA 3IXTA 3MBXL 1BPVA 4CADA 2VZ1A 1Q8MA 4X9FA 2VDQH 1FQ9C 2BVQA 2P1YA 5L6YL 4U6VH 4JFFE 2OL3H 4X0KA 2YD9A 3VWKA 4Z7UE 3VXOB 3CZJA 5JXAH 4RZCA 2GSIB 3AU1A 5ADPL 4QO1A 4ZNCD 1NGQL 4XAWL 3RWFB 1XF5B 5GZND 2JELL 1OTUC 1YEDB 4ERSL 2P8LB 5CJQH 1MCKA 3TBYA 3WFEL 2K3TA 2ZCKH 3GJEB 5F1NA 4YDIL 1OGTA 2BJML 4PY8J 3V2AR 3OKDA 1UWXK 4NN6C 2MPAH 5IWLA 3MBEA 4I18B 4BZYA 25C8H 2A74A 4Z7QF 4GKNA 5DXWA 2FJHB 4JY5H 2J7LA 4TTGA 3EOBA 5LBSL 5AD0A 1MCPL 3AAZA 5BO1H 1EZVX 5JIIA 4KKCC 1YEFH 4L5FH 1KPRB 3Q6FB 2PXYA 2QADC 4NNYB 2NY0B 3I75A 3QAZB 4ZUTA 2UWEA 3OR7A 1I7ZA 3CLFL 3FB6B 1OAXL 3HLAA 3JSSA 2XA8L 1MRCH 5ENWA 5H35A 4L8CA 2G5BB 1H8OA 5MERA 1G6RL 2Z31B 3TZVA 4ONFH 1YY8A 1QZ1A 4G8GA 4LLMA 1H9VA 1NBYA 3UTPD 1OW0C 4ZFZB 5K59F 1QSEE 1N26A 3KPPA 3EJZD 1HOCA 2GJJA 3DVIA 3V5KB 3F5WB 1KJVB 5JMRA 1ZGLP 4QHNA 4OFKA 4J3VA 1R5VB 2CLVA 4D9LH 3EHBD 3CD4A 5ETUB 3DXAE 5DA0B 2EDXA 5EBLA 1E4KA 1RZFH 1Z9SA 5HYJA 1IGYB 5DYOB 1BWMA 2ZCHH 3RWEB 4OCWH 3OAUH 3SDDC 4TUKL 3PABB 2NXYD 4YE4H 3O2VH 2E6JA 4M6OH 5EIQA 1ZLUK 5HGGS 2DQHH 4HUMB 3BQUC 4JPWH 1FFOA 4NQXB 4L8DA 4UTBH 4JKPL 3KPMB 3FZUC 4OGYH 1NCAH 4IRSB 5MI0C 2VDKH 1QUNA 4M7KL 1MVFA 1EV2E 4LGPB 4OV6F 3LSOA 1R24B 1O7VA 3ORJA 5DJ6A 4UT9L 1Q9LB 4H0GA 4G3YL 1Y6NR 4JFEB 4G8IA 2OYPA 4G7VH 4IOIA 4OFYD 2ZNXA 3RWHB 3HE6C 3O3EB 5C0BA 2BVOB 3AM8C 4PYHA 5TE4L 4Z77A 3I2CH 4MD5B 2ZUWA 3RKPA 7FABH 3T0AA 3CSYB 1TCMA 3LEVL 4XNMA 2D4FA 3ARBC 1K2DA 4Y2DD 1XCTB 1HYSD 3C87A 2Y72A 1QD0A 5DZLA 4ZS6D 3QXDB 3W2DL 3CFCL 3RI5F 3PUCA 2P8PA 4RRPG 1P4LB 5J3HD 5J6GA 3UJTH 2V7NB 1XIWB 4LHUA 4Q2ZA 3ULUE 4XPTH 3IETB 5C0DA 4H26A 4WI7A 3MUY1 3WEXA 5F6IB 4Q0XL 2XTJD 2APXA 2R0WH 1EEYA 4X7TA 3BUTA 4XPBH 1U8OB 2ATKA 3BI9X 1JE6A 4KH2A 1YY9C 3MOAH 1R0AH 4Z7WA 4DUWA 2ENYA 2MFNA 15C8L 4QRUA 1Z0MA 4MSWA 3DURB 5LGJB 1ZVSA 3W11D 1NUGA 4P49A 5TFSL 3BPNC 1EBAA 1RVFH 3Q6GH 4F7CB 5MEQB 5IV2B 1S7XA 1JJUA 5JQ6L 1IT9H 2YBRB 2R2BA 4L3CB 3O6FD 4IS6A 3BSZL 4JQXC 2H3NA 3G6JB 2VR5A 2AJSL 3VW3H 3G6JE 3SDXA 1YNKH 3HC0A 3VFPB 4X8JA 4ZFFA 3EJJX 3MUZ1 3QIUA 5ERWB 4ZUWB 3V5HB 4IIQA 3WDJA 1JZ3A 5DK3A 3K46A 3L7EA 4DCQA 3LKQB 4P46B 5T1MB 5TF1H 4G6KH 3VRIA 3VH8A 3FAXA 2XXCB 1ZS8B 1FZMA 5CD3A 2Y6SC 2IH1B 4YX2H 1J0KA 1YMMA 5BV7B 1FGNH 3O2WH 4RFOL 1ROWA 3C08L 3QI9B 1SEBA 3WL9A 3QIBD 3CXDL 3S96A 5T1LB 3WIHA 4JO2H 1ZAGA 2QHRL 2J2ZA 2GJ6E 4A6YA 1GC1H 3KLHC 5GGSA 1YEIL 4U1JA 4BKLA 3ARFC 1SJVA 3HS0A 4ODXA 5K9JL 4C59B 1FVCB 3IDYB 5HVFB 3WJLC 1YA5A 2IPUK 5E7FA 1F45A 4OQTH 2QV2A 1JK8A 2X4SA 2WW8A 4K3JL 4U1SA 4NQED 1KG0A 1KNOB 4HX1B 5DFVC 3WV0A 1UXWB 5D1XB 4YXHL 3N06B 3I50L 1BZ7B 3DSNA 1JYVA 5E6IB 5GGVY 5H8DA 5F9WC 3OAYH 5IMLB 4I0PA 5I9QB 5IVNA 4MB5A 1G6VK 3HR6A 4HLZH 4WI6A 3LDBB 4JHZA 1NKRA 1OP5K 3KLAA 3BD5A 3MNZB 2VN4A 1D6EB 2Y5EA 3E6HB 1P7HL 3F12B 3GJFH 2BVYA 2DQFB 3NN8A 3QQNA 2OQJB 1WCBB 5F8QC 4S10A 5EA0H 3BP7B 2BVEA 1SY6H 2H41A 1JWSA 4APQD 1MVUA 4JFOA 1OAQL 4ONHA 4AL8L 4GUPB 4MA7H 4BSJA 4AM0A 5I71C 5ANMB 1FN4A 3QDMD 2AGJL 3E8UH 3JTTB 2J5LB 3TO4B 1HINL 1I9EA 5EBGA 2OSLA 4X5WA 4XNZC 3OG4B 3V6OC 3Q3GA 3MV8D 2AI0H 5ESAA 1KN2L 3U83A 1DQQA 2QKIB 2Z91A 4ONGL 3N1FC 3WXWH 1S9YA 1EEZA 2VH5L 1FGVH 1CFSA 3VE0B 4UNVA 3RZCD 2IQAB 5C0NC 3H6JA 4QF1A 5C08D 5HDBF 1OT2A 4TN9A 1D9KC 1IARB 1KELH 1WJ3A 4G9DB 4MWFA 1MEXL 5EZIH 1YEJH 4UI2A 4EDWL 5L7XH 2BSSA 2CLRB 2QEJA 3DOSA 2GY7B 3RL1A 1XR9B 3S36H 5FYKL 3FKUS 3NCJL 3C2SA 2WWMC 5LQBH 2Q8AH 2V17H 3LPFA 3DMMB 3ZDYE 1MWAL 3MRKA 3VXMD 4EI6A 5CBEB 2W60A 2QQLH 4LCWD 3VFRB 1MNUH 3NIFE 1U8LA 2XZAL 5FGCB 4U7MA 2CXGA 5CIPB 2V5YA 3HPLB 1NL0H 1XF1A 1IAIM 2CXKA 4OF8A 3OR6B 5AZ2L 4G80B 4WHTB 3QDAA 1C8PA 5HHPA 4L4TA 2X44D 5CHNB 2ENSA 5KSBE 2AJZA 2ZKHH 4KWUA 5CZKA 3GKWH 4U1KA 1SBSH 1IBGH 3NBNA 3R8QA 1RIUH 3B8SA 4JHBA 1YNLL 3ABZA 2DD8H 3VXUE 3FQNA 1Q1JL 4YDJA 1YC7A 5D7LD 5D7JA 2R0KL 5J12C 2VZVA 3O41A 5HDQH 5BRZA 3FO1A 1N64L 4XGZA 4OSUL 1JNJA 2I60H 2W65B 4YGVA 4YXLH 2E7MA 5GGRB 4Z95L 2D7OA 3ZE0F 5CCKH 3AGVA 3BUYB 3T4AA 3C6LB 3EDJA 1QRKA 3U82B 1PSKL 3F7VA 4MJ6A 5F8RC 4WWKB 2AV1B 3MNVB 2AV7A 1RIVH 2HKFL 3UZVB 1EO8H 4QXUL 3RA7L 4M1DL 3ZYOA 5GZOC 4PJEF 4U6TA 3QNYA 5C86A 1RUMH 3VXRD 5IHZA 5CMAB 5HPMB 1ZEAH 3QDJD 1HWGB 4MCZB 3B9KA 3TH4T 2YWZA 1WVZA 3G5ZB 2BCKA 1TNNA 1EVTC 1Q0YH 4LFHD 1CT8B 5D7SL 5FA4B 2Y5TA 3EFDL 2NXZD 4CMHB 3FB5B 4RX4A 2WLYA 2OP4H 4YNYB 2PW1A 3EBAA 4PRPA 2ADGB 5KAQF 3P4OA 4UT6L 4ENEC 4NNPH 4G8EB 4ODWA 5DJAB 4F7EB 2EDRA 3REWB 4JGJA 2CD0A 5AWNH 4R3SA 1KJ2B 1N2RA 3PIQA 4XPHH 1LP9B 2Y7QA 1TPXC 2WM0A 2E27H 4H5SA 4P4RB 4X6BA 3QDHA 4NZUL 1MAML 1AGBA 2VITA 1MSPA 2YKLL 1QFPA 2X4TB 3EYFA 4WW2B 5DJ0A 3SQOH 3BDXA 4NZTL 4XB7A 5CZVL 1HILA 3DYMA 3BPCB 4TVSa 4ELKB 3X11A 3S4SA 1KPVA 2CIIB 2WBJC 4KZEL 3MA9H 3RAJL 5E00B 3OSKA 5HD8D 5FECB 5MEND 1YEHH 3QWQB 4N0UA 1PBYA 1JTTA 3RL2A 5F70A 2EIDA 4QHLA 4F3FA 1P4BL 4MNGA 3VI4E 4PRIB 4XVUC 3N85L 5I19H 4JQIH 4OZIB 1UWEL 5IBUG 1OHQA 5B8CC 2R0ZH 4XZUA 1AKJD 4JDTH 5C0EB 5A3IC 4QOKB 1N5AB 3ZHKA 2W91A 3G08B 4JDVB 1G9EA 1V3JA 4NKOA 1TTUA 4ZFGH 2VLRE 1Q9KB 3LN4B 1PKQB 1BFVH 2CMRL 3S88L 5F1OB 5F7WC 1PKQE 3I85A 5EO1A 3QUZC 1JZ5A 2FD6L 1TVHA 1HE7A 4JFZL 3SKNA 4GS7C 1B6UA 3G5VA 2L7JA 3HCVA 4LRNH 4YAQB 1CLOH 4QTHB 5TDPA 1J7VR 2QSCH 1DVFB 4RWYH 4YBLB 4O2FB 4KPHH 3P30L 4AIZB 1UM4L 3D85D 1LE5B 4ORGB 2NR6D 1U3HC 2FL5A 1UZ8B 3EJYC 3GO1L 1K4DA 5KTEL 5DMIH 3LZFH 3DUUB 3MLYL 5K33A 1IGCH 3OZ9L 3MV9D 5DUML 3VFWB 3W39A 5I17A 3D18B 4NRYB 4V1DE 1ACYL 3QNZB 2X40A 1IMHC 3CAFA 1ZSDA 4N9GA 4TSCL 1Y6KR 4M1CC 3GBMH 2DJ4A 2OR8A 1T04B 2GFBA 4XBEH 5HHOA 4NO3A 1Z5LB 1K6QL 3CH8A 1IL1B 4JO4H 1FVDA 4PGEA 3WHXB 1V7NL 2DI7A 1QR4A 3V0VA 2OK0L 3UJIH 4P3DB 4MNQE 1FL3A 5D2NA 2YZ8A 2JJTC 3BEVA 1FNAA 2DQEL 3FFCE 4Y7MA 4D8PB 4JE4B 5E70A 4AQ1B 4F15B 3R4DA 3JUYA 5ILTH 1IAIH 4Z7VE 3MLWL 5JOPE 4ETQA 3PWUA 4PJXF 2R29L 4XNYH 1CLYH 4KTEL 4RAVA 2ZOLB 1HH9B 1U8JB 4L29B 3X17A 2LAAA 1L7TL 3BESR 5I1JL 2I9LA 4MCYA 4OZHF 3HR5B 2W38A 4PR5B 5GRZA 2Y36L 4HBCL 1QEWB 1OSPL 1MJJA 4WFGD 5GS2H 1GYAA 3QH3A 4FMKA 4XP9L 3MLUL 2ZPKH 4JAMB 4OZFH 4PJ9A 5SWZD 4HH8A 1NAMH 2BNUA 1B90A 2B0SL 4JHAL 3HZMB 5I66B 2BC4B 2IFFH 5I8CB 5IJVB 2YXMA 1R3JB 4G7YL 3ECBA 2NY7H 4NC1C 2YA2A 4R97C 3HPJB 3GM8A 4GLRH 2VIRB 2K1MA 5C0RH 2W92A 1VSCA 3DETD 5EZOH 2A6DA 2Y06H 1RURL 4KDTA 5IESL 4NPYA 3IRZA 4FG6C 3FT2B 1F4YH 5E2VL 2VE6B 4WUUD 4W6WB 3C5ZC 1QBLH 4D9RD 5IM7B 3D69A 3U4BH 5SWSD 3H2WA 1QFUH 4HPYL 1ZGLB 4MLSA 2PETA 1A5FL 3FT3A 3MLSH 2VLJD 4BZ1H 1G6RB 3IJSB 3BKJL 3TIEB 4HCRA 4JN1L 4CADB 5FYJE 2BVQB 5E5MB 3VRLF 1NLDH 3ZDZE 5F7DB 1D5ZA 1VGEL 4H0HB 5LWYL 2VERN 4ZTPL 1S7RA 1OAZL 4LVEA 3U1SH 4X0KB 4HJ0C 3VWKB 2AEIT 2VLME 3LAFA 1INEH 5DUPL 4KTYA 3B9DA 3AY4A 4RZCB 4UV7L 3AU1B 1BJMA 4XNXL 1WFTA 3HE6D 5JORA 5EO9A 4G6MH 4AEIL 1BF2A 1EH9A 3DUSA 3CLEL 4LCIH 2CKBA 4PUBH 3BYYA 3SE4C 3KYOA 3KYKH 3TBYB 3TN0A 1KIUA 2JCCF 4JY4B 5F1NB 3HI1A 5C0CE 1MCWW 1JCKA 4HUUB 3K1KC 4OLXL 3U48A 3OKDB 2XWBA 4C83A 1LE9A 3MBEB 2A74B 2D7TL 4GKNB 5MHSE 4JVPA 4HEME 1ZLWK 3L5JA 4X7SL 3EOBB 5AD0B 3WLWC 4HJGA 3AAZB 2VDLL 5DC4B 3VGHA 1ZTXL 3T4YA 3MRBB 2VDRL 1WF5A 4M6NH 4JFHE 3C60C 4NSKA 5A1AA 1S7SA 2DBLH 1TZGH 3IXAA 3FHQA 3I9GH 3O8XC 4G6FD 4D94A 3I75B 2DMKA 1YY9D 1NCWH 3MRGA 3VGGA 4DKEH 2UWEB 3OR7B 1I7ZB 4PGBA 4JRWA 5GS2D 2UWEE 3HLAB 5ENWB 5H35B 4EDXA 4L8CB 5J4MA 4X9BA 1KT2A 5MERB 1NBQA 2EXWD 4YHNA 5D70L 3TZVB 3L3IB 1YY8B 4OZGF 5GS1C 1AE6H 1J1PL 3DHJA 3MRQA 4G8GB 3HMXH 4LLMB 3NFSL 4LQFL 2VZSA 4G8GE 1FYHB 4F8QA 4FP8H 3KPPB 4ODSL 1HOCB 1L7IL 1N0XH 1N7ML 1NBZA 1TQBB 3GJFK 3GEWB 1XMWA 2KKQA 3LPWA 4QHNB 4XP5H 1LILA 4M5ZL 4WV1A 1T1WA 4P3CL 4FQQA 2DQDH 3TYFB 3F7YA 4YDKH 5GJTL 1PVHA 5FHAL 4FS0A 2MOVA 5EBLB 4YDLB 2MQ0A 4QXTA 3L5WA 1YYLL 1NUDA 1JF1A 2CKBL 5HYJE 4JJHA 2DLEA 2Y6SD 2FR4A 3EUUA 1KUMA 5DT1H 4UILH 4HEPG 1FFOB 1EAJA 4L8DB 4PJAE 4K7PH 4EQ3A 3UO1H 4PJ7E 5ITFA 2G75A 5I1EH 1N5YL 4KV5F 1BREA 4MD0B 3ARFD 1ED3A 3LSOB 4OFYA 2A1WL 4M1GH 5DJ6B 4PJXA 5I16A 2ADIA 4Y5VC 2FIKA 5BJTA 3BHBA 4G8IB 4PGZA 5IB3A 4IOIB 4GXVH 3TVMC 4PRHA 4L9LA 1CU4H 2VDNH 1G7PA 3CCHA 4Y2DA 5C0BB 4OZHA 5C0BE 4UZGA 1EJOL 4F7MA 1WZMA 4XNMB 4EN3C 1K2DB 4JPKL 2A2QT 3K7UA 2X4RA 4UB0L 4K71C 2W0PA 1PLGL 1MJ7H 3EGSB 2P8PB 5I18L 4QGYA 5J6GB 3RWIA 2EDLA 4LHUB 4Q2ZB 5I75B 1IAII 1N6UA 5C0DB 1W0WA 4H26B 4QYOA 3WEXB 3KS0H 4POZC 3EYQD 2OZ4A 3HUJE 1D6VL 1A7RH 3C8DA 4Y19B 5DMGC 1VFUA 5HHXL 2DIJA 1EEYB 3MACL 4PG2A 5E1HB 1QSFD 1P84J 1UJTA 4AMKH 2IWGA 2ATKB 1A6WH 2VDQL 2AK1H 4LP4A 1S9VA 4Z7WB 1EX0A 4U6VL 3WNMA 1L9MA 4JPIA 4QRUB 2IFGA 2OL3L 3VXQB 3O6FA 4XWGH 4FFYL 2VXUH 3PXHA 5C0FA 4LLQA 1U93A 4BSVA 1S9XA 2VZ3A 1S7XB 3TFKC 2R2BB 1WTGT 4IS6B 4WWID 1JRHI 2H3NB 4HUKB 2X9XA 1L0YA 4GAFB 4ORZC 1I7UA 5CJQL 3HC0B 4ZFFB 4X8JB 5DDHA 2ZCKL 3QIUB 1IEAB 3SDXE 4GLRI 4IIQB 3L7EB 4DCQB 3BVNB 2MPAL 2FX7H 4U1GB 25C8L 3EW3B 1F02I 3WFBL 4JY5L 3VH8B 2VXVH 3QBTB 3QIBA 2JCCA 1FZMB 5CD3B 2H9GB 1YMMB 1IGFH 1YMME 1SEBB 4OFPA 3WL9B 1YEFL 4L5FL 3S96B 4ZXBC 1KB9K 4Z7QE 2W9EH 3A6OA 2WWMD 4J8RA 1C7TA 5J89A 3NH7H 2AEPH 4LCYB 4A6YB 4U1JB 5F9JA 1MPAH 4BKLB 3HS0B 4ODXB 1I8KA 3KAAA 1MRCL 2OX5A 3E2HC 1FP5A 3ZO0A 3C8HA 4OGXH 3U30C 1B0GA 3GSNH 4CVZA 4ONFL 1JK8B 2X4SB 3BH9B 1KG0B 3U9UB 2D9QB 4A2MA 5JA9A 1NGXA 1F4XH 1C5DB 1I3VA 1W2KT 4CKVX 4OZGA 3K0WA 3RU8H 2EZ0D 2BOBA 3VI3E 4D9LL 1U95B 5GHWH 4CVUA 1RZFL 3KLAB 4TUJA 4YBQC 4HULB 2DL2A 2ZCHL 5L88H 4OCWL 2VKWA 2CGRH 3I6KB 3OAUL 4HF5H 4YE4L 3NN8B 6FABH 4B5EA 1MWAB 3O2VL 4M6OL 4APQA 3ZKMC 1WSST 3NCBB 4Q9CA 2DQHL 4JPWL 3V5DA 3CNKA 1YN7A 1JWSB 4OGYL 5IJKC 1NCAL 2VDKL 4NZJA 1AFVH 3RBGA 4M00A 4ONHB 2BDNH 4R0LC 2YR3A 3ZKQD 5GZOD 3DBXA 4AM0B 1G84A 3QIWD 1FN4B 3O3BB 3MV8A 4G7VL 1I75A 4DKAA 2F54D 4N0YH 3OGOE 2WIMA 4X5WB 5CJOH 2V9TA 3I2CL 7FABL 3Q3GB 5ESAB 1CD8A 1DQQB 2Z91B 2HG5B 3RZCA 3ALPA 4ZUSA 3BZEA 4JRYE 1S9YB 4TSAL 3ARXA 5DGQA 1M05A 3VD4A 1CFSB 1T66D 1VEPA 1VHPA 4BQ9A 1REIA 4QF1B 5EOCJ 3UJTL 2DLFL 1DBJH 4RGMC 4XPTL 4MWFB 3CZFA 3MFGB 5F7HA 4GMSH 2X1WL 2BSSB 1QRND 3RL1B 2R0WL 5D96B 2BSRB 1ZLVK 1IM9D 4M4RA 4HQQH 4XPBL 5C09E 3VG9B 4LCWA 3OKMA 1UH3A 5IW3A 3MOAL 5DD0H 4PLNC 4KTDH 4PJDF 4G6AC 3MRKB 4U6HA 4WO4D 1PJ9A 2W60B 2JF1A 1U8LB 5F9DC 4K94C 1RVFL 2IPTH 2NY4C 3Q6GL 4ZUUA 1IT9L 5JPNA 3KDMA 4BA8A 1MFEH 4P2OC 2OM5A 2XZCH 4XP4H 1VKXA 3VW3L 1JV5A 3WCYA 4HPOH 4L4TB 5HHPB 3WO3B 1R3LA 1KSRA 3GJFA 1YNKL 4L4TE 1TJHH 4U1KB 5D7LA 3INUH 1NFDF 4TQEH 4E41D 1UA6L 5TF1L 1SY6A 3FQNB 4YDJB 4LLDA 2WNGA 3PWJA 2CDEA 5D7JB 1VFBA 5GRXG 4NQUA 3O41B 1RZJH 3FO1B 1CG9A 3TBWA 2BSED 4XGZB 4YX2L 5BRZE 4YGVB 1FGNL 4Y2OA 3O2WL 1WWWX 4UAOB 4ZOBA 3T4AB 3CXHK 4JO2L 3ZKSD 3F7VB 4Y4KD 4MJ6B 4YFDB 2AV7B 4S1QH 3NGBB 1GC1L 5IB5A 4NN5B 1JMZA 4EI5C 3QDJA 4OBSA 4XXDA 2EH7H 2EO9A 3QNYB 3PDGA 2SEBA 1WGOA 3QSKB 4OQTL 5IHZB 2DQIH 4PJIF 1IAKB 2E9WA 3B9KB 2BP3A 1T2QH 4WRLA 2BCKB 3RVXC 1E6OH 4XP1H 5B22A 2Z9TA 5DURD 1U3HD 1ADQH 5JXEC 1RZ7H 2X4PA 3RVWC 5GS0C 2Y5TB 4CU7A 4M8QB 1KIQA 1T83A 5ID0B 2E8YA 2PW1B 3JWDH 1JF5A 2J8OA 3QXWA 1CF8H 5CSGA 3NVQA 4PRPE 1CQKA 1FSKB 3P4OB 4ODWB 3WFCH 3DUHA 4UINH 2VRAA 3ARZA 4LSPH 1N59A 2DS4A 3DX8A 4M1CD 1N2RB 3NCEB 4DUXA 3PIQB 5EA0L 5EZLB 1ZWIA 2Y7QB 5D1QC 1AGBB 1SY6L 5D8JH 5GRVK 4U6XA 2IQ9H 2MJWA 3GFUA 4O9HH 3X12A 1EVUA 3EYFB 5DJ0B 5IW6A 4MA7L 4W70A 4RGNC 1HILB 1G9MH 3X11B 3E8UL 2YSSA 3S4SB 1KPVB 1QFWM 3LHPH 1CTOA 4O02H 3V0AC 5KSUA 5F7NC 2VQ1A 3GSXA 4YFLI 1CDYA 3T2NH 5MENA 4G8FA 4OAWA 1NGYA 3TCLA 3WXWL 3UPRA 3MRJA 4L8SA 3V52H 4KKLC 1FGVL 4GRLC 4N0UB 4HWUA 1DBMH 3Q5YA 3D25A 3RL2B 1NC2D 4N0UE 4QHLB 2D7NA 4ODHH 1EO7A 1GGCH 4F3FB 3NPSC 4MNGB 1KELL 1AKJA 3QT2A 2YD3A 1FNHA 5EZIL 1YEJL 2W1NA 4LEOA 5L7XL 1LO5A 2NY5H 4PTUA 3J7HA 3RTQB 1IJ9A 4KROD 3S36L 3OXSA 3ROLA 1TJGH 5DJZA 3AMLA 4JFDD 2Q8AL 2V17L 3ULSA 4NKOB 1YZZA 4NQTA 1J8HE 3GIZH 5B4MC 2GY5A 1U8IA 5EULV 2J8UF 1QLRA 5EO1B 2QQLL 1MNUL 5T3ZE 1TVHB 3MRMA 3UROR 4N0CD 2EDBA 4DN3H 3D85A 4Q6IB 3U0TA 3WXVH 3G5VB 1E28A 3HCVB 1NL0L 3L3GA 3WD5H 1AH1A 2C3GA 3LVEA 2MTPA 4HAGA 5TDPB 3B8YA 3NIDF 3O3DA 1FG2A 3JZ7A 1W8OA 3MV9A 2ZKHL 2DAVA 1WZ1H 2IH3A 3GKWL 3MJ9H 2FL5B 1JYWA 1SBSL 4HS3A 1IBGL 2JIXD 3BP6A 1K4DB 1M71A 3DROA 1RIUL 1QKZH 1ERNA 1ETZA 2DD8L 1JPGA 3W39B 2DQCH 5I17B 4BZ2H 2UUDH 4LVHC 5HDQL 4HJ0D 4PP1D 1UT9A 4N9GB 5SV4A 3GSUA 4UOW1 4HGMA 3SBWA 4R4BA 2I60L 1CDHA 1IGIH 5IROC 4CBPA 3DIFA 4R7DB 5CCKL 3G6DL 3LS4L 4MX7A 4RMWA 2GFBB 5IMKB 4K8RC 1J0JA 4PJHA 4EQ2A 5HHOB 4NO3B 3MLTA 5HHOE 1AD0A 2D03H 4NRZA 4JKLA 2CO7B 1FVDB 2FIRT 4PGEB 3TT1H 5GRUL 1RIVL 2X7LA 4XMLL 4QKXB 3TM6A 3N9GH 1EO8L 3KPRA 3V0VB 4LSUH 2FEEL 4BH7B 4IJ3C 1FL6A 3PJSA 2FSEA 1FL3B 5D2NB 1RUML 4PY8I 5KSVB 4H20H 3AROA 3BEVB 1AGCA 1ZEAL 4DUVA 5IKCA 4RMRA 2YRPA 1X9QA 3WLWD 1NCUA 1JFQH 4LP5A 5E8NA 3T65A 1Q0YL 1A2YA 4PJEB 4N9OB 1G7JA 2XWTA 5BZWA 4PG9A 1FBIH 3O8XD 1AXTH 4PJIA 2OP4L 2JB6B 2LTQB 1A6VH 2I9LB 5C3TA 5D9SB 1OW0A 4NQCD 2BOCA 5CGYD 4NNPL 5SWZA 2AS5M 3F6IA 4HS6A 5AWNL 1MJJB 3QH3B 4XPHL 3MRDA 4Q9RL 2E27L 4PJ9B 1GZQA 3BYTA 3CK0H 3D39D 3S8WA 4JFFD 5ISZA 4NO5A 3HI5H 3SQOL 5FO9A 3ESUF 2VMFA 4M02A 3F58H 5DUBA 3ZDXF 3Q5OA 4R2GC 5SWSA 3AMKA 5DR5H 3ZE2F 2FGZA 2ADJA 5DEZA 2A6DB 3MA9L 2Y9RT 4NPYB 1S5IH 2VLJA 3BQUA 1BVLA 5ICZB 2DTMH 1HH6B 3D69B 3MUHL 4HWZB 1I85C 4JZNB 4FQ2H 3X3FH 3FT3B 2RJMA 1YEHL 4NHCH 1D5ZB 1F3RB 1T0MB 1S7RB 4I8DA 3HE6A 3AM8A 5AAMA 3UZQA 4J3SA 2P47B 5I19L 4JQIL 5H2BA 1BF8A 2BRQA 2FRGP 3ULUH 1SM3H 2UVEA 3ARBA 3VFNB 5JORB 2AJUH 2DKUA 2XKSA 4PRDB 2R0ZL 4H1LA 5EO9B 2IBZX 4JDTL 1I1AC 3DUSB 4HFWA 2CKBB 2RFXA 1AHWC 4EN3D 3TN0B 2DLTA 3D2UD 3UTOA 4ZFGL 4O2EA 4I3SH 3HI1B 1BFVL 4XNUH 4HMCA 4JLRA 4C83B 1LE9B 1JGVH 3KNBA 3MRHA 4FFWC 4M6MH 3SGKC 4WI2A 2PO6D 4LRNL 5CGMA 5IP4A 3FQTA 1CLOL 1QSED 1IQWH 4NFCA 5D6DC 1WBZA 2QSCL 4HJGB 4RWYL 1DANU 3TA3D 4POZD 4KPHL 1QFWH 2GK0A 2J8UA 4NOBA 1GAFH 3T4YB 1HKLH 4NSKB 4GH7B 1S7SB 1P6AB 3LZFL 3DXAD 3QHZL 3MRGB 1IGCL 3FN3A 4OZFA 4BQ8A 5IB4A 1NAMA 4KFZC 4PGBB 2I9TA 2WIIA 1RZIA 4XMPH 3SPVA 2GKIA 1S9KC 3NZHH 1IQDB 1KT2B 4WEBH 4YHNB 1LD9A 3L3KA 3TFKD 3GBML 3MRQB 1H3PH 4HKZB 4NUJB 1JNLH 1CGXA 4HDIA 2LFGA 4XBEL 4TPRH 5I6XB 3DX9B 2DM4A 4F37K 3VGAC 4JO4L 1NBZB 1WCQA 2FNBA 5DHVH 4KJPC 4WV1B 1T1WB 4FQQB 2NXYB 3F7YB 4WI4A 1A7OH 1I4FA 3MGTB 5SV3A 3GMLA 4C54A 4QXTB 3L5WB 1JF1B 3K4AA 3GBNH 2X4QA 2FR4B 4LMQE 2OL3B 4YHYB 3BGAA 2KUTA 5ILTL 1IAIL 3FQWA 4XNYL 4ZXBD 3QO1A 3ARFA 5ESQB 3WJLA 3CC5A 4FQ1H 2N56A 5DD6A 5ITFB 3QXTA 2G75B 4Z7NF 3S9DB 3O81A 1RMFH 1BIIA 3QEGH 4YJZL 2VXQL 3ULUD 1XGTA 4D0CB 3QEUA 1XAUA 4QEGA 4PJXB 1CDJA 5HJ3A 2ADIB 5BJTB 3BHBB 5IB3B 4PRHB 5FK9A 5CAYB 4L9LB 4JM4H 3CCHB 1G7PB 4YC2C 4PRHE 5CKGA 3UZEA 4Y2DB 1B88A 1JMXA 3CX5K 3NFPA 4OZHB 1NAML 3CFBA 5F7KC 4F7MB 2HRPL 1JRHL 3LQMA 2IFFL 5BOZG 2B2XH 3FTGA 4JCMA 3DV6A 2NY7L 3BZ4A 2PW2B 3QQ9C 2X4RB 5EUOF 1ZVYA 4S11A 3UPCA 3DVNA 1Q9WA 1Q72H 5C0RL 2XOTA 4YFEA 5GRVL 2XTJB 5EZOL 3RWIB 2Y06L 1F4YL 5K9QI 1QLFA 1QBLL 1W0WB 1KACB 2EC8A 3RHWK 2HTKC 4M9OA 3U4BL 2PTVA 3ZKMD 5C0AD 1WIOA 4YFLF 3HMWH 3MLSL 5EC1A 4BZ1L 4DKDC 2YN3A 4XCCH 3HMXA 1C5BH 2DTSA 5J8OA 1NLDL 1S9VB 2Y25A 4JPIB 2NMSA 5DS8B 4YWGH 1JI2A 3RZWA 3O6FB 4LAQH 3RP1A 4XWOC 4JHWH 2ORBH 4GO6B 5C0FB 3BH8A 4LLQB 1U93B 1INEL 1S9XB 4BSVB 2AXHA 2E9JA 1RJLB 4YXKH 5JTWA 2F15A 4G6ML 3PWPD 4LCIL 4PUBL 3S35X 1I7UB 3KYKL 3WS3A 2LU7A 2R4SH 2GJ6D 5DDHB 3BWUC 4D2NA 1VDGA 2R1XA 3MRCA 4ZAKC 4D3CH 3JV4B 2BNQA 4WCYH 3MJ8A 3QIBB 2JCCB 2NZ9D 3EZJB 5E8PA 1TJIH 4U05A 4Y89A 3MJ6A 4O51A 3VCLA 1E27A 5I1LA 1KENH 1X5IA 4Z76B 2DBLL 1TZGL 3AB0C 3I9GL 4HK0A 5JNYA 3BPLC 2Y07H 4J8RB 2O61A 1MH5B 4ODVH 3OPZH 1NCWL 4DKEL 3FONA 4NQEB 4GSDH 4Z7OF 5F9JB 1I8KB 2NCMA 2QBWA 4DGYH 1B0GB 4CVZB 2NY4D 1UFUA 1AE6L 3LD8B 1BVKB 1NGXB 4FP8L 1Q38A 4AIOA 3WHE0 4B53A 2Q6WB 4I1NB 4OV5A 1N0XL 2VC2H 1F4HA 4OZGB 4XP5L 1CXFA 2YHGA 1BAFL 3KR3L 4OZGE 3K8LA 2DQDL 4MJIA 1UG9A 4YDKL 3SE3C 2IEPA 3SGEH 1CLZH 2XNAA 1QFWI 1YJDC 4U7KA 3HNVH 4OCXH 4P5TC 5FM5M 1RPQA 5DT1L 4APQB 3VXTA 4AEFA 1NAKH 3V5DB 2X1XR 1YN7B 3MTRA 4K7PL 2QL1A 3D48R 3UO1L 3QIWA 2J6EH 4QCIA 3QDMB 5I1EL 1Y18B 1OL0A 2F54A 3N1QC 4EI5D 2A6IA 2HYMA 4M1GL 1SJEA 3R0MA 5E99H 3MV8B 4GXVL 2BK8A 1HXMA 1CU4L 2VDNL 3MV8E 5JW5A 2HN7A 1BJ1J 2HRLA 3RWJA 3MV01 5BOPA 5FGSA 3RZCB 5JXED 2M8XA 4ZUSB 1RU9H 5C08B 3BZEB 3MC0A 3NAAH 5K9OB 3RWGA 1TDQA 1WITA 4YDVA 4MHHG 1M05B 3IU3A 1MJ7L 2HLAA 1KTKE 1WC7A 1QRNA 1V05A 3DVFA 4PP2A 1IM9A 5F21B 3W9DB 1XFPA 3CZFB 3ARGD 1CGSH 1MHPH 1S9WA 4MAYC 5EUOA 1A7RL 2CR3A 2E9BA 5D1QD 5DEFA 1AGEA 1UKSA 3BO8B 3GSNA 3ARSA 4BQBA 3S4SG 1S8DA 2P4AB 4AMKL 4LLAA 4U0RC 4LCWB 3OKMB 3T0BA 3VXUD 2AK1L 3P4LA 4KMTH 2WBJA 5IF0A 5TDNA 4U6HB 3VFUA 4XWGL 4RGND 3MV7E 2X4OA 1G7QA 2VXUL 5HI3C 3VA2C 4ZUUB 1OP9A 1XGQA 5JPNB 3KDMB 4CVXA 4JY6A 1VKXB 4UTAH 5IHLB 5ADOH 1A4JA 1JV5B 2ICCA 2UUDK 1R3LB 1MCBA 4XC1H 4E41A 3GJFB 4WWKD 3OKOA 5C0JA 1L6ZA 1IFHH 2IAMC 5D7LB 2J8HA 5D7LE 1N6VA 4KKLD 2CUMA 2FX7L 2LQRA 3GMPA 2AJ3A 4LLDB 3EIFA 3ARUA 2CDEB 3OF6D 5B8CA 3STLA 4QNPE 2IPKA 2VKXA 4NN7B 1CG9B 1CYGA 4NO0D 3TBWB 5C6TH 3W82A 2XQYK 1IGFL 5JHDA 2EDOA 1WK0A 4IOSD 4OCSH 3HTLX 4R4FH 4KRPD 5CJ8A 2DYPD 3MSPA 2W9EL 1RUPH 1I8IA 2XY1A 1UB5A 2AEPL 1RUKH 3CFKA 1U92A 1KIRA 3H42H 3VDCA 3QDJB 2GIYA 4WGWB 3S35L 4XXDB 3T1WA 3QDJE 1JHLH 4OGXL 2XYCA 5C6WH 1U3HA 3T04D 1E0OB 2CRMA 2WSKA 1T1XA 1UM6H 3KPSE 1F4XL 3S3JA 1HQRA 2NXZB 4LEXH 1A6UH 5IBLC 3GUTB 2KH2B 2X4PB 4XCYA 3WKMH 3GB7A 1X5AA 5K93A 3RU8L 4M7JH 1KIQB 1A6ZA 4MYWB 4RCAA 4BK4A 1TXKA 5GHWL 1JWUA 2DMBA 2C4XA 4JN2A 3SE8L 1GGIH 2BZDA 4PJGF 3QXAA 5L88L 1TZHA 4Z7UF 2CGRL 7CGTA 3IYLW 5GJSH 5TPWH 2E3VA 6FABL 4PPTA 1N59B 3DX8B 1A7NH 2YA0A 1ZWIB 3EDKA 4HZLA 3HZVA 3BAEH 3RUGF 4U6XB 3X12B 3UDWA 3GRWH 1WISA 4JFXB 2JJTA 5IW6B 1BGXH 1T20A 2BDNL 1B0RA 3UEZA 4Z8FL 1BLNA 3S5LA 4X4ME 3QB7C 4N0YL 4FXGA 5KBNC 3LH2H 5CJOL 5KSUB 2VQ1B 3GSXB 2VTFA 1KV3A 5MENB 2D7PA 3CDFA 4G8FB 4OAWB 1NGYB 3TCLB 5MENE 2VLRD 4CN6A 2FZ3A 1FRGH 1NC2A 2GSGA 2MCG1 3STZA 1BMGA 1NUNB 1EGJH 3UPRB 3MRJB 4L8SB 4HWNA 4PLKC 3V4PH 1I3UA 5J57B 5KAQG 2VL4A 1UEYA 1DBJL 3EO9H 1AKJB 2CPCA 3BN9C 3OHXA 5IK3A 4LEOB 1LO5B 4PTUB 3NABH 2F8XC 5GGTH 4KXZH 3Q5TA 3MZTA 4HQQL 4P2QA 3OXSB 1A1NB 3ROLB 5DJZB 5EUKA 5DD0L 3ULSB 2Z31C 1I8LA 4KTDL 5FYJH 1XR8A 2ARJA 4V1DD 1U8IB 1T7WA 1ADQA 1QLRB 3P3YA 4LU5H 3C5ZA 5IVZB 1EXUA 1KTDA 3BPOC 3OJDA 1EFQA 3MRMB 5EU3A 4R2GD 1WICA 5KG9B 4HGKC 2IPTL 1GH7A 3D85B 3U0TB 2YMXH 5DHYA 2F53A 3L3GB 1XGRA 4HSQA 5IOPA 1MFEL 3MGAA 2DQTH 3GI9H 4PJDB 4W6XB 2JIXA 5I1IH 2JJSC 3RX8A 3O3DB 1FG2B 3THMH 4HPOL 4KKBC 3ARPA 3CH1A 3QZWB 3MV9B 1TJHL 2IH3B 5BMFH 1DUZA 1HNFA 1M71B 3DROB 1L6XA 2BY3A 3INUL 1H3UA 4W6YB 4MNQD 1JPGB 4TQEL 1BQHG 3TNMA 1K3ZA 1QLEH 4P2RE 1AGDB 3FQXA 3FFCD 3AS3A 1RZJL 3GSUB 3SE4A 3HRPA 4MQTB 1X5FA 5JOPD 3DIFB 4Y4FD 5F7EH 3EDDA 2Q8BH 5GSRA 5LJYH 2UZYB 4G42A 3MLTB 4PJHE 4GMTH 4NN6B 1AD0B 1H3XA 1RK1A 3LPGA 4NRZB 2VAAA 3WS6C 4S1QL 2X7LB 3RY6A 2X4UA 3DI2B 3KPRE 4W4OA 2EH7L 4FFWD 2FSEB 3FO2A 3H7BB 3NACH 3OXRA 4EEEA 1DLFH 1BX2A 1JPST 3ULUF 1GXEA 2DQIL 4GW5A 4KQ4H 4Q58C 1AGCB 1XGPB 3SY0A 2HAZA 1YEGH 4AJ0A 1T2QL 3DJ9A 3O8XA 5E8NB 4XP1L 2WK2A 5HVHB 3T65B 1ADQL 1A2YB 2V9QA 1G7JB 2XWTB 1RZ7L 4NQCA 4FRWA 1KCRH 1W72H 4PJIB 2OI9B 5CWSA 2D31B 1EAPB 5F6IC 3JWDL 4O5LH 3OTTA 4PGDB 1CF8L 1X5XA 1CXIA 2EDQA 2BOCB 5DWUH 1EEUA 3WFCL 5SWZB 2HJLA 2G60H 4UINL 1VA9A 4HS6B 3LRHA 5SWZE 1EDQA 3VFVA 2HTLD 3D39A 4JFFA 3MRDB 5IEHA 4KMLB 3SKJH 4GXUN 2RR3A 3S37H 3BIBX 5FYJD 4PJGA 1IGTA 4P9HH 2R9HD 2IQ9L 2X4NA 4Z7UA 3LB6C 4NO5B 4BFIA 3UTQA 5ISZE 1KGCE 4POYA 5FO9B 4KJPD 1EHAA 2VLMD 5DUBB 3VWKD 1G9ML 3NCMA 5SWSB 4N1HB 4R8WH 2ADJB 3RUGA 5SWSE 4F58H 3LHPL 3BN3B 2ZUSA 2R2EB 4XMKH 4BELD 2VLJB 1D5IH 1BVLB 4O02L 5FM8A 3SKOA 2VLJE 5JIKA 5HYSG 5CKAA 5MI0B 3T2NL 5E9DD 3DLQR 5EOCH 5DJYA 4NZDA 5C0CD 5CJBA 1P5UA 2OJEB 3V52L 2EDTA 4Y5VA 1P6FA 4LSVH 3SCMD 5BV7C 5C2BH 1BBJA 4ODHL 2HWZH 4LBEB 3HE6B 3QPQC 1NSNH 2AAVA 1DANT 1KOAA 4XCFH 3RVUC 5BW7A 5H2BB 4EN3A 4LKCB 3D2UA 2NY5L 1O5DT 5B21A 2UZXB 3DGCR 4HFWB 3IDYC 2PXYD 1TJGL 2RFXB 1U2CA 3HAEH 1MQ8A 1MY5A 5F96H 4O2EB 1I9RH 4MXQC 4HLJA 3GIZL 3P9LA 4X99A 4E5XA 4JG1H 4JLRB 2XN9E 4LOUC 4S2SA 5D1XC 5F88B 3K2UH 2VABA 3KNBB 4F9LA 4DN3L 5DEGA 3WXVL 3TZVD 1AQDA 2PR4H 4ZO9A 1SEQL 3LKSA 3WD5L 2FDBP 4NQVA 3FQTB 1F13A 5I9QC 4JPVH 2EKSA 4G6FB 2GK0B 3WSQH 2J8UB 2DKSA 3DXAA 2F5AH 3LDBC 3MJ9L 1WZ1L 4HZAA 4UNUA 1FLTX 4EBQL 1QKZL 2O5YH 4OZFB 4S1DD 5J9PA 3BPNB 4Y5YB 2DQCL 4MA1C 1NAMB 2I9TB 5HYJD 4BZ2L 3BE1H 2WIIB 1RZIB 3FOMA 3EYUH 4CMMB 2H2SC 2G5RA 1CE6B 1A02N 4HS8H 1LD9B 3L3KB 1X5HA 1IGIL 4QRPE 1HN1A 5HHQB 1FAIH 4Z5RA 2V5SA 4MD4A 4HDIB 5JIHA 3EKCA 4JRXE 2YPKA 3V9FA 3GSQA 4OFDA 2D03L 1HIMH 4GG8A 3TT1L 3V8OA 3F8UB 3WIHH 3TO4C 3RNQA 3N9GL 4LSUL 3ZSSA 4ZAKD 4M6AA 1I4FB 1J1XH 5L2KD 1FFPA 5CP3H 4S0TD 3RX5A 4KK6C 4H20L 5J1TC 1FIEA 4ZXBA 3WMSA 5C0BD 1JFQL 1ACZA 5I30H 1JWMA 1E4JA 1CE1H 1U8KA 1UH4A 3FQWB 3GKZA 3MA7A 4Z9KB 3PV6B 1U58A 3QEHA 3QO1B 1FBIL 3ARFB 3X13A 5ALBH 1AXTL 3LKNA 3C09B 3CC5B 4P4KC 3ZDYF 5DD6B 4XHJC 1UVQA 1A6VL 2FCBA 5C70A 3O11A 1BIIB 1GIGH 5I76A 2I27N 1PQZA 3T8XA 4E0RA 3QEUB 1CDGA 1LO4H 2WUCH 3B9VA 4HIEA 5HJ3B 1S3KH 3CDGA 1XGUA 5FK9B 3LCYA 1KN4H 1B3JA 5F9WB 3NFPB 5KSBF 4NOFA 3TH2T 3CK0L 3LRSA 3CFBB 2D9CA 5C0GA 1Q94A 2VYRE 3TBSA 4XRCA 3FTGB 3HI5L 3DV6B 3BZ4B 1CICC 1MIMH 4NBYB 1FJ1A 1WAAF 1Q9WB 3DVNB 4OD2A 2H2PC 3F58L 3WNLA 2R1YA 4CVWA 2EYRA 2GITA 5DR5L 3MLXH 1SJHA 5C0AA 2QLVB 1S5IL 1ZA3A 1QSFB 2DTML 1QLFB 2X6MA 5IJKA 3UXFA 1NQBA 5I1DA 1SMAA 1MHHB 5EC1B 4DW2H 1I8MA 3ZDXE 1WWBX 4KDWA 4R0LA 1RIHH 4PYGA 1G7LA 2DM3A 4NHCL 4RNRA 2WLZA 4I77L 1CD0A 3LOWA 4HGWA 3TCXA 1UWXH 1KXVC 5DJ8A 3PWPA 4XNZB 1ZT1A 4YPGA 5I1AA 5DHVA 3V6OE 4D0BB 1JTOA 3ULUL 1SM3L 2GJ6A 2AJUL 1AC6A 4OGAC 1UQSA 2XRAH 2BXYA 3CX2A 3TYGH 4ALAH 3WS3B 1UYWH 2WWKT 2XICA 4I3SL 3TBTA 5EFIA 4XNUL 1VEOA 3MRCB 5DJXA 1JGVL 4XCNA 1WBXA 4M6ML 3LV3A 2BNQE 2FJFA 3CXHJ 5FOBB 5B38A 1FNGB 4ZFOL 3TJHC 1IQWL 4FZ8H 5E8PB 3H9ZA 2CR6A 4GFTB 1DR9A 4CMHC 3ZTNL 1QFWL 4KGLA 4L3EA 4MAYD 2DL9A 4O51B 3VCLB 1E27B 3VFTA 1VADA 2EIZA 5I1LB 1GAFL 5A2LH 3GDBA 1HKLL 2EDEA 1C7SA 4TVPE 4HK0B 5JNYB 1N4XH 4I0PD 2O61B 5IT2H 3QEQD 1ZANH 3B6SA 1HK6A 4NQSA 4XMPL 3HNTH 4P2OA 4S0SD 1A3RH 3NZHL 3VFSA 2ZOKA 1KLUA 4OKVA 4WEBL 3GK8H 1JHTA 3WNNA 3I6GA 2EC9U 1H3PL 4ZDHA 4WW2C 4TPRL 4NO2A 1UWGH 2Y1VA 1X5JA 2IAMD 4MNHA 5FDWA 3WJJC 1H8NA 4MJIB 4X5LA 1A7OL 3OJMB 4MJIE 5DTFA 3ARRA 1FH5H 5DD1L 1SQ2N 2XNAB 4QHKJ 1T80A 1QOKA 3GBNL 4TNWK 5I1HH 5KW9H 4UBDC 2GI7A 2JK5A 3AXLA 3IAPA 3VXTB 1UADC 1CFVH 3HKFA 4JRYD 2GW5A 4EI5A 1MCSA 5T5NF 1SHMA 3QIWB 2DQJH 1WWAX 1RMFL 3QEGL 2F54B 2XQBH 4LPWA 4FFZH 1FCCA 2A6IB 2P5WA 5CP7B 5A2JH 2F54E 1H5BA 1FFRA 4MA3A 3KYAA 3IFOB 4YHLH 1HXMB 4JM4L 5JXEA 4PY7A 5JW5B 3VA6A 5CEZE 5C09D 3KPLA 4Z7NE 2GT9A 1CDBA 1RQ5A 1NEZA 3DYOA 5LG1A 3ZYZA 5J11C 2B2XL 4JGUA 1OY3B 4QRRE 3RWGB 4YDVB 1DVFC 1HSAA 4YBLC 1Q72L 3IU3B 2HLAB 3ARGA 5KSBA 3RVVC 3U0WH 1TPXB 5D1QA 1WC7B 2IGFH 4FQPA 1QRNB 5JLZA 3SKMA 4I3GA 5CBAA 4PP2B 1J8KA 1IM9B 4KHXH 4GQPH 4X6EA 1YPZA 1S9WB 5EUOB 4D0DA 1WAAA 5DEFB 3HMWL 1AGEB 3U46A 3GSNB 1B2WH 1ITCA 4WO4B 4Y4HD 2A6JA 1C5BL 5JPMA 2BMKA 4RIRA 4ZD3H 5DRNA 1ES0A 5DJ2A 5EBWA 1J5OH 5IF0B 4NCDA 5TDNB 4YWGL 3VFUB 1DUYA 4LAQL 3SDAC 2X4OB 4RDQF 4PV9B 4ZTOL 1G7QB 2ORBL 5BRZD 4LGSB 2QSQA 4I0KA 4X9GA 4YXKL 3BD3A 2GTWA 5FKAA 4EXKA 4JY6B 4Z7VF 5AYUH 2EYTB 3ZSTA 1CK0H 4NGHH 2C1OA 4LHQB 4E41B 2AJXH 2EIBA 4TNWF 3MXWL 5DO2C 5C0JB 3FOLA 3VGDA 3QA3A 3OF6A 4PLKD 2GQHA 4D3CL 3GMPB 2AJ3B 4NO0A 3PXJA 4F15C 3KJ4B 1ZVHA 3ARED 2J6EA 5T3ZH 3STLB 4R9HA 3TJEH 2IPKB 1TJIL 1V5JA 4HUNB 2DYPA 2RBLA 3NCCB 4Y4KB 4IM8A 1BD2A 5JHDB 5GGUB 1MFCH 2Z92A 1KENL 5JHDE 1F42A 5TQ2H 1G1YA 4ZPVA 1M6OA 1MIEH 1E4XH 1JNNH 2IJ0C 2Y07L 3GSVA 3T2OA 1I8IB 4ODVL 3OPZL 4U3HA 1UB5B 5EB9A 4PRPD 3CFKB 2Z4QA 1U92B 1KIRB 4GSDL 5KZCD 3QZWG 4DGYL 3PG2A 1ZHBA 4XVTH 4P57A 5DURB 1J0YA 1U3HB 1K8IA 1UENA 4KAQH 1T1XB 2E5EA 3MJGX 3ROOA 1K8DB 4NKDA 1J88A 4UQ3A 4AT6A 1HQRB 4OB5H 4WU5A 1CTNA 1FC1A 2PTTA 2VC2L 5IFHH 4XCYB 4E9LA 2OTWA 3GB7B 3ALWA 3SN6N 5CD5D 3SGJC 5B3NA 1P1ZA 1A6ZB 4G6JH 1JWUB 4JN2B 1Y0LB 1CLZL 3CFEA 1IKNC 3QXAB 1TZHB 3HNVL 5GGRY 4F80A 3IB4A 4DN4H 5EWIH 3MLRH 3TT3H 1NAKL 3U2SA 4HZLB 3HZVB 4J3WA 1YQVH 2GHWB 2P46B 1X6NA 2J6EL 1A9BA 3C5SA 1MFAH 4HKBA 4PJBF 4RA3A 1T20B 1B0RB 3SDCC 2HKHH 1BLNB 2VXSH 5E99L 3S5LB 2VLRA 4FXGB 1NGPL 4Z0BH 3X14A 2VZTA 1C12A 2H26A 4R26H 2C7UA 3MBEC 3MRRB 1J8HD 1NC2B 1RU9L 3QWOA 3STZB 1BECA 4GAGH 3NAAL 3GSWA 2O26U 5EU5A 4L1DA 5T3ZD 3VFOA 3ZKNC 4NT6A 5I8EA 1JN6A 5I1KH 3BJLA 3P4MA 4YBHA 3MREA 3QFDA 3MCKA 1JZ6A 1WT5C 4KROB 2BNRD 1CGSL 1MHPL 3OHXB 5IK3B 5IBTH 1KFAH 3QXVA 5IIEA 4OI8A 2BXZA 2AXGA 1T5XA 4R97B 4XP6H 4V1DA 4TOYH 4NC1E 4P2QE 1FCGA 5FYKU 3LB6D 1PAMA 4KMTL 3MR9A 3T3MF 1XR8B 2ARJB 4MS8C 3ULVE 4WHDA 1OAKL 1EXUB 5EU3B 4NFDA 4P2CG 5DQJB 2F8VA 5DHYB 4MXWL 1HHJA 1I85A 1TQBC 1XGRB 1INDH 2F53E 1F3JA 2JJVA 4NKMA 4DQOH 2JIXB 5HYFA 4UTAL 5ADOL 3MLVH 2FH8A 2NTSP 4XC1L 4FHBD 3CH1B 1ZE3C 4ISVB 1E4KC 4YDLC 5CGTA 1IFHL 4PJAF 3BD4A 3CPLA 1DUZB 1WQVT 3FFCA 4PJ7F 5MEOA 2X41A 3TNMB 4Z7VA 3W5MA 1B9ZA 3FQXB 4Y4FA 3OJ2C 2L4OA 3QPQD 4R6UA 2FHCA 4QRQA 3BISA 2QTEA 3GRWA 4FXKA 1OF2A 3RVUD 1CXKA 1AHWA 4L4VE 5C6TL 1OWWA 5IR1A 4ZSOA 1IAOA 4OCSL 2E7CA 2C3WA 3D3VD 4R4FL 1IC1A 1RUPL 2IG2H 3MROA 1PZ5A 1RK1B 4L3AA 2VAAB 3EYOA 1RUKL 1UACH 4MXQD 1DN0A 1R5IA 2X4UB 2XA3A 3H42L 3HRZA 4XI5D 5D6DA 3S37X 3PGFH 1A0QH 1JHLL 3CVIH 3TF7C 3OXRB 1EGJA 1BX2B 3VDBA 3RIFK 4GW5B 2VSCA 1UM6L 3SY0B 1UB6A 4C56E 3HUJF 3O8XB 3O2DH 4LEXL 5E56A 1DQDH 1A6UL 2Q76A 1NGZA 4QRTA 3T1FA 5I0ZA 3V4VH 4NQCB 3WKML 5I75C 4NQCE 2IF7A 4M7JL 5CWSB 1IGMH 3VRJA 1L0XA 4OD1H 1RK0A 4RRPA 5GGTA 1CWVA 2I25N 5F1IA 1GGIL 4HMEA 5DQDH 2H2SD 3RIAK 2HJLB 5TPWL 4RSVA 3T0EC 5EU6A 3VFVB 4HXBH 1A7NL 1U8NA 3C8KA 3D39B 4JFFB 3MUJA 5IEHB 4XPFH 3D39E 3FFDA 5BS0E 3LKOA 4JKWA 1CGWA 2HT2C 3BAEL 4PJGB 1IGTB 3WO4C 2WWKO 3SDXF 4Z7UB 1BEYL 4PJGE 4WTZG 1KBGH 3P0YH 4BFIB 5EORH 1BJ1H 3UTQB 3RJDA 1ND0A 5IB2A 1A47A 3P4NA 4X6FA 2ARWA 3MOBH 4N68A 3RUGB 5E9DA 4M5YH 4N90D 3RUGE 1DE4A 3R1GH 4IIQC 1S5HA 1RZ8A 5DGRA 3LH2L 5C0CA 3SKOB 4JFPA 4PJBA 5FO7A 4R96A 4JM2C 2VO5A 1QACA 1NANI 1WFUA 3SCMA 5DJYB 3TN0D 1FRGL 4KY1L 1EGJL 1KULA 4OF5A 3VXPA 1IKFH 3V4PL 8FABA 3DV4A 4Y5VB 3UBXI 4X80H 1BBJB 3L95A 4HBQA 3T0XA 1PDKA 1P7QA 4HH9B 4H0IA 3ZT7A 2VAJA 4EN3B 4NHUA 1LO0H 3D2UB 1LO3H 3QFJA 3GGWA 4CDHA 3NABL 4K9EC 5GGTL 4P2YA 4LLYA 2YUVA 2OZ4H 2Q1EA 2A38A 1HI6A 3E6FA 2JJUA 5FYJL 4X99B 2PO6B 1CICD 3VI3F 1P7KA 4LU5L 1QSEB 4S2SB 2H2PD 1XF4B 3TA3B 5DEGB 1W72A 1AQDB 1T0NA 3LKSB 1HQ4A 1RJZA 4NQVB 2DQTL 3GI9L 4A2LA 4KK8D 5I1IL 2EKSB 3THML 2OR7A 4TNVK 1QHPA 3DXAB 2LE9A 3RIAF 1ZOXA 4OT1L 2X9WA 5BMFL 3LQAL 3G6AA 4C57C 4AG4H 1FLRH 3IFPA 5J9PB 4I2XE 4OM1L 3MRIA 5KVFH 1FZKA 1QLEL 3DSFL 3FT4A 3FOMB 2C3HA 2OMBA 4PJAA 4WUKH 2PNDA 1BQLH 1NCNA 4DEPC 3ARQA 4PJ7A 4JB9H 5F7EL 4PJ5E 4Z5RB 4OGAD 2Q8BL 3LN5A 2L0DA 2YPKB 4U1MA 2ESVE 2JLLA 4XB8A 4ZAKA 3K80A 4GMTL 2DLIA 4GG8B 5L2KA 2NQCA 3NTCH 3RNQB 2MQCA 4MQXC 4XX1E 2IC2A 3WNOA 2DM2A 1FVEA 2XZQH 3NACL 4NRXA 1DLFL 1FFPB 3OKEA 1UKQA 1FNFA 3QULA 2DBJA 4PRHD 2E6QA 4QLRA 4ZXBB 4CN1A 1YEGL 1J0IA 1JPTH 4RMVA 1JWMB 1TCRA 1JGEA 4OJFH 1JZ8A 3GMMB 2XI9A 3MLPA 1U58B 3QEHB 3X13B 5CJXC 4X6DF 1KCRL 1W72L 3E2HB 1TZIA 3LKNB 5J13C 4O5LL 3HUJA 4CDGC 3O11B 5F6HJ 2PTUA 5DWUL 3HAEA 5I76B 1PQZB 3G5XB 3T8XB 2G60L 4E0RB 3VG9C 4HIEB 3CDGB 43C9A 1XGUB 1I3GH 3W0WE 4OI7A 3CSGA 8CGTA 3SKJL 3FO0H 1A4KA 3S37L 3LRSB 1DZBA 1DN2A 2ATPB 5C0GB 3MV11 4P9HL 4ZFOB 3E0GA 1Q94B 1QSZA 2CDGA 4LPXA 3SE3A 4XRCB 3TBSB 4R90H 5CEYA 3LKPA 5KOMC 4TNVF 2NY3D 1FJ1B 3MBXH 4OD2B 5E24E 3EOAA 4P5TA 2R1YB 2GITB 3L9RA 4QWWD 4U33A 1OD7A 1SJHB 2Z8WC 4NBZB 4R8WL 5C0AB 4F58L 5C0AE 1D5IL 3B2UD 3EOYG 1ZA3B 3SEPA 4FQJH 4UBDD 2P7TA 4U1IA 1NCDH 2VZOA 4LCUB 5I1DB 3QCUH 1G7IA 5EOCL 5ADPH 4JEGB 1X7QA 1I8MB 4OF0A 4YR6A 3KPQA 2A6KB 5H94B 4R0LB 5GISH 4GG6F 5EO0A 3WYRA 1G7LB 3GSRA 4RNRB 5T1DH 5C2BL 4UAOC 1HSBA 4HGWB 1F90H 5DJ8B 1NSNL 3PWPB 3IF1A 1ZT1B 4YPGB 2VDMH 2YS4A 4X7EC 3KYNB 3PWPE 5I1AB 3WFZA 4XCFL 3OJVC 4FNLH 5DHVB 1ZLWH 4Z0XB 4LMQI 4P23D 2GJ6B 1PFCA 2GTZA 3B5GA 5CP3A 2HFFA 1LEIA 3STBA 2HVJA 4PB0H 5E7BA 5CINH 5F96L 2ZG1A 1I9RL 3TBTB 5EFIB 4JG1L 3FRUA 3B9KC 3K2UL 1U2HA 4XCNB 1WBXB 5KJRL 4KJWC 4KKAD 4MAYA 3LV3B 3RVVD 1ZV5A 5EOTA 5I73C 2PR4L 2EC9T 4IRJC 2FJFB 3JVGC 5B38B 3CLFH 1F00I 1OAXH 2XA8H 4JPVL 4XPGL 3WSQL 3UAJD 2CJUH 5I0DA 1ZA6A 1VADB 2EIZB 3QEQA 4L3EE 2F5AL 3SKUD 2IANE 3HE7D 1A7QL 2BVTA 3QQ4A 5HHME 1I7TA 1YECH 5HDOA 3ILQC 1U42A 2O5YL 1QP1A 3KHQA 2NY4B 1ZK9A 3B6SB 3N1MC 6CGTA 4WTXA 5L0QB 3BE1L 4NQSB 3EYUL 4P2OB 4YHZH 3WIFA 4PS4H 3SDAD 3U9PH 2ZOKB 5DHXB 5JW4N 3FN9A 3UJJH 1KLUB 4HS8L 1EZVY 1Q0XH 4OKVB 3R0NA 1JHTB 1P9MC 3O6KH 3I6GB 2IAMA 4ZDHB 1NMBH 1HCVA 3RVTC 4KKNA 4NO2B 3MFFA 3ZKXB 1HIML 5DO2D 3IJYA 2H32H 5FDWB 1TNMA 4I9WE 4MNHB 3T08A 3WIHL 2VL5A 3MYJA 4YIQA 2CKNA 4BSWA 1J1XL 3VWJC 4A6YL 3KHOA 5IG7A 4HIIA 4JRYA 3BGMA 1IE5A 4HT1H 4I4WB 4KC3B 5I30L 2JK5B 1CE1L 3AXLB 1S78C 1CN4A 1ZHLA 4YHIA 4J4PC 2YD5A 1OTSD 5ALBL 4EI5B 3ZLQC 4RFEA 3HHRB 3D0VA 2F19H 1VCAA 3ARWA 5GGSY 4QXWA 32C2A 4U1HA 2JTDA 5JHLH 2P48B 4MZ2A 3QG6A 5AG8A 1GIGL 3BMWA 3TPUB 5KSAC 5C09A 3RTQC 2P5WE 1H5BB 1LO4L 2WUCL 5JDJA 3K2MC 4MA3B 1S3KL 4X6DA 5DRZB 2D7QA 4PY7B 3D0LA 1INQA 3KPLB 3PWNA 3FMGH 2R1WA 3UTTA 1HHGA 4XNQA 4HIXH 3OX8A 2GT9B 2P8MA 3IDGA 1NEZB 2WINB 1QFOA 4LPUA 4Q6IC 3PL6D 1CL7H 1MIML 3MV7D 4XBGA 3BKMH 1MF2H 1N0LA 4N5ED 3ARGB 5KSBB 3PGCA 3KPNA 3MMEA 4OF7A 1G7HA 5FYLH 4K3EH 5D1QB 3SKMB 5CBAB 2L7UA 4QY8A 1LDPH 4Y4HA 1UZ6E 3VXUB