4QSXA

Structure of the bromodomain of human atpase family aaa domain-containing protein 2 (atad2) in complex with 3'-deoxy thymidine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPase family AAA domain-containing protein 2
publication title Structure-based approaches towards identification of fragments for the low-druggability ATAD2 bromodomain
doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 56
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2014-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4qsxA00
4N4GA 4YBMA 2I8NA 5EWCA 5EWWA 5F62A 4QYLA 4YYGA 5EP7A 5CY9A 2L85A 4MENA 5HFRA 5DY7A 5BT4A 4HXLA 4O77A 5HENA 3O34A 4A9EA 5KU3A 4UITA 2RI7A 4TYLA 5ENHA 5A5OA 4N4HA 3ONIA 4CUPA 5F63A 5II1A 4UIVA 5K29A 4HBWA 4BW4A 5E73A 2OUOA 5EICA 4PTBA 5FE2A 5I80A 4A9OA 3TLPA 5DLXA 5C85A 2F6NA 4YY4A 4J1PA 3ZYUA 5L96A 4YC9A 4UYDA 2OSSA 5D3JA 2R0SA 4YYNA 5COIA 4QEVA 5EISA 4A9KA 5C89A 2KTBB 4C67A 3HMHA 5H1UA 5FG6A 5II2A 3O37A 5D24A 5CUAA 4MR6A 5FG4A 4E96A 4QR3A 5DYAA 5E9YA 5EK9A 5ETBA 5IGMA 5L8UA 3DAIA 5ENCA 5FB0A 4PCEA 3G0JA 4CUSA 5HEMA 5EWVA 4IR4A 5AMEA 4IOOA 4YH4A 5DBMA 5ENEA 5ENFA 2OO1A 3O33A 4UYGA 3SVGA 4YYDA 2RS9B 2E7NA 4PS5A 4TTEA 2RNXA 5KTXA 5LJ2A 4Q0OA 4TT6A 5HM0A 5IG6A 4Z6HA 2D82A 5C7NA 5HRVA 5G4SA 4QSVA 4CFLA 4Y03A 5CQ5A 3Q2EA 4CUUA 5L99A 3UW9A 1E6IA 4O75A 4YBTA 4QSTA 2YEMA 2DVQA 5I89A 5CZGA 3QZVA 5DW1A 3MULA 4ZW1A 3G0LA 4CL9A 4O74A 4NR8A 5HRWA 4XY9A 4TT4A 4ALHA 5FH6A 2DVRA 3S92A 1N72A 1JSPB 2YYNA 4LYIA 5CUCA 5KHMA 3UVDA 4MR5A 2YQDA 2YELA 3UV4A 5DW2A 4QSWA 4NRBA 4A9MA 4PKLA 5A85A 3RCWA 3S91A 4XUAA 3LJWA 3O36A 4QUTA 4LYWA 4MEPA 4QYDA 4MR4A 5FE8A 4UIWA 4NS5A 4UYFB 2DVVA 5IGKA 4Q0NA 4YYMA 5JI8A 5HQ7A 4TU6A 5J0DA 5CQ8A 5EI4A 5HRXA 2MJVB 4QUUA 5CQAA 2LSPB 5D3LA 3D7CA 5I83A 2L5EA 5HQ6A 3U5NA 3GG3A 3U5KA 4CFKA 5HELA 5ENBA 3NXBA 3UVXA 5EPBA 5FE9A 2NXBA 4O70A 5CQ3A 3U5JA 4PCIA 5DKHA 4HXRA 4HXNA 5LVQA 4LZRA 5CS8A 5D0CA 5E7DA 4DONA 2R0VA 5ACYA 3K2JA 5CQTA 5CTLA 5EQ1A 4NYWA 4RVRA 1WUGA 4WHWA 5DKDA 4NYXA 2YDWA 5A81A 5FBXA 5FE6A 5L8TA 4BW2A 4X2IA 4QY4A 4YYKA 4UIXA 3O35A 2FSAA 3JVJA 4OGIA 1EQFA 4O76A 1JM4B 2DATA 2R0YA 5F60A 5TB6A 4BHWA 4QR4A 5DFBA 4BW3A 5ENJA 3QZTA 5F1HA 5DYCA 3SVFA 4QZSA 4MEQA 5CP5A 5EPRA 4KV1A 5ENIA 5C8GA 4C66A 4XYAA 4A9FA 5EVAA 3UVWA 4CURA 5A5RA 5EWDA 5A5NA 3U5OA 5I7XA 5F2PA 5E3DA 4Z93A 3P1DA 4YH3A 5E9IA 5DLZA 5CUBA 4UYEA 4J0RA 5CUEA 3SVHA 4HBXA 4J3IA 4N3WA 2G4AA 4YYIA 5CFWA 3MUKA 4N4IA 4QC1A 4IORA 5C4QA 5IGNA 5FE4A 4UIYA 3HMFA 4QBMA 5F61A 5LJ1A 4UIZA 5C87A 5D3SA 3IU6A 2R10A 2L84A 4IR6A 4O7FA 5EU1A 4MR3A 5F3AA 4QSPA 5E9VA 5G4RA 5I86A 4HXPA 5LKTA 5E9MA 2YW5A 2D9EA 4XUBA 3P1EA 4BW1A 4TZ2A 4YK0A 5FE0A 4OGJA 4HXOA 4OUFA 5IBNA 5E9KA 3HMEA 5F25A 5I88A 2DWWA 4TZ8A 5BT3A 5EWHA 4QB3A 5DFCA 4NRCA 5H85A 5L97A 4CUQA 4TU4A 5CGPA 4WIVA 4J0SA 4HBYA 2RNYA 5ETDA 2H60A 3AQAA 5D3TA 4GPJA 5AD3A 5FFVA 4LC2A 4YABA 5D3RA 3MB3A 5LKXA 5FE1A 5CQ6A 4NR7A 3UV5A 5DX4A 4UIUA 1ZS5A 3LQIA 4HXKA 4KCXA 5CPEA 4QSRA 3MQMA 3AADA 4ZQLA 4WHUA 4QNSA 2E3KA 5IIDA 5D3NA 5LUUA 4MEOA 4NUEA 4O7BA 5CRZA 1F68A 5D3PA 3JVMA 4LR6A 4HBVA 2WP2A 2GRCA 5FFYA 5L98A 5F1LA 5BT5A 5H1VA 4NUCA 5EM3A 2E7OA 4UYFA 5E0RA 4NQNA 4NR4A 5CU8A 4IR5A 2YEKA 4QEWA 5FB1A 4A9IA 5I40A 4HXMA 5DYUA 4FLPA 4HXSA 4IOQA 5A7CA 5E3GA 5A5QA 4QEUA 5D25A 5FFWA 4YBSA 4O78A 5A83A 4O7CA 5FDZA 4QSQA 4NR5A 5A5PA 4UYHA 2WP1A 5LJ0A 5HLSA 4NRAA 4BJXA 5AMFA 5DYXA 5I1QA 5CRMA 4Z1QA 2I7KA 3LXJA 2RO1A 3MXFA 3I3JA 3U5PA 5H1TA 5CUDA 5FE5A 4ZC9A 5E74A 4NR9A 4LDFA 4ALGA 5EV9A 2F6JA 5FG5A 3U5MA 2DKWA 5D3HA 5FH8A 4NR6A 4A9NA 5TCMA 4YYJA 5KTWA 4LZ2A 3FKMX 4CLBA 5F5ZA 5HJCA 5D7XA 3DWYA 5FE3A 4AKNA 4YAXA 3UVYA 3QZSA 4LYSA 4YYHA 5F36A 4A9LA 4Z1SA 5A82A 4TT2A 5I29A 2RFJA 5JWMA 3IU5A 3P5OA 4YATA 5LVRA 5FH7A 4QC3A 4NXJA 3P1FA 4PY6A 4XY8A 2DVSA 5E9LA 4O71A 5EGUA 3JVLA 5KTUA 4YY6A 5CUGA 4A9JA 4LZSA 4TQNA 5IGLA 2N9GA 5LKZA 3LQHA 3P1CA 4YADA 5AD2A 4O7EA 5HFQA 3Q2FA 5LKUA 4CUTA 4QSXA 4N4FA 1WUMA 4QSSA 4Z6IA 5CQ4A 5EA1A 5KO4A 4NQMA 4LRGA 2RNWA 4NUDA 5DFDA 4TS8A 5CQ7A 5FE7A 4O7AA 5A5SA 4KV4A 4IR3A 4F3IA 4O72A 5I7YA 3U5LA 5EPSA 1X0JA 5HCLA 4A9HA 5DKCA 4QSUA 3JVKA 3UV2A 4QR5A 5D26A 5ENGA 3LQJA 3MB4A 4NYVA 5HQ5A
chains in the Genus database with same CATH superfamily
4N4GA 4YBMA 2I8NA 5EWCA 5EWWA 5F62A 4QYLA 4YYGA 5EP7A 5CY9A 2L85A 4MENA 5HFRA 5DY7A 5BT4A 4HXLA 4O77A 5HENA 3O34A 4A9EA 5KU3A 4UITA 2RI7A 4TYLA 5ENHA 5A5OA 4N4HA 3ONIA 4CUPA 5F63A 5II1A 4UIVA 5K29A 4HBWA 4BW4A 5E73A 2OUOA 5EICA 4PTBA 5FE2A 5I80A 4A9OA 3TLPA 5DLXA 5C85A 2F6NA 4YY4A 4J1PA 3ZYUA 5L96A 4YC9A 4UYDA 2OSSA 5D3JA 2R0SA 4YYNA 5COIA 4QEVA 5EISA 4A9KA 5C89A 2KTBB 4C67A 3HMHA 5H1UA 5FG6A 5II2A 3O37A 5D24A 5CUAA 4MR6A 5FG4A 4AKIA 4E96A 4QR3A 5DYAA 5E9YA 5EK9A 5ETBA 5IGMA 5L8UA 3DAIA 5ENCA 5FB0A 4PCEA 3G0JA 4CUSA 5HEMA 5EWVA 4IR4A 5AMEA 4IOOA 4YH4A 5DBMA 5ENEA 5ENFA 2OO1A 3O33A 4UYGA 3SVGA 4YYDA 2RS9B 2E7NA 4PS5A 4TTEA 2RNXA 5KTXA 5LJ2A 4Q0OA 4TT6A 5HM0A 5IG6A 4Z6HA 2D82A 5C7NA 5HRVA 5G4SA 4QSVA 4CFLA 4Y03A 5CQ5A 3Q2EA 4CUUA 5L99A 3UW9A 1E6IA 4O75A 4YBTA 4QSTA 2YEMA 2DVQA 5I89A 5CZGA 3QZVA 5DW1A 3MULA 4ZW1A 3G0LA 4CL9A 4O74A 4NR8A 5HRWA 4XY9A 4TT4A 4ALHA 5FH6A 2DVRA 3S92A 1N72A 1JSPB 2YYNA 4LYIA 5CUCA 5KHMA 3UVDA 4MR5A 2YQDA 2YELA 3UV4A 5DW2A 4QSWA 4NRBA 4A9MA 4PKLA 5A85A 3RCWA 3S91A 4XUAA 4AKHA 3LJWA 3O36A 4QUTA 4LYWA 4MEPA 4QYDA 4MR4A 5FE8A 4UIWA 4NS5A 4UYFB 2DVVA 5IGKA 4Q0NA 4YYMA 5JI8A 5HQ7A 4TU6A 5J0DA 5CQ8A 5EI4A 5HRXA 2MJVB 4QUUA 1PUOA 5CQAA 2LSPB 5D3LA 3D7CA 5I83A 2L5EA 5HQ6A 3U5NA 3GG3A 3U5KA 4CFKA 5HELA 5ENBA 3NXBA 3UVXA 5EPBA 5FE9A 2NXBA 4O70A 5CQ3A 3U5JA 4PCIA 5DKHA 4HXRA 4HXNA 5LVQA 4LZRA 5CS8A 5D0CA 5E7DA 4DONA 2R0VA 5ACYA 3K2JA 5CQTA 5CTLA 5EQ1A 4NYWA 4RVRA 1WUGA 4WHWA 5DKDA 4NYXA 2YDWA 5A81A 5FBXA 5FE6A 5L8TA 4BW2A 4X2IA 4QY4A 4YYKA 4UIXA 3O35A 2FSAA 3JVJA 4OGIA 1EQFA 4O76A 1JM4B 2DATA 2R0YA 5F60A 5TB6A 4BHWA 4QR4A 5DFBA 4BW3A 5ENJA 3QZTA 5F1HA 5DYCA 3SVFA 4QZSA 4MEQA 5CP5A 5EPRA 4KV1A 5ENIA 5C8GA 4C66A 4XYAA 4A9FA 5EVAA 3UVWA 4CURA 5A5RA 5EWDA 5A5NA 3U5OA 5I7XA 3VKGA 5F2PA 5E3DA 4Z93A 3P1DA 4YH3A 5E9IA 5DLZA 5CUBA 4UYEA 4J0RA 5CUEA 3SVHA 4HBXA 4J3IA 4N3WA 2G4AA 4YYIA 5CFWA 3MUKA 4N4IA 4QC1A 4IORA 5C4QA 5IGNA 5FE4A 4UIYA 3ERRA 3HMFA 4QBMA 5F61A 5LJ1A 4UIZA 5C87A 5D3SA 3IU6A 2R10A 2L84A 4IR6A 4O7FA 5EU1A 4MR3A 5F3AA 4QSPA 5E9VA 5G4RA 5I86A 4HXPA 5LKTA 5E9MA 2YW5A 2D9EA 4XUBA 3P1EA 4BW1A 4TZ2A 4YK0A 5FE0A 4OGJA 4HXOA 4OUFA 5IBNA 5E9KA 3HMEA 5F25A 5I88A 2DWWA 4TZ8A 5BT3A 5EWHA 4QB3A 5DFCA 4NRCA 5H85A 5L97A 4CUQA 4TU4A 5CGPA 4WIVA 4J0SA 4HBYA 2RNYA 5ETDA 2H60A 3AQAA 1ZKRA 5D3TA 4GPJA 5AD3A 5FFVA 4LC2A 4AI6A 4YABA 5D3RA 3MB3A 5LKXA 5FE1A 5CQ6A 4NR7A 3UV5A 5DX4A 4UIUA 1ZS5A 3LQIA 4HXKA 4KCXA 5CPEA 4QSRA 3MQMA 3AADA 4ZQLA 4WHUA 4QNSA 2E3KA 5IIDA 5D3NA 5LUUA 4MEOA 4NUEA 4O7BA 5CRZA 1F68A 5D3PA 3JVMA 4LR6A 4HBVA 2WP2A 3D1BA 2GRCA 5FFYA 5L98A 5F1LA 5BT5A 5H1VA 4NUCA 5EM3A 2E7OA 4UYFA 5E0RA 4NQNA 4NR4A 5CU8A 4IR5A 2YEKA 4QEWA 5FB1A 4A9IA 5I40A 4HXMA 5DYUA 4FLPA 4HXSA 4IOQA 5A7CA 5E3GA 5A5QA 4QEUA 5D25A 5FFWA 4YBSA 4O78A 5A83A 4O7CA 5FDZA 4QSQA 4NR5A 5A5PA 4UYHA 2WP1A 5LJ0A 5HLSA 4NRAA 4BJXA 5AMFA 5DYXA 5I1QA 5CRMA 4Z1QA 2I7KA 3LXJA 2RO1A 3MXFA 3I3JA 3U5PA 5H1TA 5CUDA 5FE5A 4ZC9A 5E74A 4NR9A 4LDFA 4ALGA 5EV9A 2F6JA 5FG5A 3U5MA 2DKWA 5D3HA 5FH8A 4NR6A 4A9NA 5TCMA 4YYJA 5KTWA 4LZ2A 3FKMX 4CLBA 5F5ZA 5HJCA 5D7XA 3DWYA 5FE3A 4AKNA 4YAXA 3UVYA 3QZSA 4LYSA 4YYHA 3VKHA 5F36A 4A9LA 4Z1SA 5A82A 4TT2A 5I29A 2RFJA 5JWMA 3IU5A 3P5OA 4YATA 5LVRA 5FH7A 4QC3A 4NXJA 3P1FA 4PY6A 4XY8A 2DVSA 5E9LA 4O71A 5EGUA 3JVLA 5KTUA 4YY6A 5CUGA 4A9JA 4LZSA 4TQNA 5IGLA 2N9GA 5LKZA 3LQHA 3P1CA 4YADA 5AD2A 4O7EA 5HFQA 3Q2FA 5LKUA 4CUTA 4QSXA 4N4FA 1WUMA 4QSSA 4Z6IA 5CQ4A 5EA1A 5KO4A 4NQMA 4LRGA 2RNWA 4NUDA 5DFDA 4TS8A 5CQ7A 4AKGA 5FE7A 4O7AA 5A5SA 4KV4A 4IR3A 4F3IA 4O72A 3D1DA 5I7YA 3U5LA 5EPSA 2EJNA 1X0JA 5HCLA 4A9HA 5DKCA 4QSUA 3JVKA 3UV2A 4QR5A 5D26A 5ENGA 3LQJA 3MB4A 4NYVA 5HQ5A
chains in the Genus database with same CATH topology
4N4GA 4YBMA 2I8NA 5EWCA 5EWWA 5F62A 4QYLA 4YYGA 5EP7A 5CY9A 2L85A 4MENA 5HFRA 5DY7A 5BT4A 4HXLA 4O77A 5HENA 3O34A 4A9EA 5KU3A 4UITA 2RI7A 4TYLA 5ENHA 5A5OA 4N4HA 3ONIA 4CUPA 5F63A 5II1A 4UIVA 5K29A 4HBWA 4BW4A 5E73A 2OUOA 5EICA 4PTBA 5FE2A 5I80A 4A9OA 3TLPA 5DLXA 5C85A 2F6NA 4YY4A 4J1PA 3ZYUA 5L96A 4YC9A 4UYDA 2OSSA 5D3JA 2R0SA 4YYNA 5COIA 4QEVA 5EISA 4A9KA 5C89A 2KTBB 4C67A 3HMHA 5H1UA 5FG6A 5II2A 3O37A 5D24A 5CUAA 4MR6A 5FG4A 4E96A 4QR3A 5DYAA 5E9YA 5EK9A 5ETBA 5IGMA 5L8UA 3DAIA 5ENCA 5FB0A 4PCEA 3G0JA 4CUSA 5HEMA 5EWVA 4IR4A 5AMEA 4IOOA 4YH4A 5DBMA 5ENEA 5ENFA 2OO1A 3O33A 4UYGA 3SVGA 4YYDA 2RS9B 2E7NA 4PS5A 4TTEA 2RNXA 5KTXA 5LJ2A 4Q0OA 4TT6A 5HM0A 5IG6A 4Z6HA 2D82A 5C7NA 5HRVA 5G4SA 4QSVA 4CFLA 4Y03A 5CQ5A 3Q2EA 4CUUA 5L99A 3UW9A 1E6IA 4O75A 4YBTA 4QSTA 2YEMA 2DVQA 5I89A 5CZGA 3QZVA 5DW1A 3MULA 4ZW1A 3G0LA 4CL9A 4O74A 4NR8A 5HRWA 4XY9A 4TT4A 4ALHA 5FH6A 2DVRA 3S92A 1N72A 1JSPB 2YYNA 4LYIA 5CUCA 5KHMA 3UVDA 4MR5A 2YQDA 2YELA 3UV4A 5DW2A 4QSWA 4NRBA 4A9MA 4PKLA 5A85A 3RCWA 3S91A 4XUAA 3LJWA 3O36A 4QUTA 4LYWA 4MEPA 4QYDA 4MR4A 5FE8A 4UIWA 4NS5A 4UYFB 2DVVA 5IGKA 4Q0NA 4YYMA 5JI8A 5HQ7A 4TU6A 5J0DA 5CQ8A 5EI4A 5HRXA 2MJVB 4QUUA 5CQAA 2LSPB 5D3LA 3D7CA 5I83A 2L5EA 5HQ6A 3U5NA 3GG3A 3U5KA 4CFKA 5HELA 5ENBA 3NXBA 3UVXA 5EPBA 5FE9A 2NXBA 4O70A 5CQ3A 3U5JA 4PCIA 5DKHA 4HXRA 4HXNA 5LVQA 4LZRA 5CS8A 5D0CA 5E7DA 4DONA 2R0VA 5ACYA 3K2JA 5CQTA 5CTLA 5EQ1A 4NYWA 4RVRA 1WUGA 4WHWA 5DKDA 4NYXA 2YDWA 5A81A 5FBXA 5FE6A 5L8TA 4BW2A 4X2IA 4QY4A 4YYKA 4UIXA 3O35A 2FSAA 3JVJA 4OGIA 1EQFA 4O76A 1JM4B 2DATA 2R0YA 5F60A 5TB6A 4BHWA 4QR4A 5DFBA 4BW3A 5ENJA 3QZTA 5F1HA 5DYCA 3SVFA 4QZSA 4MEQA 5CP5A 5EPRA 4KV1A 5ENIA 5C8GA 4C66A 4XYAA 4A9FA 5EVAA 3UVWA 4CURA 5A5RA 5EWDA 5A5NA 3U5OA 5I7XA 5F2PA 5E3DA 4Z93A 3P1DA 4YH3A 5E9IA 5DLZA 5CUBA 4UYEA 4J0RA 5CUEA 3SVHA 4HBXA 4J3IA 4N3WA 2G4AA 4YYIA 5CFWA 3MUKA 4N4IA 4QC1A 4IORA 5C4QA 5IGNA 5FE4A 4UIYA 3HMFA 4QBMA 5F61A 5LJ1A 4UIZA 5C87A 5D3SA 3IU6A 2R10A 2L84A 4IR6A 4O7FA 5EU1A 4MR3A 5F3AA 4QSPA 5E9VA 5G4RA 5I86A 4HXPA 5LKTA 5E9MA 2YW5A 2D9EA 4XUBA 3P1EA 4BW1A 4TZ2A 4YK0A 5FE0A 4OGJA 4HXOA 4OUFA 5IBNA 5E9KA 3HMEA 5F25A 5I88A 2DWWA 4TZ8A 5BT3A 5EWHA 4QB3A 5DFCA 4NRCA 5H85A 5L97A 4CUQA 4TU4A 5CGPA 4WIVA 4J0SA 4HBYA 2RNYA 5ETDA 2H60A 3AQAA 5D3TA 4GPJA 5AD3A 5FFVA 4LC2A 4YABA 5D3RA 3MB3A 5LKXA 5FE1A 5CQ6A 4NR7A 3UV5A 5DX4A 4UIUA 1ZS5A 3LQIA 4HXKA 4KCXA 5CPEA 4QSRA 3MQMA 3AADA 4ZQLA 4WHUA 4QNSA 2E3KA 5IIDA 5D3NA 5LUUA 4MEOA 4NUEA 4O7BA 5CRZA 1F68A 5D3PA 3JVMA 4LR6A 4HBVA 2WP2A 2GRCA 5FFYA 5L98A 5F1LA 5BT5A 5H1VA 4NUCA 5EM3A 2E7OA 4UYFA 5E0RA 4NQNA 4NR4A 5CU8A 4IR5A 2YEKA 4QEWA 5FB1A 4A9IA 5I40A 4HXMA 5DYUA 4FLPA 4HXSA 4IOQA 5A7CA 5E3GA 5A5QA 4QEUA 5D25A 5FFWA 4YBSA 4O78A 5A83A 4O7CA 5FDZA 4QSQA 4NR5A 5A5PA 4UYHA 2WP1A 5LJ0A 5HLSA 4NRAA 4BJXA 5AMFA 5DYXA 5I1QA 5CRMA 4Z1QA 2I7KA 3LXJA 2RO1A 3MXFA 3I3JA 3U5PA 5H1TA 5CUDA 5FE5A 4ZC9A 5E74A 4NR9A 4LDFA 4ALGA 5EV9A 2F6JA 5FG5A 3U5MA 2DKWA 5D3HA 5FH8A 4NR6A 4A9NA 5TCMA 4YYJA 5KTWA 4LZ2A 3FKMX 4CLBA 5F5ZA 5HJCA 5D7XA 3DWYA 5FE3A 4AKNA 4YAXA 3UVYA 3QZSA 4LYSA 4YYHA 5F36A 4A9LA 4Z1SA 5A82A 4TT2A 5I29A 2RFJA 5JWMA 3IU5A 3P5OA 4YATA 5LVRA 5FH7A 4QC3A 4NXJA 3P1FA 4PY6A 4XY8A 2DVSA 5E9LA 4O71A 5EGUA 3JVLA 5KTUA 4YY6A 5CUGA 4A9JA 4LZSA 4TQNA 5IGLA 2N9GA 5LKZA 3LQHA 3P1CA 4YADA 5AD2A 4O7EA 5HFQA 3Q2FA 5LKUA 4CUTA 4QSXA 4N4FA 1WUMA 4QSSA 4Z6IA 5CQ4A 5EA1A 5KO4A 4NQMA 4LRGA 2RNWA 4NUDA 5DFDA 4TS8A 5CQ7A 5FE7A 4O7AA 5A5SA 4KV4A 4IR3A 4F3IA 4O72A 5I7YA 3U5LA 5EPSA 1X0JA 5HCLA 4A9HA 5DKCA 4QSUA 3JVKA 3UV2A 4QR5A 5D26A 5ENGA 3LQJA 3MB4A 4NYVA 5HQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4G A;  4YBM A;  2I8N A;  5EWC A;  5EWW A;  5F62 A;  4QYL A;  4YYG A;  5EP7 A;  5CY9 A;  2L85 A;  4MEN A;  5HFR A;  5DY7 A;  5BT4 A;  4HXL A;  4O77 A;  5HEN A;  3O34 A;  4A9E A;  5KU3 A;  4UIT A;  2RI7 A;  4TYL A;  5ENH A;  5A5O A;  4N4H A;  3ONI A;  4CUP A;  5F63 A;  5II1 A;  4UIV A;  5K29 A;  4HBW A;  4BW4 A;  5E73 A;  2OUO A;  5EIC A;  4PTB A;  5FE2 A;  5I80 A;  4A9O A;  3TLP A;  5DLX A;  5C85 A;  2F6N A;  4YY4 A;  4J1P A;  3ZYU A;  5L96 A;  4YC9 A;  4UYD A;  2OSS A;  5D3J A;  2R0S A;  4YYN A;  5COI A;  4QEV A;  5EIS A;  4A9K A;  5C89 A;  2KTB B;  4C67 A;  3HMH A;  5H1U A;  5FG6 A;  5II2 A;  3O37 A;  5D24 A;  5CUA A;  4MR6 A;  5FG4 A;  4E96 A;  4QR3 A;  5DYA A;  5E9Y A;  5EK9 A;  5ETB A;  5IGM A;  5L8U A;  3DAI A;  5ENC A;  5FB0 A;  4PCE A;  3G0J A;  4CUS A;  5HEM A;  5EWV A;  4IR4 A;  5AME A;  4IOO A;  4YH4 A;  5DBM A;  5ENE A;  5ENF A;  2OO1 A;  3O33 A;  4UYG A;  3SVG A;  4YYD A;  2RS9 B;  2E7N A;  4PS5 A;  4TTE A;  2RNX A;  5KTX A;  5LJ2 A;  4Q0O A;  4TT6 A;  5HM0 A;  5IG6 A;  4Z6H A;  2D82 A;  5C7N A;  5HRV A;  5G4S A;  4QSV A;  4CFL A;  4Y03 A;  5CQ5 A;  3Q2E A;  4CUU A;  5L99 A;  3UW9 A;  1E6I A;  4O75 A;  4YBT A;  4QST A;  2YEM A;  2DVQ A;  5I89 A;  5CZG A;  3QZV A;  5DW1 A;  3MUL A;  4ZW1 A;  3G0L A;  4CL9 A;  4O74 A;  4NR8 A;  5HRW A;  4XY9 A;  4TT4 A;  4ALH A;  5FH6 A;  2DVR A;  3S92 A;  1N72 A;  1JSP B;  2YYN A;  4LYI A;  5CUC A;  5KHM A;  3UVD A;  4MR5 A;  2YQD A;  2YEL A;  3UV4 A;  5DW2 A;  4QSW A;  4NRB A;  4A9M A;  4PKL A;  5A85 A;  3RCW A;  3S91 A;  4XUA A;  3LJW A;  3O36 A;  4QUT A;  4LYW A;  4MEP A;  4QYD A;  4MR4 A;  5FE8 A;  4UIW A;  4NS5 A;  4UYF B;  2DVV A;  5IGK A;  4Q0N A;  4YYM A;  5JI8 A;  5HQ7 A;  4TU6 A;  5J0D A;  5CQ8 A;  5EI4 A;  5HRX A;  2MJV B;  4QUU A;  5CQA A;  2LSP B;  5D3L A;  3D7C A;  5I83 A;  2L5E A;  5HQ6 A;  3U5N A;  3GG3 A;  3U5K A;  4CFK A;  5HEL A;  5ENB A;  3NXB A;  3UVX A;  5EPB A;  5FE9 A;  2NXB A;  4O70 A;  5CQ3 A;  3U5J A;  4PCI A;  5DKH A;  4HXR A;  4HXN A;  5LVQ A;  4LZR A;  5CS8 A;  5D0C A;  5E7D A;  4DON A;  2R0V A;  5ACY A;  3K2J A;  5CQT A;  5CTL A;  5EQ1 A;  4NYW A;  4RVR A;  1WUG A;  4WHW A;  5DKD A;  4NYX A;  2YDW A;  5A81 A;  5FBX A;  5FE6 A;  5L8T A;  4BW2 A;  4X2I A;  4QY4 A;  4YYK A;  4UIX A;  3O35 A;  2FSA A;  3JVJ A;  4OGI A;  1EQF A;  4O76 A;  1JM4 B;  2DAT A;  2R0Y A;  5F60 A;  5TB6 A;  4BHW A;  4QR4 A;  5DFB A;  4BW3 A;  5ENJ A;  3QZT A;  5F1H A;  5DYC A;  3SVF A;  4QZS A;  4MEQ A;  5CP5 A;  5EPR A;  4KV1 A;  5ENI A;  5C8G A;  4C66 A;  4XYA A;  4A9F A;  5EVA A;  3UVW A;  4CUR A;  5A5R A;  5EWD A;  5A5N A;  3U5O A;  5I7X A;  5F2P A;  5E3D A;  4Z93 A;  3P1D A;  4YH3 A;  5E9I A;  5DLZ A;  5CUB A;  4UYE A;  4J0R A;  5CUE A;  3SVH A;  4HBX A;  4J3I A;  4N3W A;  2G4A A;  4YYI A;  5CFW A;  3MUK A;  4N4I A;  4QC1 A;  4IOR A;  5C4Q A;  5IGN A;  5FE4 A;  4UIY A;  3HMF A;  4QBM A;  5F61 A;  5LJ1 A;  4UIZ A;  5C87 A;  5D3S A;  3IU6 A;  2R10 A;  2L84 A;  4IR6 A;  4O7F A;  5EU1 A;  4MR3 A;  5F3A A;  4QSP A;  5E9V A;  5G4R A;  5I86 A;  4HXP A;  5LKT A;  5E9M A;  2YW5 A;  2D9E A;  4XUB A;  3P1E A;  4BW1 A;  4TZ2 A;  4YK0 A;  5FE0 A;  4OGJ A;  4HXO A;  4OUF A;  5IBN A;  5E9K A;  3HME A;  5F25 A;  5I88 A;  2DWW A;  4TZ8 A;  5BT3 A;  5EWH A;  4QB3 A;  5DFC A;  4NRC A;  5H85 A;  5L97 A;  4CUQ A;  4TU4 A;  5CGP A;  4WIV A;  4J0S A;  4HBY A;  2RNY A;  5ETD A;  2H60 A;  3AQA A;  5D3T A;  4GPJ A;  5AD3 A;  5FFV A;  4LC2 A;  4YAB A;  5D3R A;  3MB3 A;  5LKX A;  5FE1 A;  5CQ6 A;  4NR7 A;  3UV5 A;  5DX4 A;  4UIU A;  1ZS5 A;  3LQI A;  4HXK A;  4KCX A;  5CPE A;  4QSR A;  3MQM A;  3AAD A;  4ZQL A;  4WHU A;  4QNS A;  2E3K A;  5IID A;  5D3N A;  5LUU A;  4MEO A;  4NUE A;  4O7B A;  5CRZ A;  1F68 A;  5D3P A;  3JVM A;  4LR6 A;  4HBV A;  2WP2 A;  2GRC A;  5FFY A;  5L98 A;  5F1L A;  5BT5 A;  5H1V A;  4NUC A;  5EM3 A;  2E7O A;  4UYF A;  5E0R A;  4NQN A;  4NR4 A;  5CU8 A;  4IR5 A;  2YEK A;  4QEW A;  5FB1 A;  4A9I A;  5I40 A;  4HXM A;  5DYU A;  4FLP A;  4HXS A;  4IOQ A;  5A7C A;  5E3G A;  5A5Q A;  4QEU A;  5D25 A;  5FFW A;  4YBS A;  4O78 A;  5A83 A;  4O7C A;  5FDZ A;  4QSQ A;  4NR5 A;  5A5P A;  4UYH A;  2WP1 A;  5LJ0 A;  5HLS A;  4NRA A;  4BJX A;  5AMF A;  5DYX A;  5I1Q A;  5CRM A;  4Z1Q A;  2I7K A;  3LXJ A;  2RO1 A;  3MXF A;  3I3J A;  3U5P A;  5H1T A;  5CUD A;  5FE5 A;  4ZC9 A;  5E74 A;  4NR9 A;  4LDF A;  4ALG A;  5EV9 A;  2F6J A;  5FG5 A;  3U5M A;  2DKW A;  5D3H A;  5FH8 A;  4NR6 A;  4A9N A;  5TCM A;  4YYJ A;  5KTW A;  4LZ2 A;  3FKM X;  4CLB A;  5F5Z A;  5HJC A;  5D7X A;  3DWY A;  5FE3 A;  4AKN A;  4YAX A;  3UVY A;  3QZS A;  4LYS A;  4YYH A;  5F36 A;  4A9L A;  4Z1S A;  5A82 A;  4TT2 A;  5I29 A;  2RFJ A;  5JWM A;  3IU5 A;  3P5O A;  4YAT A;  5LVR A;  5FH7 A;  4QC3 A;  4NXJ A;  3P1F A;  4PY6 A;  4XY8 A;  2DVS A;  5E9L A;  4O71 A;  5EGU A;  3JVL A;  5KTU A;  4YY6 A;  5CUG A;  4A9J A;  4LZS A;  4TQN A;  5IGL A;  2N9G A;  5LKZ A;  3LQH A;  3P1C A;  4YAD A;  5AD2 A;  4O7E A;  5HFQ A;  3Q2F A;  5LKU A;  4CUT A;  4QSX A;  4N4F A;  1WUM A;  4QSS A;  4Z6I A;  5CQ4 A;  5EA1 A;  5KO4 A;  4NQM A;  4LRG A;  2RNW A;  4NUD A;  5DFD A;  4TS8 A;  5CQ7 A;  5FE7 A;  4O7A A;  5A5S A;  4KV4 A;  4IR3 A;  4F3I A;  4O72 A;  5I7Y A;  3U5L A;  5EPS A;  1X0J A;  5HCL A;  4A9H A;  5DKC A;  4QSU A;  3JVK A;  3UV2 A;  4QR5 A;  5D26 A;  5ENG A;  3LQJ A;  3MB4 A;  4NYV A;  5HQ5 A; 
#chains in the Genus database with same CATH topology
 4N4G A;  4YBM A;  2I8N A;  5EWC A;  5EWW A;  5F62 A;  4QYL A;  4YYG A;  5EP7 A;  5CY9 A;  2L85 A;  4MEN A;  5HFR A;  5DY7 A;  5BT4 A;  4HXL A;  4O77 A;  5HEN A;  3O34 A;  4A9E A;  5KU3 A;  4UIT A;  2RI7 A;  4TYL A;  5ENH A;  5A5O A;  4N4H A;  3ONI A;  4CUP A;  5F63 A;  5II1 A;  4UIV A;  5K29 A;  4HBW A;  4BW4 A;  5E73 A;  2OUO A;  5EIC A;  4PTB A;  5FE2 A;  5I80 A;  4A9O A;  3TLP A;  5DLX A;  5C85 A;  2F6N A;  4YY4 A;  4J1P A;  3ZYU A;  5L96 A;  4YC9 A;  4UYD A;  2OSS A;  5D3J A;  2R0S A;  4YYN A;  5COI A;  4QEV A;  5EIS A;  4A9K A;  5C89 A;  2KTB B;  4C67 A;  3HMH A;  5H1U A;  5FG6 A;  5II2 A;  3O37 A;  5D24 A;  5CUA A;  4MR6 A;  5FG4 A;  4AKI A;  4E96 A;  4QR3 A;  5DYA A;  5E9Y A;  5EK9 A;  5ETB A;  5IGM A;  5L8U A;  3DAI A;  5ENC A;  5FB0 A;  4PCE A;  3G0J A;  4CUS A;  5HEM A;  5EWV A;  4IR4 A;  5AME A;  4IOO A;  4YH4 A;  5DBM A;  5ENE A;  5ENF A;  2OO1 A;  3O33 A;  4UYG A;  3SVG A;  4YYD A;  2RS9 B;  2E7N A;  4PS5 A;  4TTE A;  2RNX A;  5KTX A;  5LJ2 A;  4Q0O A;  4TT6 A;  5HM0 A;  5IG6 A;  4Z6H A;  2D82 A;  5C7N A;  5HRV A;  5G4S A;  4QSV A;  4CFL A;  4Y03 A;  5CQ5 A;  3Q2E A;  4CUU A;  5L99 A;  3UW9 A;  1E6I A;  4O75 A;  4YBT A;  4QST A;  2YEM A;  2DVQ A;  5I89 A;  5CZG A;  3QZV A;  5DW1 A;  3MUL A;  4ZW1 A;  3G0L A;  4CL9 A;  4O74 A;  4NR8 A;  5HRW A;  4XY9 A;  4TT4 A;  4ALH A;  5FH6 A;  2DVR A;  3S92 A;  1N72 A;  1JSP B;  2YYN A;  4LYI A;  5CUC A;  5KHM A;  3UVD A;  4MR5 A;  2YQD A;  2YEL A;  3UV4 A;  5DW2 A;  4QSW A;  4NRB A;  4A9M A;  4PKL A;  5A85 A;  3RCW A;  3S91 A;  4XUA A;  4AKH A;  3LJW A;  3O36 A;  4QUT A;  4LYW A;  4MEP A;  4QYD A;  4MR4 A;  5FE8 A;  4UIW A;  4NS5 A;  4UYF B;  2DVV A;  5IGK A;  4Q0N A;  4YYM A;  5JI8 A;  5HQ7 A;  4TU6 A;  5J0D A;  5CQ8 A;  5EI4 A;  5HRX A;  2MJV B;  4QUU A;  1PUO A;  5CQA A;  2LSP B;  5D3L A;  3D7C A;  5I83 A;  2L5E A;  5HQ6 A;  3U5N A;  3GG3 A;  3U5K A;  4CFK A;  5HEL A;  5ENB A;  3NXB A;  3UVX A;  5EPB A;  5FE9 A;  2NXB A;  4O70 A;  5CQ3 A;  3U5J A;  4PCI A;  5DKH A;  4HXR A;  4HXN A;  5LVQ A;  4LZR A;  5CS8 A;  5D0C A;  5E7D A;  4DON A;  2R0V A;  5ACY A;  3K2J A;  5CQT A;  5CTL A;  5EQ1 A;  4NYW A;  4RVR A;  1WUG A;  4WHW A;  5DKD A;  4NYX A;  2YDW A;  5A81 A;  5FBX A;  5FE6 A;  5L8T A;  4BW2 A;  4X2I A;  4QY4 A;  4YYK A;  4UIX A;  3O35 A;  2FSA A;  3JVJ A;  4OGI A;  1EQF A;  4O76 A;  1JM4 B;  2DAT A;  2R0Y A;  5F60 A;  5TB6 A;  4BHW A;  4QR4 A;  5DFB A;  4BW3 A;  5ENJ A;  3QZT A;  5F1H A;  5DYC A;  3SVF A;  4QZS A;  4MEQ A;  5CP5 A;  5EPR A;  4KV1 A;  5ENI A;  5C8G A;  4C66 A;  4XYA A;  4A9F A;  5EVA A;  3UVW A;  4CUR A;  5A5R A;  5EWD A;  5A5N A;  3U5O A;  5I7X A;  3VKG A;  5F2P A;  5E3D A;  4Z93 A;  3P1D A;  4YH3 A;  5E9I A;  5DLZ A;  5CUB A;  4UYE A;  4J0R A;  5CUE A;  3SVH A;  4HBX A;  4J3I A;  4N3W A;  2G4A A;  4YYI A;  5CFW A;  3MUK A;  4N4I A;  4QC1 A;  4IOR A;  5C4Q A;  5IGN A;  5FE4 A;  4UIY A;  3ERR A;  3HMF A;  4QBM A;  5F61 A;  5LJ1 A;  4UIZ A;  5C87 A;  5D3S A;  3IU6 A;  2R10 A;  2L84 A;  4IR6 A;  4O7F A;  5EU1 A;  4MR3 A;  5F3A A;  4QSP A;  5E9V A;  5G4R A;  5I86 A;  4HXP A;  5LKT A;  5E9M A;  2YW5 A;  2D9E A;  4XUB A;  3P1E A;  4BW1 A;  4TZ2 A;  4YK0 A;  5FE0 A;  4OGJ A;  4HXO A;  4OUF A;  5IBN A;  5E9K A;  3HME A;  5F25 A;  5I88 A;  2DWW A;  4TZ8 A;  5BT3 A;  5EWH A;  4QB3 A;  5DFC A;  4NRC A;  5H85 A;  5L97 A;  4CUQ A;  4TU4 A;  5CGP A;  4WIV A;  4J0S A;  4HBY A;  2RNY A;  5ETD A;  2H60 A;  3AQA A;  1ZKR A;  5D3T A;  4GPJ A;  5AD3 A;  5FFV A;  4LC2 A;  4AI6 A;  4YAB A;  5D3R A;  3MB3 A;  5LKX A;  5FE1 A;  5CQ6 A;  4NR7 A;  3UV5 A;  5DX4 A;  4UIU A;  1ZS5 A;  3LQI A;  4HXK A;  4KCX A;  5CPE A;  4QSR A;  3MQM A;  3AAD A;  4ZQL A;  4WHU A;  4QNS A;  2E3K A;  5IID A;  5D3N A;  5LUU A;  4MEO A;  4NUE A;  4O7B A;  5CRZ A;  1F68 A;  5D3P A;  3JVM A;  4LR6 A;  4HBV A;  2WP2 A;  3D1B A;  2GRC A;  5FFY A;  5L98 A;  5F1L A;  5BT5 A;  5H1V A;  4NUC A;  5EM3 A;  2E7O A;  4UYF A;  5E0R A;  4NQN A;  4NR4 A;  5CU8 A;  4IR5 A;  2YEK A;  4QEW A;  5FB1 A;  4A9I A;  5I40 A;  4HXM A;  5DYU A;  4FLP A;  4HXS A;  4IOQ A;  5A7C A;  5E3G A;  5A5Q A;  4QEU A;  5D25 A;  5FFW A;  4YBS A;  4O78 A;  5A83 A;  4O7C A;  5FDZ A;  4QSQ A;  4NR5 A;  5A5P A;  4UYH A;  2WP1 A;  5LJ0 A;  5HLS A;  4NRA A;  4BJX A;  5AMF A;  5DYX A;  5I1Q A;  5CRM A;  4Z1Q A;  2I7K A;  3LXJ A;  2RO1 A;  3MXF A;  3I3J A;  3U5P A;  5H1T A;  5CUD A;  5FE5 A;  4ZC9 A;  5E74 A;  4NR9 A;  4LDF A;  4ALG A;  5EV9 A;  2F6J A;  5FG5 A;  3U5M A;  2DKW A;  5D3H A;  5FH8 A;  4NR6 A;  4A9N A;  5TCM A;  4YYJ A;  5KTW A;  4LZ2 A;  3FKM X;  4CLB A;  5F5Z A;  5HJC A;  5D7X A;  3DWY A;  5FE3 A;  4AKN A;  4YAX A;  3UVY A;  3QZS A;  4LYS A;  4YYH A;  3VKH A;  5F36 A;  4A9L A;  4Z1S A;  5A82 A;  4TT2 A;  5I29 A;  2RFJ A;  5JWM A;  3IU5 A;  3P5O A;  4YAT A;  5LVR A;  5FH7 A;  4QC3 A;  4NXJ A;  3P1F A;  4PY6 A;  4XY8 A;  2DVS A;  5E9L A;  4O71 A;  5EGU A;  3JVL A;  5KTU A;  4YY6 A;  5CUG A;  4A9J A;  4LZS A;  4TQN A;  5IGL A;  2N9G A;  5LKZ A;  3LQH A;  3P1C A;  4YAD A;  5AD2 A;  4O7E A;  5HFQ A;  3Q2F A;  5LKU A;  4CUT A;  4QSX A;  4N4F A;  1WUM A;  4QSS A;  4Z6I A;  5CQ4 A;  5EA1 A;  5KO4 A;  4NQM A;  4LRG A;  2RNW A;  4NUD A;  5DFD A;  4TS8 A;  5CQ7 A;  4AKG A;  5FE7 A;  4O7A A;  5A5S A;  4KV4 A;  4IR3 A;  4F3I A;  4O72 A;  3D1D A;  5I7Y A;  3U5L A;  5EPS A;  2EJN A;  1X0J A;  5HCL A;  4A9H A;  5DKC A;  4QSU A;  3JVK A;  3UV2 A;  4QR5 A;  5D26 A;  5ENG A;  3LQJ A;  3MB4 A;  4NYV A;  5HQ5 A; 
#chains in the Genus database with same CATH homology
 4N4G A;  4YBM A;  2I8N A;  5EWC A;  5EWW A;  5F62 A;  4QYL A;  4YYG A;  5EP7 A;  5CY9 A;  2L85 A;  4MEN A;  5HFR A;  5DY7 A;  5BT4 A;  4HXL A;  4O77 A;  5HEN A;  3O34 A;  4A9E A;  5KU3 A;  4UIT A;  2RI7 A;  4TYL A;  5ENH A;  5A5O A;  4N4H A;  3ONI A;  4CUP A;  5F63 A;  5II1 A;  4UIV A;  5K29 A;  4HBW A;  4BW4 A;  5E73 A;  2OUO A;  5EIC A;  4PTB A;  5FE2 A;  5I80 A;  4A9O A;  3TLP A;  5DLX A;  5C85 A;  2F6N A;  4YY4 A;  4J1P A;  3ZYU A;  5L96 A;  4YC9 A;  4UYD A;  2OSS A;  5D3J A;  2R0S A;  4YYN A;  5COI A;  4QEV A;  5EIS A;  4A9K A;  5C89 A;  2KTB B;  4C67 A;  3HMH A;  5H1U A;  5FG6 A;  5II2 A;  3O37 A;  5D24 A;  5CUA A;  4MR6 A;  5FG4 A;  4E96 A;  4QR3 A;  5DYA A;  5E9Y A;  5EK9 A;  5ETB A;  5IGM A;  5L8U A;  3DAI A;  5ENC A;  5FB0 A;  4PCE A;  3G0J A;  4CUS A;  5HEM A;  5EWV A;  4IR4 A;  5AME A;  4IOO A;  4YH4 A;  5DBM A;  5ENE A;  5ENF A;  2OO1 A;  3O33 A;  4UYG A;  3SVG A;  4YYD A;  2RS9 B;  2E7N A;  4PS5 A;  4TTE A;  2RNX A;  5KTX A;  5LJ2 A;  4Q0O A;  4TT6 A;  5HM0 A;  5IG6 A;  4Z6H A;  2D82 A;  5C7N A;  5HRV A;  5G4S A;  4QSV A;  4CFL A;  4Y03 A;  5CQ5 A;  3Q2E A;  4CUU A;  5L99 A;  3UW9 A;  1E6I A;  4O75 A;  4YBT A;  4QST A;  2YEM A;  2DVQ A;  5I89 A;  5CZG A;  3QZV A;  5DW1 A;  3MUL A;  4ZW1 A;  3G0L A;  4CL9 A;  4O74 A;  4NR8 A;  5HRW A;  4XY9 A;  4TT4 A;  4ALH A;  5FH6 A;  2DVR A;  3S92 A;  1N72 A;  1JSP B;  2YYN A;  4LYI A;  5CUC A;  5KHM A;  3UVD A;  4MR5 A;  2YQD A;  2YEL A;  3UV4 A;  5DW2 A;  4QSW A;  4NRB A;  4A9M A;  4PKL A;  5A85 A;  3RCW A;  3S91 A;  4XUA A;  3LJW A;  3O36 A;  4QUT A;  4LYW A;  4MEP A;  4QYD A;  4MR4 A;  5FE8 A;  4UIW A;  4NS5 A;  4UYF B;  2DVV A;  5IGK A;  4Q0N A;  4YYM A;  5JI8 A;  5HQ7 A;  4TU6 A;  5J0D A;  5CQ8 A;  5EI4 A;  5HRX A;  2MJV B;  4QUU A;  5CQA A;  2LSP B;  5D3L A;  3D7C A;  5I83 A;  2L5E A;  5HQ6 A;  3U5N A;  3GG3 A;  3U5K A;  4CFK A;  5HEL A;  5ENB A;  3NXB A;  3UVX A;  5EPB A;  5FE9 A;  2NXB A;  4O70 A;  5CQ3 A;  3U5J A;  4PCI A;  5DKH A;  4HXR A;  4HXN A;  5LVQ A;  4LZR A;  5CS8 A;  5D0C A;  5E7D A;  4DON A;  2R0V A;  5ACY A;  3K2J A;  5CQT A;  5CTL A;  5EQ1 A;  4NYW A;  4RVR A;  1WUG A;  4WHW A;  5DKD A;  4NYX A;  2YDW A;  5A81 A;  5FBX A;  5FE6 A;  5L8T A;  4BW2 A;  4X2I A;  4QY4 A;  4YYK A;  4UIX A;  3O35 A;  2FSA A;  3JVJ A;  4OGI A;  1EQF A;  4O76 A;  1JM4 B;  2DAT A;  2R0Y A;  5F60 A;  5TB6 A;  4BHW A;  4QR4 A;  5DFB A;  4BW3 A;  5ENJ A;  3QZT A;  5F1H A;  5DYC A;  3SVF A;  4QZS A;  4MEQ A;  5CP5 A;  5EPR A;  4KV1 A;  5ENI A;  5C8G A;  4C66 A;  4XYA A;  4A9F A;  5EVA A;  3UVW A;  4CUR A;  5A5R A;  5EWD A;  5A5N A;  3U5O A;  5I7X A;  5F2P A;  5E3D A;  4Z93 A;  3P1D A;  4YH3 A;  5E9I A;  5DLZ A;  5CUB A;  4UYE A;  4J0R A;  5CUE A;  3SVH A;  4HBX A;  4J3I A;  4N3W A;  2G4A A;  4YYI A;  5CFW A;  3MUK A;  4N4I A;  4QC1 A;  4IOR A;  5C4Q A;  5IGN A;  5FE4 A;  4UIY A;  3HMF A;  4QBM A;  5F61 A;  5LJ1 A;  4UIZ A;  5C87 A;  5D3S A;  3IU6 A;  2R10 A;  2L84 A;  4IR6 A;  4O7F A;  5EU1 A;  4MR3 A;  5F3A A;  4QSP A;  5E9V A;  5G4R A;  5I86 A;  4HXP A;  5LKT A;  5E9M A;  2YW5 A;  2D9E A;  4XUB A;  3P1E A;  4BW1 A;  4TZ2 A;  4YK0 A;  5FE0 A;  4OGJ A;  4HXO A;  4OUF A;  5IBN A;  5E9K A;  3HME A;  5F25 A;  5I88 A;  2DWW A;  4TZ8 A;  5BT3 A;  5EWH A;  4QB3 A;  5DFC A;  4NRC A;  5H85 A;  5L97 A;  4CUQ A;  4TU4 A;  5CGP A;  4WIV A;  4J0S A;  4HBY A;  2RNY A;  5ETD A;  2H60 A;  3AQA A;  5D3T A;  4GPJ A;  5AD3 A;  5FFV A;  4LC2 A;  4YAB A;  5D3R A;  3MB3 A;  5LKX A;  5FE1 A;  5CQ6 A;  4NR7 A;  3UV5 A;  5DX4 A;  4UIU A;  1ZS5 A;  3LQI A;  4HXK A;  4KCX A;  5CPE A;  4QSR A;  3MQM A;  3AAD A;  4ZQL A;  4WHU A;  4QNS A;  2E3K A;  5IID A;  5D3N A;  5LUU A;  4MEO A;  4NUE A;  4O7B A;  5CRZ A;  1F68 A;  5D3P A;  3JVM A;  4LR6 A;  4HBV A;  2WP2 A;  2GRC A;  5FFY A;  5L98 A;  5F1L A;  5BT5 A;  5H1V A;  4NUC A;  5EM3 A;  2E7O A;  4UYF A;  5E0R A;  4NQN A;  4NR4 A;  5CU8 A;  4IR5 A;  2YEK A;  4QEW A;  5FB1 A;  4A9I A;  5I40 A;  4HXM A;  5DYU A;  4FLP A;  4HXS A;  4IOQ A;  5A7C A;  5E3G A;  5A5Q A;  4QEU A;  5D25 A;  5FFW A;  4YBS A;  4O78 A;  5A83 A;  4O7C A;  5FDZ A;  4QSQ A;  4NR5 A;  5A5P A;  4UYH A;  2WP1 A;  5LJ0 A;  5HLS A;  4NRA A;  4BJX A;  5AMF A;  5DYX A;  5I1Q A;  5CRM A;  4Z1Q A;  2I7K A;  3LXJ A;  2RO1 A;  3MXF A;  3I3J A;  3U5P A;  5H1T A;  5CUD A;  5FE5 A;  4ZC9 A;  5E74 A;  4NR9 A;  4LDF A;  4ALG A;  5EV9 A;  2F6J A;  5FG5 A;  3U5M A;  2DKW A;  5D3H A;  5FH8 A;  4NR6 A;  4A9N A;  5TCM A;  4YYJ A;  5KTW A;  4LZ2 A;  3FKM X;  4CLB A;  5F5Z A;  5HJC A;  5D7X A;  3DWY A;  5FE3 A;  4AKN A;  4YAX A;  3UVY A;  3QZS A;  4LYS A;  4YYH A;  5F36 A;  4A9L A;  4Z1S A;  5A82 A;  4TT2 A;  5I29 A;  2RFJ A;  5JWM A;  3IU5 A;  3P5O A;  4YAT A;  5LVR A;  5FH7 A;  4QC3 A;  4NXJ A;  3P1F A;  4PY6 A;  4XY8 A;  2DVS A;  5E9L A;  4O71 A;  5EGU A;  3JVL A;  5KTU A;  4YY6 A;  5CUG A;  4A9J A;  4LZS A;  4TQN A;  5IGL A;  2N9G A;  5LKZ A;  3LQH A;  3P1C A;  4YAD A;  5AD2 A;  4O7E A;  5HFQ A;  3Q2F A;  5LKU A;  4CUT A;  4QSX A;  4N4F A;  1WUM A;  4QSS A;  4Z6I A;  5CQ4 A;  5EA1 A;  5KO4 A;  4NQM A;  4LRG A;  2RNW A;  4NUD A;  5DFD A;  4TS8 A;  5CQ7 A;  5FE7 A;  4O7A A;  5A5S A;  4KV4 A;  4IR3 A;  4F3I A;  4O72 A;  5I7Y A;  3U5L A;  5EPS A;  1X0J A;  5HCL A;  4A9H A;  5DKC A;  4QSU A;  3JVK A;  3UV2 A;  4QR5 A;  5D26 A;  5ENG A;  3LQJ A;  3MB4 A;  4NYV A;  5HQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...