4QT0A

Crystal structure of human muscle l-lactate dehydrogenase in complex with inhibitor 1, 3-{[3-carbamoyl-7-(2,4-dimethoxypyrimidin-5-yl)quinolin-4-yl]amino}benzoic acid
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
332
structure length
332
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of lactate dehydrogenase A (LDHA) in apo, ternary and inhibitor-bound forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords L-lactate dehydrogenase A chain
total genus 109
structure length 332
sequence length 332
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4qt0A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4qt0A02
3RAJA 5C37A 2DU8A 4RQTA 3PEFA 2Z95A 1PJ3A 2QW8A 1N7HA 1HDRA 3PP8A 2BH9A 3ORFA 4IDAA 4YAKA 4K9DA 2NWQA 3H9UA 5EESA 2D4AA 2C20A 2A92A 2HCTA 3WJAA 4QSMA 1Q0HA 3IP3A 5TF4A 3H9JA 4NJMB 2QRJA 1AXEA 3IUPA 3K8ZA 5L4LA 4PG5A 3EMKA 4XZ3A 3ZU3A 1HDOA 3NYWA 4ZJUA 4II3A 1NXQA 1YB1A 4E13A 4AVYA 4NIMA 5AXDA 4FOSA 3ZHBA 2PY6A 4Q3CA 5G0TA 4W7HA 2HK8A 2A9FA 1NPDA 1ZZEA 3WBFA 2GCGA 2VOEA 3QE3A 2VWGA 3G79A 3ULKA 1B0AA 3WOHA 3E03A 2VZ8A 4C7KA 2IODA 3UN1A 3RSHA 4DYVA 5L7WA 2FZWA 4ND5A 4G5HA 2NU9A 2A4KA 1YL6A 4R3WA 1ZK4A 2GZ2A 2YFHA 4RF4A 3P2YA 4ONEA 5BSEA 2X23A 5AOVA 1OZAA 1NR1A 3GUCA 1BDMA 3HFGA 5FWNA 5JAZA 1GR0A 1DIHA 1TA4A 2IYPA 2QYSA 2ZB7A 4DQXA 1YOVA 3HADA 3H6KA 1HYHA 1UXJA 3B20A 2EIHA 5G4LA 5A5EA 1WZEA 1YO6A 4J0EA 1PJ2A 4YAIA 2XXJA 1QYXA 4BNJA 3EUWA 2VOJA 4OQYA 4NR0A 4BNFA 1E77A 4U6SA 5JY1A 2QHXA 5F21A 5BNIA 4J7UA 1GUFA 2R6JA 3WGGA 1C1DA 4OQZA 1RKXA 4FW8A 1FXSA 1IOLA 4XB1A 4F6LA 1JAXA 1TT5A 4P8RA 5JMWA 1H6DA 3O8QB 2D0IA 3WR5A 5GZ1A 4CLXA 5TNXA 2AEMA 5GY7A 4PG6A 1QLJA 1E3JA 3I5MA 1NHWA 3S1LA 4A5OA 2G1UA 3JQ8B 4RF2A 1SOWA 1UXHA 2HK7A 3GT0A 1QP8A 5IXSA 2HRBA 4BVAA 1UZNA 1JKIA 1GY8A 4NJMA 4E30A 1PJQA 5G4KB 3UCXA 3GPDG 2Q1WA 1JDJA 1PGOA 4IDCA 4R9SA 1ZH8A 4R41A 4YRAA 1LA2A 5TLSA 1GV1A 4H16A 1K0UA 3FPCA 3HN2A 1PS9A 3K6JA 2TMDA 2PH3A 4A7PA 2DAPA 3KOUA 5KJ6A 1HEUA 4E2WA 1VL8A 1GQQA 5MDHA 1LRKA 1KVUA 2PD6A 1F14A 1LSSA 3SBOA 1EBFA 5JO0A 1QKIA 2YV1A 4OGWA 3WX0A 2E48A 2VN8A 1R12A 4JNKA 4F6CA 3PVZA 3PLRA 4FFOA 3BMNA 4CM8B 4EBFA 3R3JA 4WOJA 1NPYA 4PZCA 4F46A 4CM9D 1BXGB 4OOFA 1ZFNA 3W8FA 4TRJA 5GZ3A 5L45A 1P1FA 3SLGA 1HDXA 2Y93A 2Q50A 1EVIA 1GEGA 1LLDA 4IM7A 4CV0A 1RM5A 4HXYA 1N1GA 3D5TA 1YQXA 3ZGYA 1QG6A 3B6ZA 1CERA 3WXBA 1DHTA 2ZJ1A 1PZGA 3T4XA 1NFQA 3JYQA 3VPGA 3EC7A 4RPJA 4Y6PA 1BTOA 1M2WA 3QWAA 2NM0A 2Y0EA 4FFPA 3GG9A 5BSHA 4UAGA 4RLHA 2BFOA 3H5NA 3NEPX 2VUSA 1GL3A 3LLVA 2EJWA 2Y68A 5FEUA 3D4NA 4IJUA 2E37A 3LZ6A 1HWYA 2FR8A 1R16A 3DMTA 1GAEO 2I76A 3R6DA 4WOKA 4AJOA 1UXIA 2VZ9A 5KJEA 3AU8A 4XDZA 4INAA 4XJSA 1Z75A 2YZ7A 3OQ1A 5TGDA 4CM3A 5A02A 1DC6A 5L3ZA 3IKTA 1I24A 4UUPA 3D3EA 3JD1A 4H3VA 3OA2A 1GYQA 1PWXA 1WNTA 1K5HA 4MVJH 4J2OA 2TMGA 4EJ0A 1FF9A 1W0CA 2I9PA 1MG0A 4ND1A 5TRTA 1WAMA 3BAZA 4FDAA 4BIIA 3E18A 4DLBA 1NAHA 1ZVMA 3RBXA 1I2ZA 4J1NA 1H93A 3QLJA 5JCXA 1PS8A 1VJ1A 4AJ4A 3G0OA 1KY5A 1CEQA 5HM8A 6ADHA 1XWFA 1ZNQO 4JBHA 2FPGA 2J8ZA 4OIMA 1DO8A 4Q3AA 3NGXA 1MC5A 2O23A 5CFZA 4YBZA 2B5WA 4MP8A 5EQFA 2VYNA 5CDGA 2P9CA 2FOIA 1G6KA 3KM0A 5JXWA 3KYDB 3MJEA 3PYXA 5EJ2A 4B8WA 4EUHA 4YJDA 1ENYA 3FI9A 1MA0A 1V9LA 2B37A 3ONEA 4RDHA 1U7TA 3DMTC 4OO3A 2CY0A 5HS4A 4E0BA 4LMRA 4YYZA 2EP5A 5L40A 4WECA 2AE1A 3BTOA 2AA3A 3PDJA 2NVUB 2Y0CA 4BNLA 3KYDA 4JBIA 5L7YA 4TKLA 3V1TC 4BV8A 4EDFA 3HZZA 2HMTA 3LT2A 4CUJA 2PKQP 1I32A 2PFGA 1OC4A 1Z6ZA 2O3UA 2P68A 1LUAA 3GDOA 4IIVA 1NQAO 2O4UX 1R4MA 4GX5A 3WQQA 5JNLA 3ZH2A 4BGEA 3OECA 4YT5A 5CDTA 3ADPA 5J23A 1KEPA 3ONFA 1NVTA 1VKNA 3Q11A 4CMAA 4OJNA 1KVTA 4RDIA 4RPLA 4HFMA 4CMBA 1BXZA 4XQCA 4OXYA 4XWYA 1WPQA 4J1QA 1C0LA 1PGJA 3T4EA 4G2NA 3OICA 1ZSYA 4W6ZA 1JW9B 1QLHA 3UVEA 3DFZA 3WLEA 3V2HA 3K2EA 1PU2A 1O9BA 3H7AA 3JQFA 3MCVA 3P7MA 4BNWA 3BMCA 3ZW9A 3COSA 3QSGA 1U3WA 4WCDA 4YTEA 2W2KB 4QUKA 1JAYA 3UH1A 2PR2A 3FNGA 5DNAA 3GNSA 2DC1A 2QIOA 3ST7A 2DVMA 4DIBA 4NBWA 1YS4A 3ZWPA 4J43A 4OMUA 4BNYA 4UVHA 4BNXA 3ANNA 3TL2A 3E6AA 3TJRA 2VYVA 3CXRA 2VNAA 2OL4A 1E6UA 3ZHYA 7MDHA 4HV4A 1V3UA 5JBIA 4B8ZA 2J3HA 1WWKA 3DDNA 3IIEA 4MP3A 5ER9A 2R2GA 5BSGA 4MVJI 2X7HA 3G1UA 5DCUA 1J4AA 2JHGA 1ISJA 2XAAA 4BO4A 1E7MA 4E31A 3V1UA 1H0KA 1LLUA 1GCUA 5KVQA 4M86A 4FJ2A 4RCVA 4WLUA 1RJWA 3CH6A 4NU6A 4D44A 4E2YA 2FWMX 5KVVA 3SEFA 5I9MA 4L8VA 3LC7O 3F9IA 1H6AA 2O7SA 1J49A 3LVFO 3BHIA 3E1KA 4J1TA 3Q2KA 3PFFA 4NHEA 3BXXA 4RQUA 4JJFA 1ZJYA 4L4RA 2Q1UA 1LDGA 3D0OA 3DZHA 5CDSA 4UVIA 4HX5A 1QYVA 4B79A 2HQ1A 4QT0A 3LT0A 4CUKA 2EHDA 2DBRA 2IEDA 2BF7A 2DFVA 4IDBA 2C5EA 1TT7A 2YV3A 3DONA 3F6YA 1DBVO 4ZICA 4FFNA 4AFNA 3OFSA 3ZNPA 4DC1A 2J5KA 1OFGA 4IZHA 5A3VA 4F45A 2VHVA 4R5MA 1LU9A 3P5SA 1F12A 2VNSA 3JQCA 4EUEA 3ZDFA 3ZI0A 2GN9A 4I5FA 3H3JA 5F5NA 4BUCA 4BOYA 4QO7A 4RVFA 1Y9EA 5KNLA 2GF2A 3L07A 5T8KC 5JDCC 5CHEA 1QYCA 2V6BA 2PGJA 4JK3A 1Y8RA 2J5QA 3ZU5A 5U1PA 4FGWA 4XR4A 1T4BA 4UEJA 1KETA 3C7CB 3JQ8A 4HNGA 1UAYA 4J4TA 2AQ8A 1UDBA 3CKYA 3RC7A 3WLFA 4D3SA 3TPCA 3IC5A 4PGFA 1AHHA 2VZ0A 1DC5A 3HNPA 3ROPA 1E3SA 1C0IA 1O89A 1SO8A 1I3MA 1B14A 3ROMA 5AXBA 3RKRA 1IULA 4A2CA 1E3WA 2YDYA 4XCVA 4XX0A 4MPDA 3JD2A 2IXAA 1U2DA 1JVSA 2PK3A 2WEKA 4DPKA 1ADCA 1PR3A 1NVMB 2R00A 2Y66A 3OIGA 4J4BA 4MVJA 5KKAA 1HF3A 1BXKA 3R0IA 3G3EA 3W8EA 1P0CA 5CPFA 2FRDA 4PG4A 3UCFA 4ZD6A 1UJMA 1P77A 3PWKA 2YHIB 3GH3A 1UH5A 5BNTA 1K3TA 1MX3A 3BHMA 3WMXA 3U49A 1LDEA 2GYYA 4YJHA 1F17A 2WSBA 4JIGA 4XGIA 5B37A 2IZ0A 4YRDA 4LK3A 4PLTA 4AJ1A 4IXTA 2PGLA 1H9AA 3PWZA 1E1KA 4L75A 4LVUA 3FHLA 1M67A 1EFLA 3DEYX 4WGGA 1B26A 2LDXA 4OXKA 4NBVA 3FNHA 4P4GA 4RZHA 4R1UA 4IS3A 1E5LA 1P1HA 3RUEA 2HAEA 6LDHA 1WDLA 2EGGA 4FJ1A 3JQ7B 5IN4A 1N7GA 4ZVVA 3ASVA 1JQBA 3QWIA 1I2BA 5TJHA 1KOLA 2NV6A 5ICMA 1NAIA 1RM3A 5JO9A 2EF1A 3RC1A 3KB6A 4UREA 2UVDA 1I36A 2YUTA 2O7QA 1N2SA 3QIVA 1Y9AA 3AM4A 3Q2IA 4LRSB 4YJFA 5A9TA 3E5RA 4RVHA 3WS7A 1ISMA 2JL1A 5DDIP 3KEQA 4HY3A 1ZEMA 3STHA 4AJLA 1UXKA 2X58A 3WGTA 2ZJ0A 2NUAA 4CLOA 1V35A 1Q7CA 3V5NA 1GADO 1FMCA 3U4CA 3D1LA 4R1NA 5JYDA 3GQVA 1DPGA 1TLTA 2JD1A 2OORA 3DQPA 1BGVA 5F1OA 3L4BA 4C7JA 4CMEA 2AE2A 1ISFA 1E3IA 1HE4A 1ZO8A 3WYEA 3CEAA 4R51A 3KBOA 2YHIA 3GGGA 1LI4A 4AG3A 1P1IA 5CDUA 2DM6A 1A9ZA 4ZU3A 1PJTA 4YAGA 1LJ8A 3HDHA 3PHJA 1F06A 3K30A 1CWUA 1ZK3A 3LDHA 1B8UA 1G0OA 4C4OA 4QEDA 5C7OO 2X5KO 3DMYA 1ISHA 4B7CA 3CTMA 2BFMA 4GSKA 1N1EA 4JP3A 3WQRA 1HDCA 1DC4A 1Y81A 4ND3A 2BMAA 1ENZA 4M87A 4XDYA 3DAPA 1UR5A 4BQPA 4ALMA 2ILTA 2XF8A 3CE6A 3KYBA 1FJHA 3W6ZA 4OSOA 4DC0A 1ZSNA 2YQ4A 1FDTA 1Q7BA 4BL5A 5MGBA 2EW8A 1EZ4A 3TNLA 1DXYA 2POQX 4GQAA 1X7HA 1DJQA 1YRLA 1IHYA 2AMFA 1T2CA 4PLZA 1YDEA 3Q9NA 5DP1A 3WIEA 4CMGA 3TZCA 2EXXA 4L4SA 1C1XA 4Z9XA 3FWNA 4LVCA 2Q4BA 3WGQA 3TZ6A 4DQUA 2NU7A 3DZKA 3CZMA 3Q9UA 3I6IA 3W4KA 4IXWA 2DBVO 1ENOA 2EERA 2EGHA 3DC2A 3WDSA 4DRYA 5EIOA 2C07A 3QJ5A 1KY4A 4BNVA 3PZBA 4DQVA 1H5QA 5ES3A 2CVOA 3U9LA 3PWSA 4E5PA 4EEXA 4J7XA 4D43A 3ITKA 2CDBA 4M89A 4XYBA 3AY6A 5AXAA 4J9VA 1PWZA 1BRMA 1V6AA 2X0JA 4KTTE 2HO5A 3GRKA 4XEHA 5K6AC 3NAQA 3GN1A 4FFMA 3ZV5A 3M2TA 3L6EA 5ITVA 5KVCA 3DHEA 5I9NA 4BO7A 1TB4A 3VZSA 4K1LA 4KWHA 4D46A 3ANMA 1ZK2A 1HSZA 2Q2VA 2RBEA 9LDBA 3MZ0A 1YJ8A 2GR9A 3L9WA 4XA8A 3DBRA 2GNAA 3JQDA 2LDBA 1NWHA 4CMCA 3HG7A 2VHXA 1GQYA 4M49A 4FS3A 3SLKA 1H6BA 2WYVA 5GMOA 3TOXA 3OJLA 4E12A 3KSUA 2NVUA 5DOZA 5G4KA 3WWZA 3ASUA 4Y6SA 5I8WA 3JQBC 2X6TA 5A9SA 4E5NA 3IKVA 4E5MA 1B8PA 1GPJA 3VKUA 5I7SA 3MJVA 5TSDA 1L7DA 1KIFA 1G0NA 1YONA 1OAAA 3GNTA 4GX2A 4WE3A 2CDAA 4D3FA 4L9RA 4L4XA 1NX6A 1RYDA 4EGFA 3B1KA 3AOGA 4WLEA 4NPCA 4XRRA 4J90A 3GOHA 5DZSA 1GCOA 5FYDA 5BNFA 4CMIA 4M54A 4WNCA 4CQMD 3PGXA 1JWBB 1TXGA 2WTBA 4MVJE 3UF0A 3ICPA 4NBUA 3N74A 5I7VA 1EUZA 3GK3A 4N5NA 3JQAD 4D42A 3QVXA 3GZNA 2CVZA 1SB8A 4PVDA 4J9UE 4I5EA 5JCJA 3NKLA 4II2A 1C3VA 1HTBA 3PIDA 4NK5A 3I9KA 3IL2A 2GN4A 3KSDO 1XU7A 4GGPA 1KVRA 3TFQA 3FBTA 3H2SA 4BNHA 1PJBA 1H2BA 3A28A 5I9LA 4PLYA 2GN8A 1QSGA 3OA0A 5JDCA 4YT4A 1J0XO 1X15A 3PJEA 4ID9A 4ITUA 4FIZA 1K6XA 1Z45A 1PL7A 3P19A 3UGKA 4HNHA 2ZIZA 2B35A 3GR6A 1YBMA 1EVYA 4UVGA 4U6QA 3F1KA 3DBRB 5JDIC 3W4JA 2CUKA 4E5YA 3KXDA 2I99A 3M1AA 1DSSG 1GYPA 4DLLA 3ZWAA 3HWRA 1LQUA 5I7FA 2D8AA 1U8XX 3LYLA 4IZIA 3VPSA 1YJQA 2EKPA 2PD3A 3RUFA 4XYMA 3LF1A 4XRGA 1U7HA 3UFXA 4WLFA 3H5RA 2XXBA 3IMFA 3DOJA 3I1JA 3H3FA 4M1QA 2Y1GA 3JD3A 5HTOA 5EERA 3SC4A 4AJNA 5JYEA 2I67A 3HB5X 1XG5A 1DJNA 2AEJA 1NTOA 2Q2QA 4JLWA 4IUYA 3V8BA 3ADOA 1T2AA 4ZQBA 4ESOA 1P45A 3I9NA 4WLOA 1D8AA 4CM4A 2PA3A 1NPTO 2DPHA 1X1EA 4ALNA 2QRKA 4JP2A 3TZHA 1Z74A 5TT1A 1GEEA 1WDKA 3D7LA 2Q99A 4KUEA 2DTXA 5AXCA 4GKVA 2VTEA 1ZUD1 3RJ5A 4G81A 3WWYA 4J49A 3RKUA 1ZK0A 2GUGA 3AJRA 1E1MA 2VWQA 4PVCA 3NJ8A 4NBTA 3X2EA 2H9IA 3H8VA 3BA1A 1SB9A 1Z7BA 5DBIA 4JJGA 1NQTA 1YQGA 2VUUA 2AEFA 3QVSA 2X5OA 3E82A 1YBVA 2RIRA 4Z9YA 3C85A 5KJCA 4A0SA 1DIRA 2D5CA 4BKRA 4ALJA 2GASA 1FK8A 5TS3A 1PL8A 3T7EA 4PCVA 4RLSA 2XOXA 1HLDA 2OHXA 1HZZA 3GVXA 3CSDA 4PLVA 3UOGA 1CQIA 1Y6JA 5KVSA 2E4AA 1HDGO 4Z3KA 3ABIA 2B4TO 1PJSA 2J6IA 3EY4A 4RV9A 1B2LA 4Y8VA 3ZHZA 3C1TA 3RUIA 1XGKA 5DF1A 1IPFA 1XLTA 1XHLA 3JYLA 4NU5A 2W98A 5B4VA 1AUPA 4J16A 5KJ1A 3JQAA 1LRLA 3SC6A 3VPXA 3AWDA 4MVJP 3BTVA 1DIBA 4R4JA 4AJKA 1TI7A 1IZ0A 2RHRA 1LC0A 9LDTA 4OKNA 4BV9A 1VL6A 1VE9A 2X9VA 2V6GA 2I3GA 3Q3CA 3I4FA 4XJTA 2PD4A 3ICCA 3N58A 2OBNA 3PK0A 4UUOA 1DLJA 3GA0A 4KZPA 5DP2A 3TRIA 2Q1SA 1LBEA 3O26A 5DCYA 4CODB 1BXGA 1I3KA 1A4IA 1G1AA 1GZ6A 3FWZA 3LLSA 2JFHA 3RUHA 1BDBA 4U5QA 3RIHA 2VT3A 4P22A 3A1NA 5A1TA 5JFOA 2B4QA 4PG8A 1E1LA 1YH3A 3MWDB 2PV7A 1L7EA 3F1LA 3ZV4A 3C24A 1LLQA 4O1MA 4Y67A 2ZB3A 1SCUA 1Z7EA 4TZKA 1CETA 4LN1A 2BI7A 3FTNA 4CV3A 4MIOA 1DOHA 4XQGA 4EW6A 2OBYA 3C1AA 3NGLA 3KV3O 2O3RA 2AQIA 4NNJA 3KETA 1E3EA 4O6VA 4TRMA 2OP1A 2B0JA 4TKMA 1T1SA 3RUCA 3VH1A 4CM7A 4DLAA 4CQMB 3UXYA 4BMNA 3FR8A 4IJKA 1GDHA 1I10A 2CD9A 1ENPA 4Z6KA 4PLPA 1XCBA 4GPD1 2B36A 2FP4A 5AVOA 5JAMA 1A7AA 1C0KA 3C7AA 4GKBA 1GZ3A 2Y67A 3AM3A 3AFMA 1IL0A 4J3FA 3JQBA 3L77A 3E8XA 4BO0A 1P33A 4HUJA 3E9MA 1GZ4A 4LCJA 2P9EA 5COAA 2VWPA 1RM4A 2C54A 1JKFA 1ULUA 4E5KA 3BHJA 1EE2A 3AI1A 4WJZA 5T5QA 5DBFA 3AUUA 3E48A 5JY6A 2VRBA 2NSDA 1LDYA 3PIIA 1YB5A 2HMVA 3DAFA 3MOIA 4I08A 2BRUA 2PH5A 4IDGA 2DLDA 1P31A 3EAGA 1H2HA 5FI3A 5JC8A 3AUTA 1O6ZA 4R69A 1HRDA 1B3RA 1P9LA 4KWIA 4BNZA 2OOSA 4I5DA 1Q2XA 2EJVA 2Q2WA 3JQGA 1XDWA 2W2LD 1EVZA 3HHPA 5CEJA 1A7KA 2IDZA 4KUGA 1LC3A 3MJTA 4CR6A 3O8QA 1I3NA 1V3VA 3PJDA 4Y98A 3DBLA 3GC6A 4RVSA 4R5HA 4YVFA 5L4SA 2QZ9A 3IDSA 4ALKA 2WM3A 2G82A 3AU9A 1UZLA 2O2YA 4AJJA 4RJTA 2HJSA 4L73A 2GSDA 5TJ9A 4FJ0A 4OXNA 1ZXLA 1LEHA 4PRLA 3TL3A 1C1XB 4J7CA 4WLVA 4DIFA 1R4NB 4S3MA 3KZVA 3DOCA 3DBHA 3GHYA 3W8DA 5L95A 4BNIA 2C2XA 3QQPA 4KDEA 2ZTVA 1E7SA 4YACA 4NMHA 5FI5A 3VZPA 3EZYA 4DTIA 3I23A 4RVGA 1DAOA 3TQHA 1ADBA 5CEEA 2WMDA 4WPGA 2B5VA 1EDOA 1NQ5A 4I8XA 3X2FA 2VHZA 1BSVA 1UXGA 4YJGA 1ZMOA 2J3IA 4YPOA 4PLWA 2VCYA 4IS2A 4FCCA 4K26A 4WCFC 3I52A 1D4FA 3WG9A 3K5PA 3GVHA 3INGA 4QXMA 3RU9A 4I1IA 2DKNA 3ZWCA 1DFHA 1CDOA 4DXHA 4F3YA 4LCEA 1KC3A 1P0FA 4NI5A 4BNNA 2GERA 1NHGA 3ZHXA 3AY7A 4XD2A 4AJIA 4G65A 4BO1A 4BQRA 3LT4A 1PR9A 2JFFA 3C3XA 1YE3A 1NVGA 4BNUA 3O9ZA 4TRRA 3I83A 1OMOA 3ZWBA 3FRJA 4AJEA 4IIUA 3IOYA 4WLNA 3F46A 4BGUA 3FNFA 3WICA 1C1DB 3ZCXA 4YAJA 3U62A 2B83A 2Y1EA 3TSCA 3OJ0A 4MVJM 2OXIA 2X1HA 1GFSA 2WE7A 3KO8A 1LDNA 2P5YA 5JAIA 5F1PA 2BFPA 3O4RA 4O63O 1IYZA 1PGQA 4KQXA 1I33A 4NDNE 5ER6A 3HFSA 1PIWA 3A06A 5IDWA 2J3KA 1IE3A 1UDCA 3GVCA 3TDKA 5TT0A 1GTMA 4HP8A 1T2DA 3S2GA 4AJPA 3UHAA 1IUKA 4E6PA 1U8FO 1T2FA 1RYEA 3DL2A 3KLPX 3MJCA 3S2FA 3GF4A 3QV1A 5DULA 3VC7A 3WGHA 3Q6IA 1XSEA 3L4BC 4CMEC 4KDFA 3TZKA 2HKIA 3FSRA 1MUUA 1IY8A 3AUSA 2ZQZA 1T1RA 4QX6A 2ZB8A 4Q3DA 3GG2A 3RCBA 1HZJA 2DTDA 5LDHA 4ZA2A 5B1YA 1Y5RA 1JN0A 4BKUA 1ORRA 3EGOA 1CRWG 1HE2A 1BW9B 3ITDA 4E2ZA 4M55A 2P91A 2VTDA 1E7YA 2QX7A 2V6MA 3KLMX 4O59O 2BGKA 5C7LO 2FPPA 3KVOA 1S6YA 1T2EA 1KBZA 2ZYGA 1NM5A 4Q3EA 3ROQA 3GUYA 1WXDA 2C0CA 2HRZA 2OO5A 3JYOA 4FD3A 1NYTA 3AY3A 1EE9A 1Q0QA 2Y0DA 4TVOA 4DA9A 1DRVA 3DZGA 1MV8A 3OIDA 2BFAA 4PZDA 2DBZA 3DFUA 1UDAA 2W2KA 3NTRA 2GO1A 2O3QA 4XGKA 3KUXA 2JD2A 1H6CA 1P1RA 1B3BA 1S7CA 2D3TA 4ZRNA 5BT9A 1H94A 5T64A 2PTGA 1AE1A 3G49A 4ND4A 4D3DA 4JCOA 3WIDA 5DCWA 4LRTB 1HDYA 3WGYA 5C7IO 2NTVA 4MINA 1AGNA 1GQ2A 4FOOA 2P5UA 4N5LA 1MFPA 1SOVA 5CP8A 1TT5B 5IF3A 1T25A 4B4WA 1U2GA 3M2PA 2EG9A 3D4OA 1HE3A 2Z5LA 3TF5A 3DWFA 1O0SA 1EFKA 3AFNA 2JD0A 1JVBA 1W8DA 4EJ6A 2V65A 3V1YA 1D1SA 3AM5A 2DUWA 2FSSA 2FR0A 2JKVA 4MP6A 2E6UX 5EL0A 3BMQB 1L1FA 4CV1A 1O95A 3NDIA 4I9NA 2WD7B 1XIVA 1YVEI 3CINA 4P4NA 5H81A 3T7CA 4MVJG 1U5CA 3GAFA 3KYCA 3PYLA 3A4VA 3Q1LA 5IXYA 3LC1O 4NJOA 3GFGA 4Z9FA 1MXHA 3BYZA 5ADHA 3VAZA 3QWBA 5AYVA 4CMJA 1W73A 2A35A 5CEFA 2YDXA 4KQWA 4NFSA 5IDXA 4MDHA 2XPCA 1E7WA 1E0DA 2CVQA 2VRCD 2ZB4A 5H82A 4RORA 4WK6A 3RC2A 1LSJA 4U8GA 3H9QA 5CPBA 4BO6A 1Z73A 1EEHA 1UP7A 2I3AA 5IZ4A 1WMAA 4OM8A 2R00C 4B4OA 1KC1A 3HN7A 4HFJA 4UEOA 4BNKA 4DPLA 4AJ2A 1GU7A 3CIFA 5EN4A 2GLXA 2CMDA 3RUDA 2O48X 5IN5A 2NQ8A 1AN9A 3GDGA 2V7PA 1R15A 1LLCA 2WD8A 4JBGA 4U0JA 4E2XA 1QV7A 4DYDA 4XIYA 5TIIA 1K89A 2AG5A 4PLFA 2VQ3A 1XYGA 4DPMA 4OHUA 1PSDA 2YHUA 1K6JA 5B4UA 4GSLA 3VVCA 2OFPA 3NUGA 1NFRA 4P4LA 1KERA 4RF3A 3WGOA 2PZKA 1O8CA 3R3SA 3OP4A 4TWRA 4YJGB 4R54A 4B7XA 1UP4A 1U4SA 1Y8QA 1QXSA 3TWOA 4LW8A 4YXFA 1PGPA 2JJYA 1D1TA 4GX0A 3WB9A 3WYBA 5KTKA 1NWCA 4BO3A 3ZWYA 4MKZA 4XB2A 4DREA 1SAYA 3S8MA 1PS0A 1ZXBA 3GZ4A 3U5TA 3RFVA 3DXFA 4MO2A 2Y1DA 3GPIA 1A27A 2ZTUA 3ENNA 4JX8A 4ZHSA 1E3LA 3DZFA 3GGPA 1X14A 4LISA 2RHCA 2P4QA 1LQTA 2HU2A 1U1IA 1R4NA 4EJMA 3O03A 3WGZA 1SZJG 3JYNA 3SXPA 3WSVA 3RC9A 2HDHA 1RM0A 2GDZA 1MB4A 5BR7A 4UEKA 1EQ2A 1DLIA 4EI2A 1OBFO 1VPDA 2X22A 4GI2A 2IZ1A 2JCVA 4HBGA 4NBRA 4YA6A 4BNMA 2Q1TA 1VJTA 2AQKA 1A5ZA 3RROA 4AL4A 4D0SA 4MOWA 3BIOA 1YBAA 4CL3A 4UVDA 1I5RA 3RASA 5JSFA 3WYCA 1B7GO 3QRWA 2BELA 5F5LA 4EEZA 3DHYA 5IZCA 1N5DA 3SVTA 3DZJA 4GX1A 1BHSA 4O5OA 4DL9A 1XQ6A 3JD4A 4EZBA 3HQ4O 1EK5A 1VI2A 3DHNA 3A9WA 2NTJA 4Y9DA 3DZBA 4FFRA 2DT5A 1R6DA 1R0SA 4FBGA 2C59A 4YRBA 4WUVA 3H5AA 3GN2A 3ZWVA 1UUFA 3VZRA 3DR3A 3LSYA 3I4CA 5THKA 1VKOA 4FQ8A 1GPDG 1VL0A 2NNLD 2WDZA 1MFZA 5KWEA 1MC4A 4A03A 1Z82A 2C7GA 5COQA 1M6HA 1M6WA 2IYOA 2NU6A 3FBGA 3GFBA 3JQGB 1ZSVA 3M6IA 5K9ZA 1AXGA 2VYND 3KSZO 3ZWXA 1HDZA 3L4SO 3PXXA 3G17A 2Y99A 5G0WA 3L6OO 2ZYAA 1HT0A 3D3WB 3EW7A 1SEVA 3FR7A 4QQRA 3VTFA 3ZWNA 2HUNA 4RO0A 2Y1CA 2PLAA 2DTEA 3OEWA 4OAQA 5L9AA 2C2YA 2PKRA 2PWZA 2FZEA 3VTZA 5G0UA 1DIAA 4NFYA 2J3JA 3PPIA 2O50A 4IINA 2DFDA 5FFFA 3IAHA 5JMPA 4CPDA 3ZU4A 4RPHA 1T26A 3AI2A 4QFDA 2Q4EA 3S2IA 3PZRA 3NDRA 1IB6A 4FR5A 4D7AA 1M75A 1PJCA 1R0LA 3HB4X 3PTZA 1X0XA 1ZBQA 4R9RA 1DFGA 2AG8A 1O94A 5DN9A 3SJ7A 4B3IA 3R1IA 3JYPA 1ZW1A 1DHRA 3RWBA 1KEWA 4ZQFA 1HL3A 1HXHA 2G76A 3NJ4A 4U0KA 3HE3A 3ZWOA 1XU9A 3O38A 4IMPA 1X7DA 1R4MB 2ZCVA 4D45A 3OJEA 3TFOA 4MKRA 1NP3A 3C1OA 4WCFA 2FY8A 1E3WB 2QQ5A 3QY9A 2QRLA 3DO5A 5HWSA 1HKUA 2OMEA 5K0ZA 3ZNQA 1H9BA 1N9GA 5H83A 4B4VA 2O4CA 3IS3A 1QYWA 3ETDA 3H4VA 3PGJA 4BB6A 1DC3A 2QZZA 2Y1OA 2EV9A 3K73O 4HKTA 3PHIA 2ZTMA 2Y05A 4LSMA 4URFA 3UICA 4DIOA 4FC6A 1U4OA 3JD0A 3OIFA 5EPOA 5LC1A 4BKPA 2BKAA 4CM8A 2H63A 2JHFA 2W90A 3D3WA 4MIYA 5DT9A 2O3JA 2YFQA 4CLOB 1MGOA 3WNVA 2P2SA 4CM6A 5A3JA 3Q0EA 2FN7A 4WNIA 3U09A 4RPGA 2WWRA 5CG2A 2WYWA 3PHLA 4B4UA 5L4NA 4P38A 4I9UA 5JW6A 4YT2A 4IQGA 4YJHB 3GGOA 3ZV6A 4CR7A 2HJRA 3W1VA 4CM5A 3VHRA 1VSVA 1VM6A 3WTBA 4XQ9A 2O3TA 3N7UA 3VPFA 3BMOB 5B12A 1AHIA 2BD0A 3DOOA 5KKCA 4E4YA 2IE0A 1E92A 1UP6A 4CQLB 4Z0HO 3ONDA 4DVJA 1YB4A 2PKQO 2RCYA 3CMMA 2UAGA 5KJFA 3U3XA 2B69A 3CZRA 5L53A 5I8ZA 4IQ8A 3QWHA 1XQ1A 3VDQA 3I9OA 3WQSB 4JJIA 1P74A 2RH4A 4BKQA 3F4BA 4QFCA 3KTDA 5HA5A 3GDFA 3PJGA 1YDWA 4BHTA 3NT4A 1LRJA 1EK6A 4PRKA 3RI3A 4BMSA 3F5QA 5JCJD 3HDQA 5ICSA 2BI8A 4RL6A 2B4RO 4CMIB 8LDHA 1ULSA 1HETA 4IMRA 4PG7A 1BW9A 3NTQA 3LU1A 4J4HA 4TVBA 1MXFA 3PYMA 1O5IA 5G2OA 1W4ZA 4XIJA 5K6AA 1P3DA 3F4LA 4IGEA 2NU8A 5HRUA 2F00A 1PX0A 4H7PA 3LT1A 3RD5A 4X54A 1CQJA 1WMBA 2VWHA 3F47A 4W9NA 3S55A 4GWGA 3PI7A 2ZYDA 3DBLB 4J0FA 5EMHA 3S2EA 3GMDA 2F1KA 4CLHA 4ZQGA 4GL4A 2YQ5A 4W4TA 4BGVA 4YWJA 1ZCJA 4HFNA 3RU7A 4NFHA 3LC2O 4FGSA 2IZZA 3AOEC 3IUSA 2I66A 3IJRA 5HS6A 2H5LA 4GLLA 4XGNA 1ADGA 4FC7A 2UUPA 2WJPA 4TMFA 5LCXA 2PZJA 3NT2A 4DWVA 3QHAA 4CUZA 4LSWA 3L6DA 2JAHA 4CV2A 1C14A 3K31A 5ILOA 3JQEA 1F8GA 3U0BA 1R37A 3EDMA 4EITA 1R66A 3KRTA 5TX7A 3V2UA 3I9JA 4N54A 1DRUA 3OH8A 3MJSA 2O3SA 3I6QA 3PLNA 5A05A 4U7WA 1YXMA 4ZQEA 1EUCA 5A03A 5C3MA 4W82A 1DEHA 2G5CA 3RFXA 4OH1A 3TOZA 1JWAB 2X4GA 3VVBA 4CLEA 3VH3A 1N92A 1K2WA 4NK4A 3E5MA 4JGBA 3GRPA 4A26A 2HMUA 3FPLA 1W6UA 5F3RA 1K6IA 4UULA 1MLDA 1YGYA 3RVDA 3GY0A 4B7UA 4PN3A 4I5GA 4CLDA 4E3ZA 4IDEA 4FN4A 1YWGO 2X0NA 3GHHA 3CPSA 3PQDA 1Q0LA 2I65A 3RBZA 4Q9NA 4K28A 4RVDA 2GZ3A 1SPXA 2WYUA 3MOGA 1NASA 1QRRA 1SEPA 1BMDA 2NQTA 4QTZA 4BNTA 1RPNA 1EQUA 4N7RA 1NFFA 2QYTA 1GV0A 3ETGA 2VHYA 4YQZA 3OF2A 2CDCA 3L0DA 2IXBA 4YR9A 4CL8A 1QV6A 4BO5A 5T8KA 4WKGA 3IP1A 2YY7A 4N18A 5T57A 4GLOA 1MP0A 5EINA 5A9SB 1LSUA 3DBHB 4L0QA 4MVJF 1NBOA 3GEGA 3K96A 1P44A 4J2HA 1PGNA 2UUOA 2ZKLA 1U3VA 1HSOA 2JCYA 3BTUA 4Q3NA 2G0TA 2GN6A 1WP4A 1FDUA 2V6FA 1J5PA 1U9JA 3BMOA 1Y8QB 4XKJA 5BSFA 4ZN6A 3HDJA 1E6WA 2C7VA 1NNUA 5DBGA 1LTHR 3QVWA 1ONNA 1M66A 3KEOA 3DTYA 4OOEA 1KEUA 5THQA 4D0RA 3B1JA 3PJFA 2P9GA 4JQCA 3EHEA 3ZWMA 4ZGWA 3VDRA 4DGSA 3P2OA 5JS6A 1PJLA 3QP9A 1EUDA 4N5MA 1XEAA 2UYYA 3C8MA 4OSPA 4B3HA 4BNGA 3KYCB 3PHHA 2RH8A 2EP7A 3HJAA 3ZU2A 2ZQYA 3JQ9C 3ZNNA 5IFLA 2FR1A 1PL6A 4DBVO 3D5QA 4IDDA 4W99A 1YQDA 1E7QA 4GWKA 3MTGA 1KS9A 1T24A 2JFGA 2X0IA 1F0YA 1X13A 4A27A 3FTPA 1SBYA 4WEQA 2C29D 3OJOA 2NVWA 2C5AA 3OBBA 1Y1PA 3TN7A 1I0ZA 2RAFA 3PQFA 1PJ4A 4I9HA 5KIAA 1JTVA 1BVUA 3SJUA 4RGBA 3QA9A 1JLLA 2QG4A 4FSHA 1XR3A 1IHXA 2BHLA 2W2LA 4BO8A 1P1JA 3GVPA 1DFIA 1X1TA 2G17A 5U4QA 4CQMA 3GEDA 2BGMA 2PZMA 3CMCO 1QYDA 3OEYA 5ENDA 5T6BA 3BTSA 1Q7GA 1DAPA 2AQHA 5JDIA 1B16A 5LDGA 2IRWA 2ZATA 3K92A 1EDZA 3BMQA 3B70A 4ND2A 5JE8A 3GVIA 3EVNA 2FMUA 2CZCA 5IDYA 2Q3EA 2CSUA 4CM4B 1A71A 2GPTA 3WNQA 1IZ9A 3NX4A 2I6TA 1NQOA 3FNEA 4J91A 4CR8A 2DBQA 3UAGA 1WVGA 2WD7A 1SC6A 3EYWA 3BZUA 1T4DA 4PIVA 1OOEA 3DAGA 2HK9A 2EWMA 3ZWWA 3OMLA 3ROKA 1YL5A 5AQ1A 2EKQA 1ARZA 3KHUA 4AICA 1IPEA 2FSVA 4TZTA 4UUMA 2GD1O 4BO9A 3AI3A 4IY1A 3M1LA 4XYEA 2GRAA 4E33A 1I8TA 4KUHA 1SMKA 5BQFA 1TEHA 4XR9A 4ZQHA 1VC2A 5CAEA 3A14A 2CFCA 4TQGA 3AK4A 1KYQA 4XQEA 5JPIA 2SCUA 4BGIA 4PFJA 4ROSA 2WE8A 3IQDB 4NG5A 4DMLA 3RUAA 5L51A 2BLLA 5B4TA 4LGVA 4KTVE 4YCAA 4EUFA 4HWKA 1YL7A 1PZEA 1ZKMA 1WDMA 3WSWA 4DBZA 4Z0TA 3VKVA 1ZK1A 3WJ7A 1OC2A 4Z0PA 3FCOA 3MEQA 5A9RA 5ILGA 1GUZA 2IEBA 4L74A 1U3TA 3NT5A 3B1FA 2CF5A 4QO8A 4XYLA 2NTNA 2NVBA 3UW3A 2H6EA 4OL9A 4R16A 1ML3A 4FB5A 4Y6RA 3OETA 3L9XA 4MVJD 1PQPA 3AOEA 5A5FA 3ZNOA 5IJZA 1B15A 4YDRA 4KMSA 1I3LA 1ID1A 3DB2A 1CYDA 3K2BA 5EQDA 2DQ4A 4H15A 4W7IA 1CJCA 4MKXA 3C7DB 3GEMA 3JQFC 1A4UA 4ZRMA 4DMMA 1DRWA 4W9NC 4IDFA 1PZFA 2NACA 3WFIA 3I3OA 3FD8A 4NQZA 1PQWA 2YYYA 3GMSA 3K9QO 3QVTA 4IGFA 3JTMA 4YAEA 3VPHA 3OSUA 2VT2A 3HDYA 4J1SA 5I7EA 4BMVA 2J5RA 1ONOA 2OGUA 1ISGA 3UKOA 3WBBA 4LMPA 1XA0A 4R68A 1Q1NA 4CLRA 5KCZA 2ZK7A 3ZV3A 1UZMA 3JQ9A 4BS9A 1KVSA 1I30A 3PQEA 4GVLA 3PFWO 1F8FA 3U4DA 1PQUA 4R3NA 2O2SA 3VZQA 2X9GA 1BG6A 3GNQA 5FF9A 5A06A 1WLYA 1V8BA 4GMGA 4IPTA 1BVRA 1GUYA 3H9GA 2YW9A 4IJVA 1JKJA 1U3UA 1GYRA 4E21A 1RWBA 4OYRA 3NTOA 3JQAB 4GMFA 1I2CA 4WASA 2H1SA 2E82A 3VOSA 4HFRA 1HLPA 3MTJA 3BMCB 3SX2A 4NH4A 1U28A 2DPGA 5JC1A 4CM9A 3ZN2A 5KOIA 3H2ZA 1E7RA 5G0VA 5G0SA 2X5JO 1WZIA 1N8KA 4L76A 3MWEB 3LK7A 5JLAA 2GZ1A 1EBUA 5CG1A 1ADFA 3ENKA 3OQ6A 4R01A 3W4IA 3JQ7A 1QORA 1VSUA 2EKLA 3QWFA 2D59A 4HADA 1J6UA 1E6EA 4EYEA 1ISIA 1EVJA 3U4IA 2AXQA 3DZIA 2HMWA 3E9QA 2HMSA 3D4PA 5TC4A 1QMGA 1FDSA 1KEVA 3BMNB 3F3SA 3OM9A 1A9YA 3EZLA 3RFTA 1QR6A 3EVTA 2I5PO 4GBJA 4BB5A 2AHRA 1CIVA 4OKIA 2D5AA 3NRCA 1E1NA 4Q3BA 4YEDA 2UV8A 4M8SA 3IJPA 2CF6A 3LQFA 4CLRB 3F5SA 3TZQA 1CF2O 1B8VA 1GD1O 3U4HA 1JU9A 1ZJZA 3INRA 1LDMA 3AUAA 4MJLA 1D7OA 2GGSA 1EMDA 3OJFA 2YJZA 3HSKA 5IG2A 1DIGA 4GH5A 4RF5A 5TQVA 4YQYA 3JCZA 5HBRA 3OQBA 4GAEA 1SNYA 2OZPA 5A04A 1XKQA 4D41A 3I9LA 4TSKA 3AW9A 3CUKA 1VLLA 4IQ0A 8ADHA 5T67A 2NLOA 1OI7A 5ENVA 2HSDA 2Z1MA 2D2IA 2VHWA 3JQ6A 2JCXA 3NDJA 4RPKA 1KVQA 2OP0A 4WEOA 3H9EO 1FDWA 3V2GA 4PLHA 3HUDA 1ZEJA 3PRJA 4IBOA 4RVUA 5COBA 2JAPA 3INTA 4K6CA 1DB3A 2EW2A 2Q45A 2EEZA 3ON5A 4BO2A 1A72A 1Y5MA 1N9GB 2ZTLA 4CQLA 1BWSA 4A73A 1HYEA 4Z3DA 5GZ6A 2Q46A 1C0PA 1Y7TA 3VH2A 3UCEA 4S1VA 2PGDA 1HYGA 4YB8A 5U9CA 3QVOA 5IAAA 1XELA 1X0VA 4KOAA 3RQSA 7ADHA 1YOVB 3G1TA 1D3AA 3EK2A 4R1SA 4O0LA 2BGLA 4JROA 1MG5A 1R0KA 1TVEA 2FPIA 2VRCA 5F1KA 2Y1FA 1VJ0A 4UVEA 4BKOA 2HLPA 4B3JA 2YV2A 4JN6B 4ILKA 4Q39A 3PDUA 4K6FA 4MIEA 4J6FA 3H65A 2C82A 4QECA 3WFJA 1NR7A 1PEDA 1PZHA 3VH4A 4ALIA 5IZCC 1YKFA 2OUIA 3WTCA 1DDOA 1LNQA 1E5QA 5IDQA 1VRWA 3JV7A 3PHGA 4TRNA 2X0RA 4CMHA 1U5AA 3FN4A 3I9MA 4XYGA 2VYVD 2Z1NA 5CDYA 3W6UA 4KP7A 3ANLA 4FFLA 3ZZNA 2P4HX 1LX6A 4PLCA 3WMWA 3GAZA 1WW8A 4IJWA 1I01A 1FDVA 1ZMTA 3ZW8A 1LSOA 1JA9A 4R1TA 2FHSA 1LXCA 4FPXA 4E32A 1Y8RB 2PZLA 5C5IA 1PTJA 1ONPA 2UDPA 4GGOA 4CJXA 3QW2A 3OHSX 4ALLA 2ZCUA 3DBVO 4JXKA 4A10A 4YT8A 4D79A 5L7TA 4GVXA 2CNBA 3NV9A 3RBVA 1V0JA 2X86A 2AW5A 1M76A 3DTTA 5DOVA 1HE5A 3D64A 2PNFA 4WCFB 4PZEA 4YJFB 2D1YA 4CM1A 4CMKA 3LF2A 4PLGA 3ETEA 4AJHA 3GLQA 5A4DA 2X8LA 3MJ4A 3FF4A 1ZIDA 2VUTA 4RZIA 1V3TA 1P1KA 2W4QA 3JSAA 4NZ9A 2DUUA 2E49A 4UUNA 3WGIA 3GZNB 2W8ZA 3RJ9A 5ITWA 3E9NA 5JAQA 2A94A 1LDBA 2Q49A 3UUWA 2NADA 4TROA 2X9NA 1X7GA 1UAGA 2ET6A 4DUPA
chains in the Genus database with same CATH superfamily
3CR8A 1Z28A 2X8BA 3CB4A 1VFNA 5C37A 2WUDA 1TLLA 1XT6A 2YC4C 4RQTA 2HF9A 5DK6A 4KW7A 1PJ3A 1HDRA 1NUQA 3ORFA 4I81A 2X5XA 3ZGOA 3GLIA 3GYBA 1K88A 3BF8A 2C5BA 3BE5A 1D4AA 1UK6A 3OT1B 2FWPA 3K09A 4K9DA 2D4AA 1CR2A 2JA1A 4EB6B 3OCWA 4QSMA 4MDEA 4ZDJA 4LXHA 1Z4JA 4RK0A 4NJMB 2XX3A 1DQZA 4LNUB 3EMKA 1LPSA 1C4XA 1WTCA 3T0FA 5FBVB 3L1KA 1GGEA 1HOTA 3NYWA 1GG2A 3RT7A 3VR2A 3A6PC 4II3A 1PHRA 1T0HB 1KU0A 3VTAA 2ONYA 2C7RA 1CRPA 2WLSA 3GLTA 3TKLA 4FXPA 3SQXA 4OD0A 4H77A 2QT1A 3BWVA 4WESB 1NSYA 2BHRA 2XWQA 1XEWY 1A9QA 1JDTA 1QF9A 3FGPA 3H04A 4Q3CA 1JNYA 1XN4A 4UZFA 3W06A 5KTOA 2HK8A 3D4BA 1E2HA 1GGFA 2I1LA 3WBFA 1JPJA 4KV7A 1C2TA 4YFVA 1JEYB 1X1DA 4FGUA 1Z62A 3LY5A 1X1RA 2WVJA 2FMHA 1YVPA 1IXZA 3R6TA 4RFVA 5L7WA 5HP4A 5JASA 3SDSA 3EZXA 3LPNA 3TQRA 2R8RA 5LQUA 5IBPA 1YL6A 1ZK4A 5B2ZA 1JR6A 5BSEA 2CCJA 1G17A 1NR1A 1ZLYA 2F3SA 1PAUA 3K5IA 3LQ1A 2AI1A 3GUCA 1BDMA 4KE7A 4RM3A 1JR3A 4X20B 1UOPA 4CRWB 1AS2A 1QHSA 1RYNA 1UMDA 3WRXA 1DIHA 3NHPA 4XX0B 4MYSA 3AM1A 1LJLA 1TM4E 4ACAA 4ENTA 4BUZA 4EHDA 5G4LA 2EIHA 4L57A 2LXNA 2X1LA 3NTLA 4R2MA 1WZEA 1YO6A 1L4LA 4KVAA 4YAIA 1U65A 1QYXA 4RE6A 1WL8A 5D85A 4BNJA 2DY0A 2VOJA 1OZ0A 2YXBA 2G77B 2ZRGA 4OQMA 1XMQB 1YCGA 3QKRB 4U6SA 4ARZB 2UVQA 2ZIXA 3KTOA 1JL3A 1UODA 1ZJJA 4X1YB 3UJ8A 4BTVA 2PUJA 3FCSB 4NYJR 2Q5CA 5GONB 1JFTA 2C3MA 4CCYB 1RJEA 2AG1A 1RKXA 4G97A 4JOSA 4F6LA 5EUMA 1QV9A 4UMDA 3RIEA 3T15A 1IY2A 1GNRA 1WX1A 1ZAYA 3DTNA 4P8RA 1PFKA 2BEUB 5JMWA 1W46A 1JAIA 1YRHA 1UT6A 1YR3A 3O8QB 5K3BA 5GZ1A 1USUA 3ACCA 3HVKA 2AEMA 4X44A 3IX7A 5TNXA 4CLXA 1E3JA 4B48A 1NHWA 3G8CA 4LXTA 3GRYA 4WZAB 3BEDA 3QV2A 4QULA 1BO6A 4RQBA 2DFNA 2F17A 4KN5A 4I3HA 1XAGA 1CY4A 1F9AA 4FMCB 4HYEA 2XMCA 3G8BA 4II7A 4QJIA 4AY4A 3KUUA 4E30A 3PQ8A 1VGVA 4EHLA 4LHXA 3RTBA 4TL9A 5ANRB 2R6FA 5G4KB 3WYAA 5NLLA 3WQBA 2EX1A 1PGOA 1UJ2A 3BORA 1R10A 3I2KA 3ISJA 3T5TA 1LA2A 4QGBA 4MYUA 1FIUA 1GV1A 3EG9B 1G20A 3NNDA 2BEKA 1CQWA 2FMTA 5KI6A 3T5AA 2B94A 1FC0A 2OENG 3FGZA 3K6JA 3S2ZA 3HS3A 3GPLA 3TTVA 2IVZA 2JGMA 4OY3A 1KVUA 1AMOA 3QEMB 5GV8A 3C8DA 2UXBB 3KD2A 2XVZA 4QJ3A 1M5UA 5EIAA 1QGUB 5C1IA 4N5IX 3K2IA 2GLUA 2JI9A 3WLQA 1OV4A 1T4MA 2YV1A 5DV9A 3HY6A 2A9QA 5K0JA 5CH3A 4JR1A 4JNKA 1E94E 3AJAA 2EL9A 3D6HA 4NQRA 3IBSA 4IIFA 1W49A 1JDVA 3HH8A 2YQZA 1BE6A 3K0EA 3DQQA 2GILA 2KW5A 4CM8B 4EBFA 3R3JA 1R4ZA 5F3DA 3VNSA 4CIVA 2PEYA 4PZCA 4TV9F 1KH2A 4F46A 1T2VA 4OOFA 4P4UA 4TRJA 3GQBA 5GZ3A 2G07A 4CIBA 4UFPA 5L45A 1GSOA 3SLGA 1HDXA 3GZJA 4IM7A 4CV0A 1LLDA 4HUTA 1RM5A 3W6OA 1EIZA 3U7GA 4GKAA 4A8JB 1XZQA 3IEIA 1QHNA 4GUDA 1ZRHA 2PT5A 4A6PA 4IUDS 2JGNA 1CERA 1N2JA 1X7WB 2ISCA 2JLBA 4OHCA 1SG0A 1DHTA 1R8SA 2QYOA 1RZ3A 5H9WA 5E9WA 1RAHA 4OYLA 5IANA 1ZX1A 1GZVA 4JKIA 4LZAA 4NULA 5IKPA 4Q18A 2AT1A 3RK0A 1CQXA 2WW8A 4F12A 1UJCA 2QNRA 4U9UA 2R8PA 1YDFA 2Y0EA 1JIXA 3DNPA 4TYQA 3MWEA 3QOWA 5DMXA 5F64A 4KWCA 1TMOA 2LCIA 3H5NA 4MGIR 1XZGA 3NEPX 2VUSA 5CNIA 3X1MA 1GL3A 1JSCA 3LLVA 1Q1GA 2R86A 4TV8F 3AVVA 1Z9BA 3T35A 3LO8A 4O2BF 2XQJA 3TX6A 3HKEA 1ACMA 1KAGA 2XJ9A 4H7FA 4KQ2A 1HWYA 4ZHQB 2FEXA 3HCEA 1KO5A 3DMTA 2Z3VA 4U7GA 2ZRDA 2QTFA 4FEAA 4HZUA 2I76A 4R2XA 3R6DA 4ZO6A 2C7QA 4LDJA 4CIAA 3K9LA 2EL7A 3AU8A 4XJSA 3HKDA 2YZ7A 4TKVB 4A8PA 4YQFA 4JI8B 1DC6A 2GNPA 4N4AA 3IEMA 3DS8A 5ARCA 3QTLA 3VR0A 2CXSA 5K0LA 2V55B 3RIXA 4MJ3A 4EKEA 4RD6A 2FH5B 2AZTA 1GYQA 2Y9PB 3A1TA 2C96A 4LI3X 1O6GA 2PMWB 3O2SB 1DBQA 4ND1A 4YNBA 2WF7A 4DSTA 1DQSA 4BIIA 4PCAA 3B9BA 2G8NA 1EWKA 2JJMA 4EM6A 1N6NA 1NAHA 1G9TA 2IUUA 5DIFA 4IKEA 2B4AA 1D5CA 1E0SA 1GA4A 1H93A 4QWMA 2OQIA 4RK5A 3USES 1M0WA 1PS8A 1VJ1A 1I4OA 2QXUA 4AJ4A 1MZPA 1JFLA 1V8ZA 1T3GA 1KY5A 4IFEA 3UGTA 1GKKA 4MUNA 4BKMA 2PSHA 3FWYA 3KX2A 1N0IA 5ERXA 5B1HA 2J8ZA 3AI7A 3AP2A 4OIMA 3NGXA 3ZW7A 3OIYA 4YBZA 4UM9D 3B13B 1FNCA 4MP8A 2R44A 4QAJA 2JB9A 4LTNA 4UOQA 1W4RA 3WGHA 2VYNA 3WLMA 4CEIB 5CB0A 4HB2A 1FP4A 1G6KA 4NSNA 4IJMA 5CDHA 1NQVA 2XITA 3MJEA 4I9FA 3QKTA 3PYXA 5DWVA 5ED0A 3ZTWA 3A1UA 3OIVA 3PQ3A 3KJEA 4QTTB 2B37A 1U7TA 2V7QD 2CY0A 1NSFA 3FRIA 4LMRA 3VYWA 4QICA 1P19A 1P2GA 2C1XA 2CJYA 1GFIA 1HDIA 2AE1A 3MRSA 2C8LA 5F9MA 4KSYA 1N77A 1F20A 4F60A 2FN8A 2I3BA 4BFLA 2F55A 2Q5FA 1UBTS 2JH9A 1H8EA 2Y0CA 3V4SA 3BWEA 1NI4A 5BWLA 1Y9JA 4GZ5A 4TLBA 3SNKA 4ES6A 1QGDA 5L7YA 4X41A 4WZAA 3VYRB 4D3ZA 2EFEB 2DXIA 2A0UA 1P62B 2QN9A 1XD9A 1Z13A 3RYIB 1CR6A 2PFGA 4TKVA 4DN6A 4KFSA 1JJVA 1FFAA 5FJJA 4WXHA 2P68A 1YR7A 1SZCA 3LL7A 1R6AA 2VHQA 3CA8A 2GOYA 1NQAO 1SVLA 3MS7A 2I4OA 3CX7A 5EQTA 1I51A 4YMWA 2PWPA 4ZTBA 3IEVA 3UV6A 5J23A 4CGZA 1KEPA 3O8NA 2I2AA 3JAMA 2Z4RA 2CE2X 2O0KA 3AVUA 3SR0A 4UATA 1MV5A 3B51X 4XD7D 1SQSA 2J48A 4RPLA 4XARA 5CLGA 3WIUA 1W0JA 4HFMA 3W7VA 4XQCA 1WMEA 1L4NA 1FFWA 3NHUA 1VLVA 3PR1A 1WPQA 1KP3A 3FCAA 4EF6A 1GNPA 1JILA 1TAQA 3EXHC 1T8TA 4L0MA 1OVGA 2DPYA 1E8NA 1ZSYA 2ZSBA 3ED5A 4C7XA 4F85A 1KI2A 4X45A 4QNNA 3UVEA 5HZKA 1K63A 4OHXA 3BWDD 4IZ6A 3G5TA 1BS2A 4PRYA 1N7JA 4XGRA 2D0PB 1VKZA 3UFBA 3OIUA 3PL5A 4TSRA 3ZW9A 4DJTA 1Z3IX 1ZWKA 4G36A 3COSA 3KHTA 4GZLA 1VL1A 3FOBA 2R1TB 4JYCA 2QXTA 1KNXA 4MR9B 3R7LA 2BDUA 2PR2A 3L7IA 3CNOA 3KTAA 4M36A 5ESRA 3UBMA 5DK4A 1SUAA 2DVMA 1NT4A 3TOVA 1WHSA 2HA3A 4FTWA 5L6LB 2O1SA 2B4YA 2GS9A 1SBQA 4KO2S 2WWFA 4OB8A 4TTIA 5DBHX 4BNXA 4E09A 3TL2A 4NMLA 2ODAA 3TJRA 3ASZA 1EWQA 3X1XA 1UC5B 2EFCB 1DXHA 2IX9A 3H13A 2WP0A 3PPVA 3M3HA 3PT9A 4LZLA 2RHTA 1CPYA 1XCMA 1QONA 3I37X 5LLSA 1VRVA 2J3HA 4MP3A 2HPAA 3IIEA 1N8TA 1OLUB 1ZPDA 4NJEA 5GVSA 1EZ1A 5KTTA 1ZN8A 4Z4IA 5DCUA 4YH1A 2RGNA 4D9IA 1USGA 5G40A 1ISJA 1T29A 3V1UA 3H2JA 4FX2A 3FZQA 2HI0A 4OP1A 1KMQA 1JKMA 5CR9A 1HQKA 4RCVA 1R0CA 4FJ2A 2ZR7A 2IXFA 4NU6A 3FYUC 4DCUA 3T3PB 3LUBA 2Q3BA 3FYCA 1YJXA 5FTNA 5AVWA 2ZZKA 5KVVA 1N2HA 4ZPJA 2FYTA 4MQEB 3PXAA 2FZ4A 2O7SA 1RT9A 4JC4A 4WIAA 2JI6A 3BHIA 4BTLA 2BMJA 4H7JA 4B85A 1NULA 4G5FA 4UOEA 2E21A 2C9ZA 3BXXA 2AR7A 1CT9A 3IPLA 1G5RA 2HA6A 3VFDA 4CF4A 3NHKA 3QKUA 3MWKA 3JW8A 4JP1A 2PS0A 3I09A 5JEEA 2ZOSA 1THMA 4L02A 4NY1A 5HJ5A 3D0RA 4B79A 3FOZA 4MV3A 5CVCA 3U40A 3CX6A 3LT0A 4C7OA 4JU8A 5F9FA 2IEDA 3O1LA 2DFVA 3T3MB 2C5EA 3LXRA 3L41A 3NU1A 2ZROA 3CX8A 1BEUB 3R3UA 3EH2A 4KDRA 3FPAA 3CEMA 4DHWA 1KI3A 4ZICA 5FOXA 3DVQX 4KLNA 1M5TA 1NMYA 3FPFA 4IDQA 3BQ9A 4AFNA 1Z56C 2FSIA 2WFLB 2IUYA 2IXGA 3OFSA 1FX0A 1SM4A 4CKCA 1WNFA 2PWBA 4MR9A 1J2JA 1L9KA 3BZWA 4TMXA 4V2UA 4L9WA 3U3KA 3MLEA 5CA1B 4AWXA 3TECE 2DT8A 3P5SA 1MC8A 1DEXA 3QXXA 1Z2OX 3AL0C 1OH8A 4QM6A 5KNBD 4HMOA 3IVCA 3B8EA 4CETA 2B1IA 2DWOA 4LBVA 4OI1A 2YZNA 4TN5A 1T1JA 2EG5A 4A0FA 1K6EA 2HJ9A 3H3JA 3H18A 4BUCA 3TI7A 9ATCA 4RVFA 1Y9EA 4BECA 2O05A 3VUEA 2R7AA 4FWTA 5AM4A 4ZI7B 5T8KC 3L1IA 1QYCA 4LC9A 3UWDA 2DRIA 2F9LA 3ELYA 4JK3A 4QL3A 3U61B 1H2YA 1Y8RA 1XLTC 4A1OA 2O5EA 2C9CA 3LDUA 1YBHA 4REQA 4HRXA 4C04A 4D9BA 4HQ6A 3WL6A 3T9AA 1KETA 1XZNA 2O5RA 2J9FB 3C7CB 2QLTA 2AQ8A 2P7IA 3NTXA 4LYDA 3CN7A 3EBOA 2WINI 3B9QA 3EIEA 1QYIA 4HWSA 5KSPA 3VZCA 2QTGA 3DBIA 4NDZA 2D5LA 1C0IA 3IT3A 3DFMA 3KT8A 4G1EB 5T4HA 3STVA 2CN1A 4EF5A 1RRCA 2ZIFA 4YRNA 1B14A 2AL7A 3OZIA 1V9CA 2GWHA 1KJ8A 3HCDA 2ZJAA 1N6KA 1IULA 1QRDA 1XKXA 1I4TD 2VHTA 1TKAA 3FMPB 4MEAA 3B7GA 4BQQA 4XCVA 3JASA 1UMKA 3ZGNA 4CEJB 4U2BA 2EJCA 2YWHA 3JD2A 1LS6A 1SD1A 1U2DA 3IHKA 4MVYA 2JPDA 4X20A 4F11A 3JATA 5AKKA 3RYHB 2V3CC 2R00A 1EINA 1HF3A 3R0IA 3G3EA 1P0CA 4TLDA 1ZVKA 4PG4A 3VU3A 4ZMSA 1G59A 5TGTA 3BXZA 1P77A 3EOBI 1V41E 3N28A 1AOXA 1UH5A 3VGJA 4EGAA 4UBMA 3PXBA 2OFXA 1MX3A 2GT1A 2AFVA 1QTRA 2RI1A 2W2PA 3BHMA 3WMXA 1FJXA 1XRLA 3N0WA 2QOEA 3I3SR 1NOJA 2GYYA 4YJHA 5EE9A 5B37A 2ZVQX 5B1DA 4YRDA 1TVCA 2OHGA 3MMPA 2E5LB 1SHKA 2CLSA 1E1KA 1A5SB 2QRNA 2QGFA 4RXMA 1CXZA 1Y80A 3DEYX 2GZDA 1WXGA 1ZOPA 1TADA 1B74A 4OXKA 3M4YA 4NBVA 1CUVA 5FBQB 4C2BA 3C5CA 4XOUA 4IS3A 1XL0A 5A6SB 3PFNA 1P1HA 3RUEA 2FEPA 3RWOA 2XMGA 5AK4A 1ZR4A 5E9QA 4OJTA 3EPJA 2IS6A 3JQ7B 1C9EA 2II6A 2CFTA 3KXIA 4IFIA 1ZGHA 4KR7A 1KOLA 3RS3A 3VXKA 5LYJF 1RM3A 2OM6A 1SKYB 2XYGA 5JFTA 4L85A 2GKOA 2JVJA 3RC1A 1XU4A 3S2UA 3PFCA 1Z15A 2ES4A 3BBPA 2UVDA 3O2JA 4BBJA 3DKVA 1I36A 2IU3A 4LHWA 1SVSA 4WZZA 1Y3FE 4JXXA 1J21A 2O7QA 1N2SA 3WS7A 3Q2IA 1L4UA 4LRSB 1TAGA 5AT1A 3R9IA 2VHCA 1Z63A 4KYTA 4NEHB 4OU5A 4FSXA 3DVLA 3IUQA 4KAAA 4NCNA 1O8BA 3N05A 3G8DA 4AJLA 3WGTA 3C5HA 2CNDA 1IBMB 2ZJ0A 1GXSB 4FDVA 1U8UA 4IIDA 3RH0A 1JR3D 1ECCA 3OCXA 2RSLA 3DEJA 4HRYA 4Y2JA 1SHJA 4KCGA 4KHZA 3U4CA 2UVPB 1C4OA 2VHJA 3PF8A 1PSZA 1DPGA 1ECBA 1TLTA 1JJBA 5HQJA 1KPIA 4HH4A 4N1AA 5JZOA 3BM5A 4NICA 3C3MA 3GRRA 3N2IA 5LB4A 1WR8A 4CMEA 1ISFA 1E3IA 1JMVA 2EFHB 2Y4OA 1ZO8A 3BJIC 4UNQA 5AKGA 2C9BA 3CEAA 3UC5A 1J22A 2GHQA 2JHAA 3GGGA 1PX2A 2APJA 4DR3B 4PX9A 3T38A 2QVGA 4MKGA 3IP5A 2IVFA 4K6OA 3WRYA 4E5DA 1GQOA 1N2XA 4OQEA 4C4RA 4YAGA 4FE7A 3PHJA 4ETIA 1FUKA 4XM0A 3K30A 2VBGA 1CY6A 4PFSA 1ZDMA 1ZK3A 1B8UA 1TTQB 2IHKA 4QEDA 2D54A 3B3FA 4Q1CA 1VA4A 3BDAA 5DGHA 2VDJA 3G8AA 3RS7A 2XB8A 5IABA 2XUDA 3EVCA 3D6FA 2BFMA 1GPKA 4GSKA 1N1EA 3KT0A 4JP3A 1Z2EA 4RK7A 4OFZA 2ZRKA 4XJTA 3WQRA 2XGSA 1JSZA 5C8VA 1JQJC 4ND3A 4PX2A 1XP8A 1A9RA 4FGKA 4M87A 2GMWA 3C5VA 1NXSA 3SBXA 1MF7A 4ALMA 5DHQA 3CE6A 2IOFA 1QGYA 3UJ9A 3WWEA 1ACLA 3INYA 1SCAA 1Q7BA 3L0BA 3QEJA 3RVBA 3GD7A 4HQRA 2P69A 4H35A 1BQ4A 3BKXA 3PLAE 3TIIA 4G0MA 3P1JA 1ND6A 3Q9NA 4YRSA 3PC6A 1ZNZA 3TZCA 2XUIA 5FOSA 1AK9A 3I53A 3L0IB 2V3WA 421PA 4Z9XA 2Q6TA 4LVCA 1EP3B 3OOYA 3T9FA 1XEXB 2WOJA 4O5AA 4O4JF 4DQUA 2BR3A 1GLGA 1J23A 4LX8A 1KKLA 4ESVA 1Y6ZA 4A82A 3W4KA 1ENOA 1G3QA 2W6ZA 3DDWA 1XTRA 3DC2A 3D6TB 1BU5A 1XZEA 2AYYA 3O82A 4N40A 4TMKA 1ZVVA 3QJ5A 1P3Y1 1Q95A 4DCJA 1G8AA 1XK7A 2AJBA 3UPUA 1PBNA 3KQYA 4RTLA 1NZFA 3RANA 4F4FA 1TCVA 3IHTA 1QTNA 4M89A 4MTLA 5TB5A 2AN4A 4J9VA 2XYRA 2X0JA 4KTTE 3QUTA 3NIWA 5BMVB 5K6AC 4PCLA 4FFMA 3TNJA 1ZU5A 2WJ3A 3BF7A 3ZV5A 3PF9A 4EJ2A 3FETA 3IAEA 1MAUA 3DHEA 5LQCA 4BO7A 3QMPA 16PKA 3P9RA 3HGMA 4JLBA 1P4RA 1QIMA 2YN4A 4K9PA 5AJYA 3L02A 3FMVA 4PHHA 4HNAB 1V1RA 4UXIA 3UAYA 3ANMA 2A4MA 3QBVA 4DQKA 1HSZA 2GA9A 3GARA 2ZRJA 2GZHA 2LCQA 3VJLA 4BCBA 3NH9A 5CX1B 3T7KA 1J0BA 1EUYA 5BW4A 3RVLA 4CCYA 2JJ1D 2C9OA 2GR9A 3SKYA 2R97A 3JQDA 2E1PA 1PDWA 2LDBA 1NWHA 1XDSA 1VLJA 3C97A 3HG7A 3G5UA 3JR7A 4FBLA 5CM8B 3ELBA 3ZOZA 3KKQA 4M49A 4DAEA 1R6TA 3I5AA 4LY0A 5ETJA 3UZUA 2I34A 1ABEA 1HKHA 1W2GA 3KQVA 4E12A 2Z6UA 2CUZA 4WOCA 5DOZA 3WWZA 2WV9A 4L72A 2OV2A 1I7QB 1F5NA 3KSAC 4BX8A 2DLCX 1NJFA 1PN3A 4RESA 3CRZA 3GDWA 3VKUA 4XWTA 5TSDA 2RHOA 1VG1A 2H52A 2HTFA 1U9ZA 3CLRC 3VQTA 4BRWA 1VYVA 1YONA 1OAAA 3T3EA 4DA0A 4HNSA 1UC8A 1N5MA 3MM4A 1QE3A 2O0JA 5T41A 3R74A 3SHFA 5AVYA 2IBSA 2ACKA 5J2TB 2R5NA 1IUPA 3Q5GA 3WLRA 4WLEA 2XH8A 3QXHA 4G5RA 2P62A 2FZCA 4P83A 3AF3A 2IHBA 5BNFA 3AEYA 2Z57A 4CMIA 1QGOA 3HBMA 3MBOA 4OI2A 4WNCA 3TCXB 1AO3A 1NUSA 2ZR9A 4BFZA 1U7WA 5AI5A 4CQMD 5BW6B 3TLJA 1TXGA 1D8TA 1U0EA 1XE3A 1XMPA 1K7SN 1P2SA 1SPBS 2MU1A 3EJWA 3ICPA 3A4MA 3VU9B 1N5LA 4N5NA 4E4RA 5BT8A 2BTEA 3JQAD 4D42A 4ZJPA 3BD7A 5H3CA 2FEAA 1HURA 1T3HA 1KYZA 4YDHB 4PVDA 5FI1B 1OV6A 4LE1A 4BZQA 5JCJA 3HN6A 2W6PA 1VP3A 3EY9A 1EUDB 4AF6A 1C3VA 4S2EA 2WAXA 3PIDA 4MULA 4RDCA 2JFYA 5F2KA 4ED9A 5AW2A 3IL2A 1NW7A 1P2TA 2ID9A 4RD1A 4GGPA 1JG4A 3RGWS 4EW2A 1DS6A 3HI6A 1U1EA 4KMOA 3TEFA 4M1SA 3MHTA 1CLUA 1KMMA 1D2GA 3AB3A 2V1XA 3K0CC 3DNMA 4CCWA 5DNVA 5ALEA 3CCBA 2ZPAA 3A28A 1PCXA 4JXJA 2P1ZA 4BAUA 3JXEA 1SUCA 4LWQA 1E3QA 2GN8A 3KIPA 3LECA 4Z99A 3OA0A 5IW8A 1CNMA 4YT4A 5JXHA 3KKPA 1YVDA 1XTPA 4Z7QB 5KYWA 3V4VB 1K6XA 1US8B 1PL7A 3UGKA 3IUMA 4D9MA 4HT3B 1V26A 1EB9A 2C2BA 4K81B 2IXDA 2JIBA 3DLPX 1EVYA 4B6SA 4U6QA 2BGTA 2CEKA 3DBRB 4HN4B 4I4TA 5HRCA 3ITNA 4ZGGA 3ILVA 1TZ2A 4YC7A 3KXDA 2I99A 3M1AA 1DSSG 2E4UA 5H9VA 5DHTA 5T4EA 3ZWAA 1P18A 2D8AA 4EG1A 2YRWA 5AM2A 5AW0A 5TXGA 5HZGA 1D2CA 1YJQA 2PD3A 2YUIA 1HY3A 1VE6A 4PYOA 4UE2A 1TEZA 2FEMA 3D5EA 5TQ0A 3UFXA 3H5RA 2XXBA 4HQOA 3PWTA 4ZARA 3U3RA 4ABYA 5JNWA 2VJNA 3T3OA 2G40A 2EX0A 1QVZA 1P8AA 4JEMA 4W1RA 3SC4A 2LIPA 4IF6A 3UQZA 1ZCAA 2I67A 4OBBA 1V16A 1XDUA 1WEHA 1JG6A 2HV8A 1C30B 1N0UA 1I5EA 3ADOA 5JVDB 4WLOA 3LGAA 4A0RA 1D8AA 5K5EA 3C14C 5KSYA 4ATNA 3I01M 4PHCA 4RANA 5IS2A 3HCNA 3UA4A 4JP2A 4YAFA 1K1EA 2HGSA 1T2NA 1U94A 1VLHA 2HSWA 3D7LA 4YFYA 4JH0A 5HQ3A 4AQ7A 3NQ41 4GKVA 1YI1A 2ID8A 1JYSA 2B6NA 3RJ5A 4G81A 2P9FA 2XRMA 5JJLA 4J49A 1XCJA 2DH5A 4H08A 1U7PA 5KYYA 4C7BA 2WIKA 3NJ8A 4NBTA 2JFUA 2H9IA 1RCFA 1SKUA 3X2EA 3LYHA 4BFXA 1SUBA 1DADA 1SB9A 2H5EA 3MWJA 2IYLD 4IEFB 4NZOA 4UD6A 4B6GA 2GESA 4LXGA 1RIIA 3ZZ1A 1XCLA 3EEFA 1N6PA 3OLQA 5DBIA 4DJEC 3HXQA 2J9ZB 2WILA 2YMQA 1X7XA 4I1PA 1AF7A 1PTKA 3PX7A 1NQTA 3Q8XB 1Z25A 2X5OA 1Q74A 1YBVA 1P5FA 1TM3E 1P7WA 2B8TA 2JDID 4ZAGA 5CLJA 2D0OB 3C85A 2BPOA 3I1FA 1DIRA 4I1YA 1YZ3A 4L2IA 4ALJA 4GLFA 3IYLW 5TS3A 5C8DA 2VDMB 2QD5A 4KE9A 4P3NA 3RC3A 4GDFA 1KK3A 5JEDA 2XUZA 2YWGA 2R65A 4KLCA 3SDBA 1HZZA 2MJLA 4CTJA 1GCIA 2W2MA 4PLVA 4MRMA 3JZFA 3L7DA 5KVSA 4ZYVA 2E4AA 1EBBA 1SELA 1TF7A 3B8HA 3OEED 3EY4A 1AD2A 4Z3KA 2J6IA 4Y8VA 4RV9A 1B2LA 5IXJA 2R6AA 3C1TA 2OHIA 3PD1A 5CLHA 1RFLA 2YXEA 4Z8YA 5ILQA 1WB4A 4J0GA 3VSEA 5KQRA 3ZXXA 1D6MA 1ZICA 1WQ4A 4M8IA 621PA 4N8DA 1V4BA 5ALYA 1O5OA 2MINA 3TIFA 2V03A 2XNDD 3WBJA 1UAAA 1OIWA 4YRIA 1AKWA 1LRLA 2CXHA 2D4HA 3VPXA 1A8PA 3U2QA 1CJVC 1DIBA 4DLUA 4MRMB 4QPZA 4XSHA 3SC3A 3ZCVA 4CN9A 5DI9A 1TI7A 2VF4X 4YV0A 5KMGB 1DEKA 3ZK9A 4IOKA 4JOCA 2BEWB 3T8YA 2WABA 4JLJA 4OKNA 5F2EA 4BV9A 4KVFA 3ZZ0A 5BR4A 5GIOE 3UATA 4ZCSA 4KH1A 1ZHFA 5CM9C 3Q3CA 3I4FA 3WA6A 1FFBA 4NL4H 2VHEA 1C81A 4DGQA 4KZPA 4KGDA 5FA5A 4MWEA 2BVNA 3FVQA 3TRIA 4FEEA 1AY0A 4KN6A 3W5JA 1T13A 3L6BA 3FLAA 1P9NA 2ZSIA 3QNWA 3LLSA 3OQIB 1A4IA 2D06A 3RHZA 1VDMA 2GCPA 3RUHA 1BDBA 3A1NA 3QIAA 4JP8A 4GE3A 2OCBA 3WHPA 2QRVB 3OURA 4G8JA 2PEZA 1BA3A 1TCAA 2C00A 1E1LA 1CK4A 4HSGA 4I5IA 1EK2A 2RGXA 1J09A 1L8LA 3IURA 2ERCA 2ZBVA 1NBWB 3OHMA 4YROA 4DANA 4B7ZA 1K8QA 5IARA 5A3SA 3SQNA 3MUEA 2J4CA 3T7SA 1SCUA 1XXHB 5TEWA 2ISSD 4N7JA 4LN1A 1HEYA 2BI7A 2H48A 2B8WA 1ZMXA 1L5MA 2ZWOA 2IXTA 2LTAA 1ZW6A 2OBYA 3GJSA 1F6WA 3HCWA 3N6XA 3NGLA 3DE7X 3O4HA 5BSWA 4ZDIA 4X1KB 1RJGA 2X0EA 4ZCMA 1E3EA 4TRMA 2OP1A 5E8JA 3CJRA 4A0GA 3HKEB 5K01A 2G25A 5LZ8A 3FR8A 4IJKA 5IK2D 1GDHA 5JVDA 2H5IA 5MN6A 4MRPA 3QNMA 1SOMA 3MGAA 2G4LA 4N6GA 4Y2PA 1EGAA 3C3WA 4MHSA 4Q37A 1MU0A 1ZOIA 3M6VA 1XNGA 2B36A 1XAHA 4A9AA 4AP5A 3ISVA 4UMEA 5BNZA 5JR3A 5T6MA 4FKZA 1KS2A 3GEIA 1L5WA 2AFIA 1IL0A 3NNNA 4J3FA 1YRYE 3JQBA 3NEJA 3PUVA 3L77A 4G84A 5BSMA 1P33A 1G291 1AS3A 2IELA 4DM7A 1Z26A 4EY5A 2VWPA 4R98A 1AGXA 1KSHA 2EJTA 1MB9A 2IYQA 2QL7A 3N75A 5FKJA 2PAFA 4E5KA 2HHHB 3DHWC 1GGKA 2ZBUA 3IAS1 4MGHA 2V9PA 5DBFA 4FEYA 1KY3A 5JY6A 1RE0A 3QHQA 1D09A 2IUFA 2NSDA 4P36A 3PIIA 1YB5A 2ZIWB 4KREA 2XCUA 5C31A 1FPQA 2W6JD 5D3MA 1KGSA 2BRUA 2IYWA 3GFPA 4V0NA 3R8FA 1POXA 1ZM7A 4MAFA 1WB5A 2K2QB 1H2HA 3EAGA 4D9EA 1Y5IA 3DWGA 4FEGA 1XN1A 2ERXA 3D3JA 3OTIA 1HRDA 4DILA 4CEJA 4BNZA 2BMWA 2XTAA 1Z0AA 2OCPA 5KC8A 2Q2WA 1XDWA 4I8DA 1QIGA 3E61A 3D0QA 3HCFA 2NZUG 1A7KA 2IDZA 4KUGA 5ICEA 3MJTA 3GEPA 1QHGA 1V3VA 5JOQA 2PJRA 4UU1A 4NC9A 1RMYA 5KTRA 2JG3A 3PJDA 3TKYA 2OGTA 4R5HA 2ZFUA 5CJPA 3A1VA 1TMYA 4D4KA 2QZ9A 3ZGVA 5CCXA 4PTLA 3IDSA 2WM3A 2G82A 5KTSA 1AKNA 1RC1A 2DWQA 2O2YA 3FDJA 3SJAA 4AJJA 2JA2A 4NYMQ 2HJSA 1LZLA 4FJ0A 1A98A 2RHBA 3L4EA 1DX4A 3IB6A 4KR2A 4J7CA 2ZRNA 3U4QA 2QTBA 4DIFA 1CW2B 3HWWA 1Q7TA 1AQNA 2UZ4A 4LDNA 3EUFA 2YN2A 4S3MA 1U63A 4CL0A 3FI0A 1JPNA 1SXJA 3QQPA 4L8GA 1E79D 4IILA 3TSAA 3AH8A 4YACA 2JBAA 1V96A 3D8NA 4X64B 3EWNA 5JZVA 5DRTA 1WHTB 2ORVA 3N2LA 3NB0A 1JE0A 5D3KA 1E9RA 4MJXA 1DAOA 3T54A 1FS5A 4RVCA 3TQHA 1NW5A 3KVRA 3DPIA 5HPYB 4WADA 5BRAA 2B5VA 1NQ5A 3PRHA 2JLXA 3DFIA 5LP1A 1JTEA 2C4MA 3CLSD 3X2FA 1V8DA 2Q3JA 3L6CA 5DYTA 1JYFA 4DA7A 1WOMA 3CTPA 3O1JC 3A70A 3LYAA 3UGQA 1ZMOA 4EJSC 2M6KA 4YPOA 1JFRA 2GPAA 5P8WA 3IUJA 3WGJA 3NPAA 2I2FA 4AKTA 3W5CA 2JJ2D 3BCHA 4W8GA 4MSUA 5MFZA 1DDIA 1SC1A 5E6RA 1U0BB 2XUJA 2NV2B 3GVHA 2FW9A 2OVBA 2QT0A 3B53X 3HCCA 3PKIA 4Q00A 5HF5A 3RU9A 2DKNA 3W7AA 4FCWA 1ZVJA 3TB4A 3IHLA 5GJBA 821PA 4EGQA 2YMMA 4DJDC 2CZGA 1JLRA 4AMGA 4AN0A 1WMDA 2Q27A 3LT4A 1PR9A 3C3XA 5H7XA 2PQMA 4KQJA 1I6KA 1NVGA 2B9EA 3EF0A 3LFUA 1J1IA 2E5FA 3E3NA 4QWWA 5HKBA 2GCOA 4IKOA 3I83A 1AXRA 2GFHA 3WWPA 1ATZA 1V5GA 1Y4AE 3IOYA 4IIUA 3FNFA 5AK6A 3VPBA 1S8NA 1FX0B 4YAJA 3WICA 2XGJA 3RVQA 2WFLA 2IU0A 4BPRA 2QTRA 5JD4A 2QV7A 2Z2JA 3OJ0A 4P3KA 1KAQA 4Z49A 1YJ5A 1UKVY 4OK3A 1LVUA 1GFSA 2WE7A 1W36D 5JAIA 5F1PA 5KHOC 4O63O 1YFZA 1IYZA 3P2EA 4H9GA 1JXAA 1I33A 1QWOA 4ND6A 4RMJA 5SZKB 1PQYA 5ER6A 4DCTA 2IOQA 1OXKB 3LNCA 1YB6A 5IDWA 1MB3A 1KPGA 3B85A 1AV6A 4HDSA 3A27A 3EZ6A 2HIGA 3TDKA 4CF5A 5TT0A 2PGNA 3AR7A 4HP8A 4OB6A 1L4KA 5BR8B 2PMCA 1J8YF 4FZ5A 3T94A 4AJPA 5JVDF 3RS8A 4DV3B 1DT3A 3CLKA 1XTIA 3OQJA 1Z5OA 2RGEA 1U8FO 2ZJZA 1T2FA 1LWOA 1Z68A 2VKQA 3AINA 3MXOA 3GF4A 3CZCA 1S01A 3N2YA 4PFKA 3NIGB 3ZJ4A 4J16C 3L4BC 4LZZA 3OPMA 1LW6E 4KI7A 4UPDA 5FPKA 4DARA 2YJGA 4RY9A 3FSRA 4AF7A 4NJEB 4CCAA 2UZ1A 3AUSA 1AVTA 5ITSA 5KYXB 1AHNA 3I05A 4HMQA 2DTDA 1MHPA 5A7HA 4ZA2A 2FMXA 2WICA 2QUHA 1GQFA 2Z8ZA 1T6YA 1U3GA 3FDZB 4O4LF 5GONF 5KAPA 5B1YA 3UXEA 4U02A 1HE2A 2AFHB 4EP1A 1XQVA 4NFLA 2B7CA 2LGJA 3PDIB 2EYQA 3EQ8A 5D3MB 4L22A 3TLMA 1O4WA 4S0XA 1KP9A 4MQ4A 3KVOA 2ZYGA 1Y1LA 1KBZA 4C4ZA 5ELXA 3FKJA 4JVOA 4CT5A 1EHYA 1WXDA 5C51B 2HRZA 1Z83A 3GDHA 1E8MA 1NX9A 1HI9A 4DA9A 4BU1A 4J3JA 1DRVA 1YQQA 1MV8A 2DUNA 3R7BA 1P0PA 3VM6A 3RSOA 1R27A 2FUCA 2BFAA 4PZDA 2DBZA 1E2QA 1JU3A 3DFUA 1X80A 1ESDA 2GO1A 2O3QA 1NIJA 3L0PA 1M1XB 3NTRA 4TTQA 5DTEA 4DYHA 1OYVA 4DABA 4P6VF 3DMHA 3O83A 2D3TA 4WRRA 3P9XA 5BT9A 2O8BA 4KYIB 1UPFA 3LOQA 4DZZA 1AE1A 2WHYA 3G49A 5FOTA 2P4SA 4DLTA 2PVSA 1WD5A 1KZ9A 5C81A 3B7WA 4NAVA 1KFBB 3JVIA 3PE6A 3IT1A 3ZUPA 1NF3A 1HDYA 3AEQB 2BFFA 2CK3A 2XT9A 3UAVA 3DDOA 3U48A 3ZZMA 1AGNA 2P5UA 3EFEA 4MARA 4R83A 1P5HA 4N5LA 3AR4A 2RG7A 4O2BB 1SOVA 4OJKA 5MN4A 9ABPA 1MJ5A 2X8AA 4B4WA 2LUOA 3M2PA 3D4OA 1QIKA 1HE3A 4MW6A 5LKRA 3TF5A 2AH5A 2JFQA 1W4BA 3VR2D 3QX3A 3RYCB 4A3SA 1YTUA 2GRUA 2GQ0A 4QPNA 2JKVA 3QFSA 2FR0A 3FNRA 2XT6A 4C06A 3NDIA 4LZJA 4EHIA 1KR5A 5THXA 3MINB 1HT1E 5JHHB 5BWNA 5KDOA 1XZHA 1U5CA 3J7AC 4IUBS 1I0LA 3PYLA 4F3TA 3BK1A 2ZSHA 4FYPA 3AEKB 1VKRA 5CM2Z 1KU6A 2BGRA 4CNQA 5IWAB 3LDFA 2VRWA 2YIDA 2OHOA 3A32A 3K0HA 5AHKA 4Z9FA 1KMHB 1G16A 4QVKA 2BFEA 5AYVA 4G9EA 2OGSA 3QK7A 1DIOB 1WCIB 4KWEA 3K0AB 5CEFA 4AQYB 5CYPA 5LLDA 3H1EA 1J8MF 1CZHA 2XPCA 1OLSA 1E0DA 1G8GA 2QQFA 4HN2A 2VJYA 2B78A 4F3KA 2QTLA 2FMFA 1YS7A 3P4XA 2WAMA 2ZRHA 2GNOA 1SOUA 4WK6A 3H9QA 5CPBA 4CEIA 1WXQA 1UP7A 4I7EA 4C3ZA 2O8CA 1PR1A 3T0GA 1GPLA 3ZE9A 2WG1A 2R00C 5LSAA 2WD9A 4HFJA 4EFMA 3LX4A 3QBDA 4AJ2A 3OT4A 2FQ1A 2XQKA 4Z1OA 3OQOA 5JZ9A 4A2QA 1OLXB 1WM1A 5EN4A 4H2DA 5I3CA 3U1BA 4RJ2A 2VP3A 2Q7DA 1EFHA 3ZXYA 1GAXA 2AI3A 1SH7A 2O48X 1U04A 4MZDA 3WVNA 1ETHA 3UHOA 1AQUA 3SFVA 1L4EA 2HRDA 3MW8A 2IYXA 1WKVA 1FMLA 1R15A 4NTZA 4Y30A 4GQIA 3ZE2B 4U0JA 4DYDA 3OEHA 2QP3A 3CY6A 2H4JA 2XE7A 3HB7A 3IAAA 5TIIA 4JCCA 4FM9A 1M2KA 2AG5A 4PLFA 2J6CA 2SKCA 2DQKA 1X7WA 1QZUA 3HRHA 4Q7LA 3I58A 2B3TA 2YZ2A 5ALTA 5EHGA 4PC1A 2YXNA 4NHOA 4EYQA 2GJ8A 3UK6A 4JJAA 2PZKA 1O8CA 3N8GA 2PUDA 3R3SA 4ER5A 5K3FB 4TWRA 4YJGB 1NG1A 4B7XA 3I30X 1IM8A 3OTWA 3SICE 3U7QA 2XKJE 3RVNA 3G9XA 4LW8A 3LLCA 4Y2GA 5GP1A 4CYMA 2IY9A 2VDPB 2JEZA 3NBKA 3WYBA 3P9IA 3V7YA 4QT4A 1P9RA 3GCDA 4O4JA 2O1EA 5FEMA 2AV6A