4QT0A

Crystal structure of human muscle l-lactate dehydrogenase in complex with inhibitor 1, 3-{[3-carbamoyl-7-(2,4-dimethoxypyrimidin-5-yl)quinolin-4-yl]amino}benzoic acid
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
332
structure length
332
Chain Sequence
b'ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Homo sapiens
publication title Structures of lactate dehydrogenase A (LDHA) in apo, ternary and inhibitor-bound forms.
pubmed doi rcsb
total genus 109
structure length 332
sequence length 332
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4qt0A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4qt0A02
1EUDA 1XKQA 4ZA2A 3C8MA 1PJ2A 3QRWA 3PQFA 1NP3A 2E82A 2AE2A 3D7LA 4KWIA 2O7QA 3H4VA 4JROA 4L76A 3JQAD 3WR5A 1KERA 2BMAA 3P2YA 4DGSA 5DBIA 2J5KA 1GR0A 4J3FA 4CM3A 1A5ZA 1T2CA 2VQ3A 1GUZA 4ND1A 5L45A 4TWRA 4DMLA 4EITA 4YAGA 3FBTA 1NQTA 2FMUA 5IFLA 3ZWVA 4PLTA 4AJOA 4CR7A 4Z3KA 1RKXA 1DLIA 2EGGA 1A72A 5AXCA 3DOJA 4CMHA 2HUNA 1P1KA 3BTSA 1L7EA 3DL2A 1YXMA 1RM3A 3ICCA 2VHXA 1QLJA 1CDOA 1JU9A 3LT0A 3W6UA 4XEHA 4WKGA 1PQPA 4DPMA 5I7VA 2J3HA 4KMSA 2X1HA 4Z3DA 2YV2A 5THKA 1RWBA 3WJ7A 2EJWA 3GFGA 2OP1A 4BB5A 3RBVA 5FI5A 3OJEA 2EP5A 3QIVA 1GV1A 2J3JA 5DP2A 1KVUA 1TXGA 5JDCA 1U3TA 1KOLA 3UN1A 1JKJA 4NFSA 5G4LA 4JJFA 2CSUA 5EL0A 4DTIA 4OAQA 4ILKA 4QXMA 1GYQA 5H82A 3RFTA 1ENZA 4GL4A 3GFBA 4AJIA 5ILOA 1NFQA 3KV3O 1DRWA 2W2KB 3ADPA 1YBMA 3EVNA 2FPIA 4KTTE 4XQ9A 1D8AA 3JSAA 3ZNQA 1MUUA 3OJOA 4HNHA 4BO3A 2JKVA 3SJUA 1E7YA 3M2TA 3PRJA 4CM9D 1ZEJA 2X5OA 3AUSA 4WNCA 5T57A 5I7SA 5L4SA 3GNTA 1HDZA 3FR8A 5TQVA 4PLZA 3X2FA 5BSHA 1CETA 2CF6A 5CP8A 3KEOA 3EHEA 2GZ2A 1EE9A 3BTVA 2RHCA 2X8LA 4N18A 2HMWA 3WYBA 3DR3A 1T24A 1IL0A 2B4QA 2Q2QA 3F6YA 3OIFA 4CQMD 1UDAA 2YV3A 5FFFA 2Y66A 4YCAA 4LISA 4MKRA 4GX5A 3VZSA 1V3VA 2V6BA 1Q7GA 2VWPA 1BSVA 1HDRA 1MC5A 4WEQA 4Y8VA 2IZZA 5JPIA 3Q1LA 1BRMA 4NI5A 4U8GA 4CMEA 3ZWBA 1ISMA 1SO8A 2AQKA 2B5WA 2Y68A 5TJ9A 5EMHA 2O3SA 1M76A 2BFAA 3LF2A 2GGSA 3FPCA 5JBIA 3BHIA 1NQ5A 5JO0A 1I30A 2A92A 1IPFA 1MV8A 4CLRB 2C07A 4FPXA 1E3IA 1DJNA 2SCUA 2NTNA 3GEGA 4D3DA 3QWAA 1N7HA 4NPCA 4B4VA 3DB2A 4Z9XA 4CR8A 4INAA 3T4XA 1GFSA 1PGPA 2PKQO 3UICA 2BI8A 2X9NA 1I2BA 1PWZA 4XZ3A 1HETA 2ZCUA 1B2LA 2Y1OA 5DP1A 2R2GA 4WLFA 3BA1A 4L4SA 3FNEA 3MEQA 2C20A 3CZMA 4ZQGA 4RQUA 2HKIA 3OA2A 3QVSA 4CM9A 2EJVA 1HF3A 2B4RO 2QRJA 1XG5A 1GEEA 1WXDA 2AG8A 1R66A 4CMCA 1HWYA 3A14A 5DZSA 4BGVA 5KVCA 4DXHA 1GQQA 2B37A 2AXQA 5IG2A 4DQXA 2Q3EA 1H6CA 4AICA 3GDGA 2RAFA 2NTJA 4MVJM 2XXBA 3PJGA 1LRJA 4IBOA 3AU8A 2ZJ0A 1X0VA 5KVVA 4BNYA 3DTTA 1YL5A 1ML3A 3CIFA 2HSDA 1UH5A 4ZJUA 1BDBA 2X0IA 2C0CA 1E3EA 3JQGA 1RYEA 1U3WA 4RDIA 4IJVA 4J1NA 2JD1A 3DZJA 4RPKA 4XYEA 5L4LA 3GQVA 2Y93A 2WMDA 5COQA 1QP8A 1E3SA 4MP8A 3L4BC 5EIOA 2JFHA 3FSRA 3MCVA 3K9QO 3Q9UA 3DBHB 1T2AA 3RCBA 1ZZEA 1CRWG 3JQ7B 3MWDB 4FFPA 3EY4A 5T6BA 4ZU3A 1TB4A 3QVOA 4RVDA 1OMOA 2NU8A 3PGJA 4BUCA 4NQZA 3VPSA 4CL8A 1NNUA 2WYVA 1AHIA 3PZRA 2QZ9A 3ZWNA 2YY7A 4MJLA 5K0ZA 1KVQA 3RFVA 1N1GA 1J5PA 4CJXA 5JFOA 1DB3A 1V6AA 2YQ5A 1EUZA 4FDAA 4FD3A 3RC1A 3ZNPA 2NADA 2UVDA 2NTVA 2V65A 4LGVA 3ZV5A 1ADCA 3AFMA 3G0OA 1O8CA 2ZTLA 3ZV6A 3GRKA 3BMQB 1QG6A 2BLLA 3BTOA 3HFGA 2W2KA 5JC1A 3JV7A 1HRDA 5ICMA 2O48X 3MOGA 4UULA 4W4TA 1C0IA 5KIAA 1GU7A 2VUSA 5JLAA 4W9NC 5L9AA 3INRA 2FSSA 5IXYA 2ZKLA 4YRDA 1Y8RB 5JO9A 3JYNA 1EDOA 3U3XA 3MJVA 5IDQA 1O5IA 2EW8A 3WGHA 4YRAA 1T25A 4GX1A 3C7AA 5HS6A 1SB9A 1XQ1A 2VRCA 3ANNA 5T5QA 3R3SA 2WTBA 1HE5A 4BNLA 1P1JA 2JFFA 3I1JA 2QRKA 1YQDA 4R1SA 2GRAA 4DLLA 4IDAA 2AE1A 4IMRA 3HG7A 1ZUD1 4BMVA 1B7GO 4BO0A 1K6XA 1PL6A 4J0EA 1EVYA 2GNAA 4CV3A 3K31A 5A3JA 3OHSX 1ZK4A 3KXDA 1M67A 4BNJA 2Q1TA 3GZ4A 2QYTA 3PWSA 4XRRA 1OFGA 3TFOA 1ENOA 1UXIA 1Y81A 2BFPA 4KDEA 4GLOA 3TZQA 3IAHA 2HU2A 3ZCXA 4XCVA 1Y8QB 5DCYA 3JQ8A 1HDYA 3JD0A 5CPBA 5B4VA 3DEYX 3SJ7A 4YJGB 4FFNA 5IJZA 3UCFA 4GQAA 3WS7A 3IC5A 4R68A 4R1UA 3KYBA 3F9IA 1BDMA 3AK4A 2PZMA 1BG6A 3AU9A 4YVFA 5DDIP 3AUTA 5L40A 1EBUA 5TJHA 1MFPA 4BQPA 1WZEA 3IOYA 4FOSA 4CV1A 4JJIA 1TEHA 1BW9A 1DIRA 2DM6A 1IY8A 3IQDB 2HRZA 4MVJH 4QFDA 3BMCA 1X7DA 1IZ9A 3BMOB 3IKTA 1ISHA 3F3SA 3GPIA 4EJ0A 3KSZO 1RPNA 1TI7A 3FTPA 3GUCA 3SXPA 1GD1O 4XGKA 1P74A 4DLBA 1LLUA 1XDWA 2DBVO 1ONPA 3GVPA 4NBUA 2YQ4A 4OOFA 4NU6A 4ZICA 2X9VA 3VH4A 5EERA 5K9ZA 1NASA 2VUUA 3CZRA 3AOGA 3WICA 1WMAA 3PXXA 5KKAA 1MB4A 3KHUA 1VJ0A 3QWHA 1EVIA 2O3RA 4DPKA 2B36A 3AM3A 4NIMA 2IODA 1L1FA 1A9YA 3L4BA 3UF0A 3NDRA 3ULKA 3ZU3A 5HBRA 1ADGA 4E21A 2IZ0A 4KUHA 3HHPA 4R69A 4YT2A 4UUNA 4QEDA 3RSHA 1DDOA 3OECA 3SEFA 4GGPA 1ONNA 1F8GA 1EK6A 1YO6A 1UXKA 1QYCA 2I9PA 5A5FA 2D2IA 4C7JA 1PIWA 4WUVA 3ZW9A 4BKQA 1A9ZA 3DHYA 4PRKA 4E2ZA 1KEWA 1PJ4A 1DAOA 3I4FA 2C7GA 4XX0A 9LDTA 4IIUA 4XJTA 1TVEA 1ZVMA 1OBFO 4WK6A 3I9OA 2H1SA 4U0KA 3L07A 4BOYA 3H3JA 3X2EA 2O2YA 3SX2A 1QR6A 3AI1A 1E7MA 1VLLA 2ZYDA 1X7GA 1ADFA 3SC4A 2GZ3A 4QT0A 1LQTA 4D43A 1PL8A 1NVMB 4TRNA 3U5TA 1LQUA 1LU9A 3JQGB 3JQAA 1E1NA 4PVCA 4RLSA 1QORA 2P91A 1E77A 4U7WA 5TF4A 3WGTA 1YKFA 5K6AA 3FWZA 1TT5A 3HB5X 5L7TA 1O94A 3NV9A 1N1EA 1O89A 3DMTC 1Z73A 4RF3A 5A04A 4MVJI 4M49A 5ES3A 4I9HA 2X0JA 1LTHR 4WCFB 3HB4X 1O6ZA 4NK5A 1C0PA 4YT5A 4A0SA 2NU7A 2Q1SA 1Q7CA 2Q2WA 3W6ZA 3LZ6A 1ISJA 1A7KA 1QKIA 3MJCA 4B7XA 4F45A 2FWMX 1UAGA 4HFMA 3IKVA 1GQ2A 1A7AA 2W8ZA 4P4NA 4TSKA 1HZZA 4XQGA 1PZGA 2BKAA 5JC8A 3SLKA 1LJ8A 5JYEA 3R0IA 5AYVA 3ITKA 4HFRA 3V1TC 4OSPA 1MP0A 1DHRA 4IJUA 4D3SA 4HY3A 1D7OA 3GHHA 1WP4A 1NPDA 1XHLA 3O8QA 5T8KC 2I3AA 4IUYA 1K3TA 4XDZA 4EJ6A 1ONOA 4MVJP 2E49A 2OXIA 3TJRA 1XU7A 3BIOA 1X1TA 3B70A 3BMQA 1N8KA 2VHWA 2DTDA 4K6FA 2GASA 4MDHA 3VZRA 3PWKA 3DBRA 3DO5A 4QSMA 3GGGA 1GY8A 2DTEA 3WSVA 3GR6A 3QP9A 4J4BA 4U6QA 5BR7A 1R0LA 5IZCC 4RVUA 1DIBA 4E3ZA 4J7XA 5TX7A 4AJPA 2FR8A 5JS6A 1YBVA 4ND3A 3DAPA 2Q49A 4IIVA 4I9UA 4AL4A 1KY5A 5CEJA 1FDVA 1Y5RA 3WBBA 3QW2A 1U2GA 1GCOA 1VE9A 5TNXA 3ZW8A 5IAAA 2YJZA 3I6QA 3PHJA 3WIDA 3DZKA 2C29D 4ESOA 2UV8A 3I6IA 2HK7A 4DBZA 3RC9A 2EW2A 2JFGA 1BXGB 5GZ6A 4NNJA 4N54A 3TL3A 1QV7A 2YHIB 1CQIA 3CXRA 3QSGA 4XGIA 5JDCC 1U3UA 3JQEA 1ZJZA 2GDZA 1H9AA 3CTMA 4QX6A 3PHGA 4UUPA 4WLVA 3OJFA 2DFDA 4IQ8A 3PI7A 2BFOA 4UVIA 1BGVA 3L77A 1JA9A 2XF8A 4YJFB 4PLGA 4RVHA 3RKRA 4UEKA 2QX7A 2Y05A 3GDFA 3RJ5A 5HTOA 4CQMA 3FCOA 1UAYA 4MP6A 1E7RA 1P33A 1I2CA 4IM7A 5IN5A 3WQRA 3U0BA 3LC2O 4WLUA 4RVGA 5CPFA 2NM0A 2A4KA 5TRTA 1GCUA 3ETEA 3OSUA 4KUEA 2IYOA 3FHLA 5I9NA 4K1LA 4DMMA 1B14A 2O50A 2WD7B 4IQGA 3I23A 4BO8A 2XAAA 4RORA 4E32A 3S2FA 3FPLA 4AJHA 2AEJA 2DC1A 3KO8A 4FGSA 3WLFA 3P2OA 4KQWA 1SEPA 2PKRA 2IRWA 3LT2A 1MFZA 1D4FA 1IB6A 4ALLA 3GAFA 3D3WB 5A9TA 1VC2A 1JAXA 3CKYA 3TZKA 4MVJD 4MP3A 5DOZA 2IYPA 3JQ6A 1UZNA 4NJMA 1PSDA 3JD4A 4Q3AA 3GGPA 1UJMA 4YAKA 3WGGA 2B0JA 4XYMA 4PLHA 1B3BA 1VI2A 2B69A 4DRYA 1SB8A 4WASA 1J6UA 3ZWPA 2UUOA 4AG3A 1H93A 3ASVA 4XIYA 5ICSA 1I36A 3OJ0A 1LLCA 3UUWA 4DA9A 3AI2A 1EFLA 1IE3A 1R0KA 1C0KA 2JHGA 4TVOA 1N9GB 3E48A 4UUOA 2FRDA 3KSDO 4E0BA 3EW7A 2GZ1A 1MC4A 3GZNB 5A06A 3OEYA 1PGQA 3FI9A 3TQHA 3AM4A 2FOIA 3ZWCA 3GMSA 3JQFC 4KDFA 3C1OA 5DN9A 4M54A 2VN8A 1I3NA 4PRLA 1IUKA 4LK3A 4G2NA 5ENVA 4L73A 5I9MA 1I5RA 2JCVA 2JCXA 4PG4A 4WE3A 1SOWA 4LMPA 4RDHA 1GPJA 5GZ3A 4E31A 2FPPA 2IDZA 4I9NA 1ZJYA 5CDGA 5JSFA 1U7TA 4Y98A 4IZIA 3AUAA 4WECA 2G1UA 1UUFA 1M75A 4BO4A 5T64A 4RGBA 4S1VA 3PGXA 3U62A 2BHLA 4YTEA 3MJ4A 2VZ9A 6LDHA 3QHAA 2JD2A 2NU6A 5KJCA 1W8DA 3K92A 3OF2A 3RUEA 2PNFA 3BMOA 4CMBA 1S6YA 3KLPX 4R41A 4EW6A 4NHEA 4ZQHA 2VUTA 4G65A 5CAEA 4JNKA 3LT4A 1SMKA 4DC1A 5DCUA 3JQAB 4P38A 1T1SA 5CDSA 4ZHSA 4Q3CA 2D1YA 1JVBA 4FFLA 5COAA 3ZV3A 4R1NA 2HMSA 1F17A 4AVYA 2ZJ1A 2G82A 1X14A 2X22A 3RU9A 4O59O 2X6TA 4H16A 1KETA 1LSUA 4L74A 3E5RA 4BKRA 1HDXA 3RD5A 1DOHA 1R4MB 1AXEA 2R6JA 1KC1A 4TKLA 3RU7A 4M8SA 1M66A 1UDBA 2HAEA 4OXKA 2I5PO 2Y1CA 3ASUA 5IDWA 4DYDA 2IEBA 2WD7A 3L6DA 2GN6A 1ZNQO 5T67A 4NZ9A 1JQBA 2FHSA 3JTMA 3E8XA 3JQFA 1BXZA 4RPLA 5C5IA 3ZWXA 4JP2A 5KTKA 1BHSA 5AXBA 2PZKA 3F4BA 3GEDA 1Y7TA 3M2PA 4LMRA 3JYQA 2EHDA 3U9LA 2POQX 1NHWA 3DZFA 5B4TA 4XD2A 2VRBA 1OI7A 3H6KA 4FIZA 1DFGA 2EXXA 3HSKA 3VH1A 2ZK7A 1DO8A 2H6EA 2ZIZA 4IZHA 3UHAA 1WLYA 5TS3A 1I01A 4Y9DA 3W1VA 4CM4A 3VPGA 3WIEA 2I76A 1NFFA 4YRBA 1C1DA 5HS4A 1H6AA 4FOOA 2NV6A 3DHEA 2Q1WA 1DC6A 4GKBA 1F06A 1UP6A 2O3QA 1IHYA 4XYLA 5TGDA 4WOKA 2DPGA 4J90A 3QVTA 1A27A 1B8VA 1EBFA 3F46A 3OM9A 4MOWA 3WSWA 1ZXBA 3C1TA 3BMNA 4JBIA 3R1IA 4YT8A 3ONDA 2PGJA 5A4DA 2QQ5A 3CUKA 2Y99A 3DBLB 1ARZA 4Z0HO 2JJYA 3KTDA 1ZSNA 1PEDA 3VTZA 2GO1A 4BO7A 4CM8A 4E30A 5HM8A 4PFJA 2EWMA 3ZWAA 2NSDA 3DFZA 4M87A 2B35A 2DVMA 1IYZA 1MG0A 3G49A 5F1KA 4RJTA 2DLDA 5CEFA 3H2SA 3KZVA 2YHUA 3DTYA 4R4JA 1PS0A 2ZCVA 2IEDA 4IPTA 4ZGWA 3KYCA 2DKNA 1B0AA 1Z82A 4XKJA 5DCWA 1AN9A 4Y6SA 3G1UA 3TRIA 2Z1NA 5IZCA 1E92A 3WMWA 4RF2A 3BMNB 2BH9A 3CPSA 5CG2A 3O4RA 1ZH8A 5ADHA 1TT7A 2YW9A 4BNIA 1UZLA 4MVJE 4TMFA 3WNVA 3OFSA 5EQDA 2RHRA 1PJLA 1HLDA 1ENYA 1KVRA 2OL4A 3GUYA 3PHLA 1QYWA 4CM8B 1VL8A 1R15A 4AJJA 5EESA 2WEKA 4HKTA 3ONFA 3B1FA 1ZW1A 3GEMA 4URFA 4J4HA 3N74A 4NBVA 3H9UA 5KJEA 2G5CA 2Y0EA 1Z7BA 4BNKA 4IDCA 3OEWA 4TZTA 3ADOA 2J8ZA 4RPGA 1Y1PA 3ZV4A 4YJHA 2Y1FA 4I08A 2JAPA 1PTJA 4MVJG 5HA5A 3VOSA 2O4UX 2VHYA 1EQ2A 2PGDA 2DU8A 2P68A 3DDNA 5DNAA 3DOOA 4M89A 1JWBB 1UXJA 3U4HA 3QY9A 1C1DB 3ITDA 1KEUA 2Q1UA 2EERA 3OICA 2VYNA 1PZHA 3UOGA 3EAGA 2V6GA 3ETGA 1I3KA 1YDWA 4XWYA 2GF2A 1LUAA 1JKFA 2YUTA 5A3VA 1XU9A 3OQ1A 4RVFA 4BO9A 4D41A 2X23A 4AJKA 4D0SA 1ZK0A 4TROA 1K0UA 1LDGA 2YHIA 1SZJG 7MDHA 2OGUA 3B1JA 8ADHA 1R16A 4TZKA 4D7AA 3MTJA 3UAGA 1EK5A 4J9UE 4YDRA 2GSDA 2D5AA 3BYZA 3RUCA 4J6FA 3ZHYA 2ZB4A 1AHHA 2VHZA 2OORA 2VWGA 2UDPA 5DT9A 4E4YA 3WTCA 5A9SB 2AQHA 1DSSG 1LBEA 4NFHA 2LDXA 1M2WA 5TSDA 3AJRA 3AOEA 4CV2A 5C7IO 1P9LA 2OUIA 2CZCA 5I8ZA 4WCFC 2PFGA 1DIAA 1HE2A 3HQ4O 3GN1A 1WVGA 3Q9NA 3I9MA 4AJEA 2IZ1A 2I66A 4DPLA 5JCJD 4E5PA 2F1KA 2HMVA 3GG9A 5CDUA 3QA9A 3JD3A 1PQWA 5TC4A 1XYGA 4AFNA 1MLDA 3Q11A 1P3DA 1NXQA 1ZKMA 1P1FA 1X13A 4LRSB 1VKOA 5G0TA 3H65A 1LLQA 2VYVD 1P0CA 1E7QA 3INGA 3PQEA 1BVRA 2AEFA 3N58A 4WLOA 4PZEA 4GH5A 3G17A 1Z7EA 3D5QA 3FWNA 3FF4A 3L9XA 1YONA 2Q2VA 4J49A 2DUWA 3OA0A 3H9JA 1SC6A 1BXKA 2YFQA 3UGKA 3ROQA 1ZFNA 3K96A 3KB6A 2NQTA 1DRUA 1I32A 3S8MA 1U9JA 2LDBA 3AM5A 3S2GA 3VKVA 1CF2O 2GLXA 4YPOA 3L6OO 4ZQEA 2VOJA 1NBOA 5F1OA 1LDBA 5G0UA 4KWHA 3IL2A 2W98A 3GH3A 1GEGA 3GRPA 4J1SA 3W4KA 4II3A 3M1LA 4O1MA 2HQ1A 3KYDA 2P9CA 1E1KA 2QZZA 1C1XB 1UR5A 1SPXA 2AW5A 5DBFA 3E9MA 1MA0A 1Q7BA 2VYND 3GOHA 5KVQA 4DBVO 5JY1A 1ZK2A 3PYXA 1R37A 1ZCJA 3W8DA 1Q0LA 2EKLA 4IDFA 1K5HA 3JQ9A 5I8WA 1QMGA 1VJ1A 3PIIA 3OIDA 1PJQA 4E6PA 1AE1A 1WW8A 4BKPA 1XEAA 2PY6A 3TOZA 2CDBA 5LDHA 4DQUA 4CUJA 1JKIA 3H9GA 1OOEA 3T4EA 4ALJA 5ENDA 3NRCA 1VM6A 4W6ZA 4F3YA 1PJSA 1OC4A 4N7RA 4R01A 5JCJA 1H6DA 3H7AA 4UUMA 4M1QA 5JMPA 4CMIB 3IIEA 4F6CA 3UH1A 1YDEA 3UVEA 1X1EA 5BSEA 1ULSA 3H5NA 4DREA 5IXSA 3SBOA 1ORRA 1YL6A 4PLCA 3RVDA 1U8XX 2CD9A 2PD4A 3O8QB 4B4OA 4PCVA 3RWBA 2VNSA 4GWGA 1HLPA 1HSOA 2PLAA 4ZRMA 3WQQA 1C14A 3DMYA 4NH4A 4RV9A 4DLAA 1QSGA 3PIDA 3DONA 3HJAA 2DPHA 1HYGA 2DTXA 5AXAA 4CLOB 4I5FA 5IDXA 4XA8A 5CEEA 3LLVA 3H5AA 4MO2A 3INTA 4UVEA 4MIYA 1YWGO 1E3LA 1CYDA 1JDJA 3GVXA 3V8BA 4IINA 4Z9YA 3NGXA 4BO5A 2NVUA 2RIRA 4JK3A 5A03A 1C0LA 3P5SA 2D0IA 2VHVA 1NQOA 4B3JA 3U49A 1TT5B 1UDCA 3EK2A 3NDJA 3EDMA 1U1IA 2NLOA 3PHIA 1F14A 1LDNA 3NJ4A 5IN4A 1I24A 3ABIA 3ZWYA 1AGNA 3K5PA 1XGKA 1U4SA 2EG9A 1EUCA 1YOVA 1FDUA 5AXDA 3RQSA 3AWDA 1A4IA 3TNLA 3Q6IA 4R5MA 3JD1A 5L4NA 4KOAA 4W9NA 5L53A 1E6UA 3I9LA 3HFSA 1EEHA 3JD2A 3SC6A 4A2CA 1UXHA 5TT1A 1DXYA 4W99A 2ZATA 4R5HA 4IDBA 3I83A 1Y8RA 4N5LA 3DZIA 5CG1A 5L95A 2X4GA 3I4CA 2QG4A 4OOEA 3G79A 4FGWA 4R9RA 2QRLA 3WJAA 3DQPA 4BMSA 3OBBA 1T2FA 3NT2A 3I3OA 3JYPA 5U4QA 4BGEA 2C59A 1JW9B 1E5LA 4FW8A 1B16A 4I8XA 1M6WA 2AHRA 3F1KA 3QV1A 4PLFA 4WPGA 3ZU4A 4CMIA 1PR3A 1HDGO 3LVFO 4J0FA 4ND2A 3ZDFA 4YWJA 3GVCA 3ZHBA 3DHNA 3WTBA 4TRMA 4XYBA 1EVZA 1ZK3A 1UP4A 5TT0A 4D42A 4YXFA 2NWQA 3L4SO 5BSGA 3VC7A 1EFKA 1A71A 1HTBA 1PS8A 4ZN6A 2GD1O 4FS3A 1MXFA 2IXAA 3NTQA 4GBJA 4IJKA 4K9DA 1X7HA 3EVTA 3GA0A 5KVSA 2X5KO 4BS9A 1R12A 3QWBA 1LI4A 1Y8QA 4CV0A 1H9BA 3U09A 3QQPA 3V1YA 1FJHA 1I33A 3C7CB 3MWEB 4HP8A 3HWRA 3D5TA 2AA3A 1ISIA 4Z0PA 2D4AA 1JWAB 2P2SA 2CF5A 5MDHA 1P1RA 2PA3A 1DC5A 3K8ZA 6ADHA 2WE8A 2I99A 4KP7A 1QXSA 3QE3A 3HDYA 3WLEA 4ZQFA 4YAEA 4ROSA 3ZHXA 3GVIA 5IDYA 4CQLA 4NDNE 2I65A 3LSYA 1OC2A 1NPYA 2FP4A 1G1AA 4HFJA 5BSFA 2HMUA 4FR5A 4YQYA 4B7UA 1HXHA 3BXXA 3E9NA 3AY6A 3ETDA 3PP8A 1HE4A 3ZGYA 1YBAA 2WDZA 1GL3A 2X0NA 3G3EA 3QVXA 4JP3A 1J49A 1GZ4A 1YE3A 3TF5A 2Q45A 4FC6A 1KEVA 1GV0A 1PWXA 1EZ4A 4Q3DA 4BNGA 3ICPA 5F3RA 3WGOA 1DLJA 3ORFA 3IS3A 1UP7A 5B12A 1Z74A 1UZMA 4IY1A 4JIGA 2G0TA 3GLQA 2D59A 4U5QA 4PZDA 2EIHA 3Q3CA 3PJDA 2X0RA 1SCUA 4E13A 1LDEA 1XSEA 4A03A 3VHRA 4BHTA 4LCJA 5DOVA 1EE2A 3ZNNA 1DC3A 4ALMA 1FDTA 3TDKA 3WYCA 3AW9A 4YB8A 2TMGA 4DIBA 3WFJA 3BHJA 2NQ8A 3HDHA 3NJ8A 4RLHA 1VSUA 5A9RA 2RCYA 3AOEC 3TZHA 4L0QA 1B26A 1EVJA 4WJZA 1T2DA 4PZCA 4ND4A 5KJ6A 2R00A 1RM4A 4GKVA 1ZK1A 5HWSA 2J6IA 1N9GA 3T7CA 4OHUA 1NHGA 3DBVO 2E48A 3RAJA 3C3XA 3WX0A 3ZWMA 4D0RA 3HDQA 4LRTB 4EJMA 1CEQA 4QO7A 4JXKA 1PJCA 2EEZA 3WBFA 3OIGA 4GMFA 3WOHA 3NKLA 2X9GA 3E18A 4ID9A 2HO5A 1PGJA 4NBTA 3UCXA 5ITWA 3O38A 3P7MA 2A94A 3ZHZA 1PGOA 3WGQA 3D3EA 1VL0A 3JYLA 1RM0A 4OM8A 1CJCA 4PG7A 3M6IA 4OKIA 4QTZA 3B20A 4RL6A 4HXYA 1HYEA 1ZMOA 1FDWA 2CVOA 3JCZA 5F5LA 2Y0DA 1DFIA 1TA4A 2RH4A 1ZEMA 4GSLA 4YYZA 1KYQA 4D3FA 3PDJA 5TLSA 5JE8A 4D79A 5IF3A 4RZIA 1LC3A 2VCYA 4Z9FA 1Z75A 3LC7O 2X86A 2X7HA 3L0DA 4HWKA 3S55A 5JNLA 2Q4BA 3NUGA 3KLMX 3UCEA 2DQ4A 2X58A 1T26A 4DYVA 4GX0A 4IS3A 4PG5A 5JXWA 4AJ1A 3CE6A 4KTVE 1N5DA 4OO3A 1PS9A 2EV9A 2I67A 3TZCA 4NU5A 4EBFA 5KWEA 2H9IA 4BO1A 3GVHA 4H7PA 4BMNA 4GLLA 8LDHA 2JL1A 3E6AA 1LRLA 1X15A 2C5EA 2WSBA 3KUXA 2RH8A 3TFQA 1X0XA 3S2IA 4CQLB 3IDSA 3V2UA 3WWYA 4E12A 3PJFA 4MINA 1ID1A 4F6LA 1PQUA 3FBGA 5L7YA 1IHXA 4AJLA 3GG2A 4L9RA 4PLWA 2NVUB 1YS4A 2YDYA 1BVUA 5I7EA 3I5MA 4W7HA 3WGZA 3C7DB 2W2LA 5DF1A 4M86A 2AMFA 3H3FA 1QYDA 2EKPA 5H83A 1FDSA 4A5OA 3WG9A 3F47A 5AQ1A 4FFMA 4I5DA 1E0DA 5EPOA 3E82A 3O9ZA 3JQ8B 1DRVA 1O95A 3C1AA 4BQRA 4QUKA 1NVTA 1LEHA 2J3KA 2ZTMA 2GN9A 4IS2A 1H6BA 3V1UA 1VPDA 4DC0A 1QYVA 5FEUA 2IXBA 5TIIA 3GN2A 4GMGA 1RJWA 1KY4A 2ZTUA 2VRCD 2DBRA 5JCXA 2WYWA 1NQAO 1N7GA 3B1KA 4EEXA 4TQGA 4PIVA 3VZPA 4B4WA 4CLDA 1NYTA 4OXNA 4B3HA 3EYWA 4EGFA 5A05A 4EUHA 2FZEA 4BNXA 1FMCA 4HUJA 4BNNA 1T4DA 1NR1A 3VVCA 1EMDA 4WOJA 4BB6A 4YAJA 2VTDA 3DC2A 4IGEA 3MZ0A 3ZN2A 1P31A 4DL9A 5L3ZA 2DUUA 3O26A 3UW3A 1HEUA 1YB1A 3GGOA 4UVDA 1YJQA 4ND5A 1T1RA 2D3TA 2Y1EA 4RVSA 1F8FA 4EYEA 1PX0A 3H5RA 2CNBA 1XR3A 4P4GA 2CY0A 1UXGA 4JJGA 5JAIA 4OJNA 2O23A 3LT1A 2NVBA 1GPDG 2GPTA 2CMDA 1G6KA 4XRGA 5BNFA 3GPDG 3R3JA 4EI2A 4XB1A 2PH3A 4UEOA 4FQ8A 2WM3A 1U5CA 4NG5A 3OH8A 5CFZA 1HDCA 1LDYA 1PU2A 4CLHA 2BFMA 4TRJA 1E6EA 3NAQA 4MVJF 5J23A 3PVZA 2VWQA 3U4CA 1V9LA 3QWFA 3RC2A 3ENNA 5G0WA 3JQ7A 1PL7A 4KUGA 3D4PA 2VT3A 3MJSA 5I9LA 3BTUA 3W8FA 2V6MA 3A06A 1TLTA 4YACA 3JQCA 3OQBA 4Q3BA 3M1AA 3UXYA 4MPDA 5FWNA 5L51A 4IDGA 4CM6A 2C2XA 4UREA 2CVZA 1WDLA 4CLRA 3FR7A 3LF1A 4HV4A 5JAZA 1U3VA 1J4AA 1E3WB 1H2BA 4O0LA 4JGBA 4LCEA 4DQVA 2Y0CA 1PR9A 2FR0A 3BZUA 1CQJA 1V3UA 2ZYGA 1Y5MA 2GCGA 4IXTA 3ZWOA 1GDHA 1SOVA 1NFRA 4QECA 2O4CA 1LNQA 2OMEA 2Q99A 1Y6JA 4IDDA 3ZNOA 5C3MA 3WQSB 3V5NA 4NR0A 2UYYA 2Y67A 1O9BA 3D4NA 2FPGA 5JYDA 1WDMA 1ZSYA 4ALNA 4Y6RA 2XOXA 5H81A 1YVEI 3A28A 1W73A 4CLOA 4CM1A 4RF5A 1C3VA 3MOIA 4CQMB 2AQIA 3W4IA 3RROA 3L9WA 1GQYA 4XQEA 2E6UX 3AY7A 4YJFA 1ZIDA 3MJTA 4CLEA 3IP3A 2C54A 4FB5A 4NK4A 2O7SA 4Q9NA 1LSOA 3BAZA 3LDHA 4NMHA 5MGBA 1WPQA 4BIIA 4RF4A 2P5YA 4NBRA 4BNMA 2F00A 1U28A 1BXGA 1Z6ZA 3C85A 1I8TA 2IE0A 4J1QA 4XGNA 2HJSA 3ROKA 5AOVA 4H3VA 5G0VA 2VTEA 2WYUA 4O6VA 4ITUA 1V0JA 2TMDA 4XYGA 5BNIA 5U9CA 1VRWA 3GDOA 3RUDA 4L4RA 4BNVA 2QIOA 3VAZA 4BVAA 1R4MA 1E7WA 1HL3A 3E5MA 3ZWWA 3EZLA 3FD8A 4ZVVA 3A4VA 4D44A 2HRBA 4E33A 2VZ0A 4YJGA 1WDKA 2ET6A 1KC3A 1VL6A 4BKUA 4BNUA 4NJMB 1DC4A 3RASA 4OIMA 1U4OA 1NAHA 4PLVA 4QO8A 1BWSA 2BF7A 4HNGA 3PZBA 3TWOA 4N5MA 3I9KA 4AJNA 1HDOA 4CM4B 4ALKA 4CMGA 4ALIA 3RKUA 4QFCA 4Q39A 1GUFA 4GI2A 3T7EA 5C37A 5B4UA 3IJRA 2DBZA 1A4UA 1WAMA 1YB4A 4E5KA 4IQ0A 4EZBA 2O3UA 2NUAA 2W2LD 2UAGA 1YJ8A 3K2BA 1R4NA 3COSA 1Q0QA 3C24A 4I5GA 5JDIA 5U1PA 4KQXA 1QRRA 4WEOA 2YZ7A 1LXCA 5T8KA 4NJOA 3NT5A 2C5AA 2P5UA 3CMMA 5L7WA 1GADO 3HUDA 4F46A 3QWIA 4JLWA 4YAIA 2H63A 1ZO8A 4CL3A 4UEJA 4BO2A 3GT0A 2B83A 3U4DA 2VWHA 2EKQA 1VJTA 4WCFA 3CEAA 4J91A 4CMJA 3IMFA 3GF4A 4GPD1 1PJTA 5F21A 3BHMA 2PR2A 2I6TA 1GYPA 2ZQYA 4DIOA 1E1MA 1PZEA 3NGLA 1T4BA 4P22A 4XR9A 3DAGA 5C7OO 1JN0A 1XLTA 1PJBA 2VOEA 4TVBA 5AVOA 2GYYA 3VH3A 1P1HA 4IXWA 1Q0HA 4A26A 1Y9AA 3E9QA 3KRTA 1GZ3A 1YB5A 2YFHA 3R6DA 4R51A 4GSKA 1U7HA 2PD6A 4PN3A 1EDZA 3NTOA 1YRLA 3PFFA 2NACA 1F0YA 1I0ZA 1P1IA 4S3MA 1WMBA 2EF1A 5JDIC 5LDGA 4P8RA 3U4IA 3GNQA 3HE3A 2C7VA 2D5CA 2BGKA 1N92A 4RPHA 4FJ2A 1E1LA 3ENKA 3I52A 4FCCA 3KVOA 4OMUA 4E5YA 1KEPA 4ZD6A 2C82A 3DBRB 3LQFA 2GN8A 4DIFA 1ULUA 4XQCA 4J7CA 3WWZA 1AUPA 3VDQA 3QJ5A 3WGYA 1JAYA 1IULA 1H5QA 2FN7A 3PFWO 4BV9A 4CUZA 1ADBA 1U2DA 3IUPA 3DMTA 3G1TA 2DAPA 5G0SA 1BTOA 1CIVA 1S7CA 3MJEA 4GGOA 3I9JA 4TRRA 2W4QA 2JCYA 5FI3A 3P19A 2Z95A 3SVTA 2C2YA 2YDXA 4OQZA 2Q46A 1V3TA 5DULA 2ZQZA 3RUFA 4R1TA 2Q50A 3UFXA 1ZXLA 3CSDA 2J5QA 3A1NA 3I9NA 4D46A 4EDFA 3RIHA 1MXHA 1NTOA 1PGNA 3VTFA 4W82A 1HE3A 4GVLA 2ZB7A 2P4QA 1YH3A 4GX2A 3ROPA 5ITVA 5CDYA 3ST7A 1XIVA 1XQ6A 1D3AA 5CDTA 2R00C 5G4KB 3GNSA 4GAEA 4L75A 1VKNA 1Z45A 3KBOA 2V7PA 1R4NB 4R3WA 3D0OA 2A9FA 4C4OA 2PK3A 2VT2A 1M6HA 4IJWA 1DFHA 4D45A 4OGWA 1V35A 4Y6PA 1NWHA 2O2SA 3FTNA 4JX8A 4PVDA 4HFNA 1JVSA 4HBGA 5DBGA 1XELA 2WJPA 4XB2A 1K2WA 1E3WA 3PTZA 1MGOA 3TZ6A 4A27A 3DWFA 2CVQA 2ILTA 3HZZA 3JQ9C 4E5NA 1F12A 4BGIA 2HK9A 3KM0A 5KCZA 4E2XA 1YOVB 4R16A 4Y67A 3ANMA 4XDYA 2OBNA 4YA6A 1HT0A 3D1LA 1QV6A 3K6JA 2OP0A 4RO0A 2ZB8A 2AQ8A 5LCXA 4G81A 3PYMA 4BNFA 2NVWA 5JW6A 3D3WA 3FNGA 4YBZA 3KYDB 2PH5A 2J5RA 3DBHA 3H9QA 3LK7A 1NPTO 1N2SA 4U6SA 5B1YA 4MVJA 3E03A 2FY8A 1KVTA 1R0SA 3JQBA 3GY0A 4R54A 2HK8A 1O0SA 1LSSA 4CODB 5A9SA 4B8WA 4O5OA 4CM5A 4AJ2A 4WGGA 3JYOA 5EQFA 1SNYA 1MX3A 2DT5A 4L4XA 2FR1A 3VZQA 4P4LA 2OOSA 4IDEA 1IPEA 1FK8A 1E5QA 2ZYAA 4J2OA 5JAQA 3AUUA 4RQTA 3D64A 2OBYA 3K2EA 5GMOA 3Q0EA 4LSMA 4N5NA 3DBLA 3ZU5A 4E5MA 4TKMA 4UAGA 4PLPA 4FC7A 9LDBA 5A02A 3NTRA 3RJ9A 3AY3A 4IMPA 2EGHA 2HJRA 3F4LA 1G0NA 3VDRA 1ISFA 3ANLA 3HN2A 5GY7A 3ZZNA 4B8ZA 3S1LA 3EZYA 1K6JA 1Q2XA 3NEPX 1DIGA 4J4TA 3VVBA 3KEQA 2PTGA 2B4TO 2BGMA 2HCTA 1FF9A 1W6UA 1GTMA 3HADA 2JD0A 2EP7A 7ADHA 1MG5A 3O03A 1ENPA 2B5VA 1YQXA 5KJ1A 5KOIA 1RYDA 1KBZA 4J43A 4A73A 1WZIA 2BELA 4X54A 5BT9A 1DJQA 4OSOA 5LC1A 3WDSA 4OL9A 4Q3EA 2BGLA 3LYLA 1P77A 4CMKA 4CR6A 3FNFA 3F1LA 5BNTA 4PLYA 3TN7A 3K30A 4MKZA 3RUAA 4NFYA 3PQDA 3CMCO 1IZ0A 1XA0A 4XIJA 1DAPA 1SBYA 1ZBQA 1U5AA 4YT4A 3ZH2A 4WCDA 1ISGA 1GYRA 3PEFA 3STHA 4YR9A 2PZJA 2Y1DA 1NR7A 1QLHA 3PDUA 3WXBA 1HKUA 3K73O 2E4AA 2OHXA 4JQCA 4AJ4A 4B3IA 5KNLA 1Q1NA 3H2ZA 3HN7A 1U8FO 4BNZA 4CLXA 5CHEA 2Q4EA 5A1TA 2X5JO 4I1IA 1D1TA 3JQDA 3PK0A 1DBVO 4YJDA 2XPCA 1P44A 1H94A 2VNAA 1HYHA 2WE7A 3Q2KA 4UVHA 3V2HA 3VPXA 3KETA 3EUWA 3PHHA 2PV7A 2UUPA 1JTVA 1LLDA 1GAEO 1LSJA 4MIEA 1LDMA 3WMXA 3IJPA 5ER9A 3PJEA 2NU9A 4YEDA 1H2HA 4Z0TA 4CPDA 1LA2A 2RBEA 2XXJA 4FJ1A 4DVJA 5IZ4A 3BMCB 2BI7A 4LW8A 1B15A 4YJHB 2HLPA 2G17A 3AI3A 4OKNA 2OFPA 4PGFA 2V6FA 4II2A 4U0JA 3CINA 4HADA 4JBHA 1E3JA 2PWZA 4A7PA 5F5NA 2G76A 2BRUA 2O3JA 4EUFA 1SAYA 4J2HA 4BNTA 5JMWA 5F1PA 2D8AA 3RFXA 1B3RA 4H15A 4JCOA 4E2WA 3FNHA 1D1SA 4CUKA 1YL7A 4K6CA 2H5LA 1NWCA 1R6DA 1OZAA 3HDJA 3VKUA 4R3NA 2AG5A 5B37A 4ONEA 4WNIA 3NDIA 1PZFA 4M55A 3DAFA 2PGLA 5EINA 3GHYA 4JBGA 1KIFA 5K6AC 1GZ6A 4FSHA 1CERA 1J0XO 3EMKA 1ZSVA 3Q2IA 4PG6A 3WNQA 5COBA 4BNHA 3GMDA 1NX6A 3H8VA 3KYCB 4BKOA 4Q3NA 4R9SA 4EEZA 4B79A 2JAHA 3ON5A 3KSUA 4J9VA 4BL5A 3LC1O 3IP1A 2O3TA 3D4OA 3OJLA 3F5SA 4UVGA 1VSVA 4BGUA 4LN1A 3DZBA 4XR4A 1I2ZA 5EN4A 1QYXA 3OP4A 3DZHA 5THQA 3S2EA 3CH6A 3VPHA 1W4ZA 3LU1A 4RZHA 5A5EA 2HMTA 4GWKA 2OZPA 3KOUA 4A10A 4B4UA 1H0KA 2CDAA 3TSCA 4FFOA 4DUPA 4J1TA 4JN6B 3UKOA 2Z5LA 2OO5A 3B6ZA 5FF9A 4E2YA 3PLRA 3EGOA 3RUHA 3TOXA 4FJ0A 4NBWA 5GZ1A 4YQZA 4BO6A 4QQRA 3SLGA 2YYYA 3OETA 4MIOA 2GERA 3PPIA 4B7CA 4ZQBA 4BNWA 1EQUA 3ZU2A 3GAZA 2QYSA 5KJFA 2AEMA 1B8UA 2WWRA 2P9GA 3GC6A 4C7KA 1BW9B 4RCVA 2FSVA 1K89A 1DPGA 2CDCA 2GR9A 5G2OA 5FYDA 3ROMA 3VPFA 3OMLA 3FRJA 4K28A 4LVUA 1LX6A 3DOCA 2CUKA 3PYLA 3DZGA 1JLLA 3RBZA 1WNTA 4L8VA 4K26A 4BV8A 4OQYA 1T2EA 2JHFA 3WFIA 1XCBA 3GZNA 3NX4A 2WD8A 2VYVA 4PG8A 3OQ6A 4ZRNA 3RI3A 1V8BA 2E37A 4KZPA 3ONEA 1LRKA 1YQGA 4IGFA 5BQFA 1AXGA 1HZJA 3FN4A 5JY6A 1HSZA 3L6EA 2BD0A 4MKXA 2PD3A 3PLNA 1I10A 1B8PA 1K6IA 1OAAA 1YGYA 4DWVA 3V2GA 1L7DA 1LC0A 3MTGA 4LVCA 4EUEA 1C1XA 2QW8A 3IUSA 3RBXA 1XWFA 1DIHA 1I3MA 3DXFA 1CWUA 2FZWA 1NM5A 3WYEA 2Y1GA 3QVWA 1RM5A 4FBGA 1IOLA 3N7UA 1SEVA 1KVSA 2DFVA 4WLNA 4J7UA 3WGIA 1GUYA 1E7SA 3VH2A 2PKQP 4CM7A 4WLEA 2QHXA 3H9EO 1DHTA 4GVXA 1NAIA 1WWKA 2GN4A 2GUGA 4W7IA 2J3IA 4J16A 3RUIA 3HNPA 3AFNA 2ZB3A 2DBQA 2W90A 1ZMTA 4CMEC 5I7FA 3LLSA 4OH1A 3E1KA 3A9WA 1W0CA 1P0FA 2VZ8A 5EJ2A 3GK3A 4FFRA 5HRUA 2Z1MA 2ZTVA 2P9EA 1E6WA 1Y9EA 2P4HX 4O63O 1BMDA 3TL2A 3JQBC 1P45A 2A35A 4HX5A 4OYRA 4XJSA 3W8EA 5ER6A 2HDHA 1G0OA 3WB9A 5G4KA 2I3GA 2NNLD 3EC7A 3RC7A 4RPJA 1PJ3A 3TPCA 2YV1A 4LSWA 3DFUA 2CFCA 5ILGA 5KKCA 5C7LO 1KS9A 4FN4A 1DEHA 1FXSA 3F5QA 3NYWA 4CMAA 4I5EA 1I3LA 4OXYA 3W4JA 4Z6KA 1NVGA 3PWZA 3NT4A 3ZI0A 3QLJA 4G5HA 5JAMA 2PZLA
chains in the Genus database with same CATH superfamily
4ZVKA 1XKQA 4MV0A 4ZA2A 4WL0A 1JAHA 2PEZA 3P27A 3QRWA 3PQFA 4KRXA 2E82A 2OQRA 2AE2A 1MQAA 4CE6A 2ECPA 4NPAA 1RLOA 4GF5A 4JROA 4L76A 3RS4A 3WR5A 4D9MA 3JRXA 1BWPA 2GEVA 2G7ZA 1ZMXA 4DGSA 5DBIA 1BJRE 3E3MA 1G3UA 4IZ6A 5UKDA 4CM3A 1RBYA 4CKBA 4EHKA 1Q15A 1REQA 4PWZA 4DLUA 3IDQA 1ZD9A 1GVHA 1QFZA 1EH5A 5CLHA 2Z5VA 3DPSA 1U7DA 1NQTA 2YNMA 4E94A 3ZWVA 4RH1A 4V0MA 4C1NA 3RGGA 3ZBQA 4NFLA 1HT2E 4JITA 1RRGA 1ELOA 1KO8A 1GO2A 1ZYUA 3EQ7A 2PT7A 2ZSAA 3JWGA 3KT6A 4DNXA 3FSEA 5AXCA 5BMOA 3QG1A 1E2IA 1NG9A 1LX7A 2HUNA 1P1KA 3T34A 5JPCA 1F3LA 1K27A 2BCJQ 4HTFA 5IM4A 1JF8A 3M82A 2QUHA 3LSTA 4GICA 5HCUA 6Q21A 1RM3A 3ICCA 4RL4A 4EZIA 4BQSA 4L6CA 2ODPA 3G8YA 1A8IA 2QX4A 2XRFA 1HE8B 3QX3A 4DPMA 4TTIA 3AL0C 2V3VA 2F8TA 2J3HA 3CWZA 4P4SB 4LBWA 4LXGA 4JB8A 1ORHA 3SY8A 4Q9IA 5THKA 3N0VA 1R0WA 1NW7A 1E89A 2XYGA 4UARA 2CXXA 2AJBA 5JMOA 2VK2A 2HNBA 4PX9A 3QX7A 4IUBS 1GL9B 2EP5A 3HLTA 3CE9A 1QYIA 4KFSA 1KYWA 5DP2A 1QUFA 1WXEA 4UAUA 1U3TA 4F6RB 1VA4A 4RIHA 1VLVA 4PC2A 3VAAA 1ZC3A 3UM9A 1YHZA 5EL0A 2OQ2A 4ILKA 3AX6A 4LOAA 4EQ6A 4KKXB 2CXOA 2AJLI 4R1PA 4W5WA 5H82A 1I2DA 4MQ5A 2V3WA 2HLHA 5DK4A 4FLFA 1Q74A 4AJIA 4U7FA 2W2KB 3ADPA 5ILOA 4A82A 3RADC 5AK0A 4YV0A 2J85A 1C81A 1H3FA 1T36B 4IX9A 4O4IB 1D8AA 3GELA 2UUCB 1TK9A 1G21A 4W5RA 2E4VA 1Y34E 4O33A 4PGGA 1OAKA 3OJOA 1COWA 1IQUA 3SJUA 3OPQA 3CO5A 5A4KA 1W0KA 2WHYA 5M29A 1SVIA 1ZEJA 2X5OA 3SYTA 5T57A 4QEKA 4TV9F 5I7SA 3GNTA 1VIYA 3AYZB 3ZVKA 3BAFA 3PNKA 4H3SA 4PLZA 2Z1DA 4ARAA 1QLWA 3FOFC 4M8IA 3W5JA 2B7BA 2RHCA 3N2NA 3BWCA 5H16A 3RT7A 1IL0A 1ZITA 2B4QA 3OIFA 2XDQA 1NI3A 5EVJA 1ZDMA 1RXVA 2Y66A 4KLNA 3UHFA 3VZSA 5BN5A 1OPXA 4MEJA 1N2CB 1A7JA 1NJSA 2VWPA 3F90A 3I2FA 3TLCA 5K5EA 1N36B 4WN9A 2QF7A 1DKQA 1PG0A 1VZ2A 1MOZA 4U8GA 2OEPA 1WSWA 2WWHA 3CO0S 3BXZA 1Y8CA 1FPQA 3O91A 2MSLA 2YIDA 1UBGA 3EA4A 1AHPA 4CG3A 4YRJA 2BFFA 3WNCA 1GKYA 3ESCA 3HCDA 3TOVA 1OYYA 3ZV7A 3BHIA 4N3NA 2A92A 1MV8A 2P3OA 4CLRB 4QOJA 4ZALA 4R2JA 3UQYS 4EQZA 3VOTA 1DJNA 3LWZA 1PUXA 1R50A 1SG0A 1AOXA 4RJIA 2AVDA 2G88A 2ANCA 5BSVA 1PBTA 3SQDA 2A84A 3EZFA 1EU1A 1MC8A 3K9BA 3QMPA 2JJ1A 4IO0A 4OMCA 1DXQA 4QIHA 3VXKA 3FCCA 1VHDA 5F4BA 5JHHB 4CR8A 4INAA 2XUJA 5BQ5A 2GAOA 4DT1B 4E11A 5F7OA 1J1UA 3M49A 3I42A 2PKQO 4OGGA 2BI8A 3UICA 1JE0A 2EIXA 3HCNA 5A0FA 1OTHA 1WTCA 2ZCUA 5GZ1A 2ZOSA 4EABA 4GS5A 5JJLA 4I8IA 3GJ3A 5H3HA 5JAPA 3DDOA 2L18A 3BA1A 2FQYA 4HGNA 1GNTA 3RSQA 1JHQA 1HF3A 1I1HA 1J8VA 3A1FA 2CLHB 3C14C 2ZIVB 3CM0A 4RUKA 2W2PA 1R66A 2FFJA 5DJ5A 5KNBD 2I0FA 5JQGF 4BGVA 1EJ2A 1P61B 2ZDGA 3BZWA 4B6RA 5IDVA 2P75A 1SH7A 1RI5A 2H1IA 4GFDA 4OP2A 3TXAA 2IYSA 4BMYA 2CK3A 2IW1A 3EMVA 5C3UA 4DQXA 5KX5B 1P7VA 3K6SA 2RGWA 2WD9A 2RAFA 2XA9A 4MVJM 2HGZA 4K1XA 3S5UA 2BF4A 3RVQA 2YOHA 4AXXA 2MYUA 3AU8A 1X0VA 4Q19A 4BNYA 1G8MA 1S9DA 3GFQA 4ZJUA 3ZCPA 5LKAA 1SHJA 2XIJA 4XUDA 3ZI4A 2C0CA 3CVOA 1U3WA 1FNSA 3B12A 3DZJA 3HBMA 3LUPA 4JB3A 4BVJA 1CZNA 4LE1A 2LZ0A 2HSZA 1RAGA 2PEYA 3AMVA 2ZYWX 3L4BC 4J0HA 2DCUA 3K9QO 1JZTA 3N0WA 3NS7A 2IP4A 5J5VA 1KE1A 3JASA 1ZZEA 4HI0E 3MWDB 1OJLA 4HDOB 2D54A 3EY4A 4IVNA 3RCBA 5BURA 4ZU3A 3QVOA 4BU0A 4MK4A 2ARKA 4B47A 1JHRA 3O4JA 3IKLA 4X8MA 4F5YA 5KOHB 1T5TA 3VPSA 5JJIA 2QTBA 2B92A 1M2GA 1OY1A 5GONB 3TGPA 2FP4B 1GKLA 2BGIA 3TRFA 3O4GA 2VSOA 4H1HA 3H97A 4COOA 2NZVG 1JMYA 1V6AA 2PBZA 5DVZA 5JNUA 4RD6A 3SCZA 4UOZA 4C0BA 1XCLA 1JIXA 3ZNPA 3EMBA 2R9VA 1WCIB 2OCKA 3CCCA 3ZV5A 3G0OA 1EFPA 2JRCA 3Q85A 7GPBA 3GRKA 3QEMA 3WKBA 1QG6A 1EX7A 4NOLA 4TXJA 4ZZ0A 5L6MB 1CV2A 4N82A 3H75A 1RXIA 3HJNA 3V80A 3LKDA 3WNZA 5HHTA 2RONA 4YCJA 2E85A 1GWNA 3B9PA 4ZT5A 5T4FA 4ZOEA 4ND8B 2IHNA 1GZ5A 4UULA 3QOYA 1C0IA 2N9UA 1LJUA 3DMHA 4IEEA 4QHTA 2P79A 5AI4A 2ZB2A 5EJ9A 4D0GA 1CZKA 2E4YA 4I50B 5IXYA 1RQGA 1UJNA 3JARA 1JLLB 4F21A 4IF4A 1Y8RB 3N87A 5EIWA 5FT9A 1TVCA 3JYNA 4MLPA 4DADA 3U3XA 2WZQA 1PT5A 4AULA 2H29A 4HLUC 1U2EA 4RSRA 3RS7A 1R5JA 4PCLA 3WGHA 3S1AB 4MYUA 2V7TA 5HS6A 1XQ1A 4MW0A 4LYGA 5T5QA 3PD7A 3R3SA 4AIIA 4QOIA 1KPHA 1Q1BA 4UNPA 1Z5GA 1N7IA 2XNJA 4R1SA 1ZL2A 2G8LA 3DDUA 2LIVA 4ZPJA 3X3HA 2GRAA 2QU7A 3BH6A 5FL7A 4YRLA 2GCEA 2DUMA 1CRLA 3O2NA 4NBSA 2HREA 4JDPA 2OA0A 3PC7A 3K31A 3ZXXA 4MUEA 2GA8A 2MJLA 5A3JA 2V97A 3UT0A 4HO1X 3H11B 2V8BA 4G9GA 1W8IA 4XRRA 3KZ1E 1OASA 1UXIA 3G9QA 1KYTA 2BFPA 2C2MA 4HAWA 4RVNA 3TZQA 5EJ4A 3GYGA 3NC4A 5C8XA 2C5HA 1E2KA 3O3MB 3BREA 4PU0A 4LJLA 1JT2A 2BKUA 4PQEA 5DM60 3IEXA 3JQ8A 1M5TA 1TX4B 2IP2A 4JQSA 4NNPA 4KITB 5B4VA 3B6JA 1T3TA 2ATEA 3DEYX 5JARA 2YYZA 2HDNB 3KV1A 4FFNA 4JC0A 1E6CA 2B34A 3BM5A 4LYJA 1MGPA 1MD9A 3L7NA 4AKTA 4O08A 3IC5A 2O0KA 2QORA 3FMGA 1W48A 1ZI8A 4PQRA 1H66A 2G1KA 5K3AA 5DXAA 1BDMA 1IUOA 4F8YA 2PZMA 3SHQA 4F38A 1AS3A 4TV8A 3Q15C 4L02A 3AU9A 5DDIP 1T9GR 4L15A 1MHPA 2GXSA 4KSCA 3GLGE 2LCFA 16PKA 1MFPA 2ODBA 4NCXA 5LQUA 3IP8A 2EGUA 5LZ2A 1WZEA 4FOSA 3WNDA 4JJIA 3TQOA 2IS1A 1BW9A 1DIRA 1YQUA 4A2WA 1UZUA 2UKDA 2DQSA 1I13A 1S7GA 3DULA 3PFHA 4MVJH 4BE9A 4YR7A 1Z35A 4QFDA 1S96A 1ZHHA 1QF6A 3SX4A 1RWKA 4YAWA 1GLVA 2FLKA 2ECFA 2V3CC 3WLIA 2H1VA 1FJ2A 1DI0A 3GPIA 1D1PA 1HT3A 1JSRA 2A0YA 5KX5A 4O4JF 3IKMB 1GKUB 4KSYA 1J23A 1TI7A 1I0LA 3FTPA 5AKIA 1WBJB 3RVPA 1Z0DA 3SXPA 5PGMA 4S05A 1XDWA 3IAS1 2G5TA 3W7VA 2DBVO 1OIXA 1ONPA 4KQ9A 1VSQA 2QWXA 4XLLA 3D54D 3QU5A 1OVMA 1ZM3A 4ZICA 4QRHA 2VAXA 5JS2A 1ULZA 3JWPA 4HLDA 4AKHA 1U8YA 2G28A 3EOBI 4UFOA 1DMSA 3CH7A 3PXXA 2CLDX 1BS9A 1VJ0A 3DOEA 3KBBA 1KFEB 3PI6A 2O3RA 3QWHA 5EGSA 4DPKA 2B36A 2HXGA 2ZI4A 3IRUA 3PEEA 4IDPA 2WTUA 4PO8A 4DA4A 1EWQA 3OHPA 3UB2A 4O5AA 1ZNZA 2PRKA 2PU5A 3CKMA 3NDRA 1Z9BA 3Q0TA 5HBRA 5IVIA 5F64A 3KLBA 3TTXA 4BN0A 1DKNA 3A9UA 4KUHA 3LTNC 4YT2A 5HXAA 4UUNA 4LDNA 4QEDA 2JAOA 1SIBE 1EFPB 3RSHA 1FOEB 1FSGA 1QVWA 3QX8A 2FUEA 4J16C 3ILVA 1XAHA 4ZEOA 1UPTA 3LP8A 2AH5A 2B98A 3D6MA 2ZXEA 2WSSD 2I9PA 5G41A 3H17A 3ABQB 4XIIA 4GXRA 4C7JA 3ZW9A 1A9ZA 1FSZA 2M98A 1HDIA 4PRKA 4RS4A 4EI8A 4ER7A 4R71A 1YQWA 1YDMA 3ID6C 4FYXA 2Q29A 4QULA 1NJ2A 3WK5A 3PQCA 5KYWA 1GIAA 4JUBA 4OHPA 4PZAA 1F6WA 2WWIA 3L07A 2VYCA 3H3JA 1NUTA 5TQ2A 3PJRA 3AI1A 2GFIA 4Q1EA 4RFSA 2DQYA 2ZE7A 2BBOA 3AVPA 1C9EA 2C9MA 2H07A 3L6CA 4JFAA 1W5AA 4OJTA 4NX2A 4QEZA 1G291 3P2IA 2GLTA 4MYRA 4M7RA 3DQZA 4QDOA 3WKCA 4NCKA 4Y1EA 1JDNA 3Q0IA 3GRZA 3T52A 4EPXA 3Q7SA 3OBIA 1XRSB 2RH9B 4IJ6A 1DMRA 4Z4EA 1C2YA 1CZHA 3G2QA 1NOKA 5ALKA 1XLWA 2BMEA 3T06B 2AL7A 3NHJA 2KM1A 1DTSA 3OT1A 5EE3A 1N0IA 3AJ9A 3BDIA 3GFOA 4G0OA 1O94A 3NV9A 2RG7A 4RF3A 4AMGA 1M8KA 3A04A 1XRJA 4M49A 3ZD6A 4BTLA 4JR0A 1H5UA 4D98A 1RQ7A 4I9HA 1YUNA 4WCFB 3EH1A 3HB4X 4A8HA 2XIQA 4U00A 2FDCA 4YT5A 5ALNA 2JCSA 1RTTA 1TVKB 1GNQA 2Q2WA 3IUYA 1B1AA 3CNEA 1ISJA 5D5HA 3WJ1A 4B40A 4F45A 2XEDA 4IOKA 3L1HA 3TQCA 1GQ2A 1K5PA 2CXSA 3AHIA 5JC8A 1HZZA 4QYWA 1H4TA 1PZGA 2BKAA 2JFUA 1LJ8A 1K7FB 5EZ6B 4JP8A 3SLKA 1PR1A 4URHA 1KMHB 3B48A 2W93A 2GOYA 4HFRA 1V4BA 2C8JA 4KDCA 5HBGA 3UA4A 4WJLA 4MGZR 4KQGA 1J24A 4N0QA 4HY3A 1I1QB 2Q62A 4CF4A 1XHLA 2QTLA 1M2EA 1JXQA 1YQTA 1VJRA 2I3AA 5FA8A 1K3TA 5T8KC 1SQSA 1FFWA 4EJ6A 1HQCA 3O4HA 4MVJP 4L4YA 5KAMA 3RQIA 3FYCA 3VI4B 1PFVA 3NBXX 3PVCA 3GLTA 2HCJB 5CNMA 3THSA 4P4SA 4XGRA 5KDOA 1EX6A 3DD1A 3BMQA 3P9XA 2VHWA 4K6FA 4LCBA 2FFAA 5DNUA 2PGOA 1WMEA 1NUQA 4D92A 3VZRA 2JARA 3PWKA 1F9AA 4JSRA 4QSMA 3FCYA 3KOWA 2CNDA 1N4AA 2JIOA 2X4LA 2XCUA 4OHFA 3WRWA 1Q7TA 1HDEA 5P21A 4RIIA 1EPUA 2CBGA 2X3FA 3KFXA 1EB8A 3MYRA 1WEKA 1ZGZA 1DIBA 3DXZA 3E3LA 3ORRA 2F8SA 4YHBA 2AJTA 1UBMS 3FBWA 4MB2A 3BIXA 3URKA 4ITVA 2EF0A 3CF6R 2YIMA 2Q49A 1M2VB 1Y33E 3B5IA 2GBPA 3ROFA 3IO3A 1IOZA 1NT2A 3HO6A 4PXAA 3ZQKA 1DC7A 1AVTA 1O96A 2UZ0A 3ZW8A 2I91A 2W6PA 3UMBA 2YJZA 1Y6RA 5IAAA 3TLGA 1PD1A 1Q0UA 2A1UA 4KE6A 2HK7A 1Y82A 3MS7A 3RC9A 5IAKA 3TQQA 2QTNA 2V6JA 4N54A 4E4RA 2YHIB 1O2DA 2CHFA 2ZUCA 3CXRA 4JMLA 4RLQA 4XGIA 3T7RA 3WWCA 1OW3B 1ZJZA 1MEOA 1SVWA 2GDZA 4DA9A 3T1QA 5FWYA 1SVMA 3HMKA 3PHGA 4MUHA 4WLVA 3GLVA 4IQ8A 2QVGA 1GP2A 1BGVA 2PUWA 3D8TA 3QX9A 3AWIA 5FH9A 3AM1A 2XF8A 3FH0A 3NTVA 4IP0A 4PLGA 1Q0ZA 2QMOA 5DIZA 3UENA 5DKFA 3TSZA 4BAGA 4BZPA 1VLJA 1I3OA 4E14A 3RJ5A 1P0PA 1T6YA 2QTRA 5HTOA 3RSOA 2LCQA 2OAGA 2ACVA 1QZXA 4I46A 1E7RA 5IN5A 3KJXA 3WQRA 3U0BA 2W7TA 1XZFA 1WVIA 1XZKA 2A4KA 1GCUA 1T91A 1UKVY 4KUEA 1DADA 3FMPB 4AKGA 2GM9A 2R60A 1DX4A 1SVKA 3ZVRA 2C2HA 1E8DA 2VPXA 1PVVA 4IQGA 1HORA 1JTEA 2XAAA 1WD5A 4KMMA 3PRKE 1W1UA 4G1BA 5CNKA 1S3GA 3ACBA 3VO8A 3WRXA 1I6LA 1JLRA 3KO8A 3MN1A 3P96A 3F74A 3NOQA 1MIHA 2NXNA 3U7QB 3IBCA 4M1OA 2IRWA 4KPYA 3RVSA 2IH5A 3L1KA 1MFZA 1IB6A 2VPIA 2OCGA 3GAFA 2FK7A 5D84A 1N6PA 5J4LA 1HYBA 3RG2A 5D8DA 3RWMB 2DETA 4ME6A 1KSGA 5CXXA 4UTRA 4QG3A 1U2SA 1SPBS 2OHJA 3LBFA 1JAXA 5DYGA 3R5HA 4AG6A 1Z4PX 5GJWC 1FL9A 5FB3A 4ABYA 1WE2A 3L6UA 4GKAA 4EKGA 1PFGA 1NDHA 1MIOA 5CK5A 3TRKA 2ZZNA 2R7NA 2PCJA 2X15A 3ZYZA 3QEBZ 2O8EA 1GARA 3O74A 2ZAYA 2XHZA 2CDNA 1G60A 4Q3AA 4YAKA 3L84A 3LKZA 1YNSA 3WGGA 3WRYA 3W6PA 4XYMA 2F67A 5ALZA 4PIMA 3RPEA 4ESVA 4XM0A 4R0MA 2PS1A 1BHJA 2G0AA 3LX6A 4O8CA 4TMWA 4WASA 3ZWPA 1SUSA 2IYQA 4QODA 3QI2A 2CLSA 3VR5A 2M1XA 4XIYA 4ZOAA 4EG8A 4TXHA 2GZHA 2JFVA 2NZXA 3SDZA 4TT3D 2A67A 4TVOA 4LRYA 2WG1A 1PFWA 2QI9C 2ZJFA 2E5LB 2BGGA 1MZVA 1XJCA 1ES9A 3A1DA 2FRDA 1W35A 3V8EA 4E0BA 2CNOA 3IVMA 3MGAA 1FNDA 1Z8HA 3MAAC 4BYGA 3HXOA 4O4IF 2C8KA 3EW7A 5U4XA 2VTBA 2GZ1A 1XQWA 2Z2KA 3OEYA 3TQHA 1LV7A 4F5EA 4QGHA 2Y2VA 1QCCA 3AM4A 5DCLA 1SIWA 5GIOE 1YDGA 1OGIA 4YC7A 3SBEA 5FTNA 2XB8A 1G4HA 3U2QA 5FADA 4Q4CA 4DB2A 1I3NA 4PRLA 1IUKA 4KN9S 1KZ7B 4CCAA 3FWYA 2DMRA 3M5CA 5HUJA 3V00A 1FJXA 1M0TA 3ESDA 3N7AA 2JCVA 2JRLA 4DV5B 3O2QB 3OT4A 4EKDA 3JWHA 4PG4A 4ZYTA 5EHXA 2Q0QA 4CKWB 2ZTSA 1SOWA 4LMPA 1PWYE 5ALLA 3VDXA 4E31A 2IDZA 2N0SA 5D51S 2ECKA 5C1BA 3MAGA 2XCLA 3KT0A 2G1UA 4FZVA 4MRSA 4LZLA 2OV4A 5B6PA 1RXWA 3PGXA 1OT3A 1X7ZB 4MEAA 4XJXA 3DEIA 4YTEA 3EXEB 1ZKDA 2WVJA 5BYBA 4BUJA 2A57A 2WMNB 6LDHA 3QHAA 1AQUA 2D8MA 3PT9A 4XWAA 4AQDA 3FMIA 3LUBA 3SGLA 2NU6A 4PYMA 1T1GA 4BEBA 1SG6A 4D9CA 4UQOA 3I12A 2W6ID 3STXA 3BMOA 1YFLA 4JI6B 5HKBA 4CMBA 4LY9A 4ESEA 3L7JA 1V8FA 3KLPX 1YHNA 3K70D 4XSGA 3SJAA 2A0FA 1G21E 2H1WA 4LDPA 1J97A 1NNLA 4MUGA 1QDUA 5DTQA 4KQ2A 4M9QA 5CDSA 5EWJA 2PS9A 1ZA1A 3BRWA 3HUEA 4JGIA 4DYHA 4ZXFA 3WMRA 2JLWA 3KVNA 3X43A 2VPTA 3V6LA 1IEWA 2G3YA 1Z12A 4R1NA 1DGQA 4AVYA 3ND7A 2VKQA 2D3WA 2ZJ1A 1K5GA 2X22A 1G9TA 4JL8A 5L3QB 2VTBB 1NW4A 4H16A 1VBMA 5C53B 4YYEA 1UMKA 1J00A 3P4XA 5EC8A 2QLTA 1V1RA 5C31A 4HX9A 4EBBA 5HIMA 4YS6A 3O5AA 4LFBB 5K0TA 4HEA1 2DQKA 1R4MB 3MS2A 3FJOA 4M8SA 4OXKA 5T7BA 5I6DA 4MARA 4KYUA 1TEZA 2IEBA 1ZCFA 1P7WA 1V9CA 3OPXA 1RAIA 2ZJYA 2GN6A 3DNPA 3ACDA 3L6DA 1LWOA 3AP2A 4LC1A 5E38A 1E4VA 3N8IA 1PEAA 2CXQA 3GLIE 5EHQA 3PE6A 2JCBA 2EZTA 4GR9A 2PO7A 1BXZA 2R4QA 1JEYB 4HWOA 1B6RA 4RD0A 3HKCA 4BRZA 3UPDA 4Q7MB 5H5JA 3CS3A 1V9SA 4TN5A 2FR8C 4UHJA 4Q7QA 3QBVA 4KWTA 5FA6A 3W2IA 3T3EA 1Z4MA 2IJGX 3JYQA 3QU4A 1TQ4A 4LMRA 3U9LA 3OZCA 5B4TA 3AQ4A 4XD2A 1TZKA 3A3OA 3KWMA 4KBGA 2PUBA 1RWMA 2EXXA 1HG0A 2J9FB 4CKEA 4Q1AA 3NBMA 1EM6A 2X3YA 3LNCA 4WZBB 2VSXA 3HCCA 1CJUC 2VI5A 1TZCA 2FMXA 1WLYA 1FP2A 2YN4A 1AKRA 4DY6A 6NULA 1CQWA 2R84A 4KXLA 2JLYA 1XJ5A 1YZ3A 3CVXA 3VPGA 5HIAA 1RC0A 5IKEA 4MW7A 4LRQA 1LFAA 1XPJA 1DCTA 4RC9A 3N0XA 3DT8A 1W36C 1DO2A 1KY3A 3ZHSA 3KQLA 3C5VA 5FHQA 2AD5A 1UP6A 2HU7A 1VPEA 4MDYA 5CT8A 3VFDA 4YCSA 1BN7A 1Z6TA 1TUEA 2R0QC 4JI1B 3W2FA 3HYSA 5FYQA 1B8VA 1K1EA 2UYGA 3QFFA 5DLPA 1CT9A 3L0CA 4IOLA 3FOEC 3WSWA 1HFEL 3NAGA 3AXTA 5ERYA 1GGJA 1ANKA 1V1RB 4JBIA 5M7EA 2PGJA 2GHRA 1JG6A 3CUEF 5A4DA 3OC6A 3HGTA 5B3AA 2Y99A 2P6UA 4RHCA 4Z0HO 5JNVA 4NCAA 2WSIA 3A1UA 3KKLA 3FE2A 3A3NA 3QF4A 2EFGA 2GO1A 3HR4A 3VTZA 1Z83A 4CM8A 1E9BA 4PFJA 2EWMA 2QG9A 2H0RA 3ESAA 4XE5A 4G5RA 1EESA 1A98A 2DLDA 2LPMA 5HDQA 5TVGA 3A6LA 1FTYA 1N2GA 5K0JA 2AXEA 2AFHE 4ER6A 3CUWA 2HXYA 3TO5A 2WFMA 1ECPA 1Z82A 1GPKA 1CJTC 1FFXA 1I9CA 4HZGA 1UOOA 5DCWA 1AN9A 4KMOA 4DMUB 1KS2A 3TRIA 1X7XA 1E92A 2ORVA 3OHMA 2W11A 3BMNB 1U2DC 2P9FA 2BH9A 3H11A 5GV7A 1Z5NA 4XASA 2REBA 2R1TA 4L2IA 3BC1A 3COPA 2HBZA 4X1IB 2O8BB 2VF5X 2Y3IA 3GRUA 3HS3A 1OZGA 4PO9A 2WHPB 4UHKA 4BNIA 2OPHA 5AOAA 2QJFA 3KAJA 4TMFA 3M0EA 5AKKA 1T15A 1PJLA 1E9DA 2RHRA 2XKAA 5EQDA 3WK8A 1KVRA 2OL4A 1XVUA 3LFHA 1V7CA 1JR3A 2PSDA 3WBJA 2QN6A 5AVVA 4BJ5A 1PE0A 2C2ZA 1UPUA 1GCAA 1R15A 2CC2A 2GF9A 3DT6A 3MB5A 2WEKA 1ZUNB 4HSGA 4Q1DA 5LFAA 1OH6A 1X3LA 1UPXA 2NO7A 2VSYA 2H8KA 1DAHA 3KKQA 4M53A 4W6QA 1JJFA 4MPRA 4C4SA 4NBVA 2QRGA 3WFIA 4BNKA 1QKKA 1RHJA 2HBYA 3MTIA 3ORQA 3N5CA 2ONJA 3ADOA 4AF8A 1QZZA 2D1TA 4I08A 4D02A 1OXUA 5IC6A 3S7ZA 4C2TA 5KSZA 4DABA 4YRIA 2Z56A 5DI3B 2CWWA 3LY9A 2XZLA 4G3XA 3RRFA 1EDDA 2XDAA 3D2CA 4NYJR 2VHYA 2H7VA 1EQ2A 1LJLA 3DDNA 3O82A 1CJKC 4OQPA 4BVEA 2H4XA 3U7IA 4DSNA 2GYWA 4ZVTA 1PO7A 1S0UA 3G68A 4G4IA 1FBTA 2E4WA 3ITDA 4WFQA 1QPZA 2I1VB 1KEUA 1FC0A 1GPLA 1W88A 2XNHA 2IIPA 2F43A 4URWR 4Y9TA 2VYNA 2PMCA 3ZGZA 3WGVA 3EAGA 3DXYA 1CQZA 1JIVA 2VPPA 2FWRA 2GF2A 4XWYA 3CU5A 3OLZA 3L7DA 2XMRA 4QUHA 3FETA 3OE7A 2KBFA 2CWDA 1NF8A 3EEYA 3GJQA 2GVZC 1A96A 1XFDA 5HJ5A 1VKZA 3EE6A 2ZE6A 2OSVA 1K0UA 1LDGA 2R85A 2PXXA 2YHIA 3FLMA 1SZJG 3PIRA 1N6NA 2WHEA 2ONCA 3N2GA 3SN6A 3SQMA 3T9EA 3VM6A 4F9TA 8ADHA 1L1RA 4YDQA 5JLJA 5KINB 1F1JA 1TUIA 4J6FA 3VR6D 1M1YE 3P9KA 2GEFA 2VHZA 3EC2A 5DT9A 4E4YA 4LDQA 3U3OA 2EKBA 4B3CA 5BR4A 2QRHA 4I1VA 5A9SB 1GQSA 1XEWX 4R6XA 1XMOB 5SYNA 1QOPB 1LBEA 2Q6KA 3BCRA 4NFHA 2CHEA 4DCJA 2OOKA 2QXUA 3OZXA 3ND5A 4HN4B 4KPEC 4CV2A 4TM7A 1P9LA 3ZCUA 4Z4QA 5AO9A 1KRHA 4O4LF 4KJXA 5DNCA 2IS6A 3PDCA 4CT5A 1DIAA 2IHZA 3HQ4O 4CN9A 2VHQA 2RHMA 5IASA 2VXOA 1IEVA 3I9MA 2IZ1A 2ZRPA 1EA5A 3EPKA 5KX5F 2YX1A 3HCRA 4HEQA 1YK1A 5CDUA 3OU7A 3JD3A 3H5WA 1C9DB 2I6FA 2XNDD 1XFAA 5TC4A 3F9CA 3X1ZA 4L6AA 2XGMA 4AFNA 4DUZB 2XR1A 3MMXA 3VYSB 5I7UA 5CVVA 1XKTA 2XDWA 1J2YA 1ZKMA 2GI4A 4K5QA 1X13A 1Z8NA 2QN3A 4LRSB 3QEKA 4D8VA 4KGZA 2X40A 1LLQA 2K7FA 1B1CA 3LDFA 4M0PA 1A4RA 2YWHA 4GH5A 1MABB 1Z7EA 2WUDA 3I2JA 4RV4A 3CLTD 4WZAA 2C42A 1KO7A 4CTMA 1V8ZA 2HLDD 2VPWA 4ZT2A 4LF4B 2Q2VA 2C5SA 3AKDA 4QDZA 3D3NA 1O96B 3OESA 2WUWE 2C2WA 3QPCA 5F2KA 2YFQA 2JGIA 2AC7A 4NAHA 3USES 1G38A 3WLLA 3K96A 3KB6A 4RKYA 3S4YA 4FT2A 4MQUA 5A7FA 4WHMA 1TVKA 2GLXA 1ZM2A 3C2QA 3EDYA 2HSGA 4RJ2A 3NNNA 4MQBA 3DCJA 4ZQEA 4C7MA 1MVOA 1TEVA 2H2HA 2VAVA 3PGLA 2QMHA 2AFVA 2W98A 1OD6A 1KBQA 3GH3A 3NLLA 4AG5A 3W4KA 2KLBA 4QSHA 4X61A 5EE5B 3SSAA 5C5CA 1N5JA 3AKYA 3KNZA 4X63A 2I4IA 4RXMA 1RKVA 2HQ1A 3KYDA 2BFFB 1BMFD 4JLOA 3SYNA 4TVSA 2UZ3A 4M37A 4W5JA 3LOPA 4FOTA 3R0XA 2CN1A 1J2UA 4EF6A 1Q7EA 2QUIA 2YC4C 1B6TA 1UR5A 2R47A 3E35A 4MV7A 4FW9A 2EWVA 1Z0AA 4BBZA 3FY4A 3WO0A 1OU4A 3R3ZA 5KVQA 2XMZA 5LU9A 3H16A 5JY1A 4NXMB 2QE7A 3F6CA 2ATCA 4JBXA 5F7ZA 1Q0LA 4D97A 2AF4C 4WBSA 1K5HA 1LF0A 3JQ9A 4HUQB 5I8WA 1F7UA 5HOEA 1Y9DA 2VBFA 2H4HA 5F7XA 3PIIA 5K3FA 5EJFA 5HUHA 2D0OB 3N0RA 1T5DX 2HO4A 4P7GA 2REQA 4UDXX 5IW8A 5LDHA 4DXAA 4PBTA 3MM4A 4MUBA 5B2ZA 3QVGB 4ALJA 221PA 2RBGA 2I1WA 1CJSA 5ENDA 1TYDE 5F35A 4XIFA 5KPDA 5E8RA 1CUIA 3VISA 4RA9A 2TMKA 2NXJA 2NV0A 1V11A 4UXHA 2EYQA 2HIAA 2I80A 2BISA 5J1TB 3X44A 3H7AA 3A4TA 4UUMA 5EIAA 2WKPA 3C43A 4CMIB 5IJWA 1N5OX 1MAUA 5B3KA 4U2BA 1O1YA 3H19A 1D2RA 3A25A 4PY2A 2HIMA 1QFJA 3H6GA 4IEFB 1UBCA 5EUQB 5BSEA 2WIDA 5C8YB 4H2DA 2F9LA 3NIBA 5H4GA 4ZPXA 5A3QA 5EKXA 4JS0A 1Z2PX 2ZI7A 3RS8A 1DT3A 4PYNA 4I3FA 1CXZA 4CF6A 4DREA 5IXSA 3AEKA 4QGGA 2B8TA 1VSTA 1ORRA 2I2BA 3G7UA 3RVDA 3EFHA 2CD9A 1YS9A 2QXYA 4M9ZA 1EGMB 5I7HA 3NAMA 1OPRA 4G84A 4ZRMA 1H1DA 2PLAA 5JBNA 1QWOA 1J8MF 2VA8A 2OV8A 1ZJ6A 2OD2A 2XECA 3QHPA 4P3PA 2DLCX 1DBWA 5EVCA 2BN4A 3I3SR 4RV9A 2FHPA 1LZKA 2PZBA 1G7TA 3PC3A 3AB3A 5DB4A 3S81A 4MTCA 1SKMA 4RQAA 1C4OA 4HMOA 4X1KB 2IWHA 4XA8A 5CEEA 1RLUA 4H6PA 3AGPA 4Q9LA 3Q6NA 5REQB 3PUKA 2HL6A 1QV9A 4MIYA 4E51A 1GM5A 1O9HA 4KIFA 2IS2A 5K0NA 4RD3A 3WL5A 2BCGY 4XFDA 1P2VA 3V8BA 4U2EA 4M1TA 1U0OC 2QQ0A 2HJGA 3EUEA 3NGXA 5FOTA 1J09A 2NVUA 3GOQA 3N8NA 1C0LA 1WJGA 3B36A 4B71A 2JS7A 5BQXA 1BIFA 1IK4A 3TINA 4IICA 5KQMA 4BWFB 4DC9A 3VR6H 3EK2A 3KB1A 1ZMBA 2P5SA 3NRBA 2AFIB 3UJCA 2HA5A 2NLOA 3RYIA 3WLJA 3PHIA 4U3JA 4HDRA 4D3ZA 1F14A 5K0LA 1K4KA 1J1ZA 3NJ4A 3O8LA 4NBNA 1TNDA 2HUPA 3ABIA 4W1QA 1AGNA 1HT1E 3HACA 2EG9A 1V16A 1OV4A 3L8ZA 4MMZB 3UHPA 2BTQA 4G86A 4JUCA 1YOVA 4EY3A 1Z28A 3HYCA 1W5EA 2V0GA 2VYFA 1QDEA 1N0HA 2YJGA 3QJYA 4BZQA 1QFMA 2J6HA 1UC4B 1XTBA 3KJNA 4JSTA 5LP6C 1JB9A 3FVQA 1XCOA 1JHZA 2R8OA 2ZI6A 4W1SA 1KHHA 1OBVA 3JD2A 1G20E 4K8OA 2FVYA 4AP9A 1D5WA 4DG9A 1XTIA 2FMKA 3DZIA 3L01A 5L95A 3G79A 4QNNA 3RVBA 4YRMA 1KOGA 2ZWVA 3QUQA 5A2GA 1PNTA 1T2FA 4QYIB 4RK6A 4UE6A 3I3OA 4HTAA 5B57C 3JAWA 5U4QA 1WKCA 1CQPA 2DBYA 3I37X 2PKWA 2QX6A 2OO3A 1T0IA 4MICA 1O97D 2XNDA 1QHSA 1U02A 2AHRA 3LQ4A 2YHAA 3IOEA 1HPLA 4ARIA 3A4NA 3BD8A 1CUAA 1I14A 3F1KA 3QUBA 3RYFA 5BW8A 4ZQIA 3ZU4A 2ZVDA 3EHDA 1TAGA 3AERB 4FMDF 4N6OA 4TLMB 3CSSA 4UBOA 4YN3A 5B3LA 3ZDFA 4H18A 1LQ2A 2C3YA 4EB6B 2A33A 1C0EA 3RUPA 4RVOA 1L0BA 4HNSA 3M4XA 5JROA 3OVMA 1R0ZA 1A04A 1C8VB 1ZK3A 3IEPA 3AEZA 3BF8A 2P2GA 4YXFA 3L4SO 3AVVA 4FR2A 3UJHA 3WL8A 1A71A 4KC0A 1PS8A 2AMLA 3U4AA 2PQ0A 4ZMSA 3DMFA 1NV9A 2GD1O 9MHTA 4OUDB 1QIFA 2PLWA 4D1YA 1CUFA 3E3NA 4GBJA 4JEHA 2IV3A 3EVTA 5GOTA 3RHSA 2GSWA 4AUMA 3IMEA 2G9ZA 5AVWA 4NCBA 2FLWA 3NCTA 4ZTBA 1JU4A 5B7QA 3HBAA 2FW7A 3V1YA 4AQYB 1FJHA 1EWVA 4R6WA 3L0YA 4R8SA 1I33A 4ZU1X 2ZSIA 4HP8A 1XZIA 1ZLXA 3D5TA 2GNOA 4QA9A 4QYTA 5FFNA 4Z0PA 1JWAB 1ZINA 2P2SA 4Q7LA 2F8MA 4U3JB 3I76A 1PQYA 2DPLA 3W5BA 1O58A 2JG3A 2I99A 3RFUA 1SZPA 2AMYA 4TVKA 3ZCVA 3C3AA 3FDIA 2UYCA 3A0RB 3OMXA 1XDZA 1T6XA 2I3ZA 4EAQA 4Q7EA 3PX7A 3EOAI 2PL3A 4HDMA 4NDNE 1L9KA 1OC2A 1H0HA 2VIIA 1DQYA 1J25A 3IELA 4LECA 3ILXA 5AW9A 5IFKA 2FGJA 1V7PC 3A3PA 4TSFD 3BK7A 5HK9A 3NW9A 1FNBA 1PJ8A 1UKBA 5HG0A 1HE4A 4RAQA 2PV0A 4UNSA 1SELA 1U0EA 2V4UA 1W36B 2X0NA 1C29B 1GU1A 3X1YA 1YRYE 2PS3A 3OTQA 2Q45A 1GRNA 1YA8A 5BSWA 2RG1A 3RB8A 1EZ4A 2B2NA 2JEYA 2VK8A 4OL0A 4Q3DA 5ITSA 5B5SA 5F3RA 4ZK2A 3ETHA 5JI2E 4NH0A 3MT9A 1E1CA 3AYXB 4P3NA 5EHZA 3GIWA 3RYHA 1V2HE 1Z74A 1UZMA 4RZ2A 4ZMRA 1RXSA 4QPNA 4XVQA 1CBUA 1ILEA 4M4SA 3NOVA 3BB1A 4U5QA 4U7JA 3TQTA 2IDMA 5CB4B 4CYMA 2F3PA 5LD2C 5GQSA 4DV0B 1SCUA 3D6NB 3D8HA 1CUBA 2QA5A 3Q98A 4P98A 5HVNA 4EJSC 1EE1A 1QQ5A 1TE2A 3W7BA 4E13A 1GLNA 1ESNA 1IIBA 3FZEA 5MF6A 1KEKA 2HSWA 2B2CA 4G4JA 3VHRA 3LG2A 2WR8A 1Q6ZA 1EE2A 3LBYA 4OQLA 3T7KA 3ZX4A 4ALMA 1WUHS 3TDKA 5AVRA 1TO2E 4DIBA 1DV1A 4V24A 2NPIA 3SKYA 5JXJA 3KWFA 4BVFA 3BHJA 3HDHA 3LNTA 3NJ8A 5EQJB 5EUBA 1VSUA 2BHSA 1YAJA 3AOEC 4NS4A 1NVKA 3SZGA 1X9GA 5A9RA 5CBPA 2FOLA 3NVDA 4HMQA 4WAUA 2PR7A 4D4JA 2BMWA 2XMPA 1ZK1A 1EK2A 2PBFA 3GRYA 1E69A 3GD5A 2J6IA 1N9GA 1EFCA 3EXG1 3CR7A 1NHGA 3DBVO 3ENQA 2QYHA 4JQOA 4MV1A 3U39A 2R3SA 3C3XA 3QGMA 3WX0A 5JNRA 1I4TD 1M2VA 1Q1QA 2ORWA 4P08A 1L5SA 1NF9A 3KQMA 2BMJA 1J21A 2MINA 3FYUA 4JI4B 4MV5A 4JXKA 3SF8A 4CFYA 4WZBE 3CHYA 3F6RA 3D7KA 3WBFA 1AKWA 2CEKA 3WOHA 3A31A 4M7WA 4EFNA 1WUYA 4EFLA 4FGKA 5ITWA 3O38A 3GFFA 1GTZA 2EHJA 1XYVA 2CXPA 3OZ7A 5L6LB 3HVKA 1FTNA 3D3EA 5CR9A 2J48A 2XGSA 3JYLA 3FVVA 2CLLB 2O06A 5B1EA 2E5FA 2OR3A 1CJCA 4QTZA 4RL6A 3RD5A 3B20A 3IVGA 3STWA 2JAQA 3R40A 4UXIA 2CVOA 4QUDA 4TX1A 5F5LA 2Y0DA 4YYZA 1JEDA 3CVYA 4QAJA 4YMUA 5JE8A 3JU3A 1QK4A 3R3XA 2FK8A 1MJGM 2Q5FA 1JEOA 3PUVA 1I80A 1NW9B 2NTEA 3LC7O 1Y4ZA 4BJ1A 2F4NA 2Z43A 2QJWA 4IGAA 3AQIA 4XFJA 3RVMA 3W1EA