4QTIU

Crystal structure of human upar in complex with anti-upar fab 8b12
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
277
structure length
260
Chain Sequence
LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stabilizing a flexible interdomain hinge region harboring the SMB binding site drives uPAR into its closed conformation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords anti-uPAR antibody, heavy chain
total genus 52
structure length 260
sequence length 277
ec nomenclature
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4qtiU01
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4qtiU03
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4qtiU02
1CXNA 1ERAA 1KC4A 1NEAA 4P7UA 1LX5B 2BTXA 3ERAA 3KFDI 2H64B 1I02A 1KBSA 3PLCA 1HC9B 2CCXA 1CHVS 1M9ZA 1LJZA 3BT1U 2JVEA 2I9BE 2GOOC 6EBXA 4EY8B 2H5FA 1NYUA 1ABTA 1VB0A 1IJCA 5IMYC 1KL8A 3QB4B 1COEA 2H64C 4XJJA 2MUOA 4ZQYA 1FASA 1BTEA 1RGJA 2FD6U 1W6BA 2LA1A 1CDRA 1KS6A 2GOOB 2HLRA 1CODA 2QJBC 1FFJA 3NDSA 2L5SA 2X8BB 5EBXA 1KFHA 3KFDE 2UWRA 3VTSA 2JQPA 2J8BA 4AEAA 1RL5A 1NTNA 2CTXA 1L4WA 1IKCA 1IK8A 1LXHA 2CDXA 1JE9A 2HLQA 2PJYB 1XT3A 1V6PA 2CRSA 2NBTA 2H62D 2H8UA 1FF4A 1FSSB 2MJ4A 1KTZB 1LSIA 4OM5A 1LXGA 4FAOC 3NEQA 3BT2U 1CVOA 2H7ZA 2K3GA 2CRTA 1CB9A 1CXOA 2ERAA 1CDSA 1KBTA 3EBXA 1BXPA 1PLOA 2BHIA 2OFSA 1HAJA 1H0JA 4OM4A 4QTIU 1IDHA 1NYSA 1S4YA 1ES7B 1QKEA 1TGXA 3U73U 4IYEA 2MUPA 1HAAA 2N99A 4LFTA 2MJYA 1REWC 1TXBA 1ERGA 5DU1A 1CCQA 2H62C 1TXAA 1TFSA 2MFAA 5DO6A 1G6MA 4RUDA 1ZADA 1MR6A 1IDGA 1IQ9A 4FAOE 2ABXA 4BDTB 2MJ0A 4HQPF 1CDQA 1CDTA 1F8UB 1CRFA 3U74U 1UG4A 2QJ9C 1QKDA 1YWHA 1F94A 4BIKB 2L03A 1HOYA 1KXIA 1IDIA 1KU6B 1NXBA 1HC9A 1MAHF 1NTXA 2PJYC 1NORA 1CREA 1JBDA 1IDLA 2QC1A 4DO8A 1FRAA 3HH7A 1ONJA 2MHYA 4UY2C 3FEVA 1DRSA 1KBAA 3LAQU 5IMTD 5DZ5A 2UX2A 2LCRA 1B41B 2QJAC 2VLWA 3EVSC 1CTXA 1JGKA 2H7ZB 3NH7A 1FSCA 1QM7A
chains in the Genus database with same CATH superfamily
1CXNA 1ERAA 1KC4A 4KSNA 1NEAA 4P7UA 1LX5B 2BTXA 3ERAA 3KFDI 2H64B 1I02A 1KBSA 3PLCA 1HC9B 2CCXA 1CHVS 1M9ZA 1LJZA 3BT1U 2JVEA 2I9BE 2GOOC 6EBXA 4EY8B 2H5FA 1NYUA 1ABTA 1VB0A 1IJCA 5IMYC 1KL8A 3QB4B 1COEA 2H64C 4XJJA 2MUOA 4ZQYA 1FASA 1BTEA 1RGJA 2FD6U 1W6BA 2LA1A 1CDRA 1KS6A 2GOOB 2HLRA 1CODA 2QJBC 1FFJA 3NDSA 2L5SA 2X8BB 5EBXA 1KFHA 3KFDE 2UWRA 3VTSA 2JQPA 2J8BA 4AEAA 1RL5A 1NTNA 2CTXA 1L4WA 1IKCA 1IK8A 1LXHA 2CDXA 1JE9A 2HLQA 2PJYB 1XT3A 1V6PA 2CRSA 2NBTA 2H62D 2H8UA 1FF4A 1FSSB 2MJ4A 1KTZB 1LSIA 4OM5A 1LXGA 4FAOC 3NEQA 3BT2U 1CVOA 2H7ZA 2K3GA 2CRTA 1CB9A 1CXOA 2ERAA 1CDSA 1KBTA 3EBXA 1BXPA 1PLOA 2BHIA 2OFSA 1HAJA 1H0JA 4OM4A 4QTIU 1IDHA 1NYSA 1S4YA 1ES7B 1QKEA 1TGXA 3U73U 4IYEA 2MUPA 1HAAA 2N99A 4LFTA 2MJYA 1REWC 1TXBA 1ERGA 5DU1A 1CCQA 2H62C 1TXAA 1TFSA 2MFAA 5DO6A 1G6MA 4RUDA 1ZADA 1MR6A 1IDGA 1IQ9A 4FAOE 2ABXA 4BDTB 2MJ0A 4HQPF 1CDQA 1CDTA 1F8UB 1CRFA 3U74U 1UG4A 2QJ9C 1QKDA 1YWHA 1F94A 4BIKB 2L03A 1HOYA 1KXIA 1IDIA 1KU6B 1NXBA 1HC9A 1MAHF 1NTXA 2PJYC 1NORA 1CREA 1JBDA 1IDLA 2QC1A 4DO8A 1FRAA 3HH7A 1ONJA 2MHYA 4UY2C 3FEVA 1DRSA 1KBAA 3LAQU 5IMTD 5DZ5A 2UX2A 2LCRA 1B41B 2QJAC 2VLWA 3EVSC 1CTXA 1JGKA 2H7ZB 3NH7A 1FSCA 1QM7A
chains in the Genus database with same CATH topology
1CXNA 1ERAA 1KC4A 4KSNA 1NEAA 4P7UA 1LX5B 2BTXA 3ERAA 3KFDI 2H64B 1I02A 1KBSA 3PLCA 1HC9B 2CCXA 1CHVS 1M9ZA 1LJZA 3BT1U 2JVEA 2I9BE 2GOOC 6EBXA 4EY8B 2H5FA 1NYUA 1ABTA 1VB0A 1IJCA 5IMYC 1KL8A 3QB4B 1COEA 2H64C 4XJJA 2MUOA 4ZQYA 1FASA 1BTEA 1RGJA 2FD6U 1W6BA 2LA1A 1CDRA 1KS6A 2GOOB 2HLRA 1CODA 2QJBC 1FFJA 3NDSA 2L5SA 2X8BB 5EBXA 1KFHA 3KFDE 2UWRA 3VTSA 2JQPA 2J8BA 4AEAA 1RL5A 1NTNA 2CTXA 1L4WA 1IKCA 1IK8A 1LXHA 2CDXA 1JE9A 2HLQA 2PJYB 1XT3A 1V6PA 2CRSA 2NBTA 2H62D 2H8UA 1FF4A 1FSSB 2MJ4A 1KTZB 1LSIA 4OM5A 1LXGA 4FAOC 3NEQA 3BT2U 1CVOA 2H7ZA 2K3GA 2CRTA 1CB9A 1CXOA 2ERAA 1CDSA 1KBTA 3EBXA 1BXPA 1PLOA 2BHIA 2OFSA 1HAJA 1H0JA 4OM4A 4QTIU 1IDHA 1NYSA 1S4YA 1ES7B 1QKEA 1TGXA 3U73U 4IYEA 2MUPA 1HAAA 2N99A 4LFTA 2MJYA 1REWC 1TXBA 1ERGA 5DU1A 1CCQA 2H62C 1TXAA 1TFSA 2MFAA 5DO6A 1G6MA 4RUDA 1ZADA 1MR6A 1IDGA 1IQ9A 4FAOE 2ABXA 4BDTB 2MJ0A 4HQPF 1CDQA 1CDTA 1F8UB 1CRFA 3U74U 1UG4A 2QJ9C 1QKDA 1YWHA 1F94A 4BIKB 2L03A 1HOYA 1KXIA 1IDIA 1KU6B 1NXBA 1HC9A 1MAHF 1NTXA 2PJYC 1NORA 1CREA 1JBDA 1IDLA 2QC1A 4DO8A 1FRAA 3HH7A 1ONJA 2MHYA 4UY2C 3FEVA 1DRSA 1KBAA 3LAQU 5IMTD 5DZ5A 2UX2A 2LCRA 1B41B 2QJAC 2VLWA 3EVSC 1CTXA 1JGKA 2H7ZB 3NH7A 1FSCA 1QM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CXN A;  1ERA A;  1KC4 A;  1NEA A;  4P7U A;  1LX5 B;  2BTX A;  3ERA A;  3KFD I;  2H64 B;  1I02 A;  1KBS A;  3PLC A;  1HC9 B;  2CCX A;  1CHV S;  1M9Z A;  1LJZ A;  3BT1 U;  2JVE A;  2I9B E;  2GOO C;  6EBX A;  4EY8 B;  2H5F A;  1NYU A;  1ABT A;  1VB0 A;  1IJC A;  5IMY C;  1KL8 A;  3QB4 B;  1COE A;  2H64 C;  4XJJ A;  2MUO A;  4ZQY A;  1FAS A;  1BTE A;  1RGJ A;  2FD6 U;  1W6B A;  2LA1 A;  1CDR A;  1KS6 A;  2GOO B;  2HLR A;  1COD A;  2QJB C;  1FFJ A;  3NDS A;  2L5S A;  2X8B B;  5EBX A;  1KFH A;  3KFD E;  2UWR A;  3VTS A;  2JQP A;  2J8B A;  4AEA A;  1RL5 A;  1NTN A;  2CTX A;  1L4W A;  1IKC A;  1IK8 A;  1LXH A;  2CDX A;  1JE9 A;  2HLQ A;  2PJY B;  1XT3 A;  1V6P A;  2CRS A;  2NBT A;  2H62 D;  2H8U A;  1FF4 A;  1FSS B;  2MJ4 A;  1KTZ B;  1LSI A;  4OM5 A;  1LXG A;  4FAO C;  3NEQ A;  3BT2 U;  1CVO A;  2H7Z A;  2K3G A;  2CRT A;  1CB9 A;  1CXO A;  2ERA A;  1CDS A;  1KBT A;  3EBX A;  1BXP A;  1PLO A;  2BHI A;  2OFS A;  1HAJ A;  1H0J A;  4OM4 A;  4QTI U;  1IDH A;  1NYS A;  1S4Y A;  1ES7 B;  1QKE A;  1TGX A;  3U73 U;  4IYE A;  2MUP A;  1HAA A;  2N99 A;  4LFT A;  2MJY A;  1REW C;  1TXB A;  1ERG A;  5DU1 A;  1CCQ A;  2H62 C;  1TXA A;  1TFS A;  2MFA A;  5DO6 A;  1G6M A;  4RUD A;  1ZAD A;  1MR6 A;  1IDG A;  1IQ9 A;  4FAO E;  2ABX A;  4BDT B;  2MJ0 A;  4HQP F;  1CDQ A;  1CDT A;  1F8U B;  1CRF A;  3U74 U;  1UG4 A;  2QJ9 C;  1QKD A;  1YWH A;  1F94 A;  4BIK B;  2L03 A;  1HOY A;  1KXI A;  1IDI A;  1KU6 B;  1NXB A;  1HC9 A;  1MAH F;  1NTX A;  2PJY C;  1NOR A;  1CRE A;  1JBD A;  1IDL A;  2QC1 A;  4DO8 A;  1FRA A;  3HH7 A;  1ONJ A;  2MHY A;  4UY2 C;  3FEV A;  1DRS A;  1KBA A;  3LAQ U;  5IMT D;  5DZ5 A;  2UX2 A;  2LCR A;  1B41 B;  2QJA C;  2VLW A;  3EVS C;  1CTX A;  1JGK A;  2H7Z B;  3NH7 A;  1FSC A;  1QM7 A; 
#chains in the Genus database with same CATH topology
 1CXN A;  1ERA A;  1KC4 A;  4KSN A;  1NEA A;  4P7U A;  1LX5 B;  2BTX A;  3ERA A;  3KFD I;  2H64 B;  1I02 A;  1KBS A;  3PLC A;  1HC9 B;  2CCX A;  1CHV S;  1M9Z A;  1LJZ A;  3BT1 U;  2JVE A;  2I9B E;  2GOO C;  6EBX A;  4EY8 B;  2H5F A;  1NYU A;  1ABT A;  1VB0 A;  1IJC A;  5IMY C;  1KL8 A;  3QB4 B;  1COE A;  2H64 C;  4XJJ A;  2MUO A;  4ZQY A;  1FAS A;  1BTE A;  1RGJ A;  2FD6 U;  1W6B A;  2LA1 A;  1CDR A;  1KS6 A;  2GOO B;  2HLR A;  1COD A;  2QJB C;  1FFJ A;  3NDS A;  2L5S A;  2X8B B;  5EBX A;  1KFH A;  3KFD E;  2UWR A;  3VTS A;  2JQP A;  2J8B A;  4AEA A;  1RL5 A;  1NTN A;  2CTX A;  1L4W A;  1IKC A;  1IK8 A;  1LXH A;  2CDX A;  1JE9 A;  2HLQ A;  2PJY B;  1XT3 A;  1V6P A;  2CRS A;  2NBT A;  2H62 D;  2H8U A;  1FF4 A;  1FSS B;  2MJ4 A;  1KTZ B;  1LSI A;  4OM5 A;  1LXG A;  4FAO C;  3NEQ A;  3BT2 U;  1CVO A;  2H7Z A;  2K3G A;  2CRT A;  1CB9 A;  1CXO A;  2ERA A;  1CDS A;  1KBT A;  3EBX A;  1BXP A;  1PLO A;  2BHI A;  2OFS A;  1HAJ A;  1H0J A;  4OM4 A;  4QTI U;  1IDH A;  1NYS A;  1S4Y A;  1ES7 B;  1QKE A;  1TGX A;  3U73 U;  4IYE A;  2MUP A;  1HAA A;  2N99 A;  4LFT A;  2MJY A;  1REW C;  1TXB A;  1ERG A;  5DU1 A;  1CCQ A;  2H62 C;  1TXA A;  1TFS A;  2MFA A;  5DO6 A;  1G6M A;  4RUD A;  1ZAD A;  1MR6 A;  1IDG A;  1IQ9 A;  4FAO E;  2ABX A;  4BDT B;  2MJ0 A;  4HQP F;  1CDQ A;  1CDT A;  1F8U B;  1CRF A;  3U74 U;  1UG4 A;  2QJ9 C;  1QKD A;  1YWH A;  1F94 A;  4BIK B;  2L03 A;  1HOY A;  1KXI A;  1IDI A;  1KU6 B;  1NXB A;  1HC9 A;  1MAH F;  1NTX A;  2PJY C;  1NOR A;  1CRE A;  1JBD A;  1IDL A;  2QC1 A;  4DO8 A;  1FRA A;  3HH7 A;  1ONJ A;  2MHY A;  4UY2 C;  3FEV A;  1DRS A;  1KBA A;  3LAQ U;  5IMT D;  5DZ5 A;  2UX2 A;  2LCR A;  1B41 B;  2QJA C;  2VLW A;  3EVS C;  1CTX A;  1JGK A;  2H7Z B;  3NH7 A;  1FSC A;  1QM7 A; 
#chains in the Genus database with same CATH homology
 1CXN A;  1ERA A;  1KC4 A;  4KSN A;  1NEA A;  4P7U A;  1LX5 B;  2BTX A;  3ERA A;  3KFD I;  2H64 B;  1I02 A;  1KBS A;  3PLC A;  1HC9 B;  2CCX A;  1CHV S;  1M9Z A;  1LJZ A;  3BT1 U;  2JVE A;  2I9B E;  2GOO C;  6EBX A;  4EY8 B;  2H5F A;  1NYU A;  1ABT A;  1VB0 A;  1IJC A;  5IMY C;  1KL8 A;  3QB4 B;  1COE A;  2H64 C;  4XJJ A;  2MUO A;  4ZQY A;  1FAS A;  1BTE A;  1RGJ A;  2FD6 U;  1W6B A;  2LA1 A;  1CDR A;  1KS6 A;  2GOO B;  2HLR A;  1COD A;  2QJB C;  1FFJ A;  3NDS A;  2L5S A;  2X8B B;  5EBX A;  1KFH A;  3KFD E;  2UWR A;  3VTS A;  2JQP A;  2J8B A;  4AEA A;  1RL5 A;  1NTN A;  2CTX A;  1L4W A;  1IKC A;  1IK8 A;  1LXH A;  2CDX A;  1JE9 A;  2HLQ A;  2PJY B;  1XT3 A;  1V6P A;  2CRS A;  2NBT A;  2H62 D;  2H8U A;  1FF4 A;  1FSS B;  2MJ4 A;  1KTZ B;  1LSI A;  4OM5 A;  1LXG A;  4FAO C;  3NEQ A;  3BT2 U;  1CVO A;  2H7Z A;  2K3G A;  2CRT A;  1CB9 A;  1CXO A;  2ERA A;  1CDS A;  1KBT A;  3EBX A;  1BXP A;  1PLO A;  2BHI A;  2OFS A;  1HAJ A;  1H0J A;  4OM4 A;  4QTI U;  1IDH A;  1NYS A;  1S4Y A;  1ES7 B;  1QKE A;  1TGX A;  3U73 U;  4IYE A;  2MUP A;  1HAA A;  2N99 A;  4LFT A;  2MJY A;  1REW C;  1TXB A;  1ERG A;  5DU1 A;  1CCQ A;  2H62 C;  1TXA A;  1TFS A;  2MFA A;  5DO6 A;  1G6M A;  4RUD A;  1ZAD A;  1MR6 A;  1IDG A;  1IQ9 A;  4FAO E;  2ABX A;  4BDT B;  2MJ0 A;  4HQP F;  1CDQ A;  1CDT A;  1F8U B;  1CRF A;  3U74 U;  1UG4 A;  2QJ9 C;  1QKD A;  1YWH A;  1F94 A;  4BIK B;  2L03 A;  1HOY A;  1KXI A;  1IDI A;  1KU6 B;  1NXB A;  1HC9 A;  1MAH F;  1NTX A;  2PJY C;  1NOR A;  1CRE A;  1JBD A;  1IDL A;  2QC1 A;  4DO8 A;  1FRA A;  3HH7 A;  1ONJ A;  2MHY A;  4UY2 C;  3FEV A;  1DRS A;  1KBA A;  3LAQ U;  5IMT D;  5DZ5 A;  2UX2 A;  2LCR A;  1B41 B;  2QJA C;  2VLW A;  3EVS C;  1CTX A;  1JGK A;  2H7Z B;  3NH7 A;  1FSC A;  1QM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...