4QTPA

Crystal structure of an anti-sigma factor antagonist from mycobacterium paratuberculosis
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
116
structure length
116
Chain Sequence
SAPDSITTLVEDHDGVSVVSVSGEIDMVTAPALEQAIGAVVADSPPALVIDLSAVEFLGSVGLKILAATYEKLGKETGFGVVARGPATRRPIHLTGLDKTFPLYPTLDDALTAVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-sigma factor antagonist
publication title Crystal Structure of an Anti-sigma Factor Antagonist from Mycobacterium paratuberculosis
rcsb
source organism Mycobacterium avium subsp. paratuberculosis
molecule tags Protein binding
total genus 35
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 4qtpA00
3LLOA 1T6RA 3AGEA 3LKLA 1TIDB 3MGLA 3IH8A 5EZBA 4HYLA 1SBOA 1H4XA 1TILB 5EUZA 5EUSA 4DGFA 3F43A 1BUZA 1THNB 5EUXA 1VC1A 3ZXNA 3IH9A 5EUWA 2VY9A 3T6OA 3IF5A 1H4ZA 4XS5A 3ZTBA 2KA5A 1TH8B 1H4YA 1AUZA 3OIRA 4QTPA 3NY7A 4DGHA 3IHAA 3OIZA 5EUUA 3IHBA 3AGDA 2KLNA
chains in the Genus database with same CATH superfamily
3LKLA 1FC7A 1BPLA 3F43A 1THNB 1FCFA 1K32A 3VSEA 2DXNA 2VY9A 3K50A 3T6OA 4DMGA 2RRLA 1TH8B 2KA5A 3DJAA 4QTPA 4L8KA 1N6EA 5EUUA 3GVKA 1FC6A 3IHBA 3LDFA 3QDQA 1N6DA 3AGDA 4GHNA 3LLOA 1V0EA 3MGLA 4HYLA 4L1CA 5EUSA 1J7XA 1N6FA 3GVLA 5EUXA 1VC1A 3D3UA 2B78A 3IF5A 4XS5A 2ZOAA 3GMFA 1V0FA 2ZO9B 3D03A 3C0KA 1T6RA 1TIDB 1HF2A 1WXWA 3MOGA 1SBOA 4AE2A 5EUZA 3EH7A 3V97A 3V8VA 5EUWA 3JU4A 1H4YA 1AUZA 3OIRA 3DUPA 4DGHA 3IHAA 2DXLA 2CWWA 3DORA 2KLNA 3AGEA 3IH8A 5EZBA 3GK7A 1WXXA 1H4XA 1TILB 4DGFA 1BUZA 3ZXNA 4HIZA 3IH9A 3GVJA 1FC9A 1H4ZA 4JC0A 3ZTBA 2OASA 3NY7A 3GHFA 3OIZA 4AEJA 2AS0A
chains in the Genus database with same CATH topology
3LLOA 1T6RA 3AGEA 3LKLA 1TIDB 3MGLA 3IH8A 5EZBA 4HYLA 1SBOA 1H4XA 1TILB 5EUZA 5EUSA 4DGFA 3F43A 1BUZA 1THNB 5EUXA 1VC1A 3ZXNA 3IH9A 5EUWA 2VY9A 3T6OA 3IF5A 1H4ZA 4XS5A 3ZTBA 2KA5A 1TH8B 1H4YA 1AUZA 3OIRA 4QTPA 3NY7A 4DGHA 3IHAA 3OIZA 5EUUA 3IHBA 3AGDA 2KLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LLO A;  1T6R A;  3AGE A;  3LKL A;  1TID B;  3MGL A;  3IH8 A;  5EZB A;  4HYL A;  1SBO A;  1H4X A;  1TIL B;  5EUZ A;  5EUS A;  4DGF A;  3F43 A;  1BUZ A;  1THN B;  5EUX A;  1VC1 A;  3ZXN A;  3IH9 A;  5EUW A;  2VY9 A;  3T6O A;  3IF5 A;  1H4Z A;  4XS5 A;  3ZTB A;  2KA5 A;  1TH8 B;  1H4Y A;  1AUZ A;  3OIR A;  4QTP A;  3NY7 A;  4DGH A;  3IHA A;  3OIZ A;  5EUU A;  3IHB A;  3AGD A;  2KLN A; 
#chains in the Genus database with same CATH topology
 3LKL A;  1FC7 A;  1BPL A;  3F43 A;  1THN B;  1FCF A;  1K32 A;  3VSE A;  2DXN A;  2VY9 A;  3K50 A;  3T6O A;  4DMG A;  2RRL A;  1TH8 B;  2KA5 A;  3DJA A;  4QTP A;  4L8K A;  1N6E A;  5EUU A;  3GVK A;  1FC6 A;  3IHB A;  3LDF A;  3QDQ A;  1N6D A;  3AGD A;  4GHN A;  3LLO A;  1V0E A;  3MGL A;  4HYL A;  4L1C A;  5EUS A;  1J7X A;  1N6F A;  3GVL A;  5EUX A;  1VC1 A;  3D3U A;  2B78 A;  3IF5 A;  4XS5 A;  2ZOA A;  3GMF A;  1V0F A;  2ZO9 B;  3D03 A;  3C0K A;  1T6R A;  1TID B;  1HF2 A;  1WXW A;  3MOG A;  1SBO A;  4AE2 A;  5EUZ A;  3EH7 A;  3V97 A;  3V8V A;  5EUW A;  3JU4 A;  1H4Y A;  1AUZ A;  3OIR A;  3DUP A;  4DGH A;  3IHA A;  2DXL A;  2CWW A;  3DOR A;  2KLN A;  3AGE A;  3IH8 A;  5EZB A;  3GK7 A;  1WXX A;  1H4X A;  1TIL B;  4DGF A;  1BUZ A;  3ZXN A;  4HIZ A;  3IH9 A;  3GVJ A;  1FC9 A;  1H4Z A;  4JC0 A;  3ZTB A;  2OAS A;  3NY7 A;  3GHF A;  3OIZ A;  4AEJ A;  2AS0 A; 
#chains in the Genus database with same CATH homology
 3LLO A;  1T6R A;  3AGE A;  3LKL A;  1TID B;  3MGL A;  3IH8 A;  5EZB A;  4HYL A;  1SBO A;  1H4X A;  1TIL B;  5EUZ A;  5EUS A;  4DGF A;  3F43 A;  1BUZ A;  1THN B;  5EUX A;  1VC1 A;  3ZXN A;  3IH9 A;  5EUW A;  2VY9 A;  3T6O A;  3IF5 A;  1H4Z A;  4XS5 A;  3ZTB A;  2KA5 A;  1TH8 B;  1H4Y A;  1AUZ A;  3OIR A;  4QTP A;  3NY7 A;  4DGH A;  3IHA A;  3OIZ A;  5EUU A;  3IHB A;  3AGD A;  2KLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...