4QTZA

Crystal structure of cinnamyl-alcohol dehydrogenase 2
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
321
structure length
321
Chain Sequence
LGNVVCVTGASGYIASWLVRLLLHRGYTVKATVRDPNDPKKVDHLVKLDGAKERLQLFKANLLEEGAFDSVVQGCHGVFHTASPFYHDVKDPQAELIDPALKGTLNVLNSCAKSPSLKRVVLTSSIAAVAYNGKPRTPDVVVDETWFTDADFCAKSNLWYVVSKTLAEEAAWKFVKENNIDMVTINPAMVIGPLLQPVLNTSAAAILNLINGAQTFPNASFGWVNVKDVANAHILAYENASASGRHCLVERVAHYSEVVRILRELYPSLQLPEKCADDKPYVPIYQVSKEKAKSLGLEYTPLEVSIKETVESLKEKKFANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of Cinnamoyl-CoA Reductase and Cinnamyl-Alcohol Dehydrogenase, Key Enzymes of Monolignol Biosynthesis.
pubmed doi rcsb
source organism Medicago truncatula
molecule tags Oxidoreductase
molecule keywords Dihydroflavonol-4-reductase
total genus 111
structure length 321
sequence length 321
ec nomenclature ec 1.1.1.-:
pdb deposition date 2014-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4qtzA00
1ZH8A 4UVIA 3AUSA 2O3JA 4MVJF 1HDGO 2JJYA 1JAYA 4ND4A 3TN7A 3VZPA 2E49A 1KC1A 4E2YA 3DBVO 3EAGA 2DC1A 4P4GA 3HDHA 3BHJA 4NBWA 4Q3AA 4F6LA 1T2AA 4ZQEA 3BMQB 1F14A 5G0WA 4Y67A 1DHRA 3ROMA 3ZU4A 1YH3A 1PJBA 1X13A 1X7DA 4U8GA 1HKUA 2AEJA 2VWQA 2ZB3A 1E1LA 3QQPA 5JMPA 2IXBA 2CDBA 1UDBA 3ZU3A 5L4NA 1P1RA 2FZWA 3OEWA 4CQLA 3QVTA 4IJUA 3WGIA 1VLLA 4Y6PA 3GDFA 3INRA 4DC0A 5HWSA 4GSKA 3DZHA 1H6AA 4L9RA 2HJRA 3MWDB 3RKRA 1EFLA 2FY8A 3I1JA 3GUCA 4JQCA 5I7VA 3ZDFA 3PIIA 3IJPA 4NMHA 1N2SA 3QWBA 2ZIZA 3EHEA 1FJHA 3V5NA 1ZFNA 4A7PA 2B36A 5F5NA 1YL5A 3GAFA 1R6DA 1GZ3A 1P9LA 1VE9A 5ICMA 1ISGA 3H7AA 3RROA 1Y5MA 3WWYA 5I8WA 3GFBA 4BGUA 1PGNA 1K6XA 4ZRNA 1NPDA 3AI1A 3VTZA 4YJHA 1H2HA 3DEYX 4XCVA 2PH5A 3RFVA 1F17A 1YS4A 2AQ8A 4PZEA 2X5KO 3OEYA 1R0LA 1HZJA 1X1EA 2BFMA 5IN5A 2YW9A 3WIDA 5AXDA 3I23A 4IZIA 3A4VA 3VH3A 4WKGA 3PLNA 4GQAA 4PLGA 1PJQA 3U62A 2P4HX 1I3LA 3GEMA 4CM4B 1YB5A 4FFRA 1QMGA 2CFCA 4MOWA 4YJFB 4FD3A 4CMHA 2O3RA 4NK4A 3DB2A 4BNYA 3R3SA 4ONEA 1BWSA 1GCOA 3ZHYA 1G6KA 1LLUA 1LRJA 1ML3A 3H5RA 3L4SO 5IDWA 3PK0A 4PRLA 3WG9A 4CR7A 2OZPA 3VZQA 2JD0A 4IPTA 5JE8A 3UXYA 5B4TA 1SEVA 1Y8RA 1YL6A 4X54A 5EJ2A 4Z3DA 4DC1A 4A03A 4AL4A 2GDZA 1PIWA 2DAPA 1WDMA 2I6TA 4UULA 1HETA 3PVZA 4IJWA 2P5UA 3W4KA 1RM3A 4GMGA 5LCXA 5CEJA 2PLAA 3FWZA 3JYPA 2WD8A 4J1NA 1EVYA 5G4LA 4CMEC 1E3EA 1LQUA 3HDQA 3UH1A 3WLFA 3PZRA 1JN0A 3OQBA 5I9MA 2OHXA 3ANNA 1UZNA 3KYDB 1U28A 3JSAA 4N54A 4OYRA 1I2CA 3DHNA 2P9GA 3MJSA 4CODB 1Z73A 1V35A 3KRTA 4K26A 1CERA 1DC6A 1EQUA 2A35A 3HHPA 1RM4A 4IQ8A 2HRBA 4QFDA 4YT2A 3WIEA 1Z6ZA 4DLAA 2ZQYA 1LSJA 3O03A 3PXXA 4HUJA 2C82A 1ONPA 4MP3A 3TZKA 5IJZA 4GLLA 1LSSA 3DWFA 3K9QO 1EUZA 2Y05A 3JQAD 4P4NA 4CLRB 5FYDA 3A14A 1MC4A 3WGGA 3ZHXA 5JCJA 4LSWA 4YJFA 1LC3A 4W6ZA 3K8ZA 1HZZA 1C14A 1FMCA 1JWAB 1T25A 4MP6A 4K28A 4YDRA 3O9ZA 5IDXA 5AVOA 3OJFA 1DBVO 1J0XO 3NGXA 1ZW1A 4MVJH 4I9UA 4EITA 4GGOA 4HP8A 1V0JA 4W82A 3TOZA 5COQA 2QHXA 1TLTA 2GUGA 3NYWA 1IZ9A 2AEFA 5JAMA 1Y9EA 4WCFB 1NFQA 2C54A 2V7PA 5A4DA 3ZWNA 3E1KA 1LBEA 3A9WA 2WD7B 1Y7TA 1YWGO 4CM6A 3FI9A 4M49A 5GZ6A 2R2GA 4CMJA 2C5EA 3JTMA 2H6EA 3JQ9A 4JN6B 4NU6A 1NHGA 4PG6A 5COAA 5DP2A 2H1SA 1TVEA 1ZEMA 1BRMA 2RH8A 3B6ZA 1L1FA 2GN9A 1T2CA 2A9FA 4E33A 3LF2A 1DRWA 4CLEA 2R00C 4YRBA 2NV6A 2RAFA 1GQYA 1HXHA 3ETEA 3ONFA 4HV4A 1XKQA 3ROQA 1Y6JA 2GN6A 1ZJZA 4E5PA 2X4GA 1BW9B 1E3JA 1WNTA 5ADHA 2H9IA 1I36A 3DHYA 3AW9A 3UICA 3JCZA 2BRUA 2HU2A 4TRMA 3U4DA 1VKOA 2ZYGA 3KV3O 3WBBA 3PHJA 1GYQA 2Q99A 1O0SA 1XWFA 1I33A 4ND5A 3FR7A 4YXFA 1CQJA 4BL5A 1ZK1A 3EVTA 2Y1CA 5AOVA 2QRKA 1KEWA 1SCUA 2VHYA 2IDZA 1E7SA 2IE0A 2ZYDA 1E6EA 2B83A 2I9PA 3PQFA 4XX0A 2NU8A 1P0FA 4YT8A 4K6CA 2YHIA 1E7RA 2BFOA 1LNQA 3K5PA 4GBJA 4KTTE 2HMUA 3LYLA 2VT2A 3AOEC 1QV6A 1Y1PA 1MXFA 4IJVA 1DC5A 1LQTA 4AICA 2X6TA 3EVNA 3IMFA 1ZXBA 1YE3A 2EJVA 1NHWA 1UXIA 2I76A 4YT5A 2Y0EA 5DBIA 1E0DA 4NG5A 4EBFA 4NFSA 2VYVD 3L77A 5TT1A 5ES3A 2VWGA 3QWAA 4YB8A 4ZU3A 3RBZA 2QG4A 3UF0A 2J5QA 3JQEA 1ZO8A 2XAAA 1IYZA 2GYYA 2G17A 4IQ0A 2XXJA 4CMAA 3SC4A 2UDPA 3O38A 3FNEA 1HYHA 2D5AA 4A10A 1DO8A 3TFOA 3S2FA 3F46A 3WJAA 1PQPA 4R9RA 2VCYA 3F3SA 3G79A 2H5LA 2EKPA 2ZTVA 2B0JA 3C1OA 1MX3A 1UP6A 3DAFA 3ONDA 1ID1A 1FK8A 4RLHA 4RPGA 5DT9A 5JAQA 3CMMA 2B69A 1ZSNA 1MA0A 2EGGA 5KNLA 3NEPX 4ZGWA 3N58A 3H9JA 5EQFA 5IFLA 4BIIA 3H9EO 1NAIA 2X86A 4MIOA 3TPCA 4BMNA 1WW8A 4Q3DA 2IODA 5KVQA 4FB5A 3ENNA 8ADHA 1LEHA 4RVDA 4TRRA 4Y98A 4R1SA 5ITVA 1DAPA 4XQ9A 4Z6KA 1ENZA 1N7GA 2FPIA 4TZKA 3Q9UA 4CM8A 1LC0A 1SB9A 4PRKA 4BNWA 3WMXA 4JJGA 3RIHA 4EI2A 3AI3A 1O9BA 3DMTC 3GFGA 4NHEA 1IB6A 1UR5A 3Q2IA 4OOEA 4J0EA 2POQX 3D3WB 3PLRA 3TNLA 4IINA 1BVRA 4LN1A 2RHCA 3LC2O 1DHTA 5KKCA 1RYDA 4ESOA 1U3TA 4JGBA 4PG4A 1R4NA 3GMDA 3B1FA 4MIYA 3ZN2A 1BMDA 1EBFA 3DMYA 3STHA 5CG1A 2I5PO 3FF4A 4BO5A 5IN4A 4UUOA 3HWRA 2Z1NA 3DC2A 5JC1A 3W6ZA 3RUDA 2A92A 3MJEA 2HDHA 1DXYA 4INAA 1SO8A 3JQAA 4FIZA 1ENOA 3LC1O 1ZK2A 4U0JA 4YCAA 3JQ8A 3BAZA 4BO1A 5CDUA 4D0RA 1VL0A 5B4UA 1F06A 5H81A 4BNIA 3OHSX 2IEBA 3F4LA 3OJOA 5DDIP 4DQVA 4IDGA 5L40A 1DPGA 3MTGA 2OOSA 4IDCA 2NU9A 1ZXLA 4L73A 3PZBA 4IXWA 1W6UA 3HB4X 4BVAA 4XYLA 1X14A 4CMCA 1FDWA 4XGKA 3K6JA 4YJHB 3HZZA 1B16A 1MC5A 3RUAA 4M8SA 4W99A 1V3VA 2G82A 4Q9NA 4LGVA 1P1FA 5JFOA 3EK2A 3LF1A 3QHAA 4FQ8A 5AQ1A 1JAXA 2YV2A 1S7CA 2C59A 5DZSA 5AXAA 3V8BA 6LDHA 3PGJA 5F5LA 2FPGA 3BMNB 1PZHA 4XA8A 4QTZA 3JD1A 4ZJUA 2J3JA 1D1SA 4BMVA 4UAGA 4D45A 3WTBA 2OMEA 4MVJD 1A27A 1VL6A 2P5YA 4TKLA 3ZW9A 3QVSA 5A3JA 3DBRB 2WYUA 1E7YA 2Z95A 1PJ2A 4TZTA 1B8VA 5A9SA 1FDUA 4DPMA 3GG9A 1XSEA 2RH4A 5KJ6A 1DFHA 1OBFO 1XA0A 2RHRA 4FBGA 4AVYA 4CQMB 5JDIA 4PGFA 2YHUA 2XXBA 2NTNA 1ADCA 3B1KA 3CTMA 3DBHA 3OBBA 3E18A 4CMKA 4GX5A 3HADA 1T2FA 1P1HA 2BHLA 3VC7A 4E5NA 3WYBA 1DIGA 1JTVA 2WMDA 1DJNA 5CDTA 4FS3A 4FFLA 3ZZNA 5B12A 2ZKLA 4ZHSA 1HDXA 2GZ3A 3DQPA 3PHLA 4KDFA 2NTJA 5CP8A 4Z0HO 4FFPA 1YJ8A 2EJWA 3RFXA 1QYDA 3NJ8A 3JYQA 4LCEA 4J16A 3C8MA 3P2OA 4J90A 3U4IA 4CM9D 4RPHA 1CWUA 4GKBA 2D4AA 4S1VA 4ND1A 4EDFA 2EKLA 2VZ8A 1KC3A 2Y99A 1XQ1A 1YO6A 2EKQA 2Y1DA 1YL7A 3W4JA 4BMSA 5HRUA 1VRWA 3LT2A 1WAMA 3DBHB 9LDBA 2D2IA 2IZ1A 1ISIA 3LLSA 2ZB8A 3FTPA 4OKIA 4DLBA 4BNNA 3VH4A 1C1XB 1GL3A 2PD6A 4PZDA 4PCVA 1F8FA 1PS9A 4D44A 4PIVA 4XGNA 3ST7A 1EEHA 4RDHA 3G1TA 4UUNA 4R1TA 2HK7A 2O4UX 2IRWA 3QIVA 2O3QA 4RVHA 1R66A 1EVIA 1WP4A 1YBVA 4M1QA 3LT0A 4YA6A 1EDZA 4IMPA 4PLCA 1S6YA 3VTFA 5ENVA 1VM6A 4RF5A 1Z7EA 2WJPA 1V6AA 3H3FA 4FDAA 4ZA2A 3TFQA 3WGYA 4B4VA 5HBRA 3ICPA 3FRJA 4YJDA 1NQ5A 4BNZA 4QEDA 1G0OA 2FOIA 2WTBA 3QVXA 4DRYA 2V6BA 1EVZA 3LT4A 3K2BA 4FFOA 1CIVA 2OFPA 3C85A 2VUSA 1BTOA 3DZIA 3WNVA 1MLDA 3RQSA 4CM9A 2PZKA 3I9MA 1AN9A 2ZJ0A 1ZMOA 3LSYA 5A9RA 2GSDA 1V3UA 2PD3A 1RKXA 3UAGA 5G4KA 3I9JA 3LZ6A 3GRKA 2AEMA 4BGVA 4E3ZA 3ADPA 2J5KA 1YXMA 2VRCA 3QWFA 3V2GA 1E3IA 3HB5X 4WK6A 2VOEA 4PVCA 3JQFA 2HRZA 2I3AA 2JHFA 3BIOA 3KYCA 4NBRA 1BHSA 2V65A 4WCDA 1VI2A 5TRTA 5JCXA 3D4OA 4DWVA 5B37A 3DOJA 4R1NA 3U9LA 3PYXA 1NFFA 3QJ5A 1ADBA 2NSDA 2Q1WA 3IQDB 3OA2A 3OSUA 3VPGA 2V6FA 4IS2A 3UCXA 4HADA 1NVMB 1Q0LA 3BMOB 5DP1A 5EQDA 1ZIDA 3R6DA 1ZK0A 2CVZA 2TMGA 1MFPA 2X0RA 3Q6IA 4GKVA 4XDZA 4YJGB 4KQXA 1L7EA 1NR1A 2UVDA 3D64A 1T2EA 1VSVA 4CLOB 1B14A 1P31A 1BXZA 5GMOA 5BNTA 1HSZA 2QZZA 1GYPA 2E37A 5A05A 1QYVA 1MUUA 4IM7A 3G0OA 2NWQA 2OO5A 3VAZA 4EJ6A 3I4CA 4GVXA 2YZ7A 1PZEA 1XDWA 4WE3A 1WWKA 9LDTA 3S2IA 3HJAA 4RL6A 1YQXA 2CUKA 5DULA 1ARZA 2NVBA 3JQ6A 3WGOA 4B3HA 5TX7A 3ZV6A 1YRLA 4CMIB 5CDSA 1P44A 2ET6A 4O63O 3F1KA 4FC7A 2EHDA 2JL1A 2AQIA 2PD4A 1DLIA 3RJ5A 5IXSA 4IJKA 1TT5A 2VWPA 5F1PA 3PRJA 2C29D 1CYDA 4JJIA 3GG2A 3L07A 3I9NA 1GEGA 1UP4A 1E1NA 3SLKA 4IDAA 3FPLA 2X7HA 2UYYA 4CV2A 4YRAA 1EUDA 3L4BC 4J2OA 4YJGA 5IAAA 1Q0HA 2A4KA 4KWHA 1B7GO 3F47A 4E2XA 2Q50A 5AXCA 2J3HA 1KIFA 5L45A 3AU8A 3F5QA 4MJLA 5BSFA 2P4QA 3TZHA 1EK5A 4E4YA 1EVJA 1TB4A 1BG6A 2AG8A 1KY4A 3S2EA 1N8KA 1U4SA 4MINA 5AXBA 4BB6A 3GEDA 4BKOA 5TNXA 3Q3CA 4BO6A 3L4BA 2GN4A 4WEOA 1E3LA 3IIEA 5IXYA 1CEQA 4NQZA 1T26A 5JO9A 3G49A 5TS3A 4BKUA 5ITWA 1LA2A 2V6MA 5L4SA 3H2SA 4BQPA 3E6AA 1KS9A 1VSUA 4P22A 5ILGA 4OM8A 4URFA 3MJCA 4YEDA 5I7FA 2ZYAA 2YQ5A 3F9IA 3ZWCA 4B8WA 1FDTA 3OMLA 2IZZA 4NPCA 1SEPA 1E7MA 1R0SA 2UAGA 4E6PA 3RUHA 1C1DA 3PJGA 1NVTA 2FWMX 4J0FA 4CUJA 5IF3A 1DDOA 1CRWG 4RGBA 3U5TA 5U4QA 4W4TA 3E5MA 3FBTA 2PWZA 2EP5A 3EZYA 3I6IA 3KM0A 1M6WA 3BMQA 2Q46A 4QQRA 5DCUA 3KTDA 3LQFA 3AJRA 3ZWMA 5BT9A 3QVOA 1HE4A 1BXGB 1B8PA 1Q2XA 4IQGA 1T1SA 1E92A 3VKVA 2HMVA 3HFGA 1YONA 4OOFA 3HG7A 1H2BA 4OXNA 4TMFA 4CMEA 4LW8A 1NM5A 5FI3A 1Y9AA 3RUFA 3WYCA 4DTIA 2GZ1A 4KUGA 3VVCA 4OQYA 5TQVA 2C2YA 4N18A 2PKRA 4EEZA 3NT5A 1TA4A 4J9VA 4YRDA 1HDOA 1ZCJA 3KZVA 4NU5A 1MP0A 3HN2A 2FP4A 3KSUA 5KTKA 2VTDA 5T57A 2BMAA 2AQKA 5T5QA 5F1KA 2UV8A 3W8DA 5LC1A 2D5CA 3PI7A 1U2GA 3ETDA 1N1GA 4CQMD 4KWIA 2B4TO 2BGLA 5EL0A 4R1UA 1K6IA 4B4UA 4E21A 1HLPA 3IUSA 3JD2A 4LISA 3PQDA 4O0LA 2ZATA 4LK3A 4FFMA 2OP0A 1NXQA 3ZNPA 2J3KA 4W9NA 4HWKA 1Z74A 3I5MA 1SBYA 1NPYA 2YDXA 1NWHA 1E6UA 2EERA 4D3FA 3ASVA 3MTJA 1GUYA 3JQDA 2IZ0A 4N7RA 3AUTA 3DR3A 3CE6A 3LLVA 5COBA 3TF5A 4K6FA 3ZWAA 2FRDA 4WPGA 4DIBA 1MB4A 3WQRA 1GCUA 1NFRA 1PQWA 1ONNA 4OJNA 4E12A 1Z45A 5TF4A 3RUCA 1NQAO 4L4SA 3W1VA 5CFZA 2NUAA 1AUPA 4IIVA 3GMSA 2YHIB 5ER6A 3H3JA 5ER9A 1SZJG 1GR0A 3AM5A 1JW9B 2BGMA 2X0NA 4JXKA 4OXYA 1HDZA 4XRGA 2W98A 4BNTA 1DOHA 1K3TA 2PK3A 1Q7CA 2CY0A 2D3TA 1HE2A 4EJMA 3PFWO 1GDHA 1TXGA 1VL8A 1PL8A 3I6QA 4N5LA 2YFHA 4F3YA 3SXPA 1LDGA 3C3XA 3GNSA 3VKUA 1IZ0A 3ITKA 3KYDA 5C5IA 1PJCA 2OL4A 3BMNA 1EQ2A 1J5PA 1I2ZA 4E5MA 3JQCA 3JYLA 5EMHA 2FHSA 3GVXA 3ZU5A 2PZLA 3ZWPA 2DPHA 4B4OA 4C7JA 3PTZA 1OC2A 1Z75A 3JYNA 3X2FA 1ADGA 1PZFA 5BSHA 1QLHA 3PJFA 4I1IA 1I3KA 3OQ1A 4DIFA 4E5YA 5A04A 1K2WA 1FDSA 1P1IA 3NJ4A 3N74A 3O26A 5L53A 4FPXA 2ZK7A 3GA0A 3LDHA 4XKJA 4CR6A 4YACA 3GGGA 2QYSA 4Y9DA 4NBUA 1H5QA 3ZWYA 4PLTA 3KSZO 4DBZA 4HFMA 2ZCUA 3FSRA 4B7UA 4RDIA 3F1LA 1QP8A 4R41A 2HUNA 1X1TA 1U3VA 4PZCA 1BDMA 3HFSA 1E1KA 1IHXA 1WMAA 3NGLA 3RVDA 2P91A 4ZQHA 1ISMA 4RF3A 3KYCB 1B8UA 1D4FA 2V6GA 4QFCA 1ADFA 3UVEA 3V1UA 1LLCA 3AI2A 1KY5A 3ZWXA 1XGKA 4MVJG 1ENYA 3DOCA 5TJHA 4GH5A 4J7CA 1TI7A 2WYVA 2LDBA 3I4FA 4PFJA 4YWJA 5GZ3A 1XCBA 4BKPA 1D1TA 1JVBA 3D4NA 4IBOA 1R16A 1XQ6A 2Y66A 3QWIA 2GRAA 2GCGA 4R68A 4L4RA 2WE8A 2HO5A 1ZK3A 2VNSA 3NDIA 1NTOA 5CHEA 3BHMA 2WYWA 1LRLA 4NJOA 3UUWA 5JNLA 4QT0A 1KVRA 5AYVA 1Q7BA 2CMDA 1P3DA 2IXAA 3BTUA 3H9GA 4CM8B 1GPDG 1G0NA 1PGQA 1RJWA 1JWBB 1MFZA 4MVJE 4Z9FA 3OQ6A 5IDQA 1JLLA 5KJ1A 3ZV3A 1M66A 4H15A 1KEPA 4D3DA 5BSEA 3B70A 2JCXA 4IY1A 1VKNA 1PGOA 1ONOA 3NT2A 2YV3A 1MV8A 2QQ5A 2VYVA 4ITUA 4U6QA 1K5HA 2VHWA 3TRIA 3LK7A 5LDGA 4P8RA 3ZH2A 3PHHA 3P5SA 3ZNQA 5TSDA 4E30A 1WLYA 4OXKA 3LVFO 8LDHA 1QYWA 2H63A 1GAEO 3DONA 3H9QA 4E5KA 1A9YA 4UUMA 1CF2O 2FR0A 4PLVA 3WS7A 5ICSA 1B26A 2O4CA 1PSDA 2O23A 4CR8A 3D5QA 3PP8A 1EE2A 3RUEA 2CF5A 1HE3A 3AFMA 4AJLA 1GY8A 1H6CA 3DBLB 4AJKA 2VRCD 2DTDA 1JVSA 1DSSG 4RVSA 4Q3CA 5KIAA 5JLAA 3GDGA 1X7HA 2EIHA 3PHGA 1T4BA 1UXJA 4LVUA 3VH2A 4AJJA 2NU7A 3NTRA 1KVTA 5U1PA 4L8VA 3TJRA 4H16A 4BB5A 2PZMA 1YKFA 4FOOA 2HAEA 4DIOA 5G0SA 1U3UA 1E1MA 5BR7A 1Q0QA 3EUWA 3RBXA 4FJ2A 2VTEA 4GX1A 4YAIA 2O2SA 4BO2A 2RIRA 3KOUA 3TZQA 2XOXA 3GVIA 3E8XA 3C7CB 4ZRMA 4GGPA 3WNQA 4B7XA 3WJ7A 2BFAA 4I08A 1GEEA 1GPJA 4H7PA 2FR1A 3VDRA 2GASA 2VUTA 2EXXA 2X58A 1DIRA 4FJ1A 3AUAA 4E13A 5F21A 1JKFA 2C20A 2PTGA 2CVOA 4R4JA 4RZHA 3ANLA 2ZTUA 4I9HA 3WWZA 4CUKA 3ANMA 1ZKMA 4TVOA 1PS8A 4IDDA 4XD2A 4WGGA 4GSLA 4WECA 3EYWA 5L51A 1X0VA 3GPIA 4R54A 1BW9A 5KCZA 3EZLA 4HFJA 3UOGA 3HSKA 4OQZA 1HYGA 1CQIA 2Z5LA 1IPFA 1XU7A 4J4HA 5JDCA 1NBOA 2VYNA 5L7TA 4DUPA 2CDCA 3GF4A 4DQUA 3EDMA 1PWXA 3H9UA 5JDIC 1I5RA 2ZB4A 5A9SB 3OICA 3VPSA 4AJ1A 3WOHA 1HT0A 2X5OA 5C3MA 4B4WA 3H65A 3RUIA 2Q1TA 4ZQBA 3GR6A 1F0YA 3AU9A 2DT5A 2YFQA 4Q3EA 3H5AA 3WMWA 2AHRA 3KSDO 1QLJA 1XIVA 3KYBA 2FN7A 4BNXA 4MPDA 4DMMA 3S8MA 1MG0A 3WQSB 3D5TA 2R00A 3RC9A 3NUGA 2YQ4A 4EZBA 4ZICA 4YAJA 1Y8QB 3JQGB 2GNAA 3Q9NA 1DC4A 1AXEA 4Z0TA 1ZZEA 3K30A 4RVFA 4EEXA 5H82A 1YOVB 4F46A 5JBIA 1GFSA 3BTSA 1H6BA 4XJTA 4OL9A 4IZHA 5I7EA 4J1TA 4J7UA 1HSOA 1PX0A 3BMOA 4ND3A 4BNFA 3SJ7A 2AE1A 1O5IA 3GN1A 3FWNA 3K2EA 1C1DB 3I52A 1PJTA 1U9JA 4J9UE 3GY0A 2NQ8A 1IE3A 5A5FA 3GGPA 5DBGA 1XELA 1V8BA 1J6UA 3C1TA 3ADOA 3GZNA 1B2LA 4L75A 5T67A 1M75A 4XB2A 3DBLA 3DTTA 1GD1O 1EFKA 2B35A 2UUPA 3PJDA 3UFXA 3ZHBA 3PEFA 2VUUA 4WLFA 4EUFA 4ALKA 3JV7A 4XQCA 4GVLA 1AXGA 3GNQA 4ZVVA 4DVJA 3IL2A 1YBMA 5K0ZA 4NH4A 4CMBA 4LSMA 4UVDA 2J6IA 3MOGA 3JQAB 2WWRA 3NX4A 2AMFA 1PZGA 3WQQA 4EW6A 5C7IO 2ZJ1A 2DFVA 2IEDA 4B3JA 4QO8A 4BGIA 2I99A 1P77A 5CDYA 4XJSA 3FCOA 3ZWWA 4XDYA 1RM0A 3K73O 3ABIA 2W2KA 4G5HA 4XYMA 3JQFC 4HY3A 2QRJA 5F1OA 1FDVA 4BO4A 1QKIA 1ENPA 3CIFA 3SEFA 3QLJA 5U9CA 4RQUA 3RD5A 1DB3A 1HDRA 3C7DB 1SB8A 3BTVA 1C0KA 1EK6A 2LDXA 3F6YA 4U6SA 3NT4A 3QP9A 4WLOA 4Z0PA 4A26A 3ZWOA 4YR9A 5FEUA 5JAIA 1F8GA 3RAJA 1ISFA 3FTNA 4OGWA 3E82A 2DQ4A 2TMDA 2W8ZA 4G2NA 4J3FA 1LLDA 2O2YA 2Q2QA 4OSOA 4ZD6A 1ULUA 3OA0A 2CNBA 3VH1A 1PJ3A 5L95A 3OIGA 2C7VA 3UW3A 4CM3A 4C4OA 3CPSA 2BGKA 3PWKA 4LMPA 1DIAA 1OZAA 1M76A 1YJQA 1YQGA 5CEEA 2BD0A 4N5MA 1U1IA 1KVUA 3GPDG 3GZ4A 2X22A 3KETA 4LRTB 1HRDA 4TROA 3G3EA 3L9XA 3GZNB 4WJZA 4DA9A 2X5JO 1NPTO 4DGSA 2PGDA 4IGEA 3L6OO 4RPJA 3TZ6A 4NDNE 3WGHA 3BA1A 3DZJA 1MG5A 4Q3BA 4W9NC 4DREA 3OFSA 4JCOA 1HEUA 5BQFA 5LDHA 3RFTA 1NAHA 1R37A 1C0LA 3WXBA 4ALIA 4JP2A 1TT7A 2PFGA 4CLXA 5IZCA 4HBGA 5BNFA 1EMDA 2QX7A 3RC1A 2ZTMA 4QUKA 3GAZA 1LDMA 3GHYA 4MVJA 4ZQGA 2HCTA 4M87A 3NTOA 1RM5A 2GZ2A 1JKIA 2JCVA 3ZNNA 2AW5A 3AOGA 4J6FA 2GPTA 3Q0EA 1LJ8A 4B8ZA 2HMSA 3A1NA 2EP7A 1GV0A 1NWCA 3OIDA 4FSHA 4OAQA 4JBGA 1ZNQO 4EYEA 2XF8A 4UVGA 1CDOA 4O6VA 4CQLB 2DUUA 3D1LA 3I9LA 3OJ0A 4M55A 3H2ZA 2QZ9A 3ZWBA 1AGNA 5TIIA 5T8KA 3PHIA 2G0TA 3WSVA 4EUEA 4PVDA 2CSUA 4BKQA 2RCYA 2EW2A 2AA3A 2EV9A 2C0CA 5DCYA 3VPHA 4CV0A 4XQEA 3ITDA 3VHRA 1LRKA 1DC3A 3PDUA 2WD7A 1ISJA 3O8QB 4RQTA 1BSVA 1U7HA 3HN7A 4CPDA 2I67A 4DL9A 2OXIA 1IHYA 3WLEA 2Y0CA 4ILKA 2BF7A 1JDJA 3QY9A 5MGBA 3S55A 4JBIA 3RJ9A 1SOWA 3PYLA 1KEUA 4BUCA 3BMCB 1H93A 3KUXA 1X0XA 3OP4A 4MKRA 4KUHA 4B79A 5EINA 2DUWA 4D3SA 3KEOA 3PPIA 4UVHA 4RORA 1O8CA 5A1TA 3QVWA 2I3GA 1CETA 3C24A 3W8EA 2Q2WA 4BOYA 5JCJD 1RWBA 1HTBA 2EWMA 2P9EA 3WICA 3ENKA 3I83A 3E48A 4DPKA 4MVJM 1EUCA 1NR7A 4NIMA 1VJTA 4DLLA 2JHGA 3RKUA 4RCVA 2YV1A 4JJFA 2PH3A 2YUTA 4WCFA 4CJXA 1VC2A 3KVOA 1LX6A 1O94A 1U8FO 1A9ZA 2EF1A 1SPXA 3PGXA 4IDFA 2BI7A 4MKXA 3HNPA 1PJSA 5JO0A 2OBYA 4I5DA 2F00A 5KWEA 6ADHA 2Q49A 3INTA 1PL7A 3OECA 3PWSA 4XEHA 5DF1A 1DFGA 1ZMTA 3L6DA 4Z9XA 3ORFA 1AHIA 2JFFA 3VOSA 5KOIA 4BNUA 4D42A 4AJ4A 2NNLD 1ZBQA 3SC6A 2O3SA 3BYZA 5HS6A 2OBNA 3T7CA 4YVFA 3VPXA 4EGFA 3PDJA 3UGKA 3P19A 3VDQA 5I8ZA 3ZV5A 3AM4A 4E32A 1R12A 3GQVA 1WMBA 2GR9A 1D8AA 2GLXA 1SNYA 4WOJA 4CMIA 2WE7A 1PQUA 1N92A 4RF2A 1M6HA 1OMOA 4IUYA 3RI3A 1E3SA 3GOHA 4AJPA 4BNHA 3JD3A 1B3RA 4NI5A 1LDBA 1V3TA 1DLJA 2X9NA 3GH3A 4L76A 1KVQA 3V2HA 4XGIA 5JY6A 1UXKA 5KVSA 4RF4A 1HDYA 1HYEA 1W73A 4NBTA 1AHHA 4GI2A 5JYEA 7ADHA 1EZ4A 2GGSA 1MXHA 4MVJI 4K1LA 4AJIA 1ZJYA 2X0JA 3EW7A 3I3OA 4I5GA 5FF9A 4AJHA 5G2OA 1E77A 4HX5A 4RPKA 3UCEA 1NQOA 2Y1FA 3E9NA 3WTCA 3JD4A 4IS3A 1LUAA 4YT4A 2JCYA 1W4ZA 5DN9A 2Q1SA 5BSGA 2WSBA 1JKJA 1Y81A 4J2HA 1Y8RB 2BLLA 1ORRA 3FNFA 3GK3A 2A94A 5TT0A 3IUPA 3ZGYA 4CM1A 5CG2A 1GADO 2GO1A 4P38A 3DHEA 4QO7A 3TWOA 3K31A 4XRRA 3CZMA 4R51A 4OKNA 5JXWA 3OH8A 4BNKA 3ON5A 4YQZA 1X7GA 5JAZA 1I2BA 4G81A 4Q39A 4QECA 2HK9A 4DMLA 1E3WA 4XB1A 5EPOA 1SC6A 3Q2KA 2PKQP 3NV9A 1XU9A 1NP3A 2XPCA 2QYTA 5B1YA 3VZSA 1NYTA 3GUYA 4MDHA 1WXDA 3MCVA 4Y8VA 3U0BA 5CEFA 4E31A 4Q3NA 4FC6A 5ENDA 4F6CA 2X0IA 2SCUA 1D7OA 4CV3A 5J23A 4R3WA 3TL2A 3U4CA 5CPFA 1EBUA 4M54A 2Q3EA 5ILOA 4D0SA 2EEZA 1RPNA 3I9KA 5FWNA 5KJEA 1VJ1A 5H83A 1T2DA 1Q7GA 1PR9A 3M2PA 1QORA 4R3NA 4CM7A 4FFNA 3UN1A 1P0CA 3T4EA 2VQ3A 3NDRA 3E5RA 2Q4BA 1DIBA 1VPDA 3KEQA 3M6IA 1EE9A 2NVUB 3JQ9C 4OO3A 4PG7A 2Q2VA 3INGA 4NNJA 5EESA 2VWHA 3A28A 3WGTA 2W2LA 3CUKA 2FZEA 5T8KC 3AOEA 4KMSA 5A03A 4PG5A 2HMTA 3DZGA 1IY8A 2B5WA 5HA5A 2Y1OA 3B1JA 4ID9A 4KUEA 4OIMA 1U2DA 4BKRA 1R0KA 4NZ9A 3NKLA 2Y93A 2P2SA 3AWDA 1PTJA 3DO5A 2VHXA 3COSA 4CM4A 3OJLA 2NLOA 5L3ZA 3ZV4A 3QRWA 5THKA 3WSWA 3GGOA 4WASA 3RBVA 1A7AA 2PR2A 4XIYA 1N1EA 3PQEA 1DRUA 4L4XA 1O95A 2CF6A 2GF2A 2F1KA 3FHLA 4J4TA 2Z1MA 4WNCA 3MJVA 1YB4A 3UHAA 4XYEA 3DXFA 3D7LA 4CLHA 1Z82A 4IXTA 4ALLA 3KBOA 3FR8A 3P2YA 4XWYA 1GU7A 1W8DA 1PGPA 3R3JA 4J43A 1H9BA 3R0IA 1C0PA 4UVEA 3M2TA 2OUIA 3GHHA 3KXDA 4LMRA 1YQDA 2BKAA 2CVQA 3FNHA 4IGFA 1PL6A 4YTEA 1I32A 3NAQA 3RU7A 4NJMA 5T6BA 4O59O 2J3IA 4YPOA 5T64A 1X15A 4XYBA 4NR0A 4QXMA 4KQWA 2YY7A 1QXSA 1UDCA 3TDKA 1LLQA 2DPGA 4XQGA 2VZ9A 2OP1A 2P9CA 2EG9A 2E82A 5C37A 5JW6A 1N9GB 4ZQFA 1PR3A 1EDOA 1WVGA 2PA3A 1Z7BA 2NACA 2C07A 5JPIA 1HF3A 2NVUA 2QRLA 3AFNA 3GVHA 3RC2A 5TGDA 4D41A 2NU6A 3K96A 4IMRA 4JLWA 4PLPA 1TEHA 2E6UX 3S1LA 2O48X 4DYDA 4J7XA 2JD2A 1BXGA 3NDJA 4BNLA 2RBEA 1GTMA 1UUFA 1ZUD1 3PYMA 4CQMA 3DTYA 4AG3A 2PV7A 2C7GA 4KTVE 2JFHA 1JU9A 3KO8A 4LRSB 4RO0A 4ALMA 3EGOA 1FXSA 3DBRA 3ROPA 4YAEA 4CMGA 3K92A 1WZEA 3VZRA 1L7DA 2NADA 4E2ZA 4YAKA 4YYZA 1I0ZA 3ETGA 3DMTA 5C7OO 5CDGA 3C1AA 1KETA 2PNFA 5TLSA 1SOVA 2Y0DA 3N7UA 3O8QA 1QYXA 4HKTA 1BDBA 2BI8A 1U5CA 1OFGA 1KOLA 5A5EA 5CAEA 3WGQA 5HTOA 3H5NA 1N5DA 1M67A 1HE5A 3WB9A 3WFIA 4MVJP 4UREA 3U09A 3PIDA 1JQBA 1I30A 1WZIA 3WR5A 5MDHA 4AJ2A 2DTXA 2HQ1A 2VHZA 3H6KA 3ULKA 3ZWVA 5IZCC 1LI4A 5JC8A 2CDAA 4AJOA 4R69A 3E03A 4BV8A 1R15A 4CLRA 5G0UA 5DNAA 2E4AA 1WDKA 4AJNA 4JROA 2ZTLA 1I24A 5THQA 3SX2A 5TJ9A 5A02A 4FGWA 5B4VA 1R4NB 3GVCA 4RPLA 1A5ZA 4MP8A 2BH9A 4BHTA 2GN8A 3QW2A 4ROSA 1D3AA 5KJFA 1ZEJA 3MJ4A 1T1RA 3T4XA 2YJZA 4F45A 1ZVMA 2FMUA 3FD8A 4RLSA 5EIOA 2G1UA 3JQ8B 4IDBA 3KHUA 5DBFA 1A7KA 3W8FA 1E3WB 5K6AC 2AE2A 3ICCA 5DOZA 1OC4A 4E0BA 5GZ1A 3T7EA 4YBZA 1ISHA 4XIJA 4XZ3A 3G1UA 4GMFA 5HM8A 1F12A 4RVUA 1DFIA 2NM0A 2PGLA 3O4RA 3SLGA 1IL0A 2C5AA 3FNGA 1UDAA 1UXHA 2FSVA 2QIOA 2DM6A 3HUDA 3IS3A 3RC7A 4E2WA 4U0KA 2OORA 1NQTA 5L7WA 1I3NA 4FJ0A 3LU1A 1HDCA 1PWZA 7MDHA 2VOJA 1YB1A 3OIFA 1K89A 4OH1A 3MOIA 5G0VA 4YAGA 1H9AA 4A0SA 1LSOA 2W2KB 1ZK4A 3ZW8A 2O7QA 1O89A 3M1LA 5JS6A 1PU2A 2X9GA 3IJRA 4LVCA 3UCFA 2PZJA 1T4DA 4CL8A 4NFYA 3CKYA 4IDEA 1DAOA 4WLNA 4TRNA 1HLDA 4KOAA 3VPFA 4JX8A 2DVMA 4D43A 3LT1A 4BGEA 3GNTA 4II2A 3HE3A 1LDNA 5I9NA 1U4OA 1LDYA 4Y6RA 1PGJA 3EC7A 3ZU2A 3MJTA 2PKQO 3G17A 1GYRA 1LU9A 1VJ0A 3GN2A 4JBHA 4PLWA 5EERA 5IDYA 1GZ6A 3AUUA 3IC5A 5I7SA 3OM9A 3QV1A 3JQ7B 2AG5A 3KLPX 3H8VA 4QSMA 2DU8A 4R16A 4GAEA 3WBFA 2DBVO 3DZBA 1V9LA 1XR3A 3NTQA 4WLUA 3IP1A 1UJMA 4N5NA 5A3VA 4D7AA 1YBAA 4NBVA 3CH6A 1YOVA 2NQTA 1B3BA 1Y5RA 3AM3A 1NX6A 1O6ZA 3GDOA 1ZSYA 4K9DA 5KVCA 1Y8QA 2D8AA 3JQGA 4GWKA 3M1AA 1I01A 2DTEA 1U5AA 1OI7A 3IKVA 3CEAA 4J49A 4L0QA 4B3IA 1J49A 1IUKA 2EW8A 3RASA 1XLTA 4O5OA 2CZCA 4JIGA 3GRPA 4R9SA 4GL4A 4W7HA 4D79A 4CL3A 1DIHA 3JQBA 4RZIA 3H4VA 1SMKA 2B4RO 1LDEA 3ASUA 4WNIA 3AY7A 5CPBA 3NRCA 2FSSA 3DFZA 4FGSA 4KDEA 2G76A 3WYEA 4DBVO 3IAHA 4HFNA 5IG2A 4A73A 2X9VA 2G5CA 2Y68A 1WPQA 2NVWA 4MIEA 3U49A 4UEKA 1HL3A 1KVSA 1DRVA 1RYEA 5C7LO 2Q45A 4KP7A 1U3WA 1PEDA 4A5OA 1MGOA 4P4LA 5GY7A 3DDNA 3OETA 4YQYA 3AY3A 4GX2A 5JYDA 5G0TA 3U3XA 3TL3A 1GZ4A 4BV9A 2GERA 3JYOA 4Y6SA 3VVBA 4WLVA 2YYYA 4BO7A 4NJMB 1E7WA 1P33A 1FF9A 3BZUA 4OHUA 5FFFA 5L4LA 1U7TA 1JA9A 2FPPA 5KJCA 4BQRA 1PS0A 4I8XA 4BNJA 2JFGA 4MO2A 4JK3A 2ZCVA 2EGHA 2X23A 4R5HA 1P45A 1PJ4A 1GQ2A 2HLPA 3IOYA 4BO9A 2VNAA 1N7HA 2W2LD 3TQHA 2WEKA 1XYGA 3DZFA 1XEAA 3FPCA 2UUOA 4M86A 4DPLA 3DOOA 2VN8A 3D0OA 1R4MB 2I65A 4ND2A 3EY4A 3D3EA 4FOSA 1E5QA 1UZLA 3ZI0A 1KEVA 3PJEA 4RV9A 3W4IA 5K6AA 2W90A 3Q1LA 5K9ZA 3TZCA 4R5MA 4J4BA 1BGVA 4JP3A 3SJUA 3TSCA 2FR8A 2VT3A 1A4IA 1CJCA 4UEOA 1H0KA 1UH5A 2JAHA 1AE1A 2VRBA 3Q11A 4OMUA 4NK5A 3FBGA 4I5FA 3S2GA 3V2UA 1M2WA 1TT5B 2VZ0A 1B15A 2ZB7A 1DEHA 1OOEA 2AXQA 4BO0A 3RWBA 1NVGA 5JSFA 1QR6A 3FN4A 2B37A 3L0DA 3ZCXA 1IOLA 1HWYA 4A27A 4H3VA 1UAYA 3L6EA 3RCBA 4DXHA 1KBZA 1W0CA 3JQ7A 1QG6A 4BNGA 4ALNA 1GV1A 4I9NA 4C7KA 2B4QA 4RVGA 1K6JA 3DZKA 3QE3A 2O3UA 1LXCA 2J8ZA 3GLQA 4J91A 3L9WA 2O3TA 1E6WA 4LCJA 1UAGA 2IYOA 3OJEA 3TOXA 1ZSVA 4R01A 3ZNOA 1QYCA 1KYQA 1A72A 1DJQA 3MWEB 2R6JA 1YGYA 3SVTA 5KKAA 4GLOA 3C7AA 3LC7O 4KZPA 1P74A 3QWHA 4ZN6A 4BNVA 3IKTA 4M89A 2GD1O 2VHVA 1E7QA 5BNIA 4CLOA 4FR5A 1ULSA 5EN4A 2BFPA 4J1SA 1KERA 4PN3A 4II3A 1H6DA 1K0UA 2DLDA 5L7YA 4RJTA 3GVPA 3HDYA 4WEQA 3B20A 4CUZA 1Q1NA 4XR4A 2HMWA 5L9AA 3DFUA 2I66A 4JNKA 4FW8A 5JDCC 1UXGA 3AY6A 3D4PA 4TRJA 4PLHA 4WCFC 3IP3A 1J4AA 2HKIA 1WDLA 3OF2A 3W6UA 2D1YA 3MEQA 1E5LA 3QA9A 4PLYA 2O7SA 4D46A 1G1AA 1UZMA 1I8TA 5FI5A 5JY1A 1BVUA 5KVVA 2O50A 3RSHA 4U5QA 3WDSA 3E9MA 2YDYA 3DAGA 5A9TA 4PLZA 3F5SA 3ROKA 3ZHZA 4WUVA 1A71A 3CXRA 4U7WA 2DKNA 2BELA 2HK8A 1YDEA 1YDWA 2P68A 1I10A 4MKZA 4TQGA 3I9OA 3D3WA 1B0AA 4BS9A 3X2EA 3WX0A 3IDSA 2C2XA 3GC6A 5JMWA 2HJSA 2DBZA 4BO8A 4ALJA 4UEJA 4CV1A 4EJ0A 3EMKA 2JKVA 3CINA 4UUPA 4CM5A 4OSPA 1C3VA 1H94A 4HNGA 4TKMA 4CLDA 3A06A 2QW8A 3MZ0A 1I3MA 4QX6A 3BHIA 3GT0A 3ONEA 1GUFA 2JD1A 3JQBC 4TWRA 1N9GA 1OAAA 3WFJA 4GX0A 4FCCA 5I9LA 2OGUA 3V1YA 1P1JA 3DL2A 4DYVA 1PJLA 4TVBA 2PY6A 4XYGA 1P1KA 2AQHA 4NFHA 3QSGA 3PFFA 2E48A 1IULA 3F4BA 3GEGA 3HDJA 2D59A 4G65A 4W7IA 3JD0A 4HXYA 4Z3KA 2VYND 2ILTA 3PWZA 4TSKA 2X1HA 2IYPA 1BXKA 1NNUA 1QSGA 3CZRA 3CSDA 3CMCO 3HQ4O 4AJEA 2X8LA 1UP7A 2Y1GA 2DBQA 5TC4A 4DQXA 2HSDA 1NASA 5IZ4A 2JAPA 4S3MA 1C0IA 3RU9A 4XR9A 3SBOA 5HS4A 1YVEI 2DFDA 4B7CA 4WLEA 3WGZA 1QV7A 5A06A 4BO3A 3V1TC 3BTOA 1XG5A 5DOVA 1R4MA 3P7MA 4FN4A 2WM3A 4GPD1 2B5VA 4O1MA 2J5RA 3BXXA 1C1XA 4I5EA 4AFNA 4HFRA 2CD9A 3U4HA 1QRRA 2D0IA 1XHLA 4J1QA 2WDZA 1U8XX 4IIUA 4GWGA 3E9QA 3KLMX 2NTVA 3KB6A 4BNMA 2W4QA 1A4UA 4A2CA 3AK4A 2ZQZA 3DAPA 2Y67A 4PG8A 1GQQA 3UKOA 1LSUA 2Q1UA 4L74A 4PLFA 4HNHA 5F3RA 1LTHR 3R1IA 5G4KB 1IPEA 2PGJA 1SAYA 1T24A 2Q4EA 3BMCA 4WOKA 1GUZA 2Y1EA 4Z9YA 5DCWA 2DBRA 4EUHA
chains in the Genus database with same CATH superfamily
3NALA 2JGDA 1HDGO 3HM9A 2JJYA 4B6SA 1JAYA 4ND4A 1WXFA 5K51A 1OWOA 3IT3A 3WYFA 2QXTA 3CO0S 5CM9C 1O87A 4DXAA 2OAP1 3NR2A 2DC1A 2JZNA 4P4GA 3HDHA 4PWYA 1FQWA 3HA3A 1K2VN 3GNLA 1VBKA 2XGGA 1PD0A 5HKAA 1K6EA 3BMQB 3LDAA 1F14A 3CS3A 1VCOA 1DHRA 3GBVA 4Y67A 1XMVA 2VSOA 3O9VA 4EW3A 2P11A 3FPKA 4C0XA 2AEJA 4MCAA 4HNAB 1MT3A 1UMDA 4KIWA 2XBUA 3GJZA 4JLBA 4A3SA 4IIBA 2QLNA 2FZWA 4J0CA 1EYZA 4CQLA 4X90A 3EFHA 3P26A 4QRIA 1NI4A 4Y6PA 4DC0A 3DW1X 3GDFA 4BQEA 5KHOC 4B6EA 4HH0A 4K9LA 4E4RA 3DZHA 3GEPA 4L9RA 2HJRA 3BK7A 2RC5A 1V7QA 3L1KA 5KNCH 4DEXA 4P80A 5H3CA 1CZOA 1FVOA 3F78A 3UY4A 1V41E 1JT2A 4MPTA 3EXIA 5HFJA 4EP1A 3TBFA 4MQLA 2OHIA 3FYUC 2OSVA 4MUEA 2CLLB 2PAFA 3QWBA 4Q21A 3UK0A 4C06A 2IYXA 1N5KA 3I6BA 1W52X 2EOAA 3N86A 5F5NA 3ZHUA 4EABA 1YL5A 3RFFA 5GJBA 4WAUA 1B0ZA 1WD5A 1VE9A 1W19A 4R1MA 1N78A 1ISGA 1KY3A 4YRZA 1Y5MA 2IXDA 3V4PB 3NTUA 4BMXA 4L5BA 4EQZA 1NVDA 2O5RA 4BGUA 3GJ0A 1PGNA 4L9WA 3D9QX 4U2DA 2O5VA 4ZRNA 2R6R1 2GEJA 5IBCA 4LJ5A 3FYUA 4C4AA 5FBLB 3RFVA 3IHKA 2PUCA 1Z6XA 3ADDA 1SHJA 1SBHA 1YS4A 3OX1A 2ZYWX 3HLKA 1KFCB 3URKA 2XA1A 3SIXA 4U02A 1RHUA 2AWNA 4N49A 4AY4A 5IN5A 2RBKA 4HDMB 3UGQA 3BWMA 3W34A 2X76A 2XGSA 2BR3A 1FVXA 4L2IB 4BX0A 2Q0HA 1JAZA 3OQHA 1NF3A 1U8CB 3NLLA 4A5SA 1UPTA 2MR6A 5B3JC 2H1LA 2UVPA 1F3LA 1EE1A 3GLTA 4GQAA 3RYTC 1QKJA 3IP5A 2G9QA 3NATA 1QYIA 4LJ7A 1I3LA 2B78A 2B34A 2AV6A 4KQIA 4MOWA 4FD3A 4Z5XA 3TUIC 2O3RA 2PMFA 4NK4A 5DK6A 5E9WA 5AMXA 1S2NA 3KT3A 3R3SA 4EMBA 3IKJA 5IRCD 4KODA 1LRJA 3V33A 1SD1A 1ML3A 3L4SO 4KO4S 3AEQA 2WFAA 4NRDA 3PK0A 4M7OA 4P5DA 5D7NA 3WLFA 1CUFA 5JBNA 1Y42X 2A6PA 1KFKB 1WZ2A 4X6XA 1REQA 1OWPA 2PZ8A 2XOEA 3MK31 3UXYA 5AK3A 2Z2KA 1Y8RA 3S99A 4J3JA 3QJGA 4A03A 3D6JA 2VP4A 1ZD2P 4O5AA 2ZW9A 3OTQA 3U7QB 5CX1A 2QN1A 3O95A 2MSCB 4EH1A 4QIHA 4B7AA 1HETA 2NPIA 5JARA 2R7AA 5CLJA 4UTNA 2B8JA 3F5FA 3EASA 2P4EA 5LCXA 3FWZA 3IMCA 4QNMA 3VSEA 4WBNF 2FPIB 2EARA 1Z15A 1EVYA 5G4LA 4AULA 5JPCA 3LP6A 3LBIA 5JTUA 2IIPA 1KP3A 1Z5VA 2JGMA 3NC4A 4O25A 5IJAA 4A82A 3N1UA 5HK9A 1V8OA 2WINI 3PZRA 4KOEC 2WILA 3OY7A 2OHXA 3ANNA 5HJ5A 5JNVA 3UB3A 3NHWA 2RGRA 1XHEA 1U28A 3KYDB 3NAGA 3DOFA 4N54A 2BTQA 4OP1A 4OYRA 1I2CA 3W5HA 5IVPA 4NEQA 1JECA 4LFAB 4J2TA 3AR5A 1Z73A 1U5BA 5E38A 5JNRA 2FZLA 3KRTA 4K26A 1CERA 3HVJA 2C2GA 2SKDA 2WT8A 4NZPA 1E69A 1I7QB 4YT2A 2XNHA 1DV1A 1D4ZA 2YXPX 3B8EA 5BUZA 3SWWA 4Y18A 3WIEA 2SCUB 1Z6ZA 2ZQYA 1B76A 5LMCA 1R6AA 1W88B 1LSJA 2B92A 3ZBPA 2C82A 3VSDA 4MP3A 3FCAA 1SKQA 2JPDA 3NCTA 3DWFA 3Q3HA 2SKCA 3ESBA 2Y05A 3JQAD 3D3KA 4GLLA 4P4NA 3BXHA 2VBGA 2WJAA 2AL7A 5FYDA 1K1EA 3AXSA 1MC4A 5AKYA 3ED5A 3AUKA 3ZE2B 5GVSA 3D8TA 2ZI6A 3JWPA 4G0VA 3U1VA 4Q4CA 3QXSA 3BH6A 3KJNA 1RE0A 2IYVA 3ZKWA 1J00A 5BP7A 2XMCA 3AIIA 3ACCA 3C6YA 4L15A 5AQEA 3TR6A 3TTXA 1DS6A 4BXOA 1CX9B 3N70A 4CI9A 1O6CA 3L2OB 4C3OB 5BURA 1OH5A 1ZW1A 4DQDA 1T1IA 4I9UA 2FUCA 5IVKA 1RQXA 2CL5A 4EITA 2EFYA 1CEXA 1FUIA 3O91A 4NEGA 1QO0D 4QJ5A 4W82A 5JAZA 2GUGA 1Q19A 4F5EA 3NYWA 1IZ9A 4EFKA 1HZZC 2WHYA 2NT4A 4MI3A 1NFQA 2V7PA 4QOSA 5IP5A 1H66A 5J9FA 5EJ8A 3ZWNA 4HDRA 3A9WA 2KYRA 4GMKA 5EMKA 1Y7TA 2OZVA 4MWZA 2JJMA 5IMSA 4ZZ2A 4M49A 4GO1A 3BFJA 3HV0A 4XJXA 4CMJA 4R2KA 4WA8A 2H07A 3HDTA 1RMYA 3JQ9A 3W9YA 1NHGA 4LXHA 5COAA 1W1IA 1JA0A 1J8DA 4Q03A 4B6GA 1Z83A 4AJ9A 1TVEA 3GAMA 4R2XA 2RH8A 1H42A 5A6SB 5JH7B 2WTNA 1T2CA 3IERA 5KOHB 4FILA 4QE3A 3VBCA 2BT4A 4AUEA 4YRBA 5FQNA 2RAFA 1JBKA 1HXHA 3A1DA 1JQLB 2C5FA 3AHGA 4NMLA 1DADA 5GOZA 4E1AA 3K9FC 2FW0A 1H2AS 2X4GA 4B35A 1WNTA 1GQFA 1XEXA 1H22A 2RGUA 4M4SA 5MN6A 3AV0B 3HJNA 3U3ZA 1WD7A 3VJMA 1N2GA 4YXWD 3DKRA 3RWOA 4QQ8A 1NURA 4OHZA 3WK8A 4ENUA 2OQVA 3PPYA 4BMDA 2OO3A 1WXEA 2PMKA 2YZNA 3UQYS 3WBKA 4B85A 3WBBA 2ZYGA 2Z6QA 5KQMA 3PHJA 1O0SA 2Q4TA 2WWTA 2YC2C 1CQJA 1W85B 1ZK1A 5AOVA 4P1ZA 5EAIA 4BL5A 3LI2A 1THTA 1JEAA 2QRKA 1N32B 2B82A 2P79A 4MAFA 2UXCB 2BDEA 3QFTA 1Y6QA 2VHYA 2IDZA 3KQYA 1E7SA 3INNA 1K5DA 3AY0A 5A5GA 5JROA 5KNCD 4OAOA 1OYVA 2PR7A 1RXUA 1YMQA 1AXRA 2EQ5A 3B1WA 4TYYA 1EFPB 2YJTD 3O4GA 3PC7A 4R6XA 1LNQA 1P9RA 1CRZA 2H59A 4NZMA 4RTJA 1Y1PA 4IJVA 1DC5A 3B8HA 3Q8WA 2X6TA 2ACWA 2CXSA 3RQIA 3DP9A 1ZXBA 2WICA 4RY8A 4YT5A 4CGZA 1P2VA 5AHRA 4JEMA 3KOZA 4F60A 2ZKIA 3A05A 3NTVA 2ZIWB 1FSZA 2O0HA 4NG5A 3T5GA 4DLNA 4EBFA 3KL2A 4DR4B 5BY2A 4JEUA 4D4GA 3N2YA 1BHQ1 4P33A 3T0IA 4GPBA 5KYYA 1Z5NA 2Y0PA 3H1GA 2F8MA 3EVZA 5HUQA 1E9FA 2IPMA 1M0EA 1J23A 2ZRLA 5FR1A 1DBPA 1RBYA 1ZUNB 1XDUA 5AW4A 1G9TA 2GYYA 4A36A 5DHQA 5LR6A 1ICEA 3VFDA 4ZEVA 2OR3A 3ESRA 4ZO6A 3SC4A 3VR6A 3LIPA 1HYHA 1DO8A 2BFNA 4IFBA 4HWGA 2Z04A 1SHZA 4QU5A 5DASA 2GZDA 3WIUA 4N7BA 4HAUA 4DMFA 4BAGA 1ILEA 1NSTA 1C7QA 3DJFA 1CY6A 5LD2C 3Q9SA 3S2SA 2VF7A 1JPUA 1CR6A 2RHGB 1MX3A 4RPGA 3VKWA 1AZWA 1WF3A 3HH8A 4QUDA 3A6KA 1EK0A 1ZD4A 2BW0A 3IDZA 4YRMA 1ZSNA 4RY0A 4R9UC 5HZHA 3ZJYA 3E4DA 4P7KA 3BJEA 3ENVA 3EQZA 3L5OA 5FNVF 2R6AA 2YASA 4XOUA 2X86A 4MIOA 2ENWA 5GJWC 4PEVA 5B64A 2Y1XA 7GPBA 1SXIA 1UOQA 4GNKA 2V55B 4RVDA 5LZ9A 2F1OA 3ZIAA 2I0FA 2HX1A 3AIOA 4XVCA 4ZMSA 1M7GA 2GA9A 2HI0A 4KDRA 4Y98A 1O57A 5JCPA 1UFKA 2JJ8A 2FPIA 1LH0A 4RZXA 4O4IA 5JI3E 2J5XA 1H8HA 1SB9A 1VIYA 4B84A 1DJPA 4JJGA 3RIHA 3WMXA 1JH9A 1JJVA 3O6VA 1RZUA 1IB6A 2ZJ8A 4J0EA 1Z62A 4LVNA 4UJ3A 1OZFA 3SICE 2QVLA 3TNLA 2IHYA 4RFSA 4WESB 3PDIB 3TECE 4KVAA 1CNMA 3SBEA 1A9XA 3K2IA 1I80A 3HEMA 5KKCA 4AM8A 4ESOA 3VHLB 3QVVA 2FSFA 4C0JA 4TOIA 2UZ1B 1NQXA 1D1QA 4BZPA 4P4TA 2IXEA 1NLZA 3GMDA 4YQFA 4BU1A 4QYIB 3K35A 3BPSA 1EBFA 3ZDCA 2I5PO 4BQIA 4F9FA 4UUOA 1RMTA 4GZMA 2Q6TA 2ODTX 2OE2A 2V3VA 2Z1NA 3DC2A 4FYWA 1YQEA 2H1VA 3Q7TA 5K0JA 3K70C 2G25A 4ZAGA 1Z07A 2XCLA 1E20A 4DCOA 3DSRA 1DXYA 4INAA 2B0CA 3NG1A 1FSGA 5KPDA 3UB2A 2Z2ZA 2J48A 4L6CA 3EPHA 4G24A 3RAEC 3X1JA 4MCIA 1IAQA 3EG9B 4Y7CA 5CDUA 3KT0A 3PD7A 3QLUC 4TLCA 3CVYA 4X95A 3WHLA 3SHTA 4C2TA 1DAHA 1F06A 3OCVA 3QKSB 2FWAA 1SCKA 4K3UA 3EQ8A 1CHNA 2W2VA 1GTL1 3F4LA 4JI1B 4DQVA 1BWQA 1RXCA 2I9KA 3T15A 4NDAA 1L4HA 5FB3A 1KZ7B 3O1HB 1GZ7A 5I3CA 2X2PA 2QKYA 3WQHA 1TJNA 5JCZA 1U1CA 4L73A 1KQOA 3EGDA 1W6UA 4NYJQ 4QUJA 4B8YA 4BVAA 5DTEA 4XYLA 2X5XA 4YJHB 3SQDA 2ISCA 4LY9A 1B42A 1TM5E 1UCFA 4W99A 1DAEA 4D9JA 3OOWA 4M1MA 4G1MB 1BKDR 1Z0JA 4RHFA 3N07A 3EK2A 4B80A 5JFOA 4U2FA 2GZAA 4LJSA 5AQ1A 1TC1A 3R8FA 3EG5A 4MRSA 2C95A 6LDHA 3I8OA 5F5LA 5AKGA 2XTNA 1UBLS 3FWYA 3CSUA 3JZFA 1JTEA 1LV7A 1LZKA 4N0MA 5DB4A 3BE4A 3WLTA 4ZJUA 1V95A 2G1JA 3HJFA 4KMRA 1J25A 3C98A 1G21A 4YMVA 2UYHA 1IZZA 1NI4B 4QELA 4UHBA 2AOUB 2HD4A 5BW6B 1E1CB 3R4CA 1G3IA 2Y6VA 4MVJD 3T12A 2CFSA 1A27A 2VDWB 3R3WA 3PNYA 4OHBA 2W2MA 3DBRB 1E98A 2I3ZA 4JI4B 2GUWA 4B33A 1SOUA 3L8EA 3WA6A 3WNCA 1ZI9A 1FDUA 1W1UA 3GG9A 1FB5A 2RH4A 2IKSA 1GFZA 4TYMA 1DFHA 1OBFO 2D5IA 2RHRA 2VR1A 3GFQA 4WMLA 2I87A 2X41A 4Q1AA 5DHPA 4PGFA 1DAGA 5F78A 1PQ4A 1HNXB 2YHUA 1C30A 1ADCA 1TM3E 2QJTA 3DBHA 3T3PB 2F1IA 4DSOA 1XRLA 3UT6A 1YDMA 2OFXA 2ORWA 4RIGA 4DKJA 2OHGA 1U1GA 3FNQA 4OHOA 2C2BA 3WYBA 4ZC8A 3ZJ4A 1DJNA 2ZXFA 4FFLA 4NZYA 2HREA 5I7AA 2BH2A 1K06A 3DQPA 4FHEA 1HLFA 4KDFA 4HQKA 3BF8A 5CP8A 4ZIRB 3M8KA 2DUNA 2XYQA 1YJ8A 2EJWA 2W37A 3RFXA 4JUFA 1IHDA 4OI1A 3H0CA 3K6SB 4IIYA 4ZGBA 4J16A 3TQFA 1IEXA 1CDDA 3C8MA 4J90A 2FEXA 4F4UA 1T13A 3NEYA 4TLAA 4YMHA 3K70B 2XXAA 2EF0A 2GZHA 3LXRA 2EKLA 2UYCA 4EB3A 3RNLA 1X8XA 1KC3A 2WYIA 2FHPA 2DPMA 2R7NA 2EKQA 1MC1A 2Y1DA 4Q3KA 1XAJA 3W4JA 4G5OA 1VRWA 3V8PA 3DBHB 2ONZA 4KAAA 4JI8B 1ZOPA 1JFRA 1T36A 2GTHA 5AVVA 3CZCA 3DDZX 3PGLA 4U8HA 4WK2B 1ISIA 1VCMA 3PRYA 3AF1A 3FTPA 2TECE 1CUEA 1W6RA 3FMOB 2AMJA 1JHPA 2RBGA 3D31A 4MZXA 2JGJA 2UUBB 4PICA 4DDWA 2I4TA 4TMWA 1XVAA 1QZUA 2GILA 4ZVUA 4JLSA 2QX4A 3KSRA 1YZGA 3BM5A 2ZIXB 4ZV7A 4R1TA 2OXCA 4QVIA 4FNOA 3ZI4A 2BDTA 4YLGA 2VA8A 4C0HA 4RVHA 1R66A 5DTRA 4ZAWA 1DKMA 2HPHA 5B30A 5BV0A 2XE6A 4NFLA 4P3XA 1BX1A 3C3BA 3PQ3A 4EHKA 4ISBA 4OI0A 2HW8A 2WPDD 4LJ4A 1L7OA 1S6YA 3QSYA 1SKYE 3ZGZA 2HTFA 3FDJA 3GEIA 1Z7EA 4LXGA 3T38A 2WTEA 2ARKA 3HUFA 4UHHA 2RGYA 2PRIA 2HWUA 5BRNA 4D3YA 1Y6GA 3GD7A 2QN8A 3FRJA 4DYHA 1NQ5A 3UMBA 3LHKA 4F45A 1TUGA 4GPIB 4Q4HA 1FFCA 2Y0BA 2YNMC 3ROXA 1L7QA 2CC2A 2PUJA 3SC3A 5KYTA 1TM2A 1B4DA 5D2CA 2Y1LA 4QA9A 1ACJA 4G5GA 1KOJA 3P0FA 3K2BA 2H1FA 1Z8FA 3VYSB 4IVQA 2ZG6A 3RT7A 3FYCA 3KAPA 3MYRA 2Q6LA 4UTOA 3WNVA 1QH1A 3QKRA 3O0TA 1DWPA 1A5AB 4BCCA 3OO0A 3O8NA 4Z86A 3RQSA 4EA6A 2ZJ0A 2GYVA 1NRIA 1O0BA 2I7XA 4QZVA 2J41A 1RQ2A 1PX2A 4HTFB 4COKA 2PD3A 3UAGA 4C2AA 1WSDA 1T5IA 2A1UB 1C5KA 4D96A 2YJ3A 2C4UA 1U02A 5IJWA 4BGVA 1A8PA 3FG9A 1HTTA 3ADPA 4PONA 4RVOA 4Y9RA 4WK6A 3CURA 3T5TA 2I3AA 2JHFA 1W7AA 5E2AA 2HF2A 4NBRA 4AZ3B 2P2CA 1BHSA 2RGEA 5K20A 3GLFE 1DXOA 1W36D 2G4VA 2LGJA 2VAPA 5K8UA 5TRTA 5JCXA 3KJFA 3D4OA 4B47A 2FF5A 3UT5B 4TKVB 5JSKA 4K6OA 1FZQA 1HNZB 1JEEA 1Y63A 4GLBA 3TH5A 1M2EA 5EZSA 2PBZA 3USCS 3QJ5A 1ADBA 1MB9A 2Q1WA 4LHSA 3C3EA 4PZLA 3M6LA 3TB6A 1OXXK 2BJWA 3I73A 4HADA 4RTQA 1TU0A 5EQDA 3BMOB 1QVWA 2WKRA 1W49A 3I04A 2JH8A 2WC1A 4PCLA 2WM2A 4PC2A 3VBEA 5LBTA 3DHVA 2X0RA 2AG1A 2GCOB 4KQGA 2C7BA 4ACAA 1ODTC 2CB9A 3CVJA 4HLCA 5C8YB 1GFIA 3D64A 4CLOB 5JSYA 3T7AA 2ZRPA 1JIKA 4FDLA 5GMOA 3KQLA 2J0SA 4XUDA 1TAGA 3E22A 1HSZA 2QZZA 1IEQA 1VYTA 1IJKA 1BH2A 1UMKA 3C5EA 2AX4A 3L7AA 1QYVA 1G3QA 4I3GA 2UXDB 1VPWA 3G0OA 2UYOA 4KG7A 4EJ6A 3TJZA 1XZLA 3AESA 3M49A 2H08A 4G4IA 5FLYA 5C52B 3CRNA 3M0EA 4L4ZA 3TI9A 1TM7E 1JBQA 3ZE6A 4TVSA 4KLCA 4UM8B 2FF7A 4RL6A 3EYAA 5FUWA 1RRMA 3QUBA 1ZP6A 4OBBA 4PFKA 4PPNA 3CEJA 1RZVA 3R0QA 2CN1A 3WGOA 3L4JA 4Q66C 4ZFNA 3SDZA 1KEEA 3HCAA 5CXUA 1YRLA 5CDSA 5HRAA 3WBJA 3AGPA 4BX9A 4P86A 3FWPA 1ZD5A 4QBTA 1T43A 2GKSA 4ETMA 1TGYA 5T6MA 1K5PA 2W6QA 4HEA1 2FE4A 2AQIA 2ID9A 3IDFA 3LHFA 2XTAA 3CY6A 4DCMA 3AKYA 4XD7D 5CH8A 5CYOA 5IXSA 5B1EA 5F1PA 1TYDE 3LSTA 3PRJA 3TGLA 2XCUA 2RKBA 4M9RA 1U2DC 3MTQA 1L9XA 1YFJA 3ANYB 2Y71A 2IBSA 2QZ4A 2NSLA 3I9NA 1GEGA 4C4TA 3ACDA 5JXHA 3F0TA 5CYPA 3VV3A 3ZU6A 3HACA 4CV2A 3U3DA 4YRAA 3U1BA 3RTBA 4U00A 1Q0HA 2QG9A 5KYYB 4M36A 1MZVA 2OBXA 4QU0A 3R7DA 1NC3A 1NUHA 2XGMA 3EDRA 3QYPA 4TLMB 1LZLA 1KIFA 5L45A 5JUWA 1B74A 2J32A 3I04M 2RH5A 4R1LA 4WA7A 3VYWA 2R96A 2ZT5A 1EVJA 1TB4A 4W1RA 2HIHA 3UOAB 2QTCA 4BKOA 5TNXA 2ZREA 4AP9A 4ES6A 5AO9A 1AO0A 4EY4A 3IDOA 3QW4B 1T29A 2GN4A 2L42A 4F4HA 2HGSA 3PXBA 4GD3Q 4FFBB 2NW6A 5JO9A 5TS3A 3BIFA 3QUTA 2V6MA 1T3HA 3GJ8A 3LIIA 1DARA 5E7JA 1G18A 3UPDA 5AM5A 1H2EA 5L4SA 4AQYB 3E6AA 3VI4B 4GBED 5D3ZA 3J81A 2AJBA 4D9MA 3N2LA 1BX3A 3MJCA 1Z4MA 2XDQB 4URFA 5I7FA 2ZYAA 2PS1A 1YFZA 2YQ5A 3F9IA 4MA4A 5FRDA 1FDTA 3OMLA 5FA5A 3KTOA 1I4OA 1L3CA 3URMA 4EZEA 4B3SB 4L3WA 3EEIA 4NPCA 3K5WA 3F5MA 1E7MA 3SBXA 2BEWB 1R0SA 2UAGA 3VR4D 4E6PA 2XCIA 3MMSA 3OOHA 1TJ3A 4GS5A 2CXPA 3UO8B 4Z1MD 3VU8A 1FSFA 4ZYWA 2DECA 4FGZA 2W58A 1EVQA 4EVIA 5DCLA 1GPAA 1OZHA 1EI9A 2NO5A 3ROGA 3O3MB 4OQFA 4BC1A 2NYAA 2D0DA 1WDTA 3COVA 4QU9A 2H7VA 3H87A 3I6IA 2J3EA 4UBLA 2QN3A 3S28A 3KM0A 1M6WA 4QQRA 4XOIA 2J9YB 4GZ6A 3NYQA 1HE4A 3UA4A 3N2NA 2J9FB 1Q2XA 2QENA 4NZNA 5CYFA 4D4IA 1VCHA 3BJIC 4Q19A 3RSFA 3VNSA 1ULAA 5IJXA 3JVIA 3HG7A 3PHBE 5ESWA 1ECJA 1OJLA 4LX0A 1E2KA 1NM5A 2KE5A 3VVCA 4IJ6A 4OQYA 5IK2D 1CPYA 1C4OA 1QGUB 2GK3A 2XYPA 5C8ZA 1TA4A 4YRDA 2AHOA 4R8SA 2GARA 2D1TA 2BONA 3HN2A 4ZOAA 3KSUA 2AN4A 4DFDA 2ZUUA 3EIHA 5KTKA 2VTDA 1X86B 3HJTA 5T3UA 1UMCA 1KJNA 4WHMA 4JI2B 5LC1A 2D5CA 2PEZA 1U2GA 2IYEA 2QUJA 3PI7A 3N5KA 4O2RA 4JJZA 4C3VA 4CQMD 3K8OE 2B4TO 4KWIA 2G3YA 4GFDA 4ML3A 5GP1A 3TLXA 3HCEA 3W1EA 2ZIFA 4MWGA 3PVCA 1CS4C 2C88A 1RADA 5EL0A 1JDBB 4HQ0A 1UQTA 3LQ1A 1ZA1A 3O2SB 4PYIA 3WWEA 3Q3GE 3JD2A 4YRPA 4LISA 4LK3A 1OVMA 1N0HA 1X1CA 2I2XB 1NXQA 3ZNPA 3SFZA 1VL1A 1NJ6A 4K6MA 1Z74A 1CVRA 2AI1A 3I5MA 4Z1MA 2XLCA 3B78A 2WQZA 2O8EB 1NWHA 1E6UA 2EERA 5CMLA 3ASVA 2KJQA 3MCZA 2H7XA 3UJHA 4OFXA 1R0XA 1L5ZA 4N8SA 2IZ0A 5CVDA 1W0JD 4RTLA 2FRXA 2LR0A 2IITA 1Z6YA 3DNPA 4BX3A 3ZY6A 3B7WA 1XJ0A 1T1GA 3JAKB 3TF5A 4WPGA 4X0EA 4JLAA 1OE0A 2RD2A 4X7BA 2Q2OA 1UBSB 1CEYA 1NFRA 2ZJFA 4J8PA 3AILA 1PNOA 3GUUA 5CX4A 3DGEC 2EX4A 4AUNA 2XMDA 1AUPA 4IIVA 3H3XA 4C5BA 4IKOA 5ER9A 1SZJG 1GR0A 1W93A 1PNTA 4I2VA 4OHXA 1XO1A 1YR6A 2MYUA 2X0NA 4YUAA 2CZQA 5J5AA 1DOHA 1QGAA 3RSZA 1E1QA 4OP2A 1RSZA 3CUWA 1QH0A 4DOMA 3D0RA 2B5OA 1BHJA 4Q47A 1KR2A 1G8JA 5J2UA 1SU8A 1Z6AA 5BN1A 2IUUA 2FWNA 2QVGA 1PL8A 3CU5A 2ZUBA 3I6QA 4KN6A 4LNAA 1N36B 1N6OA 2YFHA 2HQBA 1H05A 4F3YA 1E4OA 3RU2A 1LDGA 3BGOS 3VKUA 1IZ0A 1EX9A 3GPCA 1KP2A 1QHNA 1U0FA 3KYDA 2FAXA 1IG0A 1UC4B 5C5IA 4CKCB 2P78A 1U0NA 1KMNA 4OQEA 4QQFA 2QDKA 3U37A 3JYLA 4ZREA 3ZWPA 1GKKA 1QFJA 3GVXA 3ZU5A 3W3AD 4DLUA 3MBOA 5JI2E 2FK8A 2NO4A 1OI3A 2DPHA 2H1HA 3GL9A 4HXGA 3PTZA 4GDFA 2I80A 3JYNA 1GKUB 1F4LA 2DG2A 4KN5A 4FGUA 4I1IA 2RAVA 4DIFA 1NYRA 5E1DA 4Q93A 2GBLA 1Q0ZA 4Q9JA 2QAGB 4G0UA 1QHHA 3KWFA 3O26A 1G19A 6CHYA 4FPXA 4KXVA 4XKJA 3LDHA 1RYZA 3LXMA 5LZ2A 4NBUA 3ZWYA 5CNMA 2X77A 2ZCUA 2HO4A 3K4HA 4B7UA 1XB2A 3K0BA 3ZTWA 4CKBB 3PL1A 2AF4C 3BWDD 2C2OA 5ELMA 3VJRA 1DAMA 3LUBA 2ZETA 5ECYA 1X1TA 2VDOB 4FQ7A 5CB8A 5TXGA 3HFSA 1E1KA 2ZBGA 3CRMA 4YK7A 3UIEA 1X9GA 2O2EA 4CG3A 1G20E 2IOFK 3IBCA 1O6BA 4WBSA 2PGNA 3KLOA 4GUDA 3BORA 3KYCB 1D4FA 1JNYA 1ZH0A 2DUMA 4QFCA 3AF0A 3V1UA 4TXJA 1ANKA 5B57C 3AI2A 2ZT6A 3ZWXA 1OLSB 2IWHA 1BYIA 2BHNA 3EMVA 2D06A 1N1DA 9ABPA 1RLJA 5TMEA 3DOCA 3DYBA 1GPUA 4GBGA 3TTYA 3EFEA 4XM1A 3VOTA 4GH5A 5H5JA 4I19A 4J7CA 2ZSJA 5CCXA 5GZ3A 1WR8A 1EB8A 1ZA2A 2WFZA 3HY4A 4EVQA 1GGEA 1KKUA 4I1YA 1JVBA 1A77A 1SULA 5KYUB 5JEEA 1DVRA 4LWQA 1R16A 1QO9A 2XYHA 1R8JA 2FQWA 2C98A 4KBYA 3QX8A 2WQ7A 4IV8A 5I4IA 2C78A 2WP8J 1M2NA 5PGMA 1XCOA 4K8OA 4Y6QA 3A25A 1NTOA 1X92A 4V0MA 5IBPA 3SVLA 4AZ3A 1XLUA 3JAWA 5AOAA 4NCIA 2GOYA 5B53A 3V7WA 3VVLA 5HQ3B 3TIIA 4E09A 2ZRCA 3BWVA 5D00A 2AKAB 1G0NA 2PBRA 1RJWA 4TS4A 3DJYA 5KDLA 1QPBA 2BZ0A 1U6IA 3PJRA 1Z5WA 5BSEA 2PSEA 4QPZA 5TVKA 4BMPB 2MSWA 2OZLA 3PX2A 1DCFA 1ONOA 3NT2A 5KHLB 1V5GA 4CKBA 6YASA 1BU5A 5CA0F 1Y7IA 3HBAA 1QH1B 1RVDA 3CNLA 3JASB 3DYVA 3QKRB 5EZYA 3QUSA 3ZH2A 3DXYA 3PHHA 3U16A 1ZC4A 1NLUA 4MXDA 4PYNA 5TSDA 1WPXA 4EY6A 4DV1B 2PPLA 3I2GA 3JQPA 3B7PA 5JFGA 5JTTA 4QJBA 1XQVA 2F3QA 3KR9A 2HF7A 3H9QA 4BWGA 1YZLA 4II7A 1M5RA 2ORED 2AYYA 5DEOA 4HAZA 1BJRE 5FO0A 3PUXA 3R76A 5MFZA 5CH3A 1XD2B 5FWXB 4FMCB 2WHEA 3GEHA 2Q6VA 1BN7A 1JQEA 3RRYA 2HRQA 1UPCA 3EQ7A 3LWBA 3H0KA 3COWA 3HRHA 5LQDA 1J97A 1AHPA 2ACKA 2IELA 4G09A 4BNWA 4GKAA 2WHPA 3W6OA 5CT5A 1EE2A 1Q84A 1Q91A 2CF5A 1J42A 1T8SA 3AFMA 3RUEA 3ZCUA 4CG0A 4FNAA 2FW9A 1D6MA 3F74A 4BBZA 3Q87B 4PX3A 2WAOA 1JVSA 2AZXA 3NNSA 4LX8A 4MYDA 1QK4A 1A95A 1EX7A 1ZN9A 4WL0A 5G53C 1T4BA 3PD0A 2XIJA 4LVUA 4MYUA 3VH2A 4AJJA 2NU7A 3AW8A 5U1PA 5LQSA 4QSHA 3TVDA 1CUXA 3GLHA 5LYJF 2I6GA 5ERXA 4MR8A 1VPTA 2PZMA 4C2BA 5IANA 3F6EX 1F7UA 4FP9A 4EB6A 2WWGA 4AP6A 5HBGA 3TPFA 5BWBA 1Q7RA 1PR4A 4FJ2A 2VTEA 5E2IA 1RXSA 2L19A 5LIPA 2AZMA 2RIRA 3I58A 4YFVA 2GYWA 721PA 5HYVA 2I6FA 1P80A 4BLRA 3GVIA 4I8DA 6GPBA 1P4HA 2OFWA 4R7ZA 2R60A 2RJ3A 3E8XA 2XXAB 4XM0A 3COYA 3OZDA 3I9FA 4GGPA 1FNCA 1L5MA 3J7TA 3EA4A 4V03A 3WNQA 4B7XA 4AUKA 1A2KC 2XQGA 3EAQA 1M8PA 3EXHA 5D8DA 3IUYA 3F9RA 3RLFA 2FR1A 4D5GA 5B2EA 4YCLA 1I7LA 2X58A 4FJ1A 4E13A 5BPHA 1SVOA 1KA9H 1FVHA 1SUCA 2PTGA 2Q3MA 3N76A 4YMGA 2QDXA 4RZHA 1QRTA 2VQ6A 5D87A 4UOZA 5KNBH 1DG1G 2P0EA 4C9BA 1H2RS 3LOUA 4RGQA 3RIEA 1X1RA 4IDDA 4BJ1A 3ZXYA 4GSLA 5L51A 4AUMA 2OV1A 4I55B 3NAZA 1X0VA 3GW8A 1K27A 4XD7A 3ZLTA 4LMBA 3QPUA 4B87A 1TO2E 3B6IA 2C4WA 3E15A 3FW1A 3HSKA 3I0ZA 1V25A 4K81B 4OMCA 3D8UA 3R5XA 2REXB 5I9TA 4M1WA 5CT8A 4QDTA 2NU8B 5JDCA 1UFQA 1U2ZA 2HSGA 1DRJA 4BBPA 3HXPA 1BYUA 2VYNA 2QB5A 3QITA 4BE7B 4TXHA 2XZOA 2VUHB 4MV7A 4DQUA 4EYOA 1OROA 5CFNA 2DCMA 4MEJA 1I5RA 5A9SB 4RKQA 4OUDB 3T3OA 4PIPA 1HT0A 3WOHA 2X5OA 1SVMA 4ISCA 1K0FA 3I1IA 5A2GA 3TI7A 5F73A 4RACA 3WDKA 1HL7A 4Q3EA 3KSDO 4UM9D 1XIVA 3KYBA 4MPDA 3UV7A 3VSAA 3S8MA 1MG0A 4RMGA 3HKBA 3WQSB 3QHQA 2R00A 3TS1A 4G6ZA 4Q3LA 3VYUB 4ZICA 4YAJA 3JQGB 2ZAMA 4G07A 1Z06A 5CNKA 2AD5A 3KKZA 3RR2A 5ERYA 5KC8A 1AXEA 3AP1A 3PNQA 4KRFA 2OEPA 5SZKB 3GDHA 2PRSA 3BRWD 1L4FA 1NKTA 4F46A 2N75A 2MU1A 3C5VA 4MQFA 4U2CA 2Y92A 4I36A 4FBMA 1H6BA 4IGKA 5BNZA 4IZHA 5I7EA 1HMPA 4I1OA 5DYIA 1ZH4A 5LZ8A 4KLRA 2LP4Y 3HB7A 1G6OA 4BCBA 3DC7A 4JEIA 3RHTA 4W5OA 4JXZA 2FKAA 4ND3A 4BNFA 3TQSA 1NVFA 4EA8A 3NWPA 3P32A 4J29A 3CB4A 2VTKA 4ZOLF 2B4AA 3U7RA 2O2DA 5CFOA 3N0VA 1M8KA 2OKGA 5I7HA 3EZ9A 4A6PA 1OLXA 1JEJA 2EFGA 1XELA 1T4CA 1ZAKA 4CMEC 1M2KA 1VGQA 3C1TA 3RHSA 4Y2VA 2R25B 4GLFA 5CK4A 1GZSA 3G0BA 1WXXA 2FEAA 3K6KA 1LPPA 1P9WA 2H0AA 3DBLA 3P52A 4V24A 1Z6QA 3DTTA 1GR1A 4OQNA 5C3UA 2B35A 3PJDA 3UFXA 3WL6A 4TWZA 3H83A 2C1ZA 4X7RA 4EUFA 4WIAA 5MN5A 1AXGA 1MAVA 4DVJA 2P7IA 3IL2A 1BRTA 3HA5A 3NBYC 5JLJA 5A62A 4L4YA 4GRIA 3MOGA 1M2GA 3IKLA 3JQAB 2AI3A 4L8GA 3UTCA 1THMA 2AMFA 5F7ZA 3R7NA 5A3QA 2QORA 1AJEA 5B3AA 2ZJ1A 4B3JA 3L0YA 3HUEA 5FBVB 3EXFB 2PMBA 4DR2B 1GM5A 4GYWA 1RHKA 1ZCFA 2NTEA 1QPGA 3AJ8A 3QTBA 1PZMA 1RM0A 3BCHA 4N1AA 3X1KA 4C3ZA 3H75A 2XMRA 3LD9A 3S5UA 2GPSA 2ZUVA 1RAEA 2IL1A 1IMOA 1ENPA 4N7JA 4PX5A 4UNSA 2JS7A 4LY6A 3SEFA 1FMLA 3DE3X 4KAFA 1OR8A 5F2EA 3LPMA 5EPEA 3ZGLA 3C7DB 3HXMA 3I2JA 5D86A 2GSWA 3BTVA 1XKXA 1EK6A 3F6YA 3VNQA 3ZXXA 3NT4A 3S4YA 4C7OA 4YR9A 5AW5A 3E82A 5SY6A 3WP1B 4MVYA 1SRQA 5EI5A 2W8ZA 4EYKA 3BDIA 1L7NA 4V3CA 4J3FA 4JD5A 3RSCA 4UPEA 3LUFA 1JE1A 1C3JA 2HFJA 2Q2QA 1ULUA 2D4HA 4C4XA 1O6GA 5L95A 2VH5R 3OMXA 1Z12A 3MILA 5JCOA 4LMPA 4KVFA 4WZAE 3V4OA 3W06A 2QVXX 3G5TA 4CWAA 4EHLA 1FSPA 1YQGA 3OLVA 4N5MA 1KVUA 2C9ZA 3JVUA 2X22A 3VUEA 4TM7A 1NY5A 4CDGA 3KETA 3L9XA 3OCWA 4LZNA 4YRTA 2BHRA 2X5JO 3LQKA 3PKZA 4HLDA 2H4HA 5FUBA 1L6RA 4ZVNA 4PX2A 4IQFA 3QOWA 3AFOA 3K2QA 3QVJA 1YCHA 2QE7D 3OQPA 4EB8A 1PR6A 3ML1A 1VJCA 3JARB 1JRLA 3LCUA 4N3NA 4V39A 3N0WA 3RS0A 1TT7A 2JLZA 3PL5A 5J2TF 1IPHA 3AXTA 3ME5A 5GWXA 4O4IF 3EISA 4LQLA 3I5UA 4A6DA 3ZCQA 3ONWA 1SKBA 5CBPA 3OURA 1BCRB 2IY7A 4QUKA 5AVSA 5DSZA 1SQFA 1N57A 2OAQ1 3UQZA 1JL3A 2OG1A 3RODA 1XPOA 4PAQA 3GEBA 4G84A 1TTPB 1V6CA 2JCVA 3BBLA 4KXNA 3U19A 1WUJS 2FUG1 1AGRA 1CUDA 5JJKA 4GHWA 2CLCX 3CIOA 4FCWA 1KZ1A 3P96A 3PQ2A 4C4YA 4D0GA 4EF4A 3P2JA 2O8CA 1GA1A 3ZHTA 4B8ZA 2C2HA 4W5JA 1RJ9A 1JFLA 2QTTA 2EP7A 2E4ZA 4FSHA 5HG0A 4RTSA 4JBGA 4I4IA 1ZNQO 2XF8A 1K7XB 1YSCA 4FTWA 1CUUA 4UVGA 1CDZA 4MEAA 4ZKDA 3GRZA 3QLUA 3PB3A 4M55A 4RGYA 1QTIA 1J9GA 5DHRA 1TVCA 5F7OA 4M88A 3IB3A 3O4HA 4O29A 3NM6B 1D03A 1J0AA 5K8TA 4EY3A 3PHIA 3HNRA 4NY1A 3G85A 4US0R 4BKQA 4LKOA 4GBMA 2EW2A 4OQPA 3L84A 3K0HA 2JFNA 3IAFA 4M1ZA 2ZIAA 2AA3A 4K9PA 1Z5UA 2C0CA 2MMGA 1X87A 4Q15A 3KXLA 3VPHA 4CV0A 3ROFA 4XQEA 4RTKA 3PCRB 3ITDA 2W2QA 1XEWX 2C9CA 1LRKA 2N47A 2GEBA 5FA6A 2GBCA 2D5BA 3KLBA 2H9YA 4PM4A 1ISJA 3ABSB 3PU6A 4RQTA 4WY2A 4DL9A 3CPEA 3HN7A 4NEHB 2I67A 3WGJA 1VG1A 1IHYA 3DE0X 1ZRSA 4ILKA 3CSSA 1VFNA 4OXQA 1RI2A 3OKCA 1JDJA 1XRQA 3P0EA 4N40A 1JP7A 4P5PA 5BXQC 3QY9A 5MGBA 2ISQA 4JBIA 1SOWA 5FTJA 4BUCA 1KEUA 1Y3BE 2EJCA 3KUXA 5EP4A 4AN1A 3THYB 1GHTA 2ZSKA 2EZ8A 3OP4A 3TLAA 3EOZA 3GLSA 3MXOA 1PL0A 1KI3A 1F7VA 4J94A 1Q0UA 3G0HA 4UVHA 5E9JA 3K0KA 3N6VA 3LQQA 3PC4A 3QVWA 3W8EA 5K05A 2C4MA 4LJLA 3ZWQA 1HTBA 1NMXA 2O19A 5HJEA 1GSAA 1LPSA 2JFOA 1FTYA 4DPKA 1FYEA 5JZMA 1DPFA 4NIMA 1XK6A 2XEDA 2LW7A 4BVLA 4B44A 3RKUA 2JIRA 4FHCA 2CCGA 4JJFA 1OILA 4Z0NA 2PH3A 4WCFA 3VU9B 3C6KA 4PHFA 3F9CA 3ZDRA 3KVOA 1LX6A 2AFRA 1U8FO 1XZMA 2WFMA 4HDNB 4Z7NB 3EDCA 1Y1LA 1XL1A 1RC0A 1XPUA 1MX9A 4MR8B 4IHQA 4F8JA 2BLNA 4KPFC 3TM4A 1YNOA 1YQQA