4QU6A

Crystal structure of a g-rich rna sequence binding factor 1 (grsf1) from homo sapiens at 1.75 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
99
structure length
99
Chain Sequence
DDVFLIRAQGLPWSCTMEDVLNFFSDCRIRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEVYEINNEDVDALMKSLQVKSSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a G-rich RNA sequence binding factor 1 (GRSF1) from Homo sapiens at 1.75 A resolution
rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords G-rich sequence factor 1
total genus 28
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qu6A01
2XSFA 5MLCV 2MGZA 1VQMS 4TU8A 3CTRA 4CH0S 4CH1A 4QPTA 4WFBQ 1H6KX 1G2EA 1F9FA 2E5JA 2U2FA 1QVGR 4IO9Q 2KH9A 1DBDA 2FY1A 2E44A 2DNPA 2KYXA 1U6FA 4TU7A 2VOPA 4M5DB 5IFMA 3BS9A 2LXIA 2NZ4A 2CPYA 2MZTA 2JVOA 1WG4A 3P5TL 4ED5A 3MURP 2J0QD 2MHNA 2LYVA 2VODA 2F9DA 2QFJA 2FC8A 2RRAA 2M2BA 2DHAA 1YITS 1OWXA 2M9KA 1VC6A 5LSOA 5HO4A 2CQIA 2DHXA 1BY9A 1WI8A 1K9MT 3V4MA 3B4DA 1U1PA 1VQKS 1WELA 2ERRA 3G96A 1WF0A 2OTLS 1RKJA 2DO0A 3CCJS 4C4WA 1VBYA 3K0JA 4OZ0A 4LJMA 2N3LA 4FXVA 3J7YU 2MYFA 1PGZA 1S79A 3LPYA 5DDPC 2I2YA 2QEXS 1XN9A 2MXYA 2QA4S 2MQMA 2CQ4A 4UY8T 3VAFA 1VQ4S 2LQ5A 1H2UX 2AYEA 2LA4A 2KFYA 3G8SA 1PO6A 3MD1A 1M90T 2CPXA 2CQCA 1OPIA 1M5VC 3VAKA 3JB9k 1Q81T 3S6EA 3VAJA 3ZZYA 3CUNA 3VAHA 3Q2SC 5LXYA 1VQ6S 1WHWA 2KRBA 3CCUS 2MJNA 2M7SA 2KU7A 2MZSA 2LMIA 3BO2A 3CULA 1M1KT 2JX2A 2L08A 3UCZP 3CCRS 2CPEA 4Z2XA 4PKDB 1WG5A 2L9WA 2MKCA 1JJ2R 2LXUA 3G8TA 1JJ4A 4ERDA 2MKKA 2ZJPQ 2JVRA 2XS2A 3VAMA 3B4MA 2D3OR 2HYIB 2LKZA 2CPHA 2I38A 2KM8C 4IOCQ 2GHPA 1OO0B 3MDFA 3S01A 3THTA 2UP1A 3HHNB 2RS8A 3Q2TC 5GAEU 4YUDA 1WG1A 5IQQA 3P6YC 2DO4A 2N82B 3R27A 1WHXA 4WCEQ 5GAHU 3MUTP 5EN1A 4WF9Q 2CQBA 2RRBA 2DNLA 1SJQA 2LECA 2FHOB 3CD6S 3ULHA 1FXLA 1HD0A 2RT3A 3CC2S 1DRZA 2KXFA 4C0OC 1UAWA 1K8AT 2MKJA 2MMYA 3PIOQ 2M4MA 1H2TZ 3P3DA 2DNZA 3CCES 2VONA 1U1NA 2X1FA 2MQQA 3NNHA 1JMTA 2DGWA 5LSLA 2RU3A 1FT8A 2RQ4A 3G6ES 1B7FA 2DNQA 2A3JA 3VAIA 2DNOA 3HI9A 2U1AA 2HZCA 1P1TA 2KT5A 2K3KA 3LQVA 2DGXA 1WF1A 2HGNA 2KRRA 2CPIA 1S72S 3MUVP 2CQHA 1WTBA 1X4HA 2HVZA 4ZKAA 4V19X 3H2VE 2N3OA 3FEYB 1KC8T 2G4BA 2RVJA 3U1MA 2DHGA 5LJ3Y 1U1MA 2CPFA 2M0GB 3SDEA 3EGNA 2J76E 1U1QA 2MZJA 1KD1T 1VQLS 2DNHA 2CQ1A 1VQ5S 2XNQA 1A9NB 1ZZFA 2AYMA 3MD3A 4UQTA 4C7QA 4QU6A 1FJCA 2MKHA 1X4EA 3J7ZT 1VQ7S 1URNA 2JWNA 2FC9A 2YTCA 2NLWA 3G71S 2EVZA 3RW7A 2B0GA 5D78A 5JVGQ 1X4CA 2OJ3A 1WWHA 3CCLS 4A8XA 1YJ9S 1NJIT 5GADU 2DH9A 1O0PA 1WHVA 2HGMA 1VQNS 4CIOA 1WI6A 2FPHX 2CQ3A 3UE2A 1X4GA 1UFWA 1X5OA 4WFNQ 2KG0A 2KG1A 1VC5A 2V94A 1Q7YT 2VOOA 4OZ1A 3TYTA 5CA5A 2RQCA 2K8GA 1N88A 1FNXH 1NU4A 2D9PA 3PIPQ 2ADCA 3RW6A 3MXHP 1YHQS 2MZQA 2DK2A 2MQLA 1FJEB 3G9CA 3N9UC 2ZJRQ 3NMRA 2MPUA 2MY7A 2MKIA 3R1LA 1YJWS 3S7RA 1K73T 3THPA 3SDEB 1U1RA 2MQNA 3UWTA 3CCQS 2SXLA 3G4SS 2PE8A 2YH0A 2KHCA 2MKSA 1D9AA 3UD3P 1SJRA 1L3KA 2CQDA 3TP2A 3H2UB 4WIIA 1QVFR 1X5SA 2CPDA 2Q79A 5DM6Q 2MZRA 2AYBA 1QM9A 2ADBA 1YJNS 1DZ5A 2CQ2A 5DDOC 3VF0B 2MQOA 2DB1A 1M5PC 2O3DA 2RNEA 2HGLA 1N54B 4IUFA 1R8HA 1HA1A 1M5OC 3TO8A 4PR6A 2MGZB 3P49B 3CPWR 5DDRC 5IM0B 1UP1A 4PRFA 1YIJS 2MB0B 3NNAA 4TU9A 2LEAA 2G0CA 2MSTA 2PEHA 3DLLQ 2MZ1A 2CQPA 2DNGA 2DGVA 1H2VZ 1VBXA 1X4BA 2CJKA 1P27B 2RUGA 2DGSA 2DGQA 2XS7A 5CXTA 4IOAQ 3CC7S 1UW4A 2M88A 1VQ8S 1VBZA 1VC0A 3NS5A 2JRSA 3NS6A 1VQPS 1JJHA 2LEBA 2KXHA 1Q82T 3I55S 2MY8A 2XB2D 4J5OA 5HL7Q 1SXLA 3IRWP 2J0SD 1RK8A 1FJ7A 1SJ3P 2YKAA 3DXBA 1U1LA 2OSQA 1WEYA 2DNKA 3BO4A 1CVJA 2L41A 5FJ4A 4F26A 3SMZA 2N7CA 1SJ4P 2KXNB 3MOJB 4WFAQ 4QQBA 4QU7A 3CCVS 2DNNA 2BOPA 4YOEA 3S8SA 1U6BA 2DH7A 2KI2A 2CQGA 5JVHQ 2BZ2A 4WKRA 1WEXA 2DISA 2M70A 3FEXB 2G1DA 2MSSA 1YWXA 2F3JA 2DGUA 1DHMA 2M52A 3NNCA 2XNRA 3R1HA 3SXLA 3UD4P 2GO9A 1VQOS 2D9OA 2E5IA 1N52B 5LJ5Y 2EK6A 1U1OA 3VALA 4FXWA 4Y00A 1X5TA 1ZH5A 4LMZA 1D8ZA 3VAGA 4BS2A 1IQTA 1U2FA 2MJUA 4W90B 1OIAA 1Q86T 2CQ0A 4F25A 1KOHA 5H1SV 2DGOA 3CC4S 5GAGU 3OW2R 2M8DB 4YB1P 5IM0A 2OTJS 1HL6A 3CMAS 2LCWA 4W92B 2DIVA 4Y0FA 3UCGA 1SJFA 2DNMA 2LA6A 5DDQC 3L3CA 3BO3A 3EGZA 2RS2A 1YTYA 5LXRA 4LIRA 3U1LA 3CCMS 1KOOA 2E5HA 3MUMP 5BJRA 5DM7Q 3BEGB 1R8PA 1VQ9S 2CPZA 4TLQA 3CF5Q 1M5KC 2YH1A 2M8HA 2E5GA 2X1GA 1HD1A 1AUDA 1ZZNA 2MQPA 2XS5A 2WBRA 1N8RT 2DH8A 2DGTA 3UCUP 2DNRA 1KQSR 3EX7B 2X1BA 1WHYA 1U1KA 1NO8A 2DNYA 1X4FA 5DETA 1X5PA 2AD9A 2CPJA 2F9JA 3I56S 2KVIA 4F02A 1FO1A 3CXCR 3ZZZA 3MI7X 3US5A 3IWNC 2OSRA 1WEZA 2ZJQQ 1FHTA 1W2BR 2AYGA 5CYJA 2X1AA 2OIHA 4P6QA 5GVQA 2DITA 5GMKa 4RU2A 5D77A 3D2WA 3CCSS 2J8AA 4EGLA 3CMES 4CQ1A 1A7GE 2KM8B 1X4DA 1X4AA 1YI2S 4U67Q 2YWKA 5ITHA 1WF2A 2EK1A 1X0FA 2KN4A 2DIUA 2DHSA
chains in the Genus database with same CATH superfamily
1CJKA 2XSFA 3I0SA 3MEGA 3UW1A 1YBAA 3WDOA 5BYQA 4TXSA 3N6LA 4CH0S 1WNEA 3MAHA 1UEKA 5KFFA 2VKRA 1H6KX 1T9UA 4HHUA 3DU5A 5HROA 3AJDA 4OYAA 4QBUA 2GZOA 2XEXA 4TNOA 5T7LA 2OEMA 3ISNC 1EQMA 4IO9Q 2G2OA 2ROGA 1TAQA 2JEFA 1Y5IB 3ZTPA 4FN5A 3AQOA 4I2PA 1U6FA 1VISA 1XBWA 5G0RA 4NXNJ 1WC1A 5IFMA 2WB1D 5DQHA 1S1XB 3PW2A 3ILOA 2JEGA 2CPYA 2BKNA 4WKYA 3DLEB 1VFJA 3GFHA 1NJYA 1EQ0A 1RT5B 3MURP 2HVIA 4Z7CA 4X4NA 4E98A 2QFJA 2FC8A 2DY9A 2ZNZA 2M9KA 3PCOB 3C14A 5CYMB 1VC6A 4KSEB 5LSOA 2VHGA 2DHXA 2IA6A 1SQGA 3Q89A 4DZ6A 1ROFA 5LMNJ 3MWBA 1D3WA 5EUHA 3F41A 3IO1A 1WF0A 3G96A 2OTLS 1I1GA 3AXKA 3TQEA 4C3LA 3CCJS 4J9NA 2Y0BB 4C4WA 5AJ3J 3FK4A 1B3TA 3PYGA 1S48A 3K0JA 4K7QA 1VJQA 1F5AA 4MIBA 2MYFA 4ZVOB 4G1QB 1HNIA 3LPYA 5DDPC 2VF3A 3GYXB 4U95A 3QBCA 3TEGA 3M9NB 4DX5A 4MK7A 3THVA 3FZBA 4PXEA 2XO6A 1S99A 3C8YA 2RKIA 2KFYA 2B3TB 2LA4A 3KK2B 2DPJA 3MD1A 3N0VA 2C2EA 1RTIA 3C6TB 3QT7A 4LF9F 4OL8A 3P96A 2FJBB 4URQU 2FVCA 1JLCB 2HBYB 5B0CA 5J1PA 1U0HB 3J81j 3VAJA 3HHLB 5K20B 3CUNA 2PI5A 2YWEA 4LREA 3D67A 2LQ9A 3HJVA 4GMKA 2UVVA 1HWKA 4CP5A 4F4ZA 1VQ6S 2IHR1 1FKOB 1RWMB 4JI3J 1YBTA 1WHWA 1LFPA 3TI0A 1IBLJ 3BGOP 4DFJA 1I94F 2YWFA 1XMQJ 2HURA 4HL9A 4WBFA 1SKSA 3QFWA 4K2JA 2L9NA 1DAXA 3EVMA 2J7UA 2L08A 3BQ0A 3EXYA 1C0UA 2HLUA 3UCZP 2Z2LA 2ZVIA 4CNYA 1WG5A 2MKCA 2ZC3A 1ZOTA 3OR2A 2A6OA 1JJ2R 1K0TA 5H9EK 2EFPA 1FDBA 1DY3A 2B4OA 3KLFB 2P9CA 4ERDA 1I5OB 2E9ZA 2RIJA 4XDDA 3VAMA 4CLFA 1Q5YA 2DT9A 3FFIA 1R89A 4UW2A 3M9MB 2HHHJ 4DG1A 3GIRA 4KGZB 1G1XA 1H72C 2CPHA 2R7TA 2RHQB 3HX9A 4I64A 3TZXA 1W7WA 4IOCQ 1YJ7A 2VKZG 5F8IA 4M63A 5I3PA 1OSCA 6AT1B 4JI0J 5D15A 1OO0B 2WB4A 3JSMB 1XR5A 1FRHA 3THTA 9RUBA 1C0TB 1GXUA 2RS8A 3W9IA 1RE1B 1TFWA 1KKHA 2MQ8A 1TP7A 4DDFA 3KLFA 2BE2B 2DR6A 2CNKB 3Q86A 3M6VA 1FA0A 1S6QA 2ZEJA 5IQQA 2ALZA 2VDHA 3P6YC 3OR2B 5F0UA 4ED0A 4A8KA 1XNQF 4J9VA 1VR6A 3GJQB 4O4GB 4DUZF 1JXVA 1NCLA 3V81A 1UVKA 2E29A 2VH7A 3OD2A 4KH0B 4OYXA 4PXDA 3H5SA 4ZVRB 2VJVA 1KONA 1X8DA 4MMOA 1GMWA 1FKOA 1Q4RA 3A8IA 3CJ0A 3R5DA 2H65B 3KWMA 4NLRA 5CQGA 3U7JA 3CC2S 3SI8A 2K06A 1SL2A 3FVYA 1HARA 2ATLA 1NK9A 1PILA 2J7KA 3HVRA 1K8AT 2V4QA 1GK8A 1M1HA 1OYDA 5A2QU 3GCXP 1KDNA 4MKAA 2W7PA 1Q79A 3PIOQ 3OFEA 4ZCLA 3J81Y 3OFGA 2XHWA 2CJYB 3OTBA 4Y00A 4X4TA 4C2MA 1YZ7A 1VK8A 2MQQA 2XLIA 1N5SA 5E3PA 4DSEA 1RJJA 1GX5A 4IUFA 3SV4A 4A8QA 2QLJB 2V9KA 1E6YB 3VAIA 1S0OA 1SC4B 2W9BA 4A8OA 5B0EA 1OY6A 2HRUA 1D09B 2DGXA 2IJNA 2VPWB 3KLIB 4QIVA 4NLGA 2P6TA 2MKYA 2QLXA 3UD5A 2CPIA 3W2VA 3UI3A 1XQIA 1GFWB 2D74B 1YG0A 3D6FB 3DM2B 4F7VA 1C1BB 4K5SA 4DCPB 4KR0B 3ZO7A 3HVTA 1FX4A 3ICLA 2ACYA 2GMHA 1BHNA 2I5JB 1KLMB 1TZ0A 3PFEA 1FRXA 5CYMA 4XDCA 4IYQA 4ECYA 2Z2YB 4DFKA 3HJFA 4H4OB 2NXEA 2KG1A 2RVJA 3H5YA 5HBMB 3MAAB 3EPIA 2L9DA 5LJ3Y 2PN6A 3SCJE 2M0GB 4H54A 2BJ7A 1Q16B 3DN9A 4M94A 5KOXA 2NQPA 4C8NA 1YZ6A 4FVCA 1GH8A 2XNQA 2V8DA 2AMCB 4ELUA 4C3MA 3ET6B 4RUHA 2W2NP 3C66A 1BQMA 4YB5A 2NCKL 3HD2A 1FJCA 1IKWA 1RTHA 2UUAJ 1VQ7S 1YJUA 3KDOA 3EVWA 1URNA 4NA1A 2JEIA 3CJ5A 1LXNA 3ISND 5B0FA 5KOWA 2YTCA 2NLWA 4OLPA 1MN9A 3LW5C 3EPGA 2Z58B 2ZWPA 2B0GA 2BV3A 5L39A 3OL7A 3VZHA 3JTNA 5D78A 3WBZA 2OJ3A 4DU8A 3OL9A 1KFDA 2H4YB 4CO3A 2F8HA 5HP1B 5GADU 3M8PA 3TVYA 5EX3A 1LWCA 2IVMA 2CJ9A 3BGLA 3GSDA 3E51A 4MT1A 3M2UA 5L9XA 4YP3A 3JYTB 1QD1A 1NKEA 1RTDA 1VQNS 4ILMA 2XSJA 1PAEX 2F63A 4LR9A 2N4DA 2PMZD 3QJLA 1MMDA 4N41A 3W5YA 4JI8J 5KG1A 1X4GA 4M5KA 3UQSA 3M8QA 1Q7YT 3LWMA 4ZP6A 1VLOA 3L7OA 3FMBA 5B0DA 4F3MA 2DPIA 1KVJA 4ES3A 4DQIA 3TYTA 5CA5A 3FBFA 4IO1A 1KHWA 2ZC4A 2BW7A 5B7WA 2ZBIA 2UVRA 2HAFA 2AU0A 1VRUA 4EI2A 3I9V9 2HS4A 1RT3B 3MECA 2G0IA 2MLXA 1S1TA 2C2DA 2AJ0A 2VFUA 2ADCA 3RW6A 5ETTA 1IVZA 2YNFB 1SH3A 1UCNA 3KG0A 4N77A 1YHQS 3EWGA 4PG4A 3MCNA 3T3FA 1BQMB 1FWKA 2OPQB 4KFBA 4Y2KA 3W8GA 1RQ0A 2MQLA 1ELOA 5M2UA 1GT8A 1FJEB 3GJRB 3G9CA 3N9UC 2A0FB 5B0GA 4J9QA 2KT3A 2B43A 3ETMA 1OPZA 1Y10A 1RAOA 1ZPWX 4AXJA 4WFXA 3Q8RB 4DV0F 3THPA 5HK4A 4ID5A 5C2GA 3MFHA 1VIOA 1U1RA 1RAIB 4KJIA 4QWBA 2SXLA 1FDAA 2X51A 5HBMA 2VJUA 3TAQA 3IMQJ 3PACA 3UR3C 4DR2J 1HYSB 1UPMB 2EFQA 2MTLA 2PSZA 3HFZB 3I0RB 5L8RC 2GHVC 4IG3B 4LBPA 1ZM3A 4J9RA 2B51A 4Y3CA 3R6GB 7FDRA 2CQDA 1JNRB 1QVFR 2A10A 3A3OB 1C1BA 2OFHX 4DSKA 1CJVA 3EZ5A 4FF3A 3UR0A 1V5VA 2G0JA 1QTNB 3QT8A 1P1LA 3I9ZA 1PJ5A 2MZRA 2QV6A 1OS5A 3IP0A 3MPDA 3IR7B 1HQEA 4BWMA 2D3ZA 4DPYA 5A8WB 2ADBA 1YJNS 2ZH9A 4IRCA 2DB1A 1M5PC 2I0XA 1VI7A 1U2RA 2RNEA 3W63A 2HGLA 1LW0B 2E1MC 2RU9A 3D3CJ 3FCHA 1R8HA 3LA0A 3NOGA 1HA1A 4WE1B 3OT9A 4EK2A 4AL5A 4OV6A 4I6AA 1X31C 5HVHA 4DL7A 3P49B 3KMSA 1FE4A 4GO7X 3AA8A 1R31A 1VDHA 1Q8IA 1SJ1A 3OFHA 5DDRC 4K4WA 3DYAA 3BDEA 3PX4A 4HTIA 1FDNA 2YNGA 4TVAB 2XM3A 4PWDA 3CO9A 1FESA 2AJ4A 1F2GA 4M1KA 1NH7A 2JC1A 2AGPA 4AL7A 3KUGA 2MZ1A 3IBWA 2GW8A 1IKVB 4FF4A 1GQEA 2C3MA 1EHWA 2OO4A 4BLGA 3K5LA 2DNGA 3KJVB 4Q8EA 1N33J 4WZMA 2K7KA 1H2VZ 3KLHB 2W4DA 5DG7A 3I5CA 3FBBA 1P27B 1Y5NB 5K8PA 2FVPA 1LV5A 2WSEC 2WVBA 1K1QA 3R7NB 3ZTRA 3FMWA 3MCMA 2AHOB 4U96A 3R8YA 3UNYA 1PC4A 3W61A 3CC7S 3QZ8A 2F4VF 1RT1A 4IOAQ 2VZ9A 1UW4A 4UOHA 2R2UA 3L7PA 3B82A 3QLHB 4NOHA 3NS6A 4YR0A 3KDNA 1T9VA 3UO0A 2AW0A 1IN0A 2KXHA 4NI2A 5F8LA 1R8CA 2DCUB 4DI6A 1NK4A 2NXUA 2ASYA 3H25A 3PZPA 3J80U 4JV1A 2DBBA 2AV5A 3P45B 1KVIA 1MW7A 3MPWA 2Y1RI 4NLPA 4ZCIA 3DOMA 4RU9A 3HVAA 3M6WA 4DG1B 3GB0A 4J9LA 3DXBA 2YNHB 4HHJA 1LW2A 2DNKA 2DR8A 1ZA1B 2LP4A 4ED3A 3BN4A 1HBUB 4DL2A 2D3O1 1NK5A 4QWDA 1WACA 4ES1A 3KHGA 3DRSB 1WKKA 5I3UA 3GE9A 2JSXA 3MCSA 2VPZB 3NRBA 4DV3F 2ZZMA 1KP6A 2B7BB 5KFRA 3NGDA 2CZVC 3DKDA 2GMJA 2CZ9A 4K4SA 3CD7A 5GMEA 2DNNA 4GKKF 2IMOA 1T03A 1HNWJ 3K57A 3JTOA 2YKQA 4O0NA 1FEEA 5EWGA 4KGVB 1DLOB 4NYZA 4NXNF 4OLOA 4KV8B 1IXKA 3UNGC 4J37A 4EMDA 4DR5F 2F65A 4B9VA 2J9EA 3QGPA 2G1DA 1S9EB 3NCQA 4M5HA 4WYLA 3DNCA 3AOBA 4UOCA 4RNMA 4ELTA 4DR6J 4EWTA 4B9NA 2RKIB 3DRRA 3P8BB 4OX8A 1NDLA 1VQYA 2P2CB 3H0PA 3HVWA 3I5AA 3AD9C 4OZLA 5LMNF 1ZTTA 3QO9B 1FJGJ 1XNRF 1WD6A 2XHCA 2YQ0A 3OXGA 4ZHRB 4ZMMA 2GO9A 5F0WA 4DR4F 2EG2A 1Q0NA 4JI3F 3QT5A 2D9OA 1M5HA 2YBVA 3H5UA 4JI1F 2J0XA 4AQYF 2IDEA 1U1OA 1LWFA 4Q7AA 4NYPA 2Y1IA 1TMMA 5AE3A 1R8BA 1VRTA 1Z1ZA 2GQQA 1U24A 2CDQA 2KL8A 2RH3A 3PG9A 4MFBA 3GR1A 4R25A 4PWUA 2IPOB 5D4LA 5K9FA 2IC3A 3VHQA 5J2NA 4NPOA 4OQJA 1R0AB 2FJXA 2MJUA 5CD4A 2BR0A 2QZ8A 4PPZA 2BKPA 3SYZA 4OYMA 1DJ0A 2LQBA 2FGCA 2QLBB 2FHJA 3K8WA 5DQGA 3RB0A 1HMVB 1FERA 3H5XA 3GSIA 3OW2R 5J2MB 2OTJS 4KQZA 3CMAS 2W4PA 4AXIA 3MR3A 2R7WA 1RT5A 3V6DB 4R8UA 1FFSB 2PFFB 4FYWB 3CJRA 5F8GA 4C48A 4Y0FA 4PQUB 2HNZB 3BKFA 5ETLA 3UCGA 3U27A 3J7Z5 1ICEB 3L3CA 2O5DA 3QIDA 2CVIA 2RS2A 3M8YA 1GAOA 2DXDA 4P2MA 2EBEA 4URGA 3Q0AA 2W2MP 3IC1A 1IBKF 3ADAC 1WC3A 2V8HA 3BV8A 3RRHA 2XS7A 2PI4A 1NZAA 5D3GA 1QAJA 3MZIA 2C2KB 4F8RA 4ZP9A 4C11A 1QUPA 1TKDA 1L3TA 1U0SA 4DL4A 1P8GA 3CJ2A 4CYUB 2CPZA 1JXEA 4Z7YA 3N6MA 3H59A 3L09A 2OMOA 2X1GA 3QAUA 4X62J 1IR0A 2EFGA 2J9DA 3EE3A 3H98A 1EZZB 3I0SB 4OYZA 2W7OA 4X66J 2MQPA 3PW4A 2ASLA 1CJUA 2HMIB 1NLKL 2WBRA 3CEDA 3QAEA 1N8RT 1FXLA 3LGNA 4JI5J 1GNKA 4PWDB 3TUJC 1KSPA 3DOKA 2BJ9A 1PJ6A 1RU1A 1UA0A 1QJHA 4RW7A 2E9TA 2GVZA 4ICLB 4F0HA 1X4FA 5DETA 2IRXA 2EC0A 4N8NA 2Q66A 1BE4A 2GIFA 5KT5A 1F1BB 3PJXA 2AD9A 1L3SA 2QMXA 3MEEA 3SCIE 2UVUA 5F8NA 1TKTA 1FO1A 1IKYB 4CTAB 2NR0A 5E41A 3ZZZA 1TL3A 2APOA 3MEKA 8RUCA 3M32A 2UXCF 3IWNC 2LFVA 2VG7B 3KMQA 1HBOB 3L95X 3RAQA 5EWEA 2Z2ZA 4QZVB 4PG7A 4MKVA 2B9XA 4C97A 4YEAA 3D1QA 5KFBA 3OBIA 4LRBA 3KLEA 5GMKa 2R9LA 3F44A 4O3RA 2VPXB 1ACMB 2C2RA 3TANA 1BLUA 4KY3A 3EGWB 1G7CB 1SVDA 2C42A 2QFIA 1A7GE 1H74A 4EO8A 4DQSA 1EAYC 1X4AA 4JV0A 3UVJB 4ZN1A 1UMJA 2MLYA 4RNOA 2J8SA 3PJWA 3KHLA 1O6XA 4ZVPB 2UXDF 5KFMA 3X1LB 4LF7F 3TX8A 4PEOA 3CDAA 4UZCA 3ZZUA 3K17A 1S77D 2PMWA 3RBEA 3N28A 4LF2A 1QY7A 4OYPA 5A8KB 2GJ2A 3HKWA 4ZITA 2Y8WA 3OSNA 4QWCA 3I31A 1FF2A 3AD7C 4YY3F 2MGZA 1VHFA 3D6HB 4TU8A 1NM2A 4PAAA 2VA3A 2HFOA 1YJTA 3I96A 1LWEB 2JLEA 5DGAA 1LWXA 2RE1A 3DLKB 4OX7A 2V4RA 1IUJA 2YNFA 4NLWA 2C3OA 3TARA 4K5RA 1KN6A 1NK6A 1G2EA 4QYRA 1UJ6A 1RT3A 3MECB 2R8HA 2D7SA 4EEYA 1CEZA 4YMEA 1EKSA 5JMNA 4JI4J 2FJAB 1Q78A 2FLPA 2KH9A 1DBDA 1R3NA 2FY1A 4Q43A 5KFEA 2ZH2A 4RL1A 1WOSA 2HQ3A 4NEYA 1AXQA 4N5SA 4TU7A 3KHRA 2K3IA 2HBZB 4IFVA 1N34J 1C4CA 1HNVB 2HQDA 4M5DB 4ZVGA 4LR8A 4NASA 3OR1A 3OTEA 3M8QB 2MZTA 2EXUA 3RBZA 4JI7F 3GP9A 4KGMA 1MN7A 2ZOMA 2IVFB 2LYVA 1CS4A 1IKXB 4MYTA 2VODA 1QAXA 3FQKA 1NHUA 1VYAA 3M8SA 1CS4B 2M2BA 3DC2A 1OWXA 5A0YB 5HP1A 1N48A 2AGOA 4TY9A 2CQIA 4CT9A 3TR5A 1BY9A 3GYNA 1PYOB 3ISZA 3IBCB 1SB6A 3V4MA 1F5CA 5KFWA 4OHYA 1WORA 1QE1B 1S6OA 4CNZA 1U1PA 2BOAA 1T8EA 3EUNA 3TUPA 2AJ2A 2DO0A 2R8KA 4LF6J 1JLQA 3M6UA 4ZVHA 3O8WA 4YY3J 1S6PB 2RMLA 4OZ0A 4P73A 2N3LA 4FXVA 2KKHA 3ZTSA 3J7YU 4DV7J 2F5GA 2GIRA 4PWWA 4RW8A 3GV8B 4L75A 2BRKA 3GJSB 3E01A 3WHIA 1UWBA 4AT1B 4A8SA 5HAOA 3LP1B 4OYWA 4S0MA 3R97A 1TVRB 4X66F 4TY8A 4TKTA 3H2LA 1AZSA 1U7LA 3GFZA 3VAFA 1TFYA 1ZAVA 1HQUB 4Y2CA 2E1PA 4NRUA 3G8SA 1WSRA 3UDEA 5K8MA 1CBKA 4DUTA 4QIGA 1M90T 3PW7A 4WPAA 1M5VC 1Q81T 3MAAA 3S6EA 2OPPA 3DDKA 3BGRA 4E0DA 4QR2A 4LF5J 4B02A 4NMLA 5HSPA 1FRKA 4CO0A 2GHWA 3Q2SC 3VAHA 1RI7A 4K4TA 3GONA 2V5HG 2OFGX 2I5JA 2KRBA 4ZPVR 1I51B 4Y65A 2XCPA 3OTOJ 4B3MF 2B4PA 2BVZA 3KLEB 3CJ4A 2M7SA 4NA3A 3R2CJ 3C2PA 3QGHA 3F73A 2MZSA 2W7AA 3T1HF 3CULA 1HBOA 4ECQA 3J80Y 2YX7A 4D3HA 4HI2A 3CCRS 1WOOA 1TL3B 2EKYA 2IAJA 2Z30B 5SZTA 1UTAA 2L9WA 2YX4A 5CZXA 4RNFA 1F0XA 4JV5F 1O51A 3G8TA 4ZJOA 2OPRA 1ZS6A 4OMFG 5KG6A 1ZM9A 2XCAA 4EBDA 4Q44A 4ZPCA 2MKKA 1F6TA 1REVB 2XS2A 2BJ1A 1TUGB 4WP8A 2XI3A 4OJGA 3SQGB 4F4XA 3RB3A 2XLKA 2XYGB 1S1VA 4C8KA 2HLTA 2NXNA 3BGFA 2D3OR 1YLXA 2LKZA 2HYIB 1S12A 2KM8C 5DLFA 4LUBA 3DRPB 3J7YI 1RWPB 4C0BA 4OYBA 3HHLD 4FYXB 2JNJA 2W8KA 2GHPA 2AWZA 2CYYA 5H9EJ 1BWEA 3MDFA 3KNGA 3S01A 1LK5A 2CNNB 6FDRA 3SFGA 1NBEB 3NAHA 4IFYA 1EX8A 5KFXA 3HHNB 3R2DJ 1VK3A 4LVOP 3Q2TC 4DFMA 2VFRA 4HEA9 5KFOA 3T1YJ 1WG1A 3DOLB 5BYSA 1BQNB 1RT4B 4WCEQ 1N6QB 2PO4A 4UQGA 3MUTP 5EN1A 2JJ4D 3M1VA 4WF9Q 4YR2A 2I8EA 5HQ8A 1R27B 1HI0P 4KRWA 2FHOB 1IM4A 3SSQA 4XTTA 2FJEB 2DEJA 2QE5A 3IAS9 3PVXA 2DHHA 4O23A 4OZ3A 3TA1A 1HD0A 1Q1KA 1FFWB 2RT3A 3DHWC 4QPXA 1KLNA 3QRQA 3JSBA 2O67A 2PT0A 5BYRA 2CVEA 4ZIVA 2KXFA 4ECWA 3ZZTA 1QSSA 4KE5A 2NSCA 4LVNP 1UAWA 1JLFB 2W2OP 5KFPA 1D8YA 2ZBPA 4DSJA 1SI9A 1HW9A 2HBRB 3R6LB 4FS1A 1XMOF 1HMVA 1RT7A 2CA9A 3BREA 1UJ4A 3MR7A 3P3DA 4OZ2A 5HATA 4K4VA 4ZPTR 4NMXA 2VONA 3DLHA 3FRZA 1U1NA 2X1FA 3V4IA 4B3TJ 4JI4F 1R0AA 2X3DA 1JMTA 1T02A 5KFNA 3NNHA 2RU3A 2GGPB 4F0MA 5LL6d 4D3GA 2DNQA 1YVFA 1L5UA 2IYGA 1RWKB 2B6AB 2DNOA 3KK3B 5HVFA 1G3OA 2K3KA 4X4RA 2V0NA 1H98A 1C0UB 2AF6A 1TTHB 1WF1A 2HGNA 2KRRA 5H9FJ 2EG1A 1C1CA 5E0OA 3VGSA 3DXSX 4O3QA 3ZZRA 2G2YA 3U02A 2HVDA 1UEVA 2ATCB 1S72S 8AT1B 2XGQA 4X4SA 3I82A 2VBXA 3JQMA 1X4HA 4KHMA 3GMGA 3A8JA 4M5NA 3TRGA 1JB0C 2PA8D 4CO1A 3DRRB 4X65F 4KO0B 4QW9A 3FEYB 3MPUB 4ZPDA 1KC8T 4QCLA 4IFYB 2ZBCA 1Y4ZB 2YQ1A 2G4BA 4CLTA 2J9CA 5BR8J 3MOZA 1V3RA 4X4OA 1Q8KA 5D0GA 3CDBA 3U1MA 3BSNA 2CPFA 2HQCA 4N8OA 1LFWA 5T14A 5J2PA 2HFNA 1UKUA 3NLCA 5KFVA 4MKBA 3EYZA 2QLWA 1TUWA 4DZDA 1VQLS 2MEWA 2CQ1A 2H3EB 2GCFA 1VQ5S 1QLNA 1DLOA 1ZZFA 2GMLA 4UQTA 2CWXA 1Y3KA 3JQKA 1RGVA 4G1QA 1T03B 4Q5VA 1X4EA 4UOGA 4PYDA 2JWNA 2YWGA 1S0VA 1WC5A 2BKOA 2Q6BA 2FC9A 1QSYA 4TN2A 1CC8A 4M5JA 4FKYA 3G71S 2EFVA 1RAJA 4B9UA 1SC1B 4Y2MA 3RW7A 3W5XA 1ITPA 2D41A 2VPYB 5JVGQ 1X4CA 3T5LA 1WWHA 2ZD1A 2F4FA 3QZ7A 2H54B 1QDUB 1A0OB 5IT0A 1NJIT 3C14B 2DH9A 1O0PA 1UFKA 2GQCA 1RT7B 4OJHA 4MJKA 1JJCB 4QYZJ 1EB0A 2K1RB 2HGMA 3OL8A 1TK5A 1U49A 2R4FA 1U48A 3K59A 4ZPAA 4FVMA 5C42B 1WI6A 1Y7PA 2FPHX 2EC2A 2VASA 1FWPA 1NAQA 4YDXA 5E3CA 3UE2A 3VR1A 4DBQA 1UFWA 3T9NA 5GAEI 3WQPA 5KG7A 1S1XA 1JNZB 1AZSB 2V94A 3KJQB 4WFNQ 3OLAA 3T6BA 1M5SA 5AE2A 4DPUA 2DRAA 4U7UK 1ZTWA 4OZ1A 3HZEA 3OTOF 5KFDA 3OL6A 1S9FA 2NSBA 4J9PA 1FVSA 1N88A 2P9GA 3M1VB 3Q8SB 3RAXA 1X9WA 1NU4A 1TL5A 4BCAA 2HHHF 4ZVFA 1RT4A 3DRYA 3R5CA 4DHVA 5IT4A 4RW9B 3TZYA 4DPXA 3PIPQ 1NJWA 4I56A 1JLQB 4L3NA 3A3NB 2MZQA 1TELA 3ZZOA 4ILLA 2VBWA 4CM2A 3DGPB 2RILA 5IOLA 4WU2A 2WONA 4GRSA 4UOFA 1C2PA 3P4UB 5LSRA 3NMRA 4QJVA 1T9TA 2DY1A 2VG6B 2CJQA 4USWA 2LXFA 3B78A 3LWLA 2J6TA 2NREA 3SDEB 2HVHA 3M2VA 2DR7A 1N33F 2MQNA 3CO0P 3DYAB 2F7VA 2KZZA 1TL4A 4XPCA 4FXDA 1REVA 3MFIA 1MU2B 1YKWA 4AD6A 2C1EB 1D9AA 1RABB 4L72B 4PG6A 1LW0A 1SJRA 3QT6A 3H2UB 2E5LJ 1JLEA 5KG5A 1XIQA 4LFAJ 1HI1A 2WVEA 1KQGB 2AEFA 2UUTA 4BDPA 2JZ5A 4DR6F 3BSCA 4F4WA 2Z2MA 3HZGA 4USUA 4L76A 6FD1A 2IDLA 4R0JA 3OXLA 3QFHA 3PV8A 3VQTA 4IG3A 4AE5A 2BANA 4LBHA 5J2QB 3TO8A 2CKWA 3PEHA 1YK9A 4PQAA 2LU2A 2MGZB 1TAUA 1CLFA 3BGRB 1R0CB 4IH5A 4BC9A 5IM0B 2G1HA 3GCWP 3K2YA 3BDPA 4KTQA 5A8KA 1AW0A 2WK4A 5RUBA 4J91A 3PY8A 3TVKA 3C15A 2YXLA 1BGXT 1K44A 1VMBA 2FB0A 2V8PA 2ZKUA 5KT2A 1B0PA 4N47A 4CLUA 5I4MA 4DWIA 3LP1A 2IJFA 3SV3A 1RA6A 3IFEA 3PKYA 1GXLA 4ZLPA 5L1LA 1U2CA 4DPTA 2VFSA 2W25A 3MPYA 2RUGA 3OPKA 1S1TB 5F8MA 2R8JA 1UVNA 2DRDA 2V68A 4DV1F 3WZ0A 2BMBA 1T11A 3D28A 2FDNA 4FNIA 2J6UA 2KHDA 1VBZA 4A46A 1CULA 1H3DA 3VQSA 4NCGA 2OUGA 4AL6A 1XEZA 4JUZA 1R43A 5CYQA 4URSA 3MEEB 2R7XA 1SIWB 3UDCA 4C8YA 1RHRB 3W66A 2ZHOA 2DKOB 4C98A 2GNKA 1Q82T 3GILA 5B09A 4J5OA 1Z4UA 3VGTA 4DV3J 4CLPA 1XMQF 3JYTA 1RTDB 2XB2D 2HNDB 1IKXA 3IRWP 4ZVSB 1NUEA 3A8KA 2OH2A 3ZZPA 3FJ2A 4TQRA 2NXJA 2F8MA 4CO4A 2YKAA 3NGKA 2ACMA 4DSFA 1HNVA 4M5DA 4LF6F 3BO4A 3PHTA 4EBEA 2LU1A 3DLGB 2BJ8A 2OKQA 4RBTA 4M5LA 5C25B 1VC0A 5FJ4A 2QGFB 3GG0A 4B3SF 2N7CA 4O3NA 2IJRA 1SJ4P 4H4KA 4CYUA 2HVEA 2FLNA 3MOJB 3FBEA 2BM0A 3OXFA 4WFAQ 3HFVA 1J5EF 4QU7A 5KT7A 3CD5A 4L3KA 1J5OB 1RWWB 1WJ9A 3QWPA 5A6PA 2BOPA 1SH2A 1IKWB 1RTHB 4YOEA 2XMWA 3DLKA 1S4FA 4ID8A 2DH7A 4ZVUB 5A8RA 4X65J 2IA0A 1S5ZA 5IQ6A 2GJFA 2KI2A 2V2QA 2CQGA 4MAKA 4O3SA 2V9WA 2B8QA 2BZ2A 3RBDA 4JI7J 4PG5A 3O5TB 1WEXA 2DISA 4ES2A 1J27A 2ZDOA 2GFFA 2ZITA 4NLOA 4NRTA 4RNHA 4R8UB 4EZ9A 4ZP7A 4DV2J 1YWXA 3KJFB 5M2PA 3G6VA 4RUBA 3M05A 5LT5A 5KFTA 4QWAA 2QA4G 1RDRA 4KB7A 4GKJF 2NZCA 3VTIA 2BDPA 4F4KA 2ZH8A 2XZWA 3FNNA 3HPOA 2ZFHA 2XNRA 3ENAA 1H0HB 3CNQP 1AFIA 1G6BA 2OELA 1XNQJ 1EETA 1YBUA 2I1RA 3CGIA 3IN5A 3W2VB 1VQOS 5E3RA 1U47A 2FLOA 5FIIA 3CJKA 5ADZA 1RCXB 2XMJA 3NEKA 2E5IA 1N52B 3KLIA 3JQJA 3M32B 3DCAA 3MMAA 4HH1A 1LK7A 5ETRA 4ZVTB 5LJ5Y 4FXWA 2ZH5A 4YS2A 2W9BB 2AGQA 3NOCA 5J1EA 5DG9A 4C9DA 5C5JA 3IWXA 4K8RA 7FD1A 2I9SA 3CWJA 1W26A 2B56A 1D8ZA 1KTQA 2QX0A 3MMCA 3VAGA 4DQPA 1UVLA 2GVZB 4ICLA 4X4QA 4DR3F 3OUYA 4F25A 3NCRA 4EU0A 4UY8T 4YHHJ 1L3VA 3GIMA 5JUMA 2COLA 2IM0A 4KGXB 2FZGB 5IV4A 4LF8J 5HN0A 1SQEA 1ZA2B 2CFXA 2GX8A 3AD8C 2BM1A 3HSGA 4RLEA 4DN9A 4YB1P 3QPIA 1S9EA 3Q8VA 3CDWA 4Q0BB 3PO5A 4OZ5A 2JHEA 4DUZJ 2VICA 1SJFA 2JLGA 2DNMA 3AB2B 2LA6A 1KTVA 3P5BP 1DQ9A 3EGZA 2ZWOA 3MMJA 1PJ7A 3SSRA 3M8RA 4LIRA 5C7PA 1VCTA 1HBMA 3O44A 4E2FB 3A1YG 1FD8A 5DM7Q 3GR0A 5KG2A 5K5MA 3LH2S 4P72A 1LNQA 2RDJA 1FKAF 3KNAA 4HYKA 2R8GA 4DN0A 1VQ9S 1YJRA 4TLQA 2RQMA 2Z0GA 1M5KC 3JXOA 1C0TA 1Y9OA 4X64J 4HKQA 1RT6B 1N0VC 2VQFJ 1GTEA 4KHRA 4RO0A 4ECRA 3ONQA 3ITHB 3NXZA 3OFFA 4UF4A 4EFAC 2ZH6A 4F36A 4G3IA 3AT1B 4A47A 5I3QA 4NLXA 1KQSR 2POKA 1R6VA 4QW8A 2JL9A 2FTRA 2V63A 3QMQA 5DG8A 2CPJA 2ZOGA 4XIUA 4CT8A 1HIYA 4JI2F 4F67A 2FVSA 1FDDA 3PKMA 1VRTB 2ILZA 2HRTA 3MEDB 1LEOA 1CG2A 3CXCR 3GJTB 1HNXJ 3US5A 1T9WA 2VBZA 2OSRA 5ETPA 5IV3A 2ZJQQ 1D9DA 5IWAF 4JYAF 2Y8YA 3PNIA 2V4JA 2AYGA 4NLTA 1WSVA 4OI3A 3Q24A 1N34F 5KTQA 1QTMA 3BSOA 3NS7B 3V6HA 4WFYA 3D6TB 3K5PA 4X84A 5HJYA 2H5EA 5L1IA 3MR2A 2UUCF 2LDIA 3VZIA 3NBPB 1HPZB 2BX6A 2DXFA 1IKVA 2PFDA 4EGLA 3CMES 4QR0A 3TZWA 4NLYA 1T9XA 5DZ7A 3I87A 1YI2S 2FQQB 3OVAA 1N0UA 2PC6A 2YKOA 3EM1A 5SUHA 3QNWB 1KR4A 5ETNA 2W9CB 3QQCD 1X0FA 3EGVA 3UFCX 4QR1A 2KN4A 5CAAA 2NUHA 5D0RA 1S1VB 4CLZA 2HS0A 5F3ZA 2H9ZA 3OUYB 4B3TF 3M6XA 4C0HA 3W1YC 4LF4F 2VV5A 2KDOA 2KZMA 2NYIA 3AJ2A 4WE1A 3B8HA 3FCWA 3QJPA 3FRYA 5A6WA 4CH1A 4DL3A 4WFBQ 1N36F 2HHSA 2K2PA 4PXCA 5DRKA 4A48A 4BC7A 2W1BA 1X0PA 2IAJB 3MMAB 4QIWD 1F9FA 2E5JA 2C28A 1CJTA 3IS9A 4ZDNA 4RKUC 1QVGR 4DUYJ 3D4JA 1R6YA 5I3UB 2ALYB 1HQ2A 2E44A 2HKEA 2RDIA 4MTPA 1YGYA 3PXGa 2KYXA 1X9SA 2HK2A 4QIEA 5L9NA 4DV4F 2AJQA 2MDAA 1LW2B 2HQFA 2QA2A 2E7XA 4FKXA 3BS9A 3D0HE 1NDPA 1Q8LA 2BXJA 2DD8S 3P5TL 1WG4A 2DVIA 4ED5A 2J7WA 2IM2A 4USJC 3UDLA 2FY8A 2OPPB 1J2VA 2F9DA 2GJIA 2YPZA 1TL7A 2IFXA 4ZK7M 2HIQA 4NI2B 3QIPB 3ILLA 3LP2A 1N5YB 2PD1A 3DLEA 4WZQA 1HQUA 5HO4A 1WC4A 1WI8A 4GKJJ 2Y9HA 3NGRA 2ZE2B 3B4DA 5KFLA 1S1UA 1VQKS 1OY8A 3NGSA 5C2CA 2HHXA 1WKLA 2ERRA 3A13A 1RKJA 3IR5B 1NK7A 4LF8F 3ZTQA 4Q2MA 4LF9J 4U8YA 4OZJA 5HLFB 2E66A 3KLHA 3IG1B 4G1PA 4WP9A 3K5NA 1RHJB 2BRLA 1UJ5A 4OZNA 3GIIA 5E33A 2I2YA 4RBUA 2QEXS 1MWYA 2BACA 4DV5J 2ILYA 3ZFVA 3IXQA 3UPFA 2FGOA 3PEJA 1RA7A 4RR5A 5F9NA 1FNOA 4HDHA 1VQ4S 2AYEA 3LP0A 3J7AN 2OAUA 1X9MA 2ZUAA 4NZ6A 5D4NA 1R0BG 2CQCA 3BQ2A 1OPIA 2HNDA 2YKNB 3GU0A 3VAKA 3JB9k 3ZZYA 4LSLB 5LOQA 4CLSA 2QRRA 3BPSP 3M8PB 3T1YF 2FHKA 1NH8A 4HLBA 4ANEA 2XI2A 5HMXA 4ED2A 1HW8A 1UA1A 3CCUS 4IFVB 4NCGB 1DURA 2QT7A 1CULB 3RJMB 2H1YA 1HWJA 4KKOB 1T05B 5A8WA 2IRYA 2KU7A 4KPYA 2LMIA 2HQGA 3EVOA 4Y34A 1WC6A 3ZXWA 1M1KT 1PKUA 4DX6A 1AUSL 2HWIA 2CPEA 1MSWD 3D0GE 4Z2XA 2R7VA 2BYCA 4PKDB 4GC7A 1WC0A 2C3YA 3JAMU 4JV2A 2YVSA 3N01A 1NK8A 2CAJA 4YB7A 2EEYA 1IBCB 5KG4A 1XMOJ 2AKWB 4FZVA 2ZJPQ 1MWZA 2KB2A 3F56A 4PCQA 4WXOA 4AFFA 1SL0A 3V6JA 3G82B 3B4MA 1NNDA 1U8WA 1VRQC 1UPPA 2YQ3A 3BGUA 3CD0A 2CJAA 1JLAB 3ENVA 3I32A 2I38A 4Q2LA 3G2XA 3O1LA 3Q22A 3SBMA 1IR2A 2EBGA 5I42A 2HHUA 4CO2A 3Q8PB 1VOMA 4I67A 2R7QA 4E8UA 3QWUA 2RF2B 3MTKA 3VCDA 1K47A 2N7YA 1YJVA 2BANB 2FD2A 3FCVA 2PMHA 5J2QA 3K8VA 4B3SJ 3CDUA 1H7WA 1SCJB 1NSPA 2DO4A 1FRIA 2V2ZA 3R27A 1TK0A 4IRKA 3CT9A 3HFKA 1Y3JA 3R5JB 2FJVA 5AE1A 4ETZA 2R2RA 1VRUB 3VGVA 1WDDA 3CIZA 1VHIA 1V5IB 2CQBA 2HRYA 2QL9B 2RRBA 4RZRA 2DNLA 5D0EA 1ZAXA 4R5PA 3KG4A 1JLEB 5IT9Y 1UEUA 2AZ3A 3ULHA 4ITSA 1P6TA 2PEBA 1RBLA 4HR2A 5B08A 1PSDA 4YDDB 1DRZA 3UN3A 1G4CA 1MU2A 2CNLB 3I4PA 2BBEA 2XULA 2UU9F 4RW7B 4N7TA 1D9FA 4KHPF 2XZDB 4AQYJ 2MKJA 2YKNA 2MMYA 1HHSA 4GVLA 4DV7F 4EO6A 1JLBB 1IJFB 1H2TZ 2DXEA 2JOQA 3LP0B 4WTYA 5E3QA 4OI1A 1CJUB 2HMIA 1FTCA 4LQ3A 1IWGA 4DUYF 3RTVA 5HVGA 4MK9A 5LSLA 2WONB 4XO0A 2B5JA 2ZHAA 3MMBA 1FT8A 2RQ4A 4KC5A 4NE9C 4TLRA 1B7FA 2A3JA 3HI9A 1CSJA 2HZCA 4TYBA 1P1TA 2KT5A 4RW9A 4ILRA 5HLFA 2AP6A 4JI8F 4DV0J 1KQKA 4ECXA 3MM6A 1QAIA 5EX0A 4DR5J 4B9SA 1Q7LB 2P6SA 4ZJLA 1FE0A 4L6V3 1EARA 2IYIA 3ET6A 4U9RA 3RB4A 3PRVA 2H4WB 4N56A 3GWCA 3MAQA 3MUVP 4JI6J 5AXLA 3HF5A 3QSYB 4DV2F 1S4EA 1WTBA 1HNZJ 2F8EX 3IRXA 3RRKA 4V19X 2BE2A 4ATNA 1IR1A 3OVSA 3FEZA 1N5YA 3LP2B 1UVIA 5F8HA 2GS8A 1F2HA 4ZS6A 5C42A 2ZM6F 3H90A 1F5BA 5B0AA 5E2QA 1U1MA 2O66A 3V5RA 1IJEB 3EGNA 4HHHA 2J76E 4HT5A 1U1QA 1KD1T 4J9MA 2B7CB 3H4DA 2DNHA 9ATCB 8ATCB 2JFKA 1A9NB 1FFGB 3RBXA 5DLGA 1GMVA 2MKHA 3NL0A 4RUCA 3QRPA 2Q43A 3J7ZT 2PA3A 3IS9B 3G87A 3KLGA 2WCXA 1RTZA 1RHUB 2WZ1A 5M2RA 2LDYA 2HW3A 4CO5A 4DR3J 4CDIA 1E6YA 2EVZA 2YY3A 4FNHA 4P2FA 4MH8A 1NHKL 1VQSA 2UV8A 3EMTA 2XC9A 1GEHA 4I69A 4DFPA 4ZHRA 5AXKA 3KYLA 1S97A 4OHXA 3MM5B 2CJXB 1R8AA 1NEEA 2WHOA 3IM8A 3BPDA 1RTJA 3M8ZA 1SQFA 1ZBTA 3WIUA 3M2RA 3CCLS 4F50A 1MWQA 2E7VA 2QYGA 3VGUA 2WOMA 4JI6F 5K8OA 4G1IA 2VFTA 2XMAA 4DOZA 3CIMA 1JLCA 3OVBA 3L9ZA 5HMYA 4CIOA 2DR9A 1TKZA 2VG5B 1RTIB 3H8YA 4CZCA 1SH0A 1S6UA 1TKXB 2AX1A 2G13A 2ROEA 3EXCX 3BB5A 1X5OA 3IR6B 3M2RB 3NBPA 3JSYA 4KO0A 4YQWA 2R2TA 1SC6A 2Q3PA 4KV8A 5CZVA 3PRDA 4ALZA 2VOOA 4PXBA 4F2RA 1M0SA 2M3DA 2KJWA 2RB7A 4W4MA 4QYZK 2HHTA 2RQCA 2K8GA 4PZVA 3V81B 3HSDA 3KFWX 4ER8A 2VQEJ 4X64F 2D9PA 4GC6A 3Q83A 3LTOA 4O4GA 5GAGI 4FYYB 4N76A 5ETVA 1N56A 4X62F 2YNIA 1S6QB 3DRSA 4UTGA 3K5MA 3PYDA 3HT0A 2DK2A 5ETSA 1HR0F 1HBUA 3BN7A 2HSEB 4J9UE 2EKNA 4YHHF 3RUBL 2OMLA 2ZJRQ 2GV1A 2QSWA 1OMSA 2YNHA 2MPUA 2MY7A 2BJEA 2MHEA 3AA9A 4NYOA 1AA1B 3AB4B 5U47A 3S7RA 3R1LA 1GXTA 1IQZA 3DOMB 5F9LA 5EGYA 1KVKA 3TQ1A 1K73T 1VLYA 1J5EJ 1OYEA 2JLFA 3FQLA 3HO1A 4KIAA 4OYIA 3FFIB 4NZ0A 1JLFA 1RT6A 5L46A 4LRDA 3OHAA 3G4SS 1WKJA 2YH0A 2BQUA 4LF4J 1K1SA 4ELVA 2AT1B 2RUSA 2GC8A 2VFVA 1MG7A 3HK2A 2OD6A 2PDAA 3ZNJ1 1O8BA 2OHDA 3IRXB 3V2UC 3B6BA 4I2PB 3TP2A 4WIIA 2EFOA 1GMUA 2R3VA 2W01A 3A4TA 3AXMA 2HZAA 4UZBA 5DZ6A 4ZLLA 1CQNA 4UT4A 4QOTA 1NDKA 2AX0A 1HBMB 2Q79A 2I6WA 1LOUA 5A76A 5DM6Q 5GADI 3E2EA 2AYBA 2UUWA 3AODA 1QM9A 2IM1A 5CCLA 1N6QA 1BQNA 2GAHC 2XY6A 3QYYA 3G6XA 3ENWA 5KFZA 3AHPA 3LAMA 2O3DA 2FJWA 3QRRA 1S9GB 5HJXA 3K58A 3NGUA 1RT2B 1MLAA 1N32J 1OJ4A 1SC3B 1CPZA 1M5OC 2B5JB 1FKPB 2IRUA 5KAKA 3LALA 5AJ3F 3W3SA 2WSCC 4YR3A 2XBPA 1UP1A 5KT4A 4PRFA 1YIJS 3DRPA 1JLBA 3H7HB 3R5BA 1P9YA 4ED7A 2MB0B 4JI1J 3CJTA 4O44B 3NNAA 2IY5B 1NSAA 4IQXA 3CB4A 5JJBA 1AYEA 2CG8A 2G0CA 2HFUA 2PEHA 3K5OA 4Q8FA 4F3QA 3OLBA 4DR4J 2ZH3A 2F1FA 4JI2J 4RX6A 1FCAA 2OPRB 1NB7A 2E1RA 3J7A1 2HWTA 1XJWB 4JI0F 3T5JA 2DGVA 2RDDA 2HFSA 1T3NA 1VBXA 3KHHA 1KBRA 1X4BA 2DCLA 2K7JA 2QIFA 5FDLB 2CJKA 3ZNUA 4GO5X 1XERA 4ZCMA 4RPFA 2XZTB 2ZUGA 2OPSB 3A12A 3U1NA 4PG8A 4EYHB 4LFCJ 2D1CA 4LF5F 2C3UA 4LIWA 1VQ8S 2NXCA 4K59A 3K7RA 3IWLA 5THWA 3NS5A 2JRSA 1ZM4A 3W5ZA 4CLWA 2XLJA 1V3ZA 3KK1B 1RBAA 3D0IE 2Q1LA 1BQXA 1Y11A 1B4SA 4U7CA 2FLLA 4QIFA 2A2CA 1HYSA 1N5TA 2YKMB 4Z37A 1RHQB 2FHJD 5F3TA 4O3OA 3GV5B 3C3LA 5I42B 2OLWA 5HL7Q 2J0SD 1RAAB 4HACA 1RK8A 3C6UA 4M95A 1X7VA 3M4XA 1FJ7A 1X60A 3AJ1A 3LO3A 1JX4A 1U1LA 3DHXA 1WEYA 1TVRA 1ZAWA 2AJFE 3G6YA 5KFCA 3LGMA 3LF0A 3PR4A 2L41A 4A8MP 2Z4PA 3E8OA 1DARA 3SMZA 4C3KA 1BXNA 1XR6A 4ZLJA 5FLXU 2VBYA 2QJ3A 3GLJA 3L7UA 2KXNB 2JDJA 4OV1A 5T7LB 5MAOA 4QQBA 2VB6A 4K4XA 1HI8A 1S6PA 1FXRA 3CCVS 3QGGA 1U09A 4P9SA 3L4BC 3LAKA 3VV2B 2UZAA 4JI5F 1YRUA 2WSFC 2V6AA 3S8SA 4DQRA 1ULRA 1DFDA 2PGCA 3RGIA 1KS2A 3D6MB 5EDWA 4KKOA 4DV4J 3DLGA 5C25A 5JVHQ 2R7UA 3PFOA 3CW2C 2RRNA 3KJNB 3AOCA 4LFCF 4CI0B 1VIXA 2ZOFA 2M70A 4WJBA 5A0YA 4I6YA 2MSSA 4GVBA 4IG0B 2ZVSA 2F3JA 1I6JA 1JIHA 3W64A 3HXMA 4IG0A 3PYEA 4PPDA 3KLVA 1RB0A 2CG4A 2C3PA 1DHMA 2OEKA 2V67A 3H42A 1AT1B 4FDFA 4B3MJ 2M52A 4ANCA 3NNCA 4FPRA 1S59A 1UWAA 5F8JA 3SSSA 3R1HA 2W4CA 4K4YA 4B9MA 4JOUA 4DCJB 4BHQA 1PYTA 1GMWD 3ILJA 4M5IA 3R9LA 1VGYA 2VU5A 2WVDA 1V3SA 3FKBA 2ABYA 3PTWA 3IG1A 3NY0A 1OQ3A 3CDEA 3RG6A 5D0HA 2XY5A 1RLDA 3DDIA 2VDIA 3KUEA 4J90A 3VALA 1XC9A 4B9LA 2P8IA 3UCUP 1S0NA 2Z57B 5KG3A 3RB6A 3LANA 4B08A 2XYPB 3RU0A 5ETOA 1B99A 5K14B 1S1UB 3BM7A 1RYSA 2ZE2A 1HNWF 3NGTA 1FRJA 2XWYA 4BS2A 1U2FA 3MM8A 3NCPA 3KKFA 1FXDA 2E1AA 3OV7A 4DS4A 1Q86T 5H1SV 2KFNA 1CC7A 4OX9J 3QIPA 2DGOA 3CC4S 4FYVB 4DLGA 3A3PB 2A1BA 1WDTA 5IM0A 4J9OA 1HL6A 2WRMA 2YKMA 1NB2A 4H4OA 1MROB 4I6WA 4M8LA 2LCWA 5ETQA 4OFZA 2VIHA 1HNXF 3MF5A 4USHA 1RAFB 1TL1B 3MM7B 2IMWP 2UXCJ 2AJ1A 3FC9A 2R7OA 1KWMA 3HVTB 2P5VA 3DFEA 3H40A 2OPSA 2E5HA 5BR8F 5BJRA 2B4UA 4DU7A 4Y2IA 3PW0A 4IRDA 3M8WA 3TJ8A 4X4PA 1R8PA 5FDLA 1UFLA 5D4OA 3W60A 1SV5A 5HANA 2QLFB 3UN2A 3PR5B 1S49A 3MGJA 3NAIA 5CABA 1Z2ZA 3CF5Q 4OI2A 3FGVA 4DV6F 2M8HA 4OHVA 2YH1A 4WWSA 2E5GA 4EYIB 1HD1A 4LSNB 1AUDA 3A8EA 3HT3A 1SKRA 4O44A 4FF1A 2XS5A 1NPKA 1S7IA 4ECZA 2C2ZB 1U25A 3M2VB 4U8VA 2DGTA 5LMUJ 4NCBA 2PIIA 2FIUA 4GKKJ 4DSLA 2X1BA 4WFZA 2VG6A 1WHYA 5J1NA 5KFKA 1RAEB 1U1KA 2FZKB 3BZQA 3HMJG 1X5PA 5GMDA 3PW5A 4DR7J 2CDRB 5T41A 1HPZA 3I56S 3DGPA 3MCOA 4OJ1A 1S9GA 2CIMA 4C11B 4I7FB 4C8OA 2OP5A 1MMNA 1TV6A 3SZ2A 2V4JB 2QN6B 2V2KA 4CLLA 2ZH1A 2D3UA 1W2BR 2HIYA 3GFYA 3QJJA 3GV7B 4ZPBA 5HI7A 1QAYA 1EKRA 2CADA 3OTDA 2DITA 2HK3A 1CQMA 4RU2A 4FPIA 1KRPA 4P74A 1F3FA 4NLQA 3C19A 1Q95G 2HNZA 3H20A 5JXSA 4PQUA 4KBIA 2C2NA 3RZAA 1UW9A 2KM8B 1X4DA 1EJ7L 3WIVA 2XY7A 4RW4A 3JSMA 2KTQA 2YWKA 5J2MA 2DTJA 4CH7A 5ETMA 1HHTP 2QO3A 4XPEA 4FS2A 2P9EA 1B7YB 3ITHA 2CWKA 4DLEA 2DIUA 1URRA 3VWSA 2XMKA 2CZ4A 3BKTA 3BR8A 3T9ZA 1TMJA 5BXIA 2ZD1B 5MLCV 1VQMS 4BBYA 2XMUA 1D0EA 1T95A 4DR1F 2IC3B 3CTRA 4X4VA 5HMWA 5KFAA 3CJSA 3IGVA 4QPTA 4ED4A 4V1Ak 1R7IA 4OI0A 1KNZA 4MYUA 2FZCB 1LWFB 4B3OA 4K4ZA 2N4CA 3BF4A 2U2FA 2XO7A 2W9AA 3TAMA 2NS1B 1Y0HA 4I4BA 2KFZA 2DNPA 1SUQB 4P7VA 1S10A 5KG0A 4WU3A 1HNZF 4K0KF 2VOPA 4FYDA 4USTA 1ZM2A 2LXIA 5HQMA 2NZ4A 2WTFA 4ZP8A 4WTOB 4FBTA 2HHPA 2JVOA 2ROPA 1IBMJ 4NXMJ 4Q0BA 1TKZB 2MHNA 2VG5A 3HHLA 2J0QD 1U0HA 1GTHA 1IBKJ 3TWZA 2RRAA 2DHAA 1YITS 1RADB 3C6TA 1C4AA 4CCHA 2KO1A 5KFQA 2CNOB 4PABA 4LRCA 4Y2AA 3IA0A 1K9MT 4LFBF 3MM5A 2HPUA 4MIAA 3DGVA 3S1TA 2ZBQA 2HG4A 1TUVA 3Q23A 1H38A 1AB8A 2E5LF 1L3UA 1T7PA 1WELA 3ZTOA 2ZH7A 1HNIB 1NHVA 2Y1LB 5J1EB 1RWOB 3D68A 4P71A 3TAMB 1VBYA 4YN3B 1T94A 3CVKA 4LJMA 2QMUB 4NA2A 4ZN3A 2KYZA 2VC0A 1KQFB 3CMQA 4OHWA 5C24B 3KLGB 1RYRA 4B3OB 3CJKB 1T0TV 2LQ8A 2O1PA 1PGZA 2DYAA 1S79A 1PYSB 2J0WA 4DF4A 4LF7J 3F0NA 2IBOA 2GGPA 2J5AA 5FD1A 4IR1A 1XN9A 1JQGA 2MXYA 3T5KA 3OJUA 1VC5A 1UVMA 3NWGA 1U6ZA 5E3AA 2QA4S 2HHQA 2MQMA 4FF2A 1HHQA 1YX2A 2CQ4A 4LR7A 1ZPVA 4CLKA 2LQ5A 3PM9A 1H2UX 3TEHB 3BQ1A 1PO6A 2A2DA 3FZ2A 3LUYA 4DV1J 2CPXA 1QSLA 3PO4A 2HHWA 3HLUA 1FD2A 3BBFA 5EHHA 3TNVA 4RW4B 5L1KA 2EW9A 1SBRA 2WBMA 4L74A 4RJVA 3RAMA 1SL1A 4F2SA 2XMMA 4C8MA 3G86A 1PBUA 4I1TA 5D4PA 3IBFB 3QSIA 1FEHA 1P9QC 2VC1A 3DRXA 4IDKB 5LXYA 3OJSA 2A6MA 1TQLA 3PRBA 2MJNA 4NLUA 4XAKA 5G0RB 3D1OA 2GAGC 5FLXY 3UN5A 2LVWA 1DTTB 5A8RB 3KOAA 4OIXA 3BO2A 4NLDA 2XWXA 4DL6A 2JX2A 3CJ8A 1J5OA 1Q8BA 4NL5A 4HVZA 4DX7A 1NJXA 2R8IA 4ED6A 4ED8A 2H5JB 3N6NA 1U45A 2OI2A 3BR9A 3LOUA 3BH7B 2LXUA 4LBIA 3PYFA 4UUWA 2ASJA 1HFEL 2FYXA 3W65A 5KFJA 1JJ4A 1HR0J 4B9TA 3MMBB 4FBUA 4O0IA 3HULA 2JVRA 5KT6A 4RWXA 4ZPWR 3SCKE 2BJ3A 2C22A 4OI6A 2HZVA 3QATA 2M5YA 4PUOA 1N32F 1RWNB 2WVFA 1SIZA 3VVTA 2HNYA 5HQLA 3TZZA 3HP6A 4F4YA 5H9FK 2BE7D 5CCMA 1APSA 1FX2A 1N5VA 2D69A 1RACB 1DQAA 4P52A 1RZMA 2V2VA 3KG1A 3SQGA 1QUVA 1FWLA 3B54A 1RXOB 4IH6A 4NEZA 4DR1J 2UP1A 4MK8A 2LQJA 4A4JA 4ZVQB 5GAEU 3CSKA 4YUDA 3T19A 1WUUA 4USMA 1UVJA 3AAWB 1S1WA 3C16B 1SV5B 2N82B 1WHXA 1HQEB 2GVDA 3ZC4A 1YRXA 3M30B 5GAHU 3DU6A 4DR2F 5DJBA 2A18A 1SJQA 1YDLA 2LECA 3W9JA 1ZYQA 2QYCA 1TR0A 3CD6S 1NRKA 2R2SA 4B3RJ 4X2BA 3NWRA 3E3XA 3BKUA 3RYLA 1MNEA 3WC0A 5KFYA 2RF2A 4LSZB 4C0OC 1D1UA 2ZBRA 3FSIA 3PX6A 1SKWA 4H4MA 2E1CA 3OHBA 3C46A 4P75A 1EP4B 3HHLC 1AROP 2M4MA 4I68A 3BYRA 1EP4A 1JLAA 2DNZA 4WIQA 3CCES 2UVWA 3GYGA 2RSQA 2KT2A 3W8PA 1FRLA 1TU0B 1V6HA 2DGWA 3ETOA 5F41A 3TUZC 4ED1A 1UWBB 1V9OA 3G6ES 1XWLA 3GIKA 4RW8B 2U1AA 1SPBP 4RUAA 4OYOA 3LQVA 2YPYA 2ZM6J 3D3BJ 4DX8H 2QTWA 3H4BA 1RLCL 3R5GA 1PIEA 3M30A 1IM6A 4LQ9A 3EJMA 3POTB 4W98A 1KEKA 1HWLA 2AEJA 3ENQA 1T05A 4ANDA 1S1WB 3C16A 2CQHA 1FRMA 2EI5A 4FP9A 2HVZA 3HSJA 1BUXA 2JFDA 4ZKAA 1U8SA 3H2VE 1RBOB 2Z56B 2H48B 3DDNA 2N3OA 4DL0C 4RNNA 2DEIA 3DI6A 2XSJB 3D7SB 2DHGA 3T41A 4K2XA 1HWUA 2RD5C 1DTQA 2FHMA 3DI6B 1BD6A 1LWCB 4RW6B 3SDEA 1NZ8A 2HNYB 2HWHA 1VJWA 3MM9A 3ZZ0A 2MZJA 1KHVA 3OR1B 4DF8A 5AXNA 2UUBF 5CHCB 4LRFA 5KFHA 1EIYB 2DJWA 4JP8A 2V34A 4Y28C 3WX4A 2AYMA 3HHEA 2IIHA 3MD3A 3POTA 3R7BB 4HI1A 3ILIA 4IOBA 4ZA1A 4QU6A 1AFJA 1A6LA 4C8LA 3JS9A 2UV8G 2LLZA 3VVUA 1DQ8A 4ZIWA 2FUG9 1FTRA 3RR7A 4OX9F 1XTZA 2GQ2A 3W62A 1LWEA 4QWEA 2CJBA 1ZETA 1IBMF 4IR9A 2ZNYA 1FVQA 3MHYA 3NP5A 4CRJA 1S0MA 1S7HA 4NXMF 2QC3A 3OQ2A 2IBKA 3GPAA 4O3PA 4IDKA 1NKCA 1T9YA 4TQSA 4L73A 4A8XA 1W25A 3AOAA 2XGPA 1BMQB 5K8NA 3V6KA 1YJ9S 2UUAF 2YWWA 2G9OA 3C6UB 1WHVA 3HHDA 3KTQA 1PCAA 2HBQB 5GAHI 1TL7B 4BWJA 2QSFA 3TOQA 4C8ZA 4H4MB 4WP3A 1RWVB 2K1RA 3AY0A 4UUXA 2OGUA 4ZVEA 5KFGA 3UVJA 2CQ3A 2AIRB 4A8WA 4KHPJ 4M5MA 2YWHA 1KLMA 2KG0A 3K89A 3GFXA 3GTYX 2QG9B 3FSYA 3KK1A 4XK8C 3N5FA 1MMLA 2NUUG 2Y3YA 4B17A 5IXUA 3GIJA 1IBLF 2HFVA 3N4WA 3HCXA 3OTCA 3DM2A 4ENOA 3D5MA 1JLGA 2CXEA 1FNXH 5IS2A 3FDSA 3TJAA 1CJTB 2EWHA 5C24A 2E9RX 2GVDB 4DCOB 1DZ5A 2ZKTA 1IKYA 3PX0A 3MXHP 3BYPA 2VQFF 3HM9A 4ECSA 2JC0A 3DLJA 5L1JA 2OEJA 3Q8YA 1NKBA 5E7OB 3T1AA 2G2ZA 4C6AA 2MKIA 4ECUA 1YJWS 2UUCJ 3R5AA 1RWUA 2CUYA 1RP5A 3MPVA 1N36J 4V19J 5J2PB 3BH6B 4NZ7A 2W9CA 3GZ7A 2DR5A 3UWTA 3CCQS 5IC4B 4PUOB 2PE8A 3N79A 4OI4A 1FKPA 1GX6A 3W2WB 2JH3A 3BSAA 3IGNA 1RAGB 2KHCA 3D66A 3O6QA 2MKSA 1RSCA 4ZOSA 3UD3P 4JYAJ 1RT2A 3HKZD 1L3KA 5HMZA 3UDVA 5EWFA 2BQ3A 1JKHB 1XMBA 1PG5B 3RR8A 3TVZA 1X5SA 5D3GB 2CPDA 1YSJA 4ECTA 1PBAA 3FSXA 3MR6A 2R42A 1C1CB 4JB8B 3I5BA 1DTTA 4TYAA 4CLYA 2CQ2A 2BW2A 5DDOC 3VF0B 2V50A 3MEDA 4JBCA 3SEOA 4AYBD 7AT1B 3LPEA 2MQOA 5CD4H 2KJVA 2B6AA 4ZCKA 1RHMB 1LXJA 1NSQA 5AXMA 3KK3A 4B3RF 1FK9A 1HBNB 1N54B 3TW0A 5DGBA 3GQCA 2J6SA 3V6DA 2UU9J 4X4UA 4PR6A 2XG8A 4IH7A 3WX8A 2CRLA 3CPWR 4USKA 3V4IB 1B0VA 4JV5J 4PYAA 2ASDA 4I2QB 4LT6A 1RAHB 4HT7A 4I2QA 5ETKA 4Q45A 1REGX 3EZOA 4OJ3A 1RKIA 1LKZA 1Z2LA 2HEKA 4LF1A 3FBCA 1B0TA 2LEAA 4IQMA 4TU9A 2VQEF 4DV5F 3NMAA 2MSTA 3DLLQ 4DR7F 5J2NB 4ETXA 1UZDA 1HBNA 1FK9B 4DQQA 2CQPA 3TA2A 1F60B 3IM9A 4MFBB 2YNIB 2HQIA 1I94J 1F3VA 3N5BA 3HDSA 1RCOB 4KPCA 2RAQA 4G65A 2BJDA 2BABA 3EDRB 3R7SB 2DGSA 4DMZA 2DGQA 4F0KA 5G4DA 5CXTA 2VD3A 2ZZTA 1Y00A 2B9EA 4K50A 1F9HA 1JK9B 2M88A 2WAQD 4I7FA 2VA2A 1JKHA 5DO2A 3QO9A 3DOLA 1NPRA 3LGHA 4KYZA 4NWBA 4J9SA 1VQPS 2DRBA 1JJHA 5B0BA 2UXBJ 2C2OB 1Q53A 3HHKA 3ELHA 2LEBA 3CCZA 1HWIA 1LQ9A 1TKXA 2J9DE 2W2QP 1UL3A 2GIQA 4RW6A 3W2WA 3I55S 2MY8A 4DXLA 2XMTA 3T1HJ 4UY85 1OY9A 1SXLA 3NKYA 4CWBA 1RU2A 1NSKL 3CJQA 2WOMB 1IWAA 3D9BA 1N5QA 4J9KA 2AZ1A 3KK2A 2QMWA 3JAMY 4A8YA 4NLSA 1SJ3P 1KFSA 1RTJB 3SCLE 2EPIA 2OSQA 4ZLNA 4RBVA 5AT1B 1CVJA 2HHVA 2GO8A 3MMCB 4F26A 4YFUA 2UUBJ 3AQPA 2NPIA 1SUQA 2WVCA 4WK1A 2UXDJ 2RHSB 2BQRA 1BWVA 4OHZA 4KH1B 4IKAA 5DS7A 2HFZA 3CJ3A 1OSDA 1JLGB 3TAPA 4WYWA 1U6BA 4MIWA 1EETB 4USVA 2KVQE 3EDQB 3QGIA 4OX6A 1S57A 2FJDB 4ECVA 2AQ4A 4K0KJ 4WK3A 4K4UA 2XQCA 1NXIA 4WKRA 4H4KC 1VS3A 4HH0A 4LFAF 4EZ6A 3FEXB 3TJ9A 5KFSA 1O5JA 2DGUA 2H5IB 3MTJA 3SIPB 2C2MB 4U7UD 2YKPA 2Y1JA 2IVYA 1F9EB 3HSZA 5IT9U 4ZJQA 3CCTA 1HLWA 1H7XA 1FI4A 3JTPA 3KUHA 1XNRJ 4LFBJ 2FVRA 4TY8B 1VBKA 3QLHA 4F3OA 1U02A 2RQKA 2V69A 3SXLA 1SKUB 3W9HA 3MR5A 4WXWA 3UD4P 3E01B 1YQHA 1RT1B 2L3MA 2BA9A 2QA1A 5A2QY 1RHKB 3PJ9A 3RRGA 3MM6B 1TV6B 5HROB 2EK6A 2ZH4A 4AUKA 3J81U 4DV6J 1OQ6A 4P2SA 5KFIA 1X5TA 3BJYA 1FNMA 3KJVA 4J7CA 5CH7B 2BUNA 3EZUA 3JSRA 1ZH5A 2XYHB 2ZHBA 2BEFA 1QE1A 1YRTA 1TK8A 4LMZA 4KT0C 2W2PP 2X7IA 1Q5VA 5E5NA 3MEGB 4I0WA 2H51B 1CJKB 1S76D 4W90B 1OIAA 1IQTA 2CQ0A 1KOHA 3MM9B 2NYHA 2X3GA 1E6VA 2YNGB 1W2IA 3TA0A 2Y0SD 1DTQB 3T5HA 4O4RA 3X3UA 5GAGU 1T3OA 1UETA 1UZHA 3PDNA 4YB6A 2XTJP 3CE8A 2M8DB 3DLBA 4GVBB 2F4VJ 4LSNA 4C7QA 3NG8A 4DEZA 2QL7B 4W92B 2DIVA 5L38A 4DS5A 4DSIA 4NLVA 1BC6A 2HS3A 4LRAA 5CYQB 2E7WA 5D8HB 2V8VA 3TUIC 1PC5A 5DDQC 1RISA 2HAIA 3BO3A 4USIA 3GG1A 4U6PA 1YTYA 4R5PB 5LXRA 2AEMA 3BBBA 3U1LA 3DMJB 2GA7A 3Q8QB 3CCMS 1KOOA 1FJGF 2RJZA 2MLZA 2YX1A 3AH6A 3MUMP 1H73A 5LMUF 3CCWA 3BEGB 1CJVB 2NPFA 2W24A 3SFUA 4HDGA 2R7RA 2WW8A 4M5GA 1XK8A 3PHEA 1N4LA 5DQIA 4DPWA 1NJZA 4DL5A 1JWWA 3Q8UA 1TL1A 3MM7A 4KGKA 3SQOP 1M1GA 3O2IA 3I0RA 3W7BA 1U26A 4F04B 5D6GA 1U4BA 5IZHA 1MROA 4NX9A 1ZZNA 1B64A 3FUYA 2B9WA 3G8QA 1XR7A 2ZZNA 4KAIA 5KT3A 2DH8A 2IM3A 2Q6CA 3C15B 3M7VA 4ID5B 2OD4A 4HACB 2DNRA 3IAM9 5IC6B 3R3TA 2W8LA 3EX7B 1NMEB 2B4VA 4MKYA 1NO8A 1Y5LB 3D54A 1B70B 3D1HA 3G82A 2DNYA 3MM8B 5LM7E 1NPPA 1WTFA 4A8FA 2B8PA 2VUGA 1NDCA 2F9JA 2L48A 3KXDA 2EFNA 2KVIA 2OPQA 4KFBB 4Y6IA 5K14A 4EBCA 5KFUA 4P2XA 3BBCA 2Z8QA 4F02A 3MI7X 1RUSA 2LEPA 2VL1A 4NCAA 1WEZA 4P10A 1RWXB 3I6PA 4DJBA 3WC2A 2JEJA 1FHTA 2WW4A 2XMVA 3I4HX 3DMJA 2VG7A 1HKAA 2FVQA 5CYJA 4EUVA 1JXLA 2F40A 2X1AA 1NK0A 4P6QA 5GVQA 1TKTB 4CTAA 2OIHA 4G6VB 3T6JA 5D77A 3HD1A 4F4AA 3D2WA 3CCSS 2V8GA 4DPOA 2J8AA 2UXBF 4CQ1A 4RWWA 2QL5B 1I3OB 2BE9B 1PAUB 3OSPA 2R7SA 4LSLA 4U67Q 1K0VA 1WOPA 3TX0A 5IWAJ 3DOKB 3M2UB 4P7TA 1WF2A 2EK1A 5ITHA 3EICA 3M9OB 3AFGA 2B9YA 3O3LA 1E6VB 2ZDPA 2O01C 4R0EA 4HTJA 2DHSA 4CM0A
chains in the Genus database with same CATH topology
2XSFA 3I0SA 3MEGA 3UW1A 1YBAA 3WDOA 5BYQA 4TXSA 3N6LA 4CH0S 1WNEA 3MAHA 5KFFA 2VKRA 1H6KX 3DU5A 5HROA 4QBUA 2XEXA 4TNOA 4IO9Q 5T7LA 3ISNC 2ROGA 1TAQA 2JEFA 1Y5IB 4FN5A 3AQOA 4I2PA 1U6FA 1XBWA 5G0RA 5IFMA 2WB1D 5DQHA 1S1XB 3PW2A 2JEGA 2CPYA 4WKYA 1NJYA 3DLEB 1VFJA 3GFHA 1RT5B 3MURP 2HVIA 4X4NA 4E98A 2QFJA 2FC8A 2ZNZA 2M9KA 1VC6A 5CYMB 4KSEB 5LSOA 2DHXA 2IA6A 1ROFA 3MWBA 1D3WA 5EUHA 3F41A 3IO1A 1WF0A 3G96A 2OTLS 1I1GA 4C3LA 4J9NA 3CCJS 4C4WA 1S48A 3K0JA 1F5AA 4MIBA 2MYFA 4G1QB 1HNIA 3LPYA 5DDPC 3GYXB 3M9NB 4MK7A 3THVA 3FZBA 4PXEA 1S99A 3C8YA 2RKIA 2KFYA 2B3TB 2LA4A 3KK2B 2DPJA 3MD1A 3N0VA 2C2EA 1RTIA 3C6TB 3C3LA 4LF9F 4OL8A 3P96A 2FJBB 4URQU 2FVCA 1JLCB 3VAJA 5J1PA 3HHLB 3CUNA 2PI5A 2YWEA 2LQ9A 4GMKA 2UVVA 1HWKA 4F4ZA 1VQ6S 2IHR1 1FKOB 1WHWA 1LFPA 3TI0A 1I94F 2YWFA 1SKSA 4HL9A 2L9NA 1DAXA 2J7UA 2L08A 3BQ0A 3EXYA 1C0UA 2HLUA 3UCZP 2Z2LA 4CNYA 1WG5A 2MKCA 2ZC3A 1ZOTA 3OR2A 1JJ2R 1K0TA 2EFPA 1FDBA 2B4OA 3KLFB 2P9CA 4ERDA 2E9ZA 2RIJA 4XDDA 3VAMA 2DT9A 3FFIA 1R89A 4UW2A 3M9MB 2R7TA 4DG1A 1G1XA 2CPHA 3HX9A 4I64A 4IOCQ 2VKZG 5F8IA 4M63A 5I3PA 1OSCA 3JSMB 1OO0B 2WB4A 1XR5A 1FRHA 3THTA 1C0TB 1GXUA 2RS8A 1TFWA 1TP7A 4DDFA 3KLFA 2BE2B 3M6VA 1FA0A 1S6QA 5IQQA 2ALZA 3P6YC 3OR2B 5F0UA 4ED0A 4A8KA 1XNQF 4O4GB 4DUZF 3V81A 1UVKA 2E29A 2VH7A 4PXDA 3H5SA 1KONA 1X8DA 4MMOA 1FKOA 1Q4RA 3CJ0A 3R5DA 5CQGA 3KWMA 4NLRA 3U7JA 3CC2S 3SI8A 1SL2A 3FVYA 1HARA 2ATLA 1NK9A 1PILA 2J7KA 3HVRA 1K8AT 2V4QA 4MKAA 2W7PA 1Q79A 3PIOQ 3OFEA 4ZCLA 3J81Y 3OFGA 2XHWA 4Y00A 3OTBA 4X4TA 4C2MA 2XLIA 1VK8A 2MQQA 1N5SA 5E3PA 4DSEA 1RJJA 1GX5A 3SV4A 4A8QA 2V9KA 1E6YB 3VAIA 1S0OA 2W9BA 4A8OA 5B0EA 2HRUA 2IJNA 2VPWB 2DGXA 3KLIB 4QIVA 4NLGA 2P6TA 2QLXA 2CPIA 3W2VA 3UI3A 2D74B 1YG0A 3DM2B 1C1BB 4K5SA 4KR0B 3HVTA 3ICLA 2ACYA 2GMHA 2I5JB 1KLMB 1TZ0A 3PFEA 1FRXA 5CYMA 4XDCA 4IYQA 4ECYA 4DFKA 3HJFA 4H4OB 2RVJA 3H5YA 5HBMB 3EPIA 2L9DA 5LJ3Y 2PN6A 3SCJE 2M0GB 4H54A 3DN9A 1Q16B 4M94A 5KOXA 2NQPA 4C8NA 4FVCA 1GH8A 2XNQA 2V8DA 4ELUA 4C3MA 4RUHA 1FJCA 3C66A 1BQMA 4YB5A 1IKWA 1RTHA 1VQ7S 1YJUA 1URNA 2JEIA 4NA1A 3CJ5A 1LXNA 3ISND 5B0FA 5KOWA 2YTCA 2NLWA 4OLPA 3LW5C 3EPGA 2B0GA 2BV3A 5L39A 3OL7A 3VZHA 3JTNA 5D78A 3WBZA 2OJ3A 3OL9A 1KFDA 4CO3A 2F8HA 5HP1B 5GADU 3M8PA 3TVYA 5EX3A 1LWCA 2IVMA 2CJ9A 3BGLA 3GSDA 3E51A 4YP3A 3M2UA 5L9XA 1NKEA 3JYTB 1RTDA 4ILMA 1VQNS 2XSJA 3QJLA 2PMZD 2N4DA 1MMDA 4N41A 5KG1A 1X4GA 3UQSA 3M8QA 1Q7YT 3LWMA 4ZP6A 3L7OA 2DPIA 3FMBA 5B0DA 4F3MA 1KVJA 4ES3A 4DQIA 3TYTA 5CA5A 4IO1A 1KHWA 2ZC4A 5B7WA 2UVRA 2ZBIA 2AU0A 1VRUA 3I9V9 2HS4A 1RT3B 3MECA 1S1TA 2C2DA 2AJ0A 2VFUA 2ADCA 3RW6A 2YNFB 1SH3A 3KG0A 4N77A 1YHQS 3T3FA 4PG4A 1BQMB 4Y2KA 2OPQB 4KFBA 1RQ0A 2MQLA 1ELOA 5M2UA 1GT8A 1FJEB 3G9CA 3N9UC 5B0GA 4J9QA 2KT3A 2B43A 1OPZA 1ZPWX 4AXJA 4WFXA 3Q8RB 4DV0F 3THPA 1U1RA 4ID5A 3MFHA 1VIOA 4KJIA 4QWBA 2SXLA 1FDAA 2X51A 5HBMA 3TAQA 3PACA 3UR3C 1HYSB 2EFQA 2PSZA 5L8RC 3I0RB 2GHVC 4IG3B 1ZM3A 4J9RA 2B51A 4Y3CA 7FDRA 2CQDA 1JNRB 1QVFR 2A10A 1C1BA 2OFHX 4DSKA 3EZ5A 4FF3A 3UR0A 1P1LA 3I9ZA 2MZRA 2QV6A 1OS5A 2ADBA 5A8WB 3IR7B 1HQEA 4BWMA 2D3ZA 1YJNS 1DZ5A 4IRCA 2ZH9A 2DB1A 1M5PC 2I0XA 1VI7A 1U2RA 2RNEA 2HGLA 1LW0B 2E1MC 2RU9A 3FCHA 4WE1B 1R8HA 4EBCA 4IUFA 1HA1A 1UVLA 4AL5A 4DL7A 4I6AA 3P49B 3KMSA 1FE4A 4GO7X 3AA8A 1R31A 3OFHA 1Q8IA 1SJ1A 5DDRC 4K4WA 3DYAA 3BDEA 3PX4A 4HTIA 1FDNA 2YNGA 4PWDA 3CO9A 1FESA 2AJ4A 1F2GA 4M1KA 1NH7A 2JC1A 2AGPA 4AL7A 2MZ1A 3IBWA 1IKVB 2GW8A 4FF4A 1GQEA 2C3MA 2OO4A 3K5LA 4Q8EA 2DNGA 3KJVB 4WZMA 2K7KA 1H2VZ 3KLHB 2W4DA 5DG7A 3I5CA 1P27B 1Y5NB 5K8PA 2FVPA 1LV5A 2WSEC 1K1QA 3FMWA 2F4VF 2XS7A 4IOAQ 1PC4A 3CC7S 3QZ8A 1RT1A 2VZ9A 1UW4A 2R2UA 3L7PA 3B82A 3QLHB 4NOHA 3NS6A 4YR0A 2AW0A 1IN0A 2KXHA 5F8LA 1R8CA 2DCUB 1NK4A 2NXUA 2ASYA 3H25A 3PZPA 4JV1A 2DBBA 2AV5A 1KVIA 1MW7A 3MPWA 2Y1RI 4NLPA 4ZCIA 3DOMA 4RU9A 3HVAA 3M6WA 4DG1B 3GB0A 4J9LA 3DXBA 2YNHB 4HHJA 1LW2A 2DNKA 2DR8A 4ED3A 4DL2A 3BN4A 1HBUB 1NK5A 4QWDA 1WACA 4ES1A 3KHGA 3DRSB 5I3UA 3GE9A 2JSXA 3MCSA 2VPZB 3NRBA 4DV3F 2ZZMA 2B7BB 5KFRA 3NGDA 2CZVC 2GMJA 4K4SA 3CD7A 2DNNA 4GKKF 2IMOA 1T03A 3K57A 3JTOA 2YKQA 1FEEA 5EWGA 1DLOB 4NYZA 4NXNF 4OLOA 4KV8B 1IXKA 3UNGC 4J37A 4DR5F 4B9VA 2J9EA 3QGPA 2G1DA 1S9EB 3NCQA 4WYLA 3DNCA 4UOCA 4RNMA 4ELTA 4EWTA 4B9NA 2RKIB 3DRRA 4OZLA 4OX8A 1VQYA 5LMNF 3HVWA 3I5AA 2KZMA 1XNRF 1ZTTA 3QO9B 1WD6A 4ZHRB 3OXGA 4ZMMA 2GO9A 5F0WA 2EG2A 4JI3F 2D9OA 1M5HA 3H5UA 4JI1F 2J0XA 4AQYF 1U1OA 1LWFA 4Q7AA 4NYPA 2Y1IA 5AE3A 1R8BA 1VRTA 1Z1ZA 2GQQA 1U24A 2CDQA 2RH3A 4MFBA 4R25A 5K9FA 3GR1A 4F50A 4PWUA 5D4LA 2IC3A 5J2NA 4NPOA 4OQJA 1R0AB 2FJXA 2MJUA 2BR0A 2QZ8A 4PPZA 3SYZA 1DJ0A 2LQBA 2FGCA 2FHJA 3K8WA 5DQGA 3RB0A 1HMVB 1FERA 3H5XA 3OW2R 5J2MB 2OTJS 4KQZA 3CMAS 2W4PA 4AXIA 3MR3A 2R7WA 1RT5A 3V6DB 4R8UA 2PFFB 5F8GA 4PQUB 4Y0FA 2HNZB 3UCGA 3U27A 3J7Z5 3L3CA 2O5DA 3QIDA 2CVIA