4QU6A

Crystal structure of a g-rich rna sequence binding factor 1 (grsf1) from homo sapiens at 1.75 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
99
structure length
99
Chain Sequence
b'DDVFLIRAQGLPWSCTMEDVLNFFSDCRIRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEVYEINNEDVDALMKSLQVKSSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords G-rich sequence factor 1
publication title Crystal structure of a G-rich RNA sequence binding factor 1 (GRSF1) from Homo sapiens at 1.75 A resolution
rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 28
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qu6A01
3UCZP 3THPA 3J7ZT 2L41A 2KXHA 1FT8A 5D77A 5D78A 3VAHA 2CQGA 3TYTA 3IRWP 2I2YA 3CCJS 1F9FA 1U1NA 5H1SV 2RQCA 1JJ4A 2QA4S 2DNQA 2ADCA 2M0GB 2LA6A 3MXHP 2LEAA 1R8PA 4C0OC 2GHPA 1DBDA 3VAJA 2XB2D 2XS2A 2RVJA 1H2VZ 1UP1A 2YWKA 2CQPA 1OO0B 5MLCV 1L3KA 1JMTA 2F9DA 2MZ1A 4W92B 1KQSR 4IOCQ 2M70A 2DNZA 2J0QD 2JVRA 2RNEA 1VQ8S 1U6FA 1XN9A 3G4SS 2DNOA 2F9JA 3CCSS 3LQVA 1M5OC 2LYVA 2G0CA 4LIRA 3P3DA 1Q82T 3R27A 5GAHU 2OTLS 4TU7A 2MPUA 2L9WA 5LSLA 3Q2TC 1DHMA 2KM8B 3MOJB 2DNYA 2MJNA 2E5GA 4CH0S 3H2UB 2MGZA 1X5PA 5HO4A 1YI2S 3VF0B 3K0JA 1U1LA 1VC5A 1FJCA 1M1KT 2FC8A 1A7GE 2N3OA 2DHXA 2RT3A 3S01A 3NNCA 2RU3A 4QQBA 3CCQS 2EK6A 1YIJS 2DIUA 3UD4P 1H6KX 3S6EA 2DGVA 2MKKA 2X1FA 2K3KA 3CXCR 3PIOQ 5DM7Q 1QVGR 2DNMA 4LMZA 3CCES 2DITA 1PO6A 2DIVA 1RK8A 4FXWA 1O0PA 2MQOA 2MB0B 2BZ2A 4QPTA 1D9AA 2LEBA 3DXBA 2CQDA 4Y0FA 3CC4S 5GAGU 2I38A 2XS7A 3EGZA 2M52A 1U2FA 2MKSA 2MQNA 2CPIA 1FJ7A 1WG1A 2CQ1A 1N8RT 2LKZA 1M90T 1K73T 2MHNA 2CPEA 2DNPA 3TP2A 3B4MA 3SXLA 1UAWA 4OZ0A 2LXUA 1X0FA 2CQHA 2D3OR 3CTRA 3NMRA 1S72S 2DGQA 2E5HA 1JJHA 1X4AA 2X1AA 3CUNA 3CMES 2RQ4A 1WHYA 2MQQA 2YH1A 1ZZFA 1SJRA 5DDPC 2DNLA 4F25A 5CXTA 4CQ1A 2V94A 2HVZA 2CPFA 3VAIA 2JRSA 2KXFA 2LA4A 5JVGQ 3TO8A 2J76E 2OTJS 2M8HA 3CD6S 5ITHA 1FHTA 1S79A 2G1DA 2MZJA 2SXLA 3R1HA 1JJ2R 2DGUA 1YJNS 1AUDA 2KN4A 2MQMA 5GAEU 3BO2A 2MZSA 2GO9A 1H2UX 3UCUP 2DHGA 2LECA 4QU7A 1IQTA 4TU9A 3EGNA 5DDQC 2FPHX 3EX7B 2DHSA 2DNGA 2DNRA 2E44A 1U6BA 4F02A 3UE2A 3G8SA 2NZ4A 4WKRA 1X4DA 3UCGA 3BO3A 1VQMS 4TLQA 3I55S 3FEYB 2XNRA 3CCUS 1G2EA 1P27B 1YJ9S 4BS2A 2DH7A 5HL7Q 2CQCA 2MZTA 1WG4A 1OIAA 2HZCA 1BY9A 3R1LA 2AYGA 5IM0A 1H2TZ 3U1LA 4Y00A 5DDOC 4IO9Q 3BS9A 1VQPS 4V19X 3CCLS 3IWNC 1X5TA 3JB9k 2OSRA 1WHVA 3DLLQ 4IUFA 1WI8A 5GADU 2QFJA 4WFAQ 1DRZA 3D2WA 2DK2A 3HHNB 2M2BA 2DO0A 2FY1A 4TU8A 2CPXA 3BO4A 1VC6A 2YH0A 1VQ7S 5CA5A 1R8HA 4EGLA 2KHCA 2M88A 3RW6A 3Q2SC 1WHXA 4PR6A 2WBRA 3NS5A 3H2VE 1X4HA 2RRAA 1SJFA 4UQTA 3G6ES 1DZ5A 1B7FA 3UWTA 2MZQA 1UFWA 2UP1A 1U1KA 2KH9A 3MUTP 5LSOA 1Q81T 3CC7S 4PKDB 3NS6A 3CCVS 1U1MA 2MKIA 1Q86T 3OW2R 2EK1A 1RKJA 2VOOA 1WI6A 2YKAA 2MKJA 2N82B 2MSTA 3P5TL 2AYEA 1WF1A 2LMIA 3U1MA 2DH9A 5LXRA 3VAMA 1VC0A 1U1QA 2FC9A 2M8DB 3MURP 1CVJA 3MI7X 1U1PA 1HL6A 1Q7YT 1VBYA 2KU7A 2YTCA 3SDEB 5LJ3Y 1NO8A 2CQIA 3FEXB 3S8SA 1D8ZA 2MYFA 1M5KC 2AD9A 2F3JA 2MKCA 1KC8T 3VAGA 2LCWA 3CF5Q 1OWXA 1N54B 4WCEQ 2M4MA 2VOPA 2MY7A 5LJ5Y 1VQNS 3RW7A 5GVQA 1HA1A 4WF9Q 1WEXA 2CPYA 2MY8A 1FNXH 1YHQS 3ULHA 3MD3A 1WEYA 2MSSA 2J0SD 1X5SA 2L08A 1FXLA 4P6QA 2RS8A 4ZKAA 2EVZA 4YB1P 2FHOB 2DGWA 1VQKS 3HI9A 4Z2XA 3G9CA 1SXLA 2MMYA 4U67Q 2DISA 2DNHA 1KOHA 1PGZA 2MGZB 3N9UC 2OSQA 4WFNQ 2BOPA 2AYMA 2MKHA 1WG5A 2JX2A 1ZZNA 1WWHA 3MUVP 2KVIA 2CQ0A 2RS2A 5GMKa 2CPZA 2JWNA 2ZJQQ 5JVHQ 5IQQA 2DB1A 2E5JA 2CPJA 3P49B 1KD1T 1X4FA 4C4WA 2DNKA 4M5DB 1YJWS 1VBZA 2DGOA 1X4EA 2CPDA 2KYXA 3VAKA 2HYIB 3LPYA 2A3JA 3ZZZA 1M5VC 4WIIA 2HGMA 1X4GA 3G96A 4J5OA 3US5A 5DM6Q 3SDEA 2DGXA 2G4BA 2ERRA 3NNAA 4A8XA 1WTBA 2NLWA 2DGTA 2B0GA 1NU4A 1VQ5S 1X4BA 2HGLA 2DGSA 3SMZA 2KI2A 2DH8A 2M7SA 1SJ3P 1VQ9S 1U1OA 1YTYA 1U1RA 3G71S 3UD3P 4RU2A 2DHAA 2U2FA 4PRFA 2M9KA 1N52B 3CULA 4WFBQ 2MJUA 4ED5A 2LXIA 3S7RA 1HD1A 3I56S 2Q79A 4FXVA 4W90B 3CC2S 1VQ4S 1URNA 3L3CA 2MXYA 2CPHA 2U1AA 4UY8T 1KOOA 2QEXS 2RRBA 2KRBA 3ZZYA 1P1TA 4CIOA 2K8GA 5CYJA 1SJ4P 5BJRA 2X1BA 3BEGB 4LJMA 3CPWR 1VBXA 5EN1A 4YUDA 2VODA 5DDRC 3CMAS 1OPIA 1QVFR 4ERDA 2CQ4A 1QM9A 4C7QA 2JVOA 5IFMA 3MUMP 2KG0A 2XS5A 1FO1A 2D9PA 3G8TA 4IOAQ 1WF0A 2N7CA 1W2BR 1FJEB 2PE8A 3VALA 2XNQA 5LXYA 2OJ3A 3CCMS 2VONA 2CQBA 1VQOS 2D9OA 1X5OA 2AYBA 1WHWA 2J8AA 4CH1A 5DETA 3MD1A 2ADBA 4F26A 1M5PC 4OZ1A 2DO4A 2E5IA 3P6YC 4QU6A 2KM8C 3PIPQ 1VQ6S 3J7YU 1WELA 2MQLA 2X1GA 1WF2A 1YWXA 1HD0A 1VQLS 1N88A 2DNNA 2MZRA 2KT5A 3B4DA 5IM0B 1WEZA 1SJQA 2PEHA 2CQ3A 2HGNA 1K8AT 3VAFA 2O3DA 2KFYA 3THTA 1UW4A 2ZJRQ 2XSFA 1ZH5A 3NNHA 2KRRA 3CCRS 2RUGA 1A9NB 3V4MA 2ZJPQ 4YOEA 1NJIT 1K9MT 2CJKA 2OIHA 1X4CA 2N3LA 2MQPA 3MDFA 2CQ2A 2KG1A 2KXNB 5FJ4A 1YITS 2LQ5A
chains in the Genus database with same CATH superfamily
3GYGA 3THPA 2KXHA 3KK1B 3TWZA 1HQUB 2C2EA 5DS7A 4H4KC 4B9SA 2LA6A 3KFWX 2KDOA 4M5HA 4IR1A 1TAQA 4A8MP 2YWKA 2W2MP 1UPMB 2HIYA 4ECVA 2XZWA 3IO1A 4KBIA 4ILLA 5KT7A 3BSAA 3KLFB 4WZQA 1CLFA 2E5GA 2QTWA 1D0EA 1KVJA 3RB6A 1U24A 2N3OA 3VQSA 4BLGA 1HKAA 4F2RA 2RMLA 1K0VA 3FSIA 2CA9A 3QWPA 4MKAA 5KFBA 4WU3A 1H6KX 3POTA 2O01C 5KAKA 4GC6A 1N36J 3LUYA 4DV0J 3DXBA 4B3OB 1X8DA 4B3SJ 3TUZC 2I38A 4RUAA 3PCOB 1XWLA 1SI9A 2CDRB 2HHXA 2WAQD 3VGUA 3PO4A 1T05A 2CPIA 3KG4A 1QJHA 1RHQB 2V8VA 2APOA 4MH8A 3SXLA 1RT3A 4OZ0A 4ANCA 4DR3F 2IAJB 1S72S 3QT8A 2PMWA 4MKYA 2BABA 1TKZA 1G3OA 3PW0A 4DUYF 5KG0A 3TO8A 2XMMA 4YY3J 4A46A 1HHSA 4X62J 4IG3A 2DHGA 5KFMA 3NGRA 2NXUA 4GO5X 3HVWA 2KTQA 3D3CJ 2W9BA 2GGPA 2HZAA 4HHJA 4BS2A 3JTOA 5D3GB 2J9EA 2RQMA 1C0TB 2E5LF 3JB9k 1U0SA 1WI8A 3SYZA 5KFGA 2OKQA 2KFNA 4WFAQ 3SSRA 1KQFB 4EBDA 4H4OA 2M2BA 2CIMA 4LF9F 3RB3A 1S6UA 4L75A 4OI6A 1RA7A 3G6ES 2GA7A 4NA1A 3BSOA 1V9OA 4XIUA 1DTTB 3QT6A 1R0CB 4ED1A 4WJBA 1EB0A 5ETNA 3KJNB 2EFPA 2M8DB 3ZTSA 5LL6d 2YTCA 3TJ8A 3MAHA 4NA3A 2F3JA 2LCWA 3DRPA 3CF5Q 2WONA 5HLFB 3T6BA 1HA1A 2VFRA 2VB6A 4JI0F 3HO1A 2J0WA 4Y2MA 2MSSA 4R5PB 2GC8A 2JZ5A 4I7FB 3HI9A 1NZ8A 2W4PA 5J2PB 1CQNA 1FNOA 5CYMB 2VQFF 1DTQA 1BGXT 3HK2A 3H98A 4HACA 2BQRA 4FF1A 1RWVB 5JVHQ 5IQQA 3AA9A 2AHOB 3PEJA 4M5DB 1T3NA 3GSDA 5C5JA 3KMSA 2W25A 4ZPAA 3TAQA 4LF1A 2XO6A 4N7TA 3ENQA 1CULA 2QV6A 2WSEC 2HQ3A 5HROA 1NK9A 1RXOB 3HX9A 1XERA 1NSAA 1XNRF 3U27A 1IKWB 4ANEA 1SH2A 2IPOB 1PYTA 1FNMA 1S1TA 3K5OA 1KFDA 3PYDA 3LF0A 4U6PA 2Q79A 4W90B 2GIFA 1RE1B 2DR7A 2GQQA 2QEXS 1JLQA 1HQEA 5HQLA 2IIHA 4DR7J 4I6WA 2VODA 4BC7A 3D1QA 4C3MA 2CQ4A 2IBKA 1V5IB 2D9PA 1BHNA 1AFIA 2L3MA 2D7SA 3KMQA 2IM3A 1ELOA 3OR2A 1EQ0A 1CC7A 2F5GA 1FE0A 1UVLA 4OZ1A 4KO0B 2HK2A 3TVYA 3UD5A 3MFIA 2CJYB 1KTQA 1YWXA 2L48A 4K5RA 4NE9C 3BGLA 1PJ5A 3T5KA 1FFWB 3T41A 1ZAXA 1TKTA 4HH0A 5KG6A 4FPRA 2ZJRQ 1PJ7A 1A9NB 4F4KA 3CD7A 1IXKA 2K1RB 2R8IA 3IRXB 5IT4A 4KPCA 4KSEB 3H40A 3EDQB 3IRWP 4U7CA 3HFKA 4ZHRA 3HD1A 3BSNA 2IJNA 3M9MB 4RX6A 2XMTA 1GNKA 1IQZA 2CRLA 4O3NA 4USIA 3U1NA 3EUNA 4CCHA 2A18A 2HIQA 4EWTA 2R7QA 1CSJA 4NWBA 2G0CA 1YJVA 5KT5A 3DLGA 3ZO7A 4N41A 4M94A 1W2IA 2RF2A 5KG1A 1NUEA 1XMQJ 3CJSA 2JL9A 2W8LA 1TTHB 5HMYA 5KFDA 4LFBJ 3S6EA 2IM0A 1FERA 2UV8A 4OHWA 3OL7A 3ILLA 1FI4A 2CNNB 1PO6A 2N4CA 1ICEB 3NCPA 4IFVB 2HHHJ 3R3TA 5K8NA 2FVPA 4BDPA 3PW5A 3H0PA 2XLKA 1ZAWA 4OYWA 4DR6J 1P9QC 4A8WA 1K0TA 4QIVA 1ROFA 1T0TV 5KT3A 1IWAA 2ZKUA 3GWCA 2ZM6F 1L3UA 1MMDA 1N5YB 2BJ8A 5ADZA 3R5AA 1IBLJ 1UFKA 2GV1A 2Z0GA 3BO2A 1H2UX 4DXLA 3TAPA 1Y0HA 2P9EA 1NHKL 4N56A 4MFBA 2ZH8A 4HI2A 2R8JA 4WKRA 2AT1B 1NPRA 1T7PA 1E6VB 2OPSA 1VRUA 3CDBA 2CQCA 3OJSA 1SC4B 3DXSX 2RJZA 4GO7X 2RILA 3DU6A 1S9EA 3KTQA 1OJ4A 2PIIA 1Q8BA 2CJ9A 3OR1A 2JFKA 1FX4A 2C3MA 4K0KF 5CA5A 3MMAA 3F0NA 3PG9A 1EJ7L 5K8OA 4UQTA 1N5SA 3MF5A 5KFOA 1WDDA 2KH9A 2KZMA 2A0FB 4DQQA 4ZP6A 1FEEA 2AJ1A 3AJ2A 4KIAA 3M8QA 2JH3A 2C2KB 2IYIA 2HPUA 1T03B 1FKPB 2CQIA 2UXCF 2YKNA 1KDNA 4LBIA 3SQGB 1F3FA 1KTVA 4ZJQA 3QZ8A 3SIPB 1S0VA 3QPIA 2FLNA 1RBAA 1RTIB 1H7WA 3W62A 4ILRA 2IMOA 4LF6J 1IBKJ 3ZXWA 3QLHB 4ZK7M 2V4QA 4OYMA 4NCGA 4J9UE 4B9TA 3I5AA 1ZZNA 4DPUA 1V6HA 2QC3A 2HFNA 2V0NA 1WJ9A 4I6AA 3KWMA 1JXLA 2DNKA 1V3RA 2Q3PA 4B08A 2A3JA 4OYIA 2GW8A 4Y34A 3NWGA 2BKOA 1YZ6A 3MMCB 4G1QA 2EG2A 2DHAA 2AJ2A 1HR0F 3V4IA 5FDLB 3SEOA 2VFUA 3L3CA 1TKXB 5E3CA 2L9DA 1NB7A 4KE5A 3DRSA 5IQ6A 2XMUA 5KT6A 2V4RA 2VBXA 1P1LA 1KONA 4IH7A 1MWZA 4UOFA 4DZDA 4LF8F 4WTOB 1QM9A 1QE1B 2ZH7A 3OTOF 1SL2A 2EFQA 5DZ7A 4DV5J 4P2MA 5LXYA 1VQOS 3TUJC 4P72A 1BQMA 2NXNA 3WBZA 3GG1A 3DOLB 2W7PA 1RBLA 4ZS6A 3GP9A 4PQUA 1HD0A 1R0AA 3OL8A 4X4UA 4B3MF 1GTEA 4B9UA 1WEZA 4KT0C 2QA1A 3A12A 4ZVTB 4G6VB 2VL1A 2YX7A 3JAMY 4H4MA 1LW0B 3AHPA 2MQPA 2G2ZA 5FJ4A 2R42A 2XMKA 3CJ2A 5K9FA 2FZGB 4YS2A 2B9YA 2AEFA 1RB0A 2VC0A 1RWUA 1HYSB 3MXHP 3DGPB 1TK0A 5I3UB 4C0OC 2PI5A 4LFCF 2QSFA 1S1XA 5D4LA 1HBOB 1RTDA 2VPZB 4B17A 2G1HA 2OPQB 3RBEA 2Y1IA 1NDPA 3K89A 1HQ2A 3EZUA 2ZUAA 1YJ7A 2HFSA 1CJKA 3Q2TC 2QL9B 3V5RA 4Y2KA 5ETLA 3GCWP 3TAMB 3LP1B 5D0RA 2NUHA 1T95A 3FBBA 1R31A 4OMFG 8ATCB 4OZNA 2ZD1B 4CWBA 1FKOA 5KFRA 2HW3A 2E7XA 5L46A 5C42A 4IDKB 2JFDA 2MQ8A 2ZOMA 2DIVA 2BZ2A 2GS8A 1B4SA 2H4WB 1FJGF 2M52A 3KUEA 4LUBA 2AU0A 1EZZB 2F40A 4O3OA 4BBYA 3TP2A 3HHEA 3E8OA 1UAWA 3N4WA 4DR2F 3HJFA 5F8MA 3AH6A 1X0FA 5KOWA 4FKYA 3LP0B 5BXIA 4NX9A 2X1AA 3CUNA 3ZZUA 2MQQA 5KFIA 1ZZFA 4CLYA 2XO7A 2V94A 2JEFA 2E1CA 2JRSA 2ASJA 2OO4A 2I8EA 5IT9Y 2BJ9A 2HHWA 3TVKA 5IZHA 2CXEA 4B3RF 2DY9A 3MZIA 1RQ0A 5HJYA 3MPWA 1BY9A 4URGA 4NI2A 4V19X 3W61A 3P5BP 3O8WA 4KQZA 3UDCA 2XQCA 2HZVA 4AL5A 1TP7A 3ZTOA 1TL4A 3IG1B 3HHLA 2FDNA 1RWMB 2BRKA 1YSJA 3IM8A 2XYPB 4O3PA 1UFWA 5CYQB 1EQMA 2GVDA 4RW8A 2XMVA 2W4DA 3FVYA 2V50A 1RT1B 4KGZB 3O5TB 2V2QA 1LXJA 2OI2A 2N82B 2AYEA 2LMIA 5IC4B 2EXUA 4LQ3A 3KHLA 3MURP 2KU7A 1GFWB 3W2VA 4J9SA 1L5UA 4USVA 4YHHF 1N54B 2M4MA 1L3SA 2VOPA 3G6XA 1C0UA 3Q23A 3OL9A 3LGHA 4U96A 3IBWA 2B4UA 3GFZA 1F5AA 3NBPA 4YB1P 1MNEA 4KFBA 4O44A 1QTMA 3MM8B 1S9GA 2MMYA 4P74A 4E98A 4F67A 2CNLB 2VJUA 3KJFB 3MPUB 4IKAA 3KLVA 2ZBPA 3D1HA 2CZ4A 3NGKA 1RTJB 1HWJA 4ZJOA 1U02A 1HBMB 3VAKA 3R5BA 4ZVFA 3D4JA 4H4KA 3FK4A 5DM6Q 2ERRA 2LQJA 1RZMA 3TW0A 1NU4A 4JB8B 4AE5A 1V5VA 1ITPA 1HW9A 1NLKL 2GMHA 4DF8A 1U1OA 1BE4A 3I0RB 3E01B 2B5JA 2HRYA 3N6LA 4RUCA 1MSWD 1GTHA 2JOQA 1AZSA 1EKSA 3JSRA 3ENVA 1I94J 1ZOTA 2IC3A 1KLMA 4PAAA 4B9VA 4CIOA 3RTVA 4CYUA 1SJ4P 3BZQA 3C3LA 1HFEL 5A8WA 3HVTB 4RW6B 1TUVA 1CC8A 3P8BB 4ERDA 2WVDA 4U8YA 3PX6A 4IOAQ 2N7CA 2PE8A 2DY1A 3ZC4A 2J8AA 4Q8EA 2FB0A 4LF7J 3G6VA 3NOGA 2IA0A 4KAIA 5M2RA 3CJ0A 2X1GA 4IH6A 3JSYA 3VCDA 3RYLA 5IWAJ 3TEGA 3LGNA 5KFEA 3VAFA 2E7WA 1M1GA 3PRBA 3DRRA 2JEGA 2V4JA 2IRXA 2B51A 2QMXA 3PJXA 4DSKA 1LWFB 3FDSA 3GFYA 4ED4A 1S77D 3J7ZT 4I67A 2HMIA 4JI3F 1V3SA 2P6SA 4TLRA 2LQBA 2A10A 5K8PA 1Q5YA 3WX8A 4DMZA 4KYZA 1TAUA 2GJIA 5K8MA 1TMMA 1H2VZ 4CT8A 2OEKA 1RAFB 2CQPA 1VBKA 1NK6A 4IOCQ 3J80Y 3MCNA 3GPAA 2QMWA 3BM7A 2DNZA 2HNDA 1NK0A 4RBTA 4L3NA 4YP3A 4M8LA 4WE1A 4CTAA 1IJEB 1CS4A 4USWA 5LM7E 4JYAJ 2HWIA 4OLPA 3N5BA 4M5NA 1RT3B 1DHMA 3IXQA 4LSNB 2W2OP 4NRTA 4X65J 1U1LA 1GH8A 2YNFB 2BBEA 4LR8A 3NNCA 2PO4A 1UETA 2RH3A 1O8BA 4HR2A 2ZKTA 2Z2MA 2DGVA 1DAXA 2X1FA 4IG3B 4DL7A 2VICA 2OEJA 5A2QY 3EPGA 2VQEF 1KNZA 3M2RA 5E0OA 1SV5A 2KYZA 1LWXA 3GMGA 1M1HA 3I82A 4DV2J 2FJAB 1SPBP 4NLDA 1VFJA 2CQHA 1DURA 2HLTA 3K5LA 1Y7PA 4A8KA 4JI6F 2X3GA 2XCAA 4CDIA 1PG5B 1NJZA 3CE8A 5HBMA 2GVZA 2KVQE 3PHTA 3I9ZA 4PCQA 3W60A 1UL3A 3BQ2A 5CABA 1RABB 3BO3A 1XMBA 4TLQA 4F4AA 3PW2A 2C1EB 5EUHA 4I69A 1ULRA 3BR8A 1FD2A 4NLTA 1RWOB 3HLUA 1X5TA 1WHVA 3Q22A 3D0HE 1JQGA 1X0PA 3M6UA 2ZOFA 5DGAA 1DRZA 3QRQA 2GO8A 2ZH6A 2DVIA 3OXFA 2V34A 2YWFA 1WC6A 3BDEA 3RB4A 5K5MA 3HZEA 5IV3A 2UP1A 3ITHA 2YQ1A 3NMAA 3CCVS 1A0OB 1B7YB 3FUYA 4TXSA 2EK1A 4WYWA 2CKWA 1HI0P 3W65A 2YKAA 1JLBB 1NRKA 2JLGA 4DUZF 2OHDA 1WACA 1CULB 2UXDJ 4DL5A 2MKCA 3JTNA 3QSYB 2BJ3A 1LFPA 2IDEA 3GR0A 3M8YA 4RPFA 4OFZA 1XJWB 8RUCA 5M2PA 1S1TB 3ULHA 3K57A 4OYOA 1SQGA 3N79A 1AUSL 2FHOB 1KN6A 2VKZG 1S6QB 5GMEA 4U67Q 1SB6A 2FJBB 5I42A 3PR5B 3RBDA 2YQ3A 1UEVA 4USHA 2CQ0A 2D3O1 2QYGA 4M5KA 2OPPA 5ETOA 3CDAA 4ZPTR 4WP9A 4DV1J 2UUTA 2W4CA 1YJWS 3T9ZA 3ZZZA 2ZHOA 4C3LA 5LMUF 2GAGC 3US5A 1YRTA 4OX9J 4ECWA 2EBGA 1X60A 1S0OA 4IG0A 4F4YA 4ED3A 1MROB 1IR1A 1RSCA 1N52B 2M9KA 2GMJA 2Y1RI 4FXVA 4MK8A 3I4PA 4XPEA 2CFXA 4AQYJ 4J9PA 5BJRA 3MEEB 2B7BB 3L09A 3MECA 3O6QA 2K3IA 1PJ6A 3EM1A 2OFGX 4JI8F 1RI7A 4DPWA 3V6JA 2HNYA 3FCVA 5F0WA 4X4VA 4NLUA 1FRIA 5LMNF 3HT0A 3VWSA 3QIPA 1EETA 2CJXB 5J2QB 2DR5A 2Z58B 3OQ2A 1T3OA 5KFSA 4LIWA 3FBFA 4OV6A 2PDAA 3TJAA 1HARA 1RAGB 1Q78A 1TR0A 5IM0B 2XEXA 3JAMU 3QO9B 4L3KA 5F8LA 4X4SA 2ZHBA 2HGNA 4ZA1A 2KFYA 1NSKL 4USMA 2RUGA 2ZJPQ 5CHCB 1HNZF 3D67A 2Q6CA 1PYOB 2FVQA 1F0XA 2IM2A 1DARA 2FY8A 1OSDA 1FT8A 2GJFA 1S7IA 4NPOA 1QD1A 1QUPA 3DLEA 3CSKA 1JXVA 1PAUB 2NXEA 4O4GA 1ZTTA 4NXMF 4F3QA 1RACB 3CJRA 2ZWOA 3UFCX 3I0SA 4PZVA 3B82A 2EFVA 3P3DA 2L9WA 4EO6A 2YBVA 2BJEA 2AJFE 2W2PP 4G1IA 1VI7A 1MLAA 4BHQA 3MPDA 2Z8QA 1KWMA 1VC5A 4CM0A 4A8SA 2W9CB 4TVAB 3GE9A 5J2MA 2L9NA 4DV3F 3G6YA 1HNXF 3N28A 2E9TA 1DLOB 2B9XA 4GRSA 1VIXA 1FDAA 5DO2A 5J1EA 2MB0B 3Q8YA 1JWWA 4QPTA 2CQDA 4CT9A 3LAKA 1UPPA 2R3VA 1WSRA 1ZM3A 2G9OA 4J9VA 4IFYB 2OD4A 1HBUB 5EWFA 2MTLA 4RW7B 3OUYB 2HVIA 2FVRA 1VK8A 2XTJP 2RKIB 3OR1B 4P10A 1WHYA 2N7YA 2YH1A 1SJRA 1T94A 1S1UB 4F3MA 3KLIB 4PEOA 3R1HA 2G1DA 3QSIA 4X84A 1OMSA 3UO0A 3MM6B 4QU7A 4GVLA 5AJ3J 2KL8A 3GB0A 3M8PA 2OPRA 4OHYA 4Q44A 2XNRA 1C1BB 2KO1A 1S97A 3EJMA 2UUBF 5DZ6A 3T1YJ 4GKKF 2AYGA 3I5BA 1SH3A 1CJVA 2YKNB 2FYXA 4K2JA 3J81Y 3RJMB 4UOHA 2MHEA 3VZIA 2ZZMA 5ETVA 4JI7J 4DV7F 1GQEA 3Q2SC 1S99A 1WHXA 1X4HA 2RRAA 1SJFA 1B7FA 1ZPVA 2XWXA 2CWKA 3OTDA 3HHLD 3FQLA 3DLHA 4QWBA 1RKJA 4LSLB 4OYXA 1FRKA 2FZKB 4KHPF 3VAMA 3TZWA 2GAHC 1N33F 3LALA 4K50A 2VG5B 4NOHA 1KC8T 3KK3A 1S0NA 3BQ0A 2GQCA 4PWDA 1KQGB 2QL5B 3KOAA 1PCAA 3MD3A 1NJYA 1FXLA 3Q0AA 2XBPA 4DV6F 3M8WA 4F50A 1VQKS 1WTFA 2V68A 2ZEJA 2QO3A 3G9CA 2B4PA 2PN6A 2XYHB 1KOHA 2C2OB 4PXBA 1DQ8A 1RWPB 1RADB 3D6MB 4PG6A 1UJ4A 3GV5B 1AA1B 2CPZA 1FRHA 2JWNA 3CIMA 4RBVA 3ZTPA 2Q66A 2DB1A 4DCPB 3D7SB 3PZPA 3P49B 2YNGB 1U48A 5F8GA 3MMBA 1S5ZA 2DGXA 3GCXP 1XIQA 2Y0SD 1I51B 2R7UA 4K4XA 3BREA 1SC3B 4UY85 1MU2B 3TA1A 1OYDA 1G6BA 1NBEB 1R0AB 3SZ2A 2MJUA 4QJVA 3BH7B 1U2RA 4V1Ak 4N76A 1B70B 3SBMA 5SUHA 4AXJA 2XGQA 3OFFA 1LWEA 4EU0A 3OVAA 2AW0A 4AL6A 3IM9A 3C16B 3VALA 3C14B 4X4RA 2C2ZB 2P9CA 5F9NA 3N01A 3PKYA 6FD1A 3W3SA 3UN5A 1LWCA 3MD1A 1KHWA 3R8YA 3GR1A 3LTOA 4O0NA 1N5VA 2HHSA 1RHRB 5A8RB 2ASDA 3M2UB 4PG5A 1GX5A 4LF2A 5ETQA 3IR6B 2HS0A 3VR1A 1UVKA 1WORA 2NPIA 4I1TA 5C24A 3CCRS 1U0HA 1NJIT 1SQFA 2KXNB 2LQ5A 3WDOA 1C1CA 1N4LA 5D78A 3VAHA 3EGWB 2I2YA 4ECSA 2ADCA 1D09B 2ATLA 1YX2A 2QA2A 5C42B 2JEIA 3J80U 3Q89A 1BC6A 3KJVB 2V2ZA 2UUAJ 1RT4B 3L4BC 4USTA 2JVRA 3CNQP 2R2UA 1QUVA 2JHEA 2PFFB 1Q82T 1HNIA 3K17A 1JB0C 2XSJB 3IS9B 1N36F 1HNVA 1RU1A 1RT7B 2X3DA 1RP5A 5A2QU 5IS2A 2E29A 4B3SF 2ASYA 3DOKB 2WW4A 4WP3A 4DBQA 3FCWA 2I5JA 2ZHAA 4FXWA 5K14B 2ALYB 2GCFA 1RWKB 4YDXA 1JLAB 1NK4A 2F1FA 3K7RA 4Y28C 1BQXA 4LFAJ 2IVFB 1FJ7A 1HHQA 4OZ2A 1EARA 2XY6A 4OI3A 4F0HA 3HXMA 2CPEA 5KFFA 4F8RA 4YY3F 2B6AA 5GADI 2VG6A 2GMLA 2J7WA 4X62F 1R0BG 1FWLA 3J7AN 5DDPC 1RYRA 2BE2A 3IGNA 1OQ3A 2C2DA 2EFOA 4UF4A 2M8HA 5A8KB 2UVVA 1YKWA 5EX0A 4YR0A 1T9VA 3MAAB 4NZ0A 5ETPA 2IDLA 4RW8B 1X9WA 3OHBA 3BBBA 4GC7A 2B8PA 2COLA 1GXTA 3CCUS 1YJ9S 1HNWJ 4IRCA 2DEIA 4O23A 2C3UA 3NWRA 1J5EJ 1VQPS 1XK8A 1N56A 5E7OB 3TQEA 2C3YA 2ZBIA 1C2PA 1JJCB 5LSRA 3FEZA 3BV8A 3LA0A 3KUHA 3NLCA 1SC1B 2VIHA 2NYHA 3D1OA 3NBPB 2YH0A 2HNZA 4OV1A 3RW6A 3QJJA 3I9V9 5AXKA 2WBRA 1JLGA 4CLPA 4RNFA 5B0CA 2BM0A 3Q8SB 4ECXA 3ILOA 4Q2MA 2DJWA 2K2PA 1WC1A 3K8VA 2H54B 1Q86T 4NMLA 3P96A 3MM7B 4AT1B 3GIKA 1R6VA 3AOAA 3T9NA 5HP1B 2J7UA 3RRHA 3QWUA 4JI5J 3QATA 4WF9Q 1WEXA 1TKDA 5IT0A 3PFEA 1BQNB 1NK7A 3QJPA 3DN9A 1TK8A 4ELUA 2RE1A 5AE2A 2RHQB 3N9UC 4TKTA 4WFNQ 1WG5A 1WWHA 1WC3A 4BWJA 2ZJQQ 4CNYA 1F2HA 5L1IA 1SL1A 2BJ7A 2Z30B 4C4WA 1IUJA 2HAFA 1WOSA 3BPSP 3RRKA 1QSSA 2DGSA 1F9HA 5HMXA 2LEPA 2G2YA 4G1PA 3D6FB 1N5QA 4RU2A 4ZDNA 4QIWD 2O67A 1RT6A 2J8SA 4ED5A 4DR7F 1UZHA 4KHRA 1UEUA 1VQYA 4WXWA 3VGSA 4IH5A 3RUBL 3UI3A 1TVRA 4TQSA 2KRBA 4K4SA 3MEGA 2DKOB 2FJDB 2UUCJ 4YUDA 5HVFA 5DDRC 3ENAA 1FFGB 1KBRA 2HMIB 4PUOA 4OJ1A 4NLSA 4A8QA 5HMZA 3GIJA 1X5OA 4DJBA 2ILYA 5T7LA 2ZVSA 4CO2A 4J9QA 3BGUA 1VQ6S 1TL3B 1VQLS 3KXDA 5KFYA 4P2XA 5J2NB 3AXMA 2WCXA 2KT5A 3CJKA 4CTAB 2FIUA 2UXCJ 1CS4B 3THTA 1F5BA 3C6UA 3GSIA 4RJVA 2KRRA 3MEDB 3I31A 5D0GA 2DEJA 2VFSA 5KFZA 3UCZP 3H20A 2L41A 4F0MA 3B6BA 4DQPA 4ZVSB 1O5JA 3D9BA 2H1YA 4KV8A 3CCJS 1JJ4A 2O5DA 3JSMA 2DNQA 3TI0A 1CJUB 1IVZA 4LVOP 1XQIA 2HWTA 1BWEA 1Q53A 1IM6A 3TVZA 4Z7YA 1SQEA 3F56A 1MMNA 2IHR1 5DQHA 2XCPA 3NCRA 2C42A 3TZXA 1RAEB 1XN9A 1XMQF 3H42A 3HSJA 4QW8A 4AUKA 3QRPA 4LFBF 4K5SA 2VHGA 3IC1A 1M1KT 3TEHB 1HBNB 4DQSA 4YB6A 4X4OA 4A47A 4C8YA 4TY8A 2HHHF 4EUVA 1B3TA 4R0JA 4QWDA 3DMJA 2EEYA 5JMNA 4PXDA 4RW4B 2D1CA 1T11A 1NNDA 4JI1J 3LGMA 1QTNB 1TV6B 2QLFB 3EVMA 1O0PA 4EMDA 2J0XA 3T1HJ 4DR6F 5D4NA 1BLUA 4Y0FA 3BGRA 5A0YB 4ID8A 4ID5B 1J27A 3Q86A 1GMWA 3QFHA 3GIIA 1FWPA 2WBMA 1K73T 1TL7A 2CJQA 5H9FK 2BQUA 3CDEA 1IKYB 1IBLF 2QL7B 2R7RA 5F8HA 1VYAA 3EXYA 4UUXA 3HKZD 2DGQA 2VA3A 1H98A 2R7XA 3TR5A 2IFXA 1VRTA 3UVJB 4CQ1A 3DOMB 2HVZA 5CAAA 3M2VA 4CH7A 2IYGA 5L1LA 1RHKB 4A8FA 1KR4A 2GFFA 2MQMA 5KFUA 3LP2A 1NJXA 3MEKA 4X64J 5ETTA 1TUWA 3R2CJ 4UW2A 4OZJA 2Y8YA 3I55S 1QAJA 4DS4A 1TUGB 1G2EA 5IC6B 4E0DA 4LFCJ 1D9DA 3U1LA 4DL4A 2AZ1A 1KKHA 5KFVA 3WX4A 2MKYA 1AFJA 1AT1B 3D2WA 1JLEA 2Q6BA 4DL2A 3A8EA 3KK1A 4QW9A 4PR6A 4WYLA 3AA8A 1Z2LA 4DSEA 1EIYB 2KT2A 2BEFA 2VBZA 1RWNB 2DXDA 4PKDB 1LK7A 3GFXA 1X9SA 2ZH4A 1JIHA 2J6UA 3P5TL 3V6HA 2WTFA 2VF3A 2D74B 3AFGA 2W7AA 3EZOA 2ZH1A 2UZAA 3FEXB 3R6GB 1JLCB 4LF6F 1IBKF 4K4WA 3THVA 3KLFA 3FSXA 2FJWA 3RW7A 1JKHB 1R8CA 2YY3A 2B4VA 2GJ2A 2L08A 3OT9A 1S49A 2EC2A 1Q0NA 3NG8A 4NASA 5L1JA 1M0SA 2PC6A 3HVRA 1SXLA 5D0HA 2OSQA 2I9SA 2BOPA 3MECB 3R5GA 2WSFC 3K5MA 2KVIA 2ZH9A 4DFPA 4M5JA 3C6TA 4MJKA 3W1YC 1X4EA 4CLUA 1Q7LB 1EETB 2HRUA 3BQ1A 3NNAA 2CNKB 1N32J 1B0TA 2F8HA 2HGLA 3SMZA 3M30B 1SJ3P 2CWXA 2A2DA 2NREA 2IAJA 3KUGA 1S1VB 1HD1A 4DR5J 3PRVA 2OEMA 1WDTA 3FFIA 4RNMA 4QYZJ 4DV5F 2HKEA 2X1BA 3GZ7A 2LXFA 4LJMA 1VBXA 1RYSA 2ZE2B 2V2VA 4QYZK 2XZDB 4W98A 2HBQB 5DG9A 1TL5A 2JC1A 2VG7B 3NGDA 2Q43A 2HQCA 2AYBA 5D3GA 1WHWA 2C3OA 1R89A 3QRRA 4CO1A 1VRQC 2E5IA 3J7YU 4RZRA 3IR5B 1WF2A 2PI4A 3LANA 1UMJA 2YX1A 2DNNA 3VGVA 1F9EB 1KSPA 3W9IA 3B4DA 1SUQB 3AJ1A 3DDKA 1SJQA 2CQ3A 3RU0A 3AD8C 2LQ8A 3MM9B 4C8KA 5F8NA 1NHVA 2CJKA 3MDFA 2X7IA 3MGJA 1DTTA 2JNJA 3IWLA 4J7CA 5J2MB 3W2WB 2B43A 1UEKA 4DR4J 4G3IA 2Y9HA 3LAMA 3E2EA 3PXGa 5HLFA 3J7YI 2YNHA 1RAOA 2PT0A 2WB4A 1R43A 2ZH5A 1UZDA 4R5PA 3NL0A 2F9JA 3IAM9 3HZGA 3LO3A 3R27A 4I7FA 1VHIA 1Y00A 1H73A 2KM8B 3KDOA 5CYMA 4CH0S 3HFZB 1SL0A 3K0JA 1Y5NB 1RTZA 1FTCA 4OHZA 4TQRA 2DT9A 2PA3A 3LWMA 1L3TA 4IQMA 3C19A 4PXEA 4M5DA 1U4BA 4L73A 4QR0A 4HHHA 3RAXA 5DM7Q 4EZ6A 4P71A 4UUWA 4DOZA 3H59A 3M8PB 1GAOA 4PQAA 2HBYB 4HLBA 3NGTA 4OQJA 5DLFA 1NKCA 2BYCA 1N8RT 4YQWA 1M90T 2GZOA 1I1GA 3D54A 3IP0A 4P75A 1S76D 2UXBJ 1IBMJ 2KHDA 1NDCA 1TZ0A 4RR5A 1HW8A 1RISA 5HN0A 3TQ1A 4WFXA 5M2UA 2MZJA 2WW8A 2WK4A 4X4PA 5I4MA 1N6QB 2FPHX 1S48A 2DNRA 1W25A 2DRAA 3UE2A 4KO0A 1IKVA 5KT4A 3HSZA 2UVWA 4KGMA 3FEYB 2BW7A 3M1VA 5HL7Q 4OX8A 3R7SB 2MZTA 1FD8A 5L38A 2HZCA 3BF4A 4MYTA 3KK3B 3IWNC 5AXMA 1RCXB 3TA0A 4IUFA 3H5XA 2H4YB 2DHHA 3RBXA 2QFJA 3CB4A 1NCLA 3KDNA 2DK2A 2K1RA 3IRXA 1I5OB 5KFTA 1VC6A 2OH2A 3JSBA 3FKBA 4KHMA 3FCHA 4NYOA 4CO4A 1R8AA 1XR7A 3PJWA 4DR1F 4KRWA 3M9OB 3T19A 1FK9A 4EFAC 3OXGA 3PW4A 2POKA 2VOOA 4NCAA 1F3VA 3HSGA 2DH9A 4DQRA 2MLXA 4YFUA 1LK5A 3PM9A 3PNIA 3ELHA 4ZVEA 3R6LB 2MLYA 1OWXA 3RGIA 1GT8A 2MY7A 2V5HG 4ES2A 1RT5B 4ZCIA 2DRBA 2RS8A 2HHQA 1OS5A 1REVB 3IBCB 2W1BA 2DISA 1ZETA 3DYAB 1K1SA 3CCZA 2MGZB 4Q8FA 3NKYA 3R9LA 3MUVP 3BGOP 2V8GA 1MG7A 4URQU 5KFNA 2ZZNA 2J6TA 2RAQA 3EYZA 4MIAA 2Y1LB 4JV2A 1S6PB 1OQ6A 3LPYA 1WC4A 3SDEA 5KFLA 3AODA 5THWA 3Q24A 2BKNA 2KI2A 1I94F 4LT6A 3UD3P 2W7OA 1UA0A 3S7RA 4RW9A 1URNA 3DM2B 1N5YA 3DNCA 3MR5A 4C3KA 1ZTWA 2ZH2A 3CPWR 1IWGA 1GK8A 4X66J 3CMAS 1FXRA 1H0HB 4C7QA 4LF7F 3MM5B 4AYBD 4O3SA 4NLQA 2YKOA 1UW9A 2B7CB 3MR3A 3TA2A 4UQGA 3K59A 1LEOA 3IR7B 1E6VA 1Z4UA 1HPZB 2MLZA 1FRLA 5IWAF 1V3ZA 5DETA 1SKUB 3SFGA 1UKUA 4OJ3A 1M5HA 2DO4A 2P9GA 5ETMA 2EG1A 4DUZJ 2E9RX 1FVSA 5DGBA 4ZLLA 4J9LA 3BN7A 1EP4A 4PYDA 5HQ8A 2BW2A 3QMQA 3WIUA 3PR4A 4GKJJ 3DI6A 4ZN1A 3A8IA 1HNVB 3QT5A 4ICLB 4PWUA 1SIWB 1O6XA 4MTPA 4D3HA 4ZJLA 2NYIA 2DTJA 1TQLA 1PBUA 2E1PA 3EGVA 1FKPA 1LQ9A 3GYNA 1NJWA 2GHPA 2I5JB 2XS2A 3MPVA 1UP1A 4JYAF 3O3LA 4C6AA 2IRUA 3P4UB 3SQGA 4WK3A 4W92B 1PILA 2ROGA 3WZ0A 4X65F 4CO3A 2K06A 2Y1JA 1RTIA 2FGOA 4ATNA 3LQVA 2AKWB 4KGXB 2LYVA 2FQQB 3QLHA 2XGPA 5H9EJ 2LP4A 4CLSA 4P73A 1BXNA 4QWEA 1WKJA 1NDKA 2AJ4A 3D5MA 2RRNA 5H9EK 1RTHA 2RT3A 3S01A 2XHCA 1UCNA 2AQ4A 2UUWA 2V8PA 4LF4F 2NPFA 3CWJA 4B9MA 3CMQA 3EDRB 2D41A 3CXCR 4DV2F 3CJ5A 4M5LA 3ET6B 1RK8A 3I32A 2MQOA 3MMCA 1TK5A 3TZZA 3D68A 4I2QB 1NM2A 1RA6A 3ZNUA 2MQNA 3OSPA 5FDLA 4DHVA 4WPAA 1GMWD 1RKIA 2LKZA 5AE1A 4C11B 1TKXA 3Q8PB 1CEZA 2E66A 2JDJA 2LXUA 1JLFB 1LW2A 5FLXY 4FVCA 3QGHA 2KKHA 4DL3A 2QGFB 2Z57B 5CXTA 4X4QA 2LA4A 4ECQA 2LLZA 1Q4RA 1JLGB 1FESA 2SXLA 4ZVPB 1YJNS 1AUDA 3NY0A 5B0BA 2GO9A 3KLGA 2HS3A 5B0FA 4LR9A 2VDIA 2F4FA 3R5CA 1FDNA 3BYPA 1T8EA 3DOLA 5E41A 2W24A 1Y9OA 4P2FA 2DH7A 1FX2A 1WG4A 1OIAA 5CQGA 2R8HA 1XTZA 4Y00A 2BANA 2WOMB 2WZ1A 5E2QA 3L7UA 2Z2YB 2ATCB 2DO0A 3AOBA 4F7VA 3R7BB 3AT1B 1QSYA 3VV2B 1K1QA 1KRPA 2HQIA 4DX7A 2M88A 3R7NB 5D4OA 1T02A 5AXLA 1E6YB 1HYSA 5I3UA 2UXDF 4ZIVA 3Q83A 3O1LA 4I2PA 1HBOA 5KG2A 3OW2R 4U7UD 1WI6A 2O1PA 3CGIA 2OPQA 3ETOA 4NEZA 1RT2A 5F3ZA 4NLYA 3CJ8A 1VC0A 4NLXA 2FC9A 2CJAA 1B0VA 3T5JA 5HSPA 2YKMB 1M5KC 2HFOA 2BMBA 4DSJA 1N48A 4C8ZA 3MFHA 2J9DA 4CO5A 2WVEA 2OLWA 3IWXA 5G4DA 4ZPDA 2XZTB 1RT6B 4AFFA 3JYTB 5BR8J 3KHRA 3VTIA 4Z2XA 1FE4A 2ZD1A 1TVRB 4DV1F 3MEGB 4J9MA 2C2MB 1PGZA 5G0RB 4IDKA 3GJSB 4OI4A 1D3WA 2QZ8A 4PUOB 3TANA 1ZA2B 1SH0A 1KD1T 1X4FA 1PAEX 1VBZA 2KYXA 2ASLA 1F5CA 4WIIA 2HGMA 1SBRA 4ITSA 5KOXA 4J9NA 1YZ7A 2Y0BB 1SCJB 5IXUA 5T7LB 4K4UA 3BGFA 2HHVA 3DC2A 2C28A 3AB4B 4AQYF 2VV5A 1REGX 1HMVB 2FHJA 3LP0A 2LXIA 4ECYA 4DLGA 4GVBB 3QJLA 3HKWA 1LNQA 4HHUA 2HEKA 2MXYA 1ACMB 2U1AA 4TNOA 3OFEA 1KOOA 2RRBA 2UV8G 1P1TA 1M5SA 3OFHA 1XR5A 3V81B 1FCAA 4ETZA 2XS5A 1FO1A 3M4XA 4I68A 4LF5J 1U09A 4DWIA 3MTJA 2OJ3A 2RHSB 3DCAA 4IOBA 3HHDA 2RQKA 4F26A 4DU7A 1SVDA 5B0DA 1KVIA 2W2QP 4KGKA 1LKZA 3OJUA 4HL9A 3UN3A 4LRBA 4X4NA 2HWHA 3WC2A 3V6KA 2XSFA 3IG1A 2FVSA 3H90A 1Z1ZA 4HEA9 3NAIA 5CYQA 4ECZA 3P45B 2KG1A 4DFJA 3DLKB 3PFOA 2V2KA 3TYTA 3IMQJ 3DMJB 2E9ZA 2OAUA 3PY8A 2XB2D 2HVDA 2IA6A 4OZ3A 4UOGA 1Y3JA 3IAS9 2YWEA 5MLCV 1JMTA 2MZ1A 3J7A1 1B99A 4HDHA 1PKUA 1KQSR 2VASA 3KLEB 1JXEA 4JI4J 3A4TA 2RNEA 4OX6A 4QPXA 3CCSS 1P9YA 1TL7B 2ZDPA 2BR0A 3PYGA 3MM8A 1U25A 2BV3A 2GHVC 4I56A 1YI2S 2B9EA 3SCJE 4K2XA 4JOUA 2OP5A 1X31C 3PX0A 4ELTA 1RTJA 2AEJA 3M2VB 3F73A 2DR8A 3QGGA 1MW7A 2QMUB 1HBMA 3UD4P 1YQHA 2JJ4D 5KT2A 1R7IA 3I0RA 3E01A 3TNVA 2XS7A 4CLFA 2MKSA 3AD7C 4N8NA 1WG1A 2CQ1A 4ILMA 4MK7A 2WB1D 2H9ZA 4RBUA 1JLEB 1S1WB 3ISNC 3CMES 4RW6A 3PKMA 2CUYA 5B7WA 4HTJA 4C0HA 5AJ3F 4FKXA 4YEAA 3DDIA 3MCSA 5I3PA 2FLPA 4NCBA 1SJ1A 2AV5A 2AWZA 2QSWA 3T1YF 1TELA 2YNIB 2HAIA 2DHSA 4KPYA 1IR2A 3PVXA 2AJQA 2MEWA 2NZ4A 4OL8A 2HURA 5DLGA 1IKXB 2AZ3A 2F63A 1G4CA 4PPZA 4PG4A 1ZS6A 4M5MA 4R0EA 4Q5VA 4JI7F 3ETMA 4G65A 1HWUA 4LQ9A 2IBOA 4IO9Q 3IBFB 3DLLQ 2HLUA 2AMCB 3ONQA 1QLNA 3CCTA 4JV5J 1LWFA 2CAJA 3KK2B 3BR9A 4ZPWR 1URRA 4I0WA 4QIFA 4I64A 5F41A 3H2VE 1KLNA 4DV4J 3HSDA 2WVFA 1UVMA 2H65B 3G82B 1U1MA 5LT5A 3MR7A 2YWGA 3C6TB 3GQCA 4DCJB 2R9LA 4PWWA 1IN0A 2A1BA 3AQOA 5E3QA 5C7PA 4QYRA 4K4TA 4ZVOB 5LJ5Y 4LSNA 5A6PA 1NPKA 3HHKA 1EX8A 2YNFA 8AT1B 3A3NB 2IY5B 4E2FB 3NCQA 3FFIB 3HP6A 3WC0A 2XC9A 4P7TA 1UJ6A 2DNHA 3H25A 1U45A 1OY8A 2QN6B 4WIQA 4NXNJ 1U2CA 5F9LA 2C2RA 5E33A 4UZCA 3POTB 3MR2A 2NSBA 1X4GA 2GIQA 2DGTA 4Y2AA 1CJTA 1PC5A 3TARA 3MTKA 1U1RA 3RR7A 4F4WA 1T05B 3CDUA 4ELVA 1WSVA 3CC2S 4RUHA 1VQ4S 3G2XA 2VPXB 4WP8A 4UY8T 1XEZA 3ZZYA 1KHVA 5CYJA 1YVFA 4C48A 2ZUGA 3X1LB 3KYLA 3BEGB 4DF4A 1TKZB 2CJBA 4EO8A 3MOZA 3GFHA 5IFMA 1GX6A 3HMJG 2IVMA 4ZCLA 1FJEB 4UZBA 2Q1LA 5E3PA 3C15A 3HVAA 4HI1A 3P6YC 2W9BB 1I6JA 1U26A 2YNHB 3AOCA 3PIPQ 2GGPB 3KKFA 2WHOA 3I6PA 3UR0A 1MN7A 1MWQA 2I6WA 2MZRA 5L8RC 2PEHA 2HHTA 3GYXB 1K8AT 5B08A 2CADA 3T1AA 3V4MA 6AT1B 3BPDA 3N6NA 4K59A 4ZVRB 3HFVA 4HDGA 2N3LA 3H4DA 4H4OB 1YITS 3C66A 3KJQB 2UUAF 4JI2J 4Z37A 1U1NA 1JLBA 3CJQA 2CG8A 3CCWA 4NLOA 2M0GB 2Y8WA 2LEAA 3TX0A 1MWYA 4Q43A 5GMDA 2QT7A 3GJRB 4KKOA 1WKKA 1EAYC 1Y3KA 2HVHA 4M95A 3FRZA 1SIZA 4DFMA 3EXCX 2AP6A 3OXLA 2ZOGA 2DRDA 4CM2A 4BWMA 3DRPB 2WONB 1RWWB 2BACA 3DFEA 1NPPA 2XMJA 3VQTA 1S6QA 2YVSA 2HRTA 2MJNA 3PHEA 2ZFHA 1F6TA 4IR9A 2QLXA 3KNAA 4DLEA 1YJUA 1HWLA 5AXNA 3GLJA 2LVWA 4OHXA 4LFAF 1T9TA 4DEZA 2AGPA 3PO5A 1RU2A 4WWSA 4LMZA 1DTQB 1KFSA 3CCES 4MT1A 4HACB 3HULA 3HJVA 3C8YA 2B3TB 1IKVB 5GAGU 4HVZA 4X2BA 3QFWA 1XNQJ 3M1VB 1XMOJ 1MROA 2UU9J 5FLXU 3V2UC 5HROB 2QLBB 4BC9A 2MHNA 3OVSA 3B4MA 2WVCA 2WRMA 4M63A 2F4VJ 4L6V3 2VU5A 2HSEB 1QY7A 2DBBA 3G86A 3MEEA 1Y5IB 3D6HB 1SKRA 2VFTA 3SQOP 3SFUA 1S0MA 3PACA 4LRFA 4BCAA 2XG8A 1RAHB 1JLQB 1S10A 1HQEB 4RWXA 1HNWF 1F60B 5J2QA 3SCIE 1FK9B 1IQTA 4B3TJ 4TU9A 2DCUB 5L39A 3W9HA 1J5EF 1VS3A 3FRYA 5GAGI 3A3PB 4C2MA 3LWLA 1N0VC 3R1LA 5IM0A 3QO9A 2AX0A 3OR2B 1DY3A 2NXJA 3BS9A 3TUIC 1G7CB 2BJ1A 1RUSA 3OL6A 2ZBCA 1I3OB 1VLYA 1VQ7S 1TKTB 2FZCB 3NRBA 4ZLPA 4J91A 4KY3A 4RO0A 1DZ5A 4OI2A 2MZQA 1Y4ZB 2VH7A 2ACMA 2XYGB 3M32A 1WOPA 3I87A 2G0IA 3ZZRA 2MKJA 4JI5F 2MSTA 1D9FA 3QGIA 4ZHRB 1U1QA 3MI7X 1HL6A 2AGOA 3SDEB 5LJ3Y 3QAUA 1AW0A 1N34J 2MYFA 4DUTA 7FD1A 4DZ6A 2KZZA 5GVQA 3UNYA 3B8HA 2W9CA 2J0SD 5I3QA 4ZKAA 4RW9B 2BRLA 2DGWA 3QAEA 3DLGB 3G87A 2RF2B 2DXFA 3ZZ0A 4OZLA 1DLOA 2MKHA 2JX2A 2R2TA 4FBUA 5MAOA 2IMWP 4NL5A 1Q8IA 3V6DA 4F0KA 4LVNP 2J7KA 5BYSA 4K7QA 4OYBA 5JXSA 4J9RA 2G4BA 4JV0A 2VDHA 4UOCA 4AL7A 1NK5A 1R27B 1VQ5S 4C9DA 4IFYA 2RD5C 1CG2A 1HBUA 2M7SA 1VQ9S 5ETRA 2CNOB 4QR1A 1YJRA 4RW7A 3OUYA 3I4HX 2ZZTA 3W5XA 4XAKA 2UUCF 2RKIA 3AJDA 4PABA 3I56S 2VPWB 5F8IA 5D6GA 4OLOA 2ZITA 2FHJD 3FQKA 2AIRB 1U6ZA 1S1UA 1DJ0A 3KLIA 5L9XA 1EP4B 1ZAVA 2K8GA 1H72C 3DI6B 4EBCA 5J1PA 2W9AA 3MM6A 1UJ5A 3OTBA 2EC0A 9RUBA 2QLJB 3W8PA 2W2NP 4JBCA 1C1BA 5B0AA 2XNQA 3CO0P 3NOCA 3CVKA 4DG1A 4MFBB 3K8WA 2ADBA 4FDFA 2QA4G 2KM8C 2MQLA 2G2OA 2XY5A 2FLOA 2OPSB 1VRUB 1N88A 4FYWB 1WC0A 1F2GA 5JJBA 4ZLJA 2VD3A 1S9EB 1QAYA 3VZHA 4B02A 1YGYA 1Q16B 2ACYA 1GXUA 3EMTA 1RTHB 2ZNZA 4RUBA 3CEDA 3MMAB 1J5OA 2CQGA 3A8JA 3MHYA 1WOOA 4LSLA 1UWBA 3HCXA 3VVUA 1PC4A 3VGTA 2VG5A 4EBEA 1NEEA 4Q45A 3CJ4A 3M8QB 3BJYA 2P8IA 1VQ8S 4F3OA 2EKNA 5KFXA 1M5OC 4TU7A 4XDCA 3A13A 5LSLA 1LW2B 3LPEA 2MDAA 3WHIA 2LU1A 4JI1F 1FJCA 2DXEA 2VA2A 3ZTRA 2R2RA 3RRGA 3T1HF 5HAOA 5AE3A 4CLZA 4QQBA 2EK6A 2V67A 2YNGA 4NCGB 2UVUA 2HFZA 3D0IE 4OX7A 5KFHA 2LFVA 1GMVA 2EI5A 1QVGR 3QYYA 3KLGB 2QLWA 3OBIA 2DITA 2XMAA 4FF2A 3R5JB 1MU2A 3H4BA 3SV4A 1KS2A 2Z2ZA 4C8OA 1Q8KA 2XLJA 5KFWA 3H5YA 2BANB 3OFGA 4G1QB 2D3OR 1R3NA 3V4IB 1JJHA 4X64F 5D4PA 5DRKA 4MMOA 1WKLA 2D3ZA 4DPYA 2JSXA 1VJWA 3BBCA 1TMJA 3DRSB 2V63A 2J76E 3CD6S 5ITHA 3OHAA 5IV4A 3C16A 2HHPA 4DR3J 3SV3A 2KN4A 3C14A 3FBEA 5BYRA 1TL1A 1ZM4A 3EGNA 2CZVC 1SC6A 4DUYJ 4I2PB 4F02A 1Q95G 5E3AA 1RT2B 1S7HA 3R2DJ 1P27B 4ZN3A 1B64A 5A8RA 5EDWA 3M2UA 1BQMB 1H2TZ 4B9NA 2R8KA 1LXNA 2GX8A 1ZBTA 5SZTA 4PQUB 3PJ9A 5CD4A 4J90A 2KHCA 4ES3A 2E5LJ 4L72B 4DN9A 4H4MB 1U1KA 4LF9J 2BA9A 1OY9A 3KJVA 1Y11A 1FFSB 1YBTA 1CQMA 1RT4A 1U49A 2BOAA 3DHXA 2O66A 1A6LA 4LRDA 1DQ9A 3ILIA 1NO8A 3FZBA 3O44A 3ZNJ1 2QG9B 1S1XB 3W5ZA 1RTDB 2V69A 1DFDA 2R4FA 1NAQA 3HM9A 1U7LA 2XSJA 3IS9A 2VBYA 2FUG9 1RT7A 2H48B 4NA2A 4EYIB 4F36A 5FIIA 3DRXA 1RAAB 3BYRA 1CJKB 3I96A 5D0EA 4X4TA 4XK8C 5KTQA 4Q0BA 3DOKA 4PXCA 4JI0J 2AYMA 2JLEA 3M6VA 1N32F 5GMKa 3CDWA 5K14A 1B0PA 1JLAA 3M8SA 3IA0A 4TN2A 2DCLA 3KG0A 1FKOB 2H51B 2QE5A 2VQFJ 4DR5F 4QR2A 4FPIA 2E1AA 1QSLA 4LBPA 2DH8A 2DPJA 2V8HA 1FA0A 4DN0A 1MMLA 1OYEA 3CULA 3SCLE 3MCOA 4F4ZA 1XNRJ 5A8KA 2KJVA 1WC5A 1D8YA 2JEJA 3QIDA 3MAAA 2V6AA 4DV0F 1QVFR 1BMQB 4ECUA 1UVIA 2R7TA 4R25A 3MUMP 1WF0A 2YKQA 1W2BR 1IBCB 2BJDA 4DR1J 3CCMS 4YB7A 5B0GA 2OGUA 3W63A 4CH1A 1CPZA 3Q8UA 4FS2A 2CZ9A 4USKA 4V19J 4MAKA 3H5SA 2GNKA 3GG0A 1YRUA 3RZAA 4NI2B 4ZCMA 1NKEA 4XPCA 4Z7CA 4DR4F 2E1RA 1XR6A 4YOEA 2R7VA 5L9NA 3OPKA 4XDDA 4PYAA 5D77A 3Q8VA 3MM7A 3HHLB 4DFKA 2BX6A 4OYPA 5JUMA 2R8GA 2QA4S 1HWIA 3U7JA 1DBDA 4IRKA 2GVDB 4EYHB 1XBWA 2IJRA 5KFQA 5HP1A 1APSA 1QAXA 2F9DA 1VMBA 4C8NA 2M70A 2J0QD 1U6FA 1F1BB 3G4SS 2DNOA 2BXJA 3W2VB 6FDRA 1BQNA 5GAHU 5B09A 1Y10A 7AT1B 3M7VA 3MOJB 1C0UB 4PG8A 3H2UB 4DSLA 5HO4A 4A48A 1A7GE 1VK3A 2RU3A 2BDPA 4KFBB 4O44B 2DYAA 4MK9A 3CCQS 4USUA 1S9GB 2XWYA 3GJQB 3FMWA 4DU8A 3A3OB 2MKKA 4A4JA 2W01A 2DNMA 3WIVA 4F4XA 3PYEA 1D9AA 4Y65A 1UWAA 2NUUG 1WUUA 3ICLA 2UXBF 1IBMF 2PMZD 4NYZA 2IRYA 4CLLA 2ZC4A 1NB2A 4C8MA 4ED8A 5GAHI 2DNPA 1LOUA 2VFVA 3NMRA 4XTTA 2E5HA 1VISA 2B5JB 3BH6B 4QWAA 1YG0A 3VAIA 4TY9A 1AZSB 2IC3B 1KLMB 1RHUB 2ZBRA 4Q2LA 4CYUB 3K5NA 1JJ2R 2ALZA 2DD8S 5A8WB 4RU9A 3UPFA 2DPIA 2XULA 2DNGA 2E44A 3L7OA 2XM3A 2ZM6J 3HT3A 2XLIA 1AYEA 1X4DA 5C25A 3Q8QB 1TL3A 5J2NA 4KGVB 4AD6A 3DGVA 5DDOC 4CI0B 3CCLS 2HQGA 3ADAC 1YDLA 3MEDA 3Q8RB 4EEYA 2VKRA 1VQSA 1Y5LB 3KLHA 1AXQA 2A2CA 3HHNB 4ZVGA 2E7VA 4J37A 2F8MA 3DRRB 4FVMA 2V4JB 4TYAA 4CP5A 4QCLA 1VLOA 1CJUA 3UDEA 4L74A 4NLPA 4RLEA 4K0KJ 3CC7S 3OLAA 4A8OA 4LF4J 4C98A 3IN5A 3AY0A 5DQIA 4ZPVR 3K58A 5LXRA 4R8UA 2HG4A 4F04B 5F8JA 1Q7YT 5A76A 1X9MA 3S8SA 3MMJA 2HS4A 1CJTB 4WXOA 1NSQA 2B9WA 1VQNS 4ZVQB 2XHWA 2CPYA 2HNDB 4U8VA 1YHQS 2F7VA 2C2NA 1HBNA 4WE1B 4FZVA 4FYVB 2EVZA 3ZFVA 1ZPWX 2RU9A 4ZVUB 2HK3A 2XY7A 3RAQA 2FGCA 3OV7A 2HFVA 1IJFB 4RW4A 1OPZA 2FD2A 3K2YA 4DPOA 1TV6A 4W4MA 2YXLA 4MKVA 1H7XA 5A0YA 4B9LA 4ID5A 2FVCA 3D28A 2DGOA 3AD9C 2QX0A 4HT7A 1M5VC 1WTBA 2XI3A 2CVEA 1X4BA 4IO1A 3C15B 3M2RB 1SKSA 1SV5B 3KNGA 2OELA 2BM1A 4NLRA 1IKYA 3G71S 1NDLA 1YRXA 1PSDA 2RB7A 1KVKA 2ZVIA 4PRFA 4EZ9A 4PPDA 4X66F 3ZZOA 3FC9A 3UVJA 3UDLA 3DOMA 4J9KA 2DR9A 1U8SA 3PRDA 1HR0J 4LSZB 3PV8A 1OY6A 5EN1A 4K8RA 4NYPA 1GMUA 1ZM9A 2KG0A 5HBMB 3G8TA 2GVZB 1BUXA 4FBTA 4F2SA 2VONA 2LQ9A 1NMEB 2D9OA 4LF8J 3D0GE 2K7JA 4KKOB 4Q7AA 1VGYA 2CG4A 2P5VA 3OTOJ 4GKJF 3CJTA 5H9FJ 2EW9A 2JLFA 3NXZA 3L9ZA 3ENWA 2ROPA 4Y2CA 3BDPA 2H5EA 4ZLNA 2KFZA 4EI2A 1ZH5A 2OMOA 3ZZPA 5HQMA 3M6WA 2H3EB 4B3MJ 3DDNA 2ZBQA 4KJIA 2LU2A 3HPOA 3OLBA 4NLWA 3OD2A 5H1SV 2NR0A 3VVTA 5KG3A 3ITHB 3H5UA 1R8PA 3G8QA 3NEKA 3VAJA 4MIWA 4Y6IA 1JLCA 4FF3A 4YDDB 1L3KA 1O51A 5HMWA 4OIXA 3QNWB 3R5DA 5RUBA 5A6WA 1JKHA 4CO0A 4S0MA 3JXOA 3BB5A 2OTLS 4M5IA 1RHMB 4CRJA 3MWBA 2MPUA 2DNYA 1RDRA 3LW5C 3OVBA 1RLCL 4WFYA 1S4FA 4IYQA 1X5PA 5IOLA 1S6OA 3VF0B 4LREA 2DHXA 4RL1A 1HQUA 1YIJS 2DIUA 2VUGA 4C8LA 5I42B 1TFYA 2HFUA 1GXLA 1RHJB 2OPPB 3M30A 3MPYA 4WFZA 4MIBA 1KQKA 3PEHA 4RNHA 1U8WA 1S1VA 3D66A 3T5HA 1BD6A 3QGPA 1RBOB 5C2CA 4IG0B 4ZP9A 2ROEA 1VDHA 1FJGJ 1X4AA 4NZ7A 2RQ4A 2ZE2A 2KT3A 3TJ9A 1JNZB 2NZCA 1S57A 1IR0A 5KFCA 2RSQA 4DR2J 2OTJS 1S9FA 1FHTA 5GAEU 2MZSA 2VG7A 5DDQC 3EX7B 3M32B 2ZDOA 2QIFA 2AGQA 2HNYB 4B3OA 3QIPB 2EFNA 5CCMA 1SUQA 1ZA1B 5B0EA 3MM9A 2OSRA 2OUGA 4Y2IA 4B3RJ 4QIEA 4XO0A 4NLGA 2CPXA 3FJ2A 1R8HA 2N4DA 1FRJA 1FEHA 5FD1A 3W2WA 5KFPA 3DKDA 1J2VA 5GAEI 3M8RA 5HK4A 3MUTP 3DRYA 5EGYA 1YBAA 2WVBA 5HVHA 2MKIA 5EWGA 3LOUA 4LR7A 3OSNA 4U7UK 3V6DB 4ZITA 2K7KA 2RUSA 3DLEB 1U1PA 3DLBA 4HKQA 3PW7A 3B54A 2AD9A 4O4GB 2D69A 5BR8F 4N77A 2FJEB 1C0TA 2YX4A 4QOTA 2VJVA 4WCEQ 4NEYA 3EWGA 1NSPA 2VC1A 2PEBA 4FYDA 3ZZTA 3I0SB 2MY8A 1FNXH 4DDFA 4MYUA 4QBUA 3J81j 5IT9U 2AJ0A 3MR6A 3N0VA 1FTRA 4ETXA 2Y3YA 4YHHJ 4I4BA 4P52A 3EICA 4DL6A 3H2LA 2PD1A 1H38A 1FF2A 2RDJA 3RG6A 3L95X 2VBWA 1LV5A 3I5CA 3WQPA 2RDDA 2IM1A 2CPDA 2RDIA 5D8HB 4KB7A 4DPTA 4J5OA 1FKAF 3K5PA 1Q1KA 4DG1B 2B0GA 5J1EB 1C4CA 4ZMMA 5L1KA 4UT4A 3TX8A 1GEHA 4DX6A 2GQ2A 3CJ3A 1FRXA 4J9OA 4WFBQ 4Y3CA 2YPYA 1RGVA 4FP9A 1X7VA 4YMEA 2M5YA 4LF5F 5KG7A 4MKBA 2R7OA 5J2PA 3SSSA 5T41A 1N6QA 4ALZA 1J5OB 1UWBB 5E3RA 2ZC3A 4YB5A 2OMLA 2G0JA 4O3QA 3C2PA 4QU6A 2OPRB 1IKWA 1WELA 5HI7A 4ZCKA 5DG7A 3FMBA 1HIYA 3M8ZA 4DSIA 4UTGA 2A6MA 3KG1A 3B78A 4TYBA 3J7Z5 4DS5A 1CJVB 5HATA 2IJFA 3M6XA 2O3DA 1T9XA 5EHHA 2OD6A 4YR2A 2FHKA 3UN2A 4ZP8A 1KEKA 3H8YA 3CO9A 2ZNYA 5CZXA 1K9MT 3N5FA 3W5YA 1RCOB 1JNRB 3TRGA 2CQ2A 1RAJA 3FGVA 4KH1B 4KTQA 3FBCA 1K47A 2PMHA 1N0UA 4YN3B 4NMXA 4K4ZA 3ISND 1F9FA 2RQCA 4C97A 4JI4F 1N5TA 1DQAA 3U02A 1WNEA 1JK9B 4PG7A 2PA8D 1OO0B 4JI3J 1BWVA 3DLJA 3E51A 4H54A 5CH7B 1Q8LA 3DHWC 3OTCA 1SKWA 3FSYA 1RT5A 4LBHA 2WSCC 4M1KA 2P6TA 4M5GA 4O3RA 1YBUA 3GIRA 4ZVHA 4PWDB 1REVA 2C3PA 1S12A 3DYAA 4OI0A 2NQPA 2MGZA 2P2CB 2YQ0A 1G1XA 2FC8A 2A6OA 1KP6A 4DQIA 3EVWA 4RWWA 4ZOSA 1T9YA 4KH0B 2XMWA 3R97A 3PDNA 1VIOA 3NP5A 1HWKA 1S6PA 4OI1A 2DR6A 3PIOQ 3F44A 1TL1B 2AX1A 5D15A 2LEBA 3CC4S 2I1RA 3JTPA 3CD5A 2HVEA 4ZPCA 3MMBB 2EPIA 1U2FA 3OTEA 3UW1A 5ETKA 2VQEJ 3HF5A 1WD6A 3DM2A 3QZ7A 3T6JA 5EX3A 4DSFA 2QYCA 3SCKE 3BKTA 3QQCD 3E3XA 4F25A 3MM5A 2CPFA 4ER8A 2KXFA 5JVGQ 2QJ3A 4O0IA 4USJC 1S79A 2YWWA 2DGUA 1LWEB 1JX4A 1HPZA 4KC5A 4JI6J 4OHVA 2LECA 1U6BA 3G8SA 4IFVA 2V8DA 3S1TA 1EHWA 3UCGA 4JV5F 1NH7A 2BKPA 1VHFA 2LDYA 1LWCB 4DPXA 4HT5A 4WZMA 4DV4F 3SI8A 5GADU 2NCKL 1FRMA 3AXKA 4A8YA 2KB2A 3T3FA 4ICLA 3BO4A 3W7BA 4EGLA 4AXIA 4URSA 4ED2A 4P9SA 5C24B 4N5SA 1U0HB 3UWTA 3W9JA 4Q0BB 1OSCA 2I0XA 1W7WA 1T9WA 2F8EX 2Z56B 4IQXA 2R7WA 1Q81T 1C1CB 2HBRB 2QFIA 3GIMA 3LH2S 7FDRA 4CZCA 3U1MA 2F65A 4ED7A 1VBYA 4C0BA 2FTRA 4HTIA 2IVYA 3EZ5A 2GIRA 3VAGA 3FNNA 4ENOA 3UNGC 2EFGA 4FNIA 1UTAA 2X51A 2J6SA 4OZ5A 2ABYA 2R2SA 2FLLA 4DX8H 1X5SA 1UVNA 1CBKA 3GV8B 4FYYB 4I6YA 2ILZA 4NXNF 2FHMA 5EWEA 4JV1A 1HNIB 4DL0C 5LOQA 2HQDA 1PIEA 1ZYQA 2UVRA 4EK2A 3ET6A 2RS2A 2B4OA 1H74A 4GMKA 2CPJA 2LDIA 4I2QA 4WBFA 5DJBA 3MCMA 5AT1B 2HYIB 2EBEA 3N6MA 2H5JB 3G96A 5C2GA 1T03A 3RB0A 2CYYA 3CT9A 4C11A 5J1NA 4ES1A 1FWKA 4QIGA 1JLFA 4DX5A 3NGSA 2PSZA 1QAIA 3AQPA 3BBFA 4QZVB 5LMUJ 4OYAA 2VPYB 3JQMA 4IRDA 2EWHA 2CPHA 3L7PA 2B6AB 3VHQA 2VG6B 1T9UA 2ZWPA 4CLKA 2FJVA 2W8KA 4HYKA 3NS7B 3D3BJ 4DCOB 2JVOA 1LFWA 2HBZB 2BE2B 3M05A 1RWXB 2B8QA 4D3GA 3PYFA 2CQBA 1UVJA 1R6YA 1U47A 1P6TA 2PFDA 5CZVA 4NLVA 1ZM2A 1YJTA 2CVIA 4JI8J 2WOMA 4FNHA 5LMNJ 2BE9B 2J9CA 2HHUA 3IFEA 2H5IB 1Q5VA 3UDVA 3F41A 1Q79A 4JI2F 1UW4A 3NNHA 2FJXA 1E6YA 1X4CA 4ED6A 5F0UA 1EKRA 1FDBA 4FS1A 5K20B 2HNZB 1QE1A 2C22A 4CLWA 1NXIA 5KFKA 2R7SA 3W64A 3CD0A 3JS9A 1HNZJ 5BYQA 2YKMA 3IGVA 2RVJA 5E5NA 1FXDA 1NH8A 3NGUA 4K4YA 4ZP7A 1NHUA 3KHHA 4OJGA 2Z4PA 3W66A 3JYTA 4JP8A 4N47A 4LIRA 2BQ3A 2BUNA 4NXMJ 1K44A 4ECTA 5HANA 4JUZA 1RLDA 2J9DE 3UR3C 1LW0A 4RNOA 4WK1A 2AEMA 1UA1A 5G0RA 3MAQA 1Z2ZA 3QT7A 2YWHA 3DU5A 1XNQF 3HD2A 3EVOA 1XMOF 3TOQA 4OJHA 1NKBA 2UU9F 1RAIB 2K3KA 3DGPA 2YPZA 1VOMA 3O2IA 4RKUC 3UQSA 3ISZA 3KHGA 2F4VF 2NXCA 4DV3J 1VCTA 5C25B 1HNXJ 3C46A 3JQKA 1HMVA 2BVZA 3EGZA 1D1UA 4P2SA 1VR6A 4GVBA 4WKYA 5HJXA 3CTRA 3KLHB 3TAMA 3LP1A 4B3TF 3V81A 2BE7D 4P7VA 1QDUB 2DNLA 1XC9A 4QWCA 2RIJA 2Z2LA 3PTWA 3UCUP 4OX9F 3JQJA 1YK9A 4ECRA 3AAWB 5CCLA 1C4AA 2HQFA 2V9KA 1VQMS 1TFWA 1S4EA 4R8UB 1H3DA 2NSCA 2PGCA 1P8GA 1S59A 3ZTQA 2XI2A 3CW2C 4LRAA 1YLXA 2G13A 3EE3A 3GV7B 3ILJA 3QBCA 2UUBJ 3DLKA 4ZIWA 4TU8A 2FY1A 4GKKJ 3CJKB 3FZ2A 2AF6A 1HI8A 4CLTA 4ZPBA 3C6UB 3NS5A 1UFLA 1FDDA 1TU0B 1PBAA 4NZ6A 1HHTP 3BSCA 3T5LA 5LSOA 1N34F 1W26A 3NS6A 2ZH3A 4DV7J 5F3TA 4WU2A 2M3DA 4KV8B 1L3VA 4U95A 4O4RA 4L76A 3JSMB 1WF1A 3GILA 3GU0A 3KLEA 1CVJA 2NS1B 3GJTB 5DG8A 1D8ZA 4U9RA 4ED0A 4OYZA 2J5AA 3A8KA 4KHPJ 4CNZA 1R8BA 1WEYA 4P6QA 4FXDA 1N33J 3GTYX 4LRCA 3M9NB 3SSQA 3PX4A 4NRUA 5KG4A 9ATCB 2QRRA 1NK8A 1RJJA 1MN9A 4DV6J 1RT1A 2E5JA 4TY8B 5CD4H 4FF4A 2V9WA 4DI6A 2D3UA 4KR0B 3J81U 5DQGA 5U47A 4A8XA 2NLWA 1AROP 3BGRB 1YTYA 4HH1A 2U2FA 1IM4A 1HLWA 1FVQA 1S1WA 1HI1A 4FN5A 2EKYA 3CIZA 3HHLC 3TZYA 4WTYA 3D6TB 3X3UA 2JC0A 4YR3A 5KFAA 2YNIA 1OPIA 5KFJA 1VRTB 5KG5A 3RR8A 3NAHA 3W8GA 1NZAA 1IKXA 4N8OA 2E1MC 5HVGA 3LP2B 3A1YG 3BKUA 5T14A 2B56A 3RBZA 1M5PC 4FYXB 2CDQA 5ETSA 4RNNA 3BKFA 2YKPA 3AB2B 2GHWA 3GONA 3TUPA 1AB8A 3KK2A 3EPIA 2OFHX 1VJQA 3BN4A 2KJWA 1PYSB 4K4VA 3RAMA 4E8UA 2OIHA 3H7HB 4ANDA 2VZ9A 3G82A 3HVTA 3HDSA
chains in the Genus database with same CATH topology
2FVQA 1F0XA 2IM2A 1DARA 3THPA 4ICLB 4PWUA 1SIWB 2KXHA 3KK1B 1OSDA 1FT8A 5D77A 1HQUB 4MTPA 4D3HA 3MM7A 2NYIA 3HHLB 4DFKA 4NPOA 2DTJA 5JUMA 2R8GA 2C2EA 5DS7A 1QUPA 1TQLA 2QA4S 4H4KC 4B9SA 3DLEA 2LA6A 1HWIA 3CSKA 3U7JA 1FKPA 1LQ9A 3KFWX 3GYNA 1NJWA 2GHPA 1DBDA 2I5JB 4IRKA 4EYHB 2XS2A 1XBWA 2KDOA 3MPVA 4O4GA 1UP1A 1ZTTA 5KFQA 4IR1A 4JYAF 1TAQA 4A8MP 5HP1A 4NXMF 2YWKA 1APSA 4F3QA 3O3LA 2IRUA 3SQGA 4WK3A 1QAXA 2F9DA 4W92B 1PILA 3UFCX 1VMBA 2ROGA 4C8NA 2M70A 3WZ0A 3I0SA 2J0QD 4X65F 4CO3A 4ECVA 2XZWA 1U6FA 3IO1A 3G4SS 2Y1JA 3B82A 1RTIA 2DNOA 2BXJA 2FGOA 4ATNA 4KBIA 4ILLA 3LQVA 3W2VB 5KT7A 2LYVA 2EFVA 6FDRA 1BQNA 3P3DA 5GAHU 5B09A 3QLHA 2L9WA 3BSAA 2XGPA 3KLFB 5H9EJ 4WZQA 4EO6A 3MOJB 1C0UB 2BJEA 2AJFE 4G1IA 4PG8A 4QWEA 1CLFA 2E5GA 3H2UB 1VI7A 1D0EA 4BHQA 4DSLA 1KVJA 5HO4A 2AJ4A 2Z8QA 1VC5A 4A48A 3D5MA 4A8SA 3RB6A 2W9CB 1A7GE 1U24A 2N3OA 2RRNA 3VQSA 1VK3A 1RTHA 2RT3A 3S01A 3GE9A 4F2RA 5J2MA 2L9NA 2RMLA 2RU3A 1K0VA 3FSIA 2BDPA 2AQ4A 4KFBB 2UUWA 4O44B 4LF4F 3QWPA 4MK9A 2NPFA 3CCQS 4DV3F 3CWJA 3G6YA 1HNXF 1S9GB 4B9MA 2XWYA 4MKAA 3FMWA 5KFBA 4WU3A 1H6KX 2D41A 3POTA 3N28A 2MKKA 2O01C 4A4JA 5KAKA 3CXCR 2E9TA 4DV2F 3CJ5A 1DLOB 2B9XA 4GC6A 2DNMA 3LUYA 1VIXA 1FDAA 4F4XA 1RK8A 3I32A 5DO2A 3MMCA 5J1EA 2MQOA 1TK5A 2MB0B 1JWWA 4QPTA 1D9AA 4Y65A 3DXBA 2CQDA 4CT9A 2NUUG 3LAKA 4I2QB 3ICLA 4B3OB 1X8DA 3TUZC 2I38A 4RUAA 2UXBF 1XWLA 1SI9A 1IBMF 2HHXA 2PMZD 1ZM3A 2WAQD 4NYZA 1RA6A 2IRYA 3OSPA 2MQNA 3PO4A 1T05A 2ZC4A 2CPIA 5FDLA 4DHVA 2G9OA 3KG4A 1RKIA 2LKZA 1QJHA 5AE1A 4C8MA 2V8VA 4IFYB 4C11B 4ED8A 2APOA 4MH8A 1TKXA 2OD4A 5GAHI 3Q8PB 2DNPA 1HBUB 3SXLA 1CEZA 5EWFA 2E66A 1RT3A 2JDJA 2LXUA 4OZ0A 1LOUA 1JLFB 1LW2A 4DR3F 2VFVA 4FVCA 5FLXY 4RW7B 2IAJB 3OUYB 3QGHA 1S72S 3NMRA 2HVIA 2E5HA 2KKHA 2FVRA 4MKYA 1VK8A 2B5JB 2RKIB 2BABA 3OR1B 1TKZA 1G3OA 1WHYA 4DL3A 2N7YA 2YH1A 3PW0A 4DUYF 1SJRA 4QWAA 5CXTA 4X4QA 1YG0A 1T94A 3VAIA 1S1UB 2LA4A 4TY9A 4F3MA 4ECQA 5KG0A 3TO8A 2LLZA 1Q4RA 2XMMA 3KLIB 1JLGB 2IC3B 1KLMB 1FESA 3R1HA 2G1DA 4Q2LA 2SXLA 3K5NA 1JJ2R 4X84A 4A46A 1YJNS 1AUDA 2ALZA 2DD8S 1HHSA 5B0BA 4IG3A 5A8WB 2GO9A 4RU9A 3KLGA 2DHGA 2HS3A 3MM6B 4QU7A 5KFMA 5B0FA 3UPFA 2DPIA 2XULA 2DNGA 2E44A 2NXUA 3L7OA 3R5CA 4GO5X 1FDNA 1T8EA 3GB0A 3HVWA 3M8PA 2KTQA 3DOLA 2XLIA 5E41A 2OPRA 3HT3A 2W9BA 1X4DA 4OHYA 2W24A 5C25A 3Q8QB 1Y9OA 4Q44A 2GGPA 2XNRA 1TL3A 1C1BB 4HHJA 4BS2A 2DH7A 2KO1A 1S97A 1WG4A 2UUBF 1OIAA 5J2NA 3JTOA 4GKKF 2AYGA 5D3GB 2J9EA 3I5BA 5CQGA 1SH3A 2R8HA 1XTZA 4Y00A 2RQMA 5DDOC 4CI0B 2YKNB 1C0TB 3CCLS 2E5LF 2BANA 2WOMB 3JB9k 3J81Y 1WI8A 3MEDA 3Q8RB 3SYZA 4EEYA 5E2QA 5KFGA 2VKRA 2MHEA 2OKQA 2KFNA 3VZIA 1VQSA 1Y5LB 4WFAQ 3KLHA 1AXQA 3SSRA 2A2CA 1KQFB 4EBDA 4H4OA 2M2BA 3HHNB 2DO0A 2ZZMA 2CIMA 4ZVGA 4LF9F 3RB3A 1QSYA 4J37A 1K1QA 1KRPA 2F8MA 4DV7F 2HQIA 2M88A 1S6UA 1GQEA 3Q2SC 1S99A 1WHXA 4OI6A 1X4HA 3DRRB 4FVMA 2RRAA 1RA7A 1SJFA 3G6ES 2V4JB 2GA7A 1B7FA 1ZPVA 4TYAA 1T02A 2XWXA 5D4OA 4QCLA 5AXLA 4NA1A 1E6YB 3BSOA 1HYSA 3OTDA 3HHLD 4NLPA 5I3UA 4RLEA 1V9OA 2UXDF 3CC7S 4XIUA 1DTTB 3FQLA 3OLAA 3DLHA 3O1LA 4I2PA 1HBOA 5KG2A 4QWBA 4A8OA 3OW2R 4ED1A 1RKJA 4WJBA 1WI6A 2O1PA 3CGIA 3AY0A 2OPQA 3ETOA 4LSLB 4ZPVR 1RT2A 4C98A 5DQIA 5F3ZA 3K58A 1FRKA 4NLYA 5LXRA 4R8UA 4KHPF 2HG4A 3VAMA 1VC0A 2EFPA 4NLXA 2FC9A 2M8DB 5F8JA 1Q7YT 2CJAA 5LL6d 2YTCA 1B0VA 1X9MA 3T5JA 2YKMB 3MAHA 1N33F 3S8SA 1M5KC 2HFOA 3LALA 4NA3A 4K50A 2F3JA 2VG5B 3MMJA 2HS4A 4NOHA 4DSJA 1KC8T 1N48A 4WXOA 3KK3A 1S0NA 3MFHA 2LCWA 3DRPA 3CF5Q 2J9DA 2WONA 4C8ZA 4CO5A 3BQ0A 5HLFB 2GQCA 4PWDA 1KQGB 2OLWA 3KOAA 3IWXA 2B9WA 3T6BA 1VQNS 1HA1A 2VFRA 2VB6A 5G4DA 2XHWA 2CPYA 4ZPDA 4JI0F 3HO1A 1RT6B 2HNDB 1YHQS 2J0WA 3MD3A 2F7VA 4Y2MA 2MSSA 4R5PB 1NJYA 1HBNA 1FXLA 2GC8A 4WE1B 4AFFA 3Q0AA 3JYTB 4FZVA 2XBPA 4DV6F 2EVZA 2JZ5A 3ZFVA 1ZPWX 4F50A 1VQKS 1WTFA 2RU9A 4I7FB 3KHRA 3HI9A 2QO3A 3VTIA 4Z2XA 1FE4A 3G9CA 2ZD1A 1TVRB 2B4PA 2W4PA 4DV1F 5J2PB 2PN6A 3MEGB 1CQNA 4J9MA 2XY7A 3RAQA 1FNOA 2FGCA 1KOHA 4PXBA 5CYMB 1PGZA 2VQFF 3OV7A 1DQ8A 4RW4A 1IJFB 1OPZA 1DTQA 1BGXT 5G0RB 4IDKA 2FD2A 3K2YA 4OI4A 3HK2A 1D3WA 4DPOA 1TV6A 4PG6A 3H98A 1UJ4A 2QZ8A 3GV5B 2CPZA 1FRHA 2JWNA 3CIMA 2BQRA 4FF1A 4RBVA 5JVHQ 5IQQA 3AA9A 2Q66A 2DB1A 4PUOB 3TANA 1H7XA 5A0YA 4B9LA 3PZPA 3P49B 1SH0A 2FVCA 3PEJA 4ID5A 1X4FA 1KD1T 4M5DB 1T3NA 3D28A 3GSDA 5C5JA 3KMSA 2W25A 2YNGB 1VBZA 2DGOA 4ZPAA 2KYXA 3TAQA 2ASLA 1U48A 5F8GA 4HT7A 1M5VC 1F5CA 3MMBA 4WIIA 2HGMA 1SBRA 2DGXA 2QV6A 3ENQA 4ITSA 1WTBA 2XI3A 5KOXA 4J9NA 2Y0SD 2WSEC 2HQ3A 2CVEA 2R7UA 5HROA 1NK9A 1X4BA 4K4XA 5IXUA 4IO1A 5T7LB 3M2RB 1SKSA 4K4UA 3HX9A 1SV5B 1XERA 3BGFA 3BREA 3KNGA 3DC2A 2C28A 2HHVA 1XNRF 2BM1A 3AB4B 3U27A 4NLRA 1IKWB 4UY85 4AQYF 1IKYA 3G71S 1MU2B 1YRXA 3TA1A 1PSDA 1G6BA 2RB7A 1SH2A 2VV5A 1HMVB 4PRFA 2FHJA 1FNMA 1R0AB 1S1TA 3LP0A 3SZ2A 3K5OA 1KFDA 2MJUA 4QJVA 2LXIA 4PPDA