4QU6A

Crystal structure of a g-rich rna sequence binding factor 1 (grsf1) from homo sapiens at 1.75 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
99
structure length
99
Chain Sequence
b'DDVFLIRAQGLPWSCTMEDVLNFFSDCRIRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEVYEINNEDVDALMKSLQVKSSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords G-rich sequence factor 1
molecule tags Rna binding protein/rna
source organism Homo sapiens
publication title Crystal structure of a G-rich RNA sequence binding factor 1 (GRSF1) from Homo sapiens at 1.75 A resolution
rcsb
total genus 28
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qu6A01
3CF5Q 2MGZB 3I56S 2DNRA 2LA4A 2N3LA 4WFAQ 3CCUS 1NJIT 5IFMA 3MDFA 3BO2A 3NNAA 2AYMA 1U1MA 2DIUA 4U67Q 1RKJA 3FEYB 2SXLA 2CQ3A 3NS6A 2DIVA 3CC4S 3ZZYA 1VQNS 3TO8A 3S8SA 2MQQA 5CYJA 3UE2A 2NLWA 2MQOA 4Y0FA 4TU7A 1PGZA 2O3DA 1YHQS 3G6ES 2L41A 3G9CA 2RQCA 2AYEA 2ADCA 2FPHX 2NZ4A 4C0OC 2XS2A 3MUTP 4WF9Q 3VALA 4QQBA 2AYBA 3G96A 2KRBA 1G2EA 2DGTA 1WF1A 1YTYA 3HI9A 3CCMS 2LCWA 2YTCA 4LJMA 1VQ7S 2KN4A 2DITA 5HO4A 1X5PA 1Q86T 2K3KA 2BZ2A 1Q7YT 2MZTA 2KH9A 3VAJA 1M90T 3EGZA 2I38A 3CCJS 3MURP 5GAEU 1ZZFA 2CPZA 2HGMA 5DM6Q 4IOAQ 4CH0S 2MPUA 1KQSR 3UD3P 2KHCA 1OO0B 2RT3A 1DRZA 4LIRA 3NNHA 2M4MA 2MQLA 2DB1A 3G8TA 1X5SA 4FXWA 2MKIA 1HL6A 1WHXA 1VQPS 3B4MA 3NS5A 2RRBA 2N82B 2MY7A 2MKHA 2CQGA 2DNYA 4PKDB 1N8RT 1WWHA 2MGZA 3CCQS 3N9UC 2G0CA 2LQ5A 3BS9A 2RQ4A 1DZ5A 2KM8C 2DGWA 3Q2TC 2DNKA 5LSOA 5GAHU 1P1TA 2CQDA 2MKSA 2B0GA 2DNNA 2KT5A 3DXBA 2DH7A 2A3JA 3EGNA 1VBXA 2PEHA 1SJ4P 3MUMP 4PR6A 2AYGA 3VAHA 1VQ9S 4P6QA 1Q81T 1RK8A 3CXCR 2F9DA 5ITHA 3PIOQ 2M9KA 1YJWS 1YITS 2M0GB 3K0JA 2JRSA 1X0FA 5H1SV 3DLLQ 2X1BA 3G71S 2DGOA 3CULA 3L3CA 2MJUA 2DISA 5HL7Q 3D2WA 4J5OA 2XNRA 3ZZZA 5GAGU 3CC2S 3OW2R 4QU7A 2KM8B 2RUGA 1SJ3P 5D77A 4YOEA 1SJQA 3U1LA 2KG1A 2MY8A 1A7GE 4LMZA 1U6FA 1YJ9S 5DDOC 2LXIA 1U1KA 1OPIA 1S72S 2YWKA 2X1GA 1PO6A 1M5PC 5JVHQ 1H2UX 5LSLA 2X1FA 2OTLS 2DNMA 2QEXS 1D8ZA 4F02A 2ZJQQ 2MKJA 2MB0B 2J0QD 2RVJA 2D9PA 1KOOA 2DHGA 3H2UB 3CCVS 5CA5A 2G4BA 2U1AA 2MKCA 5DDPC 2LYVA 1DHMA 2CQHA 1WF0A 5EN1A 3SMZA 2EK1A 1WEXA 2ZJPQ 4TU9A 1FO1A 2FHOB 3UD4P 2LECA 4YB1P 4IOCQ 1VQOS 2DNZA 1CVJA 2M88A 2CPEA 2HGLA 2RU3A 2OSQA 2MQMA 3TYTA 2CPXA 1JJHA 2WBRA 3SXLA 2DNHA 5DETA 4RU2A 1WI8A 5LJ3Y 3EX7B 1VC6A 5DDRC 3VAIA 1UW4A 5GMKa 2VOPA 2YH1A 4CH1A 5IQQA 1VQ5S 2FC8A 5CXTA 1D9AA 3VAKA 1XN9A 1SXLA 2D3OR 2CPFA 1U1QA 3MXHP 4IO9Q 2F9JA 2DGVA 3VF0B 1VQKS 3SDEA 3Q2SC 2DGXA 3SDEB 2N7CA 2MZ1A 1VBZA 2M8HA 2E44A 2RS8A 3U1MA 1R8PA 1WF2A 3CMES 1X4BA 1YI2S 1WHWA 2CQ0A 3IWNC 2VODA 1M5OC 4TU8A 4BS2A 2F3JA 1NU4A 4V19X 3BO3A 2DO0A 2FY1A 3NNCA 5DDQC 2ERRA 2HGNA 2CJKA 3P3DA 1X4FA 3US5A 2D9OA 3CCRS 2KU7A 2DO4A 1WELA 4C7QA 2CQ1A 3CCLS 2RRAA 5JVGQ 1P27B 3CPWR 2CQ2A 3S01A 2K8GA 4WKRA 3UCUP 2XNQA 1YJNS 2OSRA 2XSFA 4UY8T 1JJ2R 1WG5A 1X4HA 1X4AA 4M5DB 2KG0A 3MUVP 2MZJA 2DNPA 4OZ1A 1U1RA 3LPYA 1ZZNA 2OJ3A 1AUDA 4C4WA 3MD3A 1U6BA 2KYXA 2GHPA 3R27A 3CTRA 2HYIB 3THPA 1N52B 2J76E 2L9WA 1VC0A 1VQLS 2CQPA 1QM9A 5FJ4A 3I55S 2YKAA 1VQ8S 1K8AT 3B4DA 1WEYA 3R1HA 3THTA 2DH9A 2HVZA 2X1AA 4ED5A 5LXYA 1NO8A 2MJNA 2KXFA 1SJRA 2MSSA 3IRWP 3J7ZT 3ULHA 1KD1T 2N3OA 5DM7Q 3S6EA 3VAFA 1K9MT 2E5JA 2RS2A 4FXVA 2DGUA 2CQBA 2MZRA 1VQ6S 3G8SA 2LEAA 2DHXA 3LQVA 2MQPA 2CQ4A 3MI7X 4YUDA 2E5GA 2MZQA 4TLQA 1OIAA 1H2VZ 2XS5A 3HHNB 2EVZA 2CPYA 1M5KC 2DHSA 1Q82T 1DBDA 3UCZP 1HD0A 2FC9A 2KI2A 1L3KA 5GADU 4UQTA 1UFWA 2J8AA 2L08A 3UCGA 2OTJS 1WHVA 3H2VE 2KFYA 2LA6A 4WFBQ 1FT8A 4QPTA 2QFJA 1X4CA 2UP1A 1X4EA 2MHNA 2JX2A 2JWNA 2DNGA 2CPJA 2QA4S 3V4MA 3CC7S 2HZCA 3NMRA 2DNQA 1QVGR 3RW7A 5MLCV 2RNEA 1X4DA 2DH8A 2CPIA 1JMTA 2V94A 4WFNQ 1QVFR 4ERDA 1R8HA 1WI6A 5LJ5Y 2MXYA 3CMAS 2AD9A 1VQ4S 2Q79A 2G1DA 2DNLA 3P5TL 3G4SS 4F25A 2MQNA 1FXLA 1FNXH 3PIPQ 2LKZA 5LXRA 2E5IA 2M52A 3RW6A 4EGLA 2MKKA 2J0SD 3P6YC 1H2TZ 1S79A 1OWXA 2MYFA 5IM0B 5IM0A 1UP1A 2EK6A 2JVOA 2ZJRQ 1VBYA 3CUNA 1SJFA 3R1LA 1X4GA 2M70A 3MOJB 1FJCA 2JVRA 3CCSS 2CQCA 2MSTA 4Z2XA 3P49B 1N54B 2OIHA 2KXHA 1WTBA 1WG4A 2KXNB 1M1KT 1B7FA 3FEXB 4WCEQ 2E5HA 1BY9A 3UWTA 1FHTA 1U2FA 2DK2A 2M2BA 5BJRA 1URNA 4OZ0A 5GVQA 1KOHA 1VC5A 5D78A 3CCES 2VONA 3MD1A 2KVIA 1W2BR 4A8XA 1JJ4A 1HD1A 4WIIA 1WG1A 3JB9k 1U1OA 1M5VC 2M7SA 2YH0A 1VQMS 4Y00A 1FJEB 3S7RA 1YWXA 3VAMA 2DGQA 2CPDA 2KRRA 1X5TA 3BO4A 1F9FA 3VAGA 1U1PA 1ZH5A 1HA1A 1UAWA 3BEGB 2I2YA 1O0PA 1X5OA 2ADBA 1H6KX 1WEZA 1N88A 2LMIA 2DNOA 4QU6A 4ZKAA 4W90B 1K73T 1FJ7A 2U2FA 1IQTA 2XB2D 1WHYA 2BOPA 1U1NA 2M8DB 2DHAA 2GO9A 2MZSA 2VOOA 3CD6S 2LXUA 2PE8A 3TP2A 4PRFA 4CQ1A 4W92B 2XS7A 1YIJS 2LEBA 4F26A 3J7YU 2MMYA 2CPHA 4IUFA 2DGSA 4CIOA 1U1LA 1A9NB 1KC8T 2CQIA
chains in the Genus database with same CATH superfamily
4LRAA 5LL6d 3AD8C 1C4CA 2OPQB 3M6UA 3IA0A 3FKBA 3FVYA 1TK8A 2QLBB 4ZVSB 3CCUS 1NJIT 2XMVA 1L3TA 4LF6F 2WCXA 5IFMA 4ZITA 3IR6B 4PYAA 1S12A 3C6TA 1S99A 1CJVB 1RE1B 3HLUA 3N0VA 5KFXA 2EWHA 2QSFA 1NNDA 3FEYB 1J27A 1S5ZA 2PIIA 5DZ7A 1RKJA 2LDYA 2DIVA 3CC4S 4X66J 2BRKA 4IQMA 4ELTA 3HVWA 4C97A 2Y9HA 2BANA 4ZP7A 4XPCA 4CWBA 2JLFA 3BKTA 1ZAXA 2DR5A 1M5SA 2VDHA 5EWGA 5DLFA 3J7AN 3JSYA 3G9CA 3BM7A 3KTQA 2XMAA 5I3UB 4PCQA 1HNWF 3PXGa 4MKAA 2M3DA 3D0IE 2PSZA 3GILA 3H40A 4A8KA 2CA9A 2VBWA 1RAOA 1RT5B 2FJEB 2XI3A 2XBPA 2ZUAA 5IC6B 5HVGA 4GO5X 3FQLA 3G96A 2EKYA 2FJAB 1KONA 2KRBA 2DGTA 3M4XA 5D4NA 1XQIA 2D3UA 1FTRA 5B7WA 4KPYA 2D7SA 3NP5A 2UXDJ 3JAMY 3CCMS 3MECB 4P72A 4B02A 1VQ7S 2KN4A 5E0OA 3OVBA 4HH0A 3KJVB 1ZTTA 4OV6A 2G2YA 5HO4A 3G82B 2NR0A 3A12A 1R8BA 4R0EA 4K4WA 1Q7YT 1IKWB 4G65A 3VAJA 1UVJA 3EGZA 3RU0A 1JXEA 2I38A 4LR7A 4ES3A 2KXNB 2DCLA 4DUYJ 4OLPA 4C11A 4RWWA 2HGMA 1ZZFA 3HHDA 2RB7A 1Q4RA 2FHJD 4IOAQ 5D3GA 4DR5J 2NXJA 2V0NA 1REVA 3IP0A 1EP4B 1NSKL 1X7VA 1TKTA 2C1EB 4E8UA 3AXMA 1SV5A 4FXWA 2MKIA 1IJFB 2Z2ZA 4CLUA 2FVQA 2BQRA 2UUCF 4J91A 3TEGA 2C3UA 2R8GA 3ITHB 1VQPS 1TMMA 4NCAA 3TVYA 5I3UA 3BBBA 2CJAA 2BYCA 2VPWB 2ABYA 2MY7A 3BGLA 2MKHA 2HNDB 2FZKB 3CJRA 3HKWA 1U0HB 1Y11A 2ALYB 2HRYA 3MF5A 4AD6A 3M2VB 1MU2B 4KBIA 1F5AA 2ZH5A 2L9DA 3KNAA 4U8VA 3Q8PB 4TYBA 2VQEF 1KVJA 1ZM2A 5KG7A 4E2FB 4JYAJ 2LQ5A 2OPRA 2ZBRA 1UA0A 1DZ5A 3BSOA 2ZH1A 3R97A 3BQ2A 4ECZA 2DGWA 4DQSA 1HPZA 2W2PP 3C15B 1T9WA 3NWRA 1P1TA 8RUCA 5J1EB 3D6MB 1NJYA 1C0UB 1UWBA 2MKSA 4WFYA 2P9EA 1D9FA 2EC0A 3PACA 4NASA 1VQSA 3AT1B 2P6TA 3TA0A 2YQ3A 4M5LA 3PZPA 3QIPA 2FY8A 2V9WA 1TKZA 2VU5A 1IUJA 3EGNA 4HACA 1IWAA 1KS2A 2HWTA 2QJ3A 4LF2A 5KFGA 3MFHA 4JV0A 4YB5A 1VQ9S 3UN3A 3GIIA 1BE4A 5IQ6A 1Q81T 5DG8A 4IG0B 3GV5B 2NUUG 3J81Y 2F9DA 3W1YC 3CD5A 4HVZA 5ITHA 4XPEA 3JYTB 2LEPA 1HBMB 2M9KA 2OPSB 3M30A 3OFHA 4EO8A 2N4CA 5SZTA 2EBEA 4ECYA 1FWKA 2HZAA 4ICLB 4IO1A 2AEMA 2PO4A 3KLEA 1JQGA 1KLNA 1CQNA 1RT2A 4LVNP 4CZCA 1X0FA 1BD6A 3UNGC 2ZOFA 3VTIA 3N4WA 1DTTA 2V4JA 3OTBA 2XMMA 2MJUA 4I2PB 3F73A 1S77D 1SCJB 2DISA 3ONQA 4ZVQB 4LF4F 1RGVA 5A6PA 5KG5A 1TUWA 1FD2A 3CC2S 2QG9B 3WC0A 3OW2R 2XNRA 3D5MA 3UNYA 2KM8B 3D67A 3A3NB 2PI4A 3BBFA 2C3YA 1NAQA 2Y1JA 2LLZA 2WONA 1SJ3P 3U1LA 4YOEA 3RB6A 4ECXA 1JLEB 5K5MA 3HXMA 3EPGA 2FVSA 1N0VC 2BM0A 4X84A 1H3DA 5E3AA 4B3RJ 3OBIA 2KZZA 4X4VA 3ZFVA 4KSEB 2MKYA 3BREA 2PMHA 3EYZA 2AW0A 2B9YA 1K1SA 3KOAA 3PRVA 2EFGA 3V6HA 2G0JA 1RCOB 1VIXA 1WC5A 4OZJA 3H5XA 2EFQA 2C2RA 3L09A 1X9SA 2GS8A 4NLVA 5B09A 2BR0A 3VQTA 2OTLS 1Z2LA 2GHVC 2DNMA 2YKMB 1NSAA 1DURA 1FXRA 4NRUA 2VC0A 3T6JA 3FFIB 3CDBA 5T7LA 2BJ8A 3QNWB 1NKBA 4FZVA 2MB0B 1LWFA 3WDOA 2J0QD 4JOUA 3TI0A 2ZD1B 2D9PA 4WJBA 5K8OA 2XQCA 4XO0A 2X7IA 1NB7A 4NCBA 5BR8F 3FBBA 3LP2A 1FF2A 2QLXA 3PRBA 5CABA 1RHKB 2BMBA 2YWEA 4ECVA 3P5BP 1Y7PA 3C66A 4LSZB 2OD4A 2JLEA 2CQHA 4EK2A 3PKYA 3LP1B 2H48B 2O67A 2ZZNA 1VLYA 4B3RF 1ACMB 2LECA 3DYAA 3MGJA 3OHBA 3DHWC 2E7XA 4ED8A 1VQOS 2CPEA 2HGLA 1ZA1B 3PVXA 1UPMB 4X4UA 4LF5F 1F0XA 1WDTA 2FHMA 2VJVA 2OSQA 4MKVA 2J0SD 3GTYX 4WPAA 1JXLA 5J2MA 1OY8A 3BYPA 3M9OB 4LRCA 4AT1B 3QRRA 2HHTA 3NGSA 1KKHA 2L3MA 3GIKA 5DETA 4OJ3A 5BXIA 2H4WB 5LJ3Y 3I0RB 4L3NA 1AFIA 4NYPA 1FESA 2IA0A 2QL9B 2W4PA 2O66A 1SQFA 2VG5A 3C16A 1HKAA 1RWUA 3H42A 4FYVB 3VAIA 4K4XA 4URGA 4I0WA 4YMEA 2LVWA 2YNIA 4H4MA 4CH1A 5IQQA 4H4KA 1WOSA 2R2RA 2P6SA 3M2UB 4UZCA 4FPRA 3HDSA 3ZTQA 3QZ8A 2AD9A 2CJ9A 5ETKA 1ZYQA 2DGVA 1D09B 5AE3A 2ZD1A 3RRHA 1R31A 1H74A 2HHSA 3SDEA 2MZ1A 1S1XB 4ED3A 1KEKA 2UUBF 4JV1A 1X31C 2E44A 4X66F 4GC7A 3TUPA 3R8YA 1RBAA 2DXEA 2MTLA 3MEDB 3SSSA 1S1WB 1T02A 3ETMA 2B9XA 1F3VA 2E29A 3DRXA 1DTQA 1K44A 2QA1A 2R8HA 3GJTB 3EVWA 1BQNB 2IVMA 1R8PA 2FHKA 1WF2A 1GT8A 1DAXA 2HIYA 2MQ8A 3HCXA 4OI6A 2LQBA 4F0HA 4DR4F 5KT2A 4NLWA 3HHLC 4K4UA 1PC4A 4ID5B 3CJTA 3M9NB 4ZVPB 1S97A 2WZ1A 4Y34A 5E33A 3ZZOA 2X3DA 1QLNA 2UXCJ 2ZBPA 4BCAA 3BO3A 4NI2A 1HI1A 3HSGA 5L38A 4OYOA 4FN5A 3EPIA 3R7SB 5F8NA 3ILJA 2ACMA 3P3DA 2ZH6A 4J9OA 4A4JA 4QWAA 2UV8A 2VPYB 1T3OA 3PHTA 1X4FA 2YWGA 3RJMB 4ILLA 1WSRA 4CLTA 3FCHA 3JTOA 3RGIA 3CCRS 2DO4A 1T9UA 1GMWD 2ZZTA 4GMKA 1RTDA 2GC8A 1FTCA 2NYIA 1WOOA 2CQ1A 3KG4A 2XYPB 4OYXA 2BM1A 1I1GA 5JVGQ 1B64A 4MIAA 3TX8A 4ED1A 4JI4J 3GIRA 2CNOB 2VIHA 4N77A 3FZBA 4LQ9A 4KV8A 1KDNA 2EW9A 1HIYA 1MMNA 3PYDA 5LMNJ 5IT0A 4I7FA 4WKRA 5IS2A 2HFNA 4N8OA 3HP6A 3Q23A 2R7SA 2XNQA 2O01C 1Q0NA 4DG1A 1CULB 1Q8IA 1RBLA 2Q3PA 4ZHRA 3BKUA 1ICEB 2XSFA 4I64A 5KOXA 3J81U 2OTJS 4RW8B 2W9CA 5G0RA 3W7BA 3F56A 5A8KA 2UVRA 3DOMB 1FFSB 4M5DA 2QLFB 4DF8A 3MUVP 4J9MA 3OR2A 4G1QA 3KWMA 1FE0A 4LF5J 4F4AA 4NCGA 4YFUA 4LF7J 3W5XA 4ES1A 4DV2F 2HLUA 3LPYA 1ZZNA 2LP4A 1VI7A 3J81j 4C4WA 3MD3A 3TAMB 2GHPA 2UV8G 4WTYA 3R2DJ 2CVIA 1XIQA 1RHJB 5BYSA 3FQKA 4KO0B 2YQ1A 1RWKB 2DR7A 3PFEA 1FDBA 5DZ6A 3M8PB 1IKVA 1L3VA 2CNKB 9RUBA 5HK4A 3SCJE 4RKUC 3HT3A 3PDNA 1FWPA 4IFVA 3FRYA 4AUKA 1H73A 4K4TA 4Q0BB 5HVHA 1HI8A 1K8AT 1Q8LA 3IFEA 1WEYA 3N6MA 2D41A 2AHOB 2DH9A 4I7FB 5EWFA 2W1BA 2IJRA 4A48A 4WXOA 2V8PA 3D0GE 1S9FA 3N01A 4LF1A 5KFIA 4ALZA 3OTOJ 3C6UB 3FJ2A 4ELVA 3DHXA 2LQJA 3TJAA 2JFDA 1UVKA 4FYWB 3D6FB 2W9CB 3MM7B 3PR4A 2DY1A 3EXCX 3LTOA 2N3OA 2QA2A 2F4VF 2MLZA 1OPZA 3BN4A 5ETPA 3DNCA 4WU2A 3ZTSA 2ROPA 5LOQA 4ED6A 3TA1A 3ILLA 4ZVGA 1AZSB 2CIMA 2E5JA 4N76A 1S1VB 4QBUA 2DGUA 2OAUA 2HHQA 2MZRA 1WSVA 4M8LA 4LRBA 4P7VA 3V5RA 4TY9A 2GQ2A 4QZVB 5AXKA 3KMSA 1RAJA 3T1YJ 4J9RA 4KO0A 1N33J 1IBCB 3NBPA 2CQ4A 4A8YA 2W4CA 4RW6B 1RT1A 2J9DA 3IG1A 3PYFA 3GJQB 5GAHI 4K2XA 4R8UB 1BHNA 3MM8A 4IFVB 3M8SA 1L3SA 3RB3A 1XEZA 1HNWJ 3DRSB 3LAKA 4CO4A 2W9AA 2MDAA 3C6TB 3OXGA 3DRPA 3QAEA 2AQ4A 1S7IA 2BW7A 5KT5A 3IAS9 4K4YA 1N34J 5A0YB 4CT9A 1FKAF 2EVZA 4DX6A 2PEBA 1F9HA 2DPIA 3KK1A 4WU3A 2DHSA 3TJ8A 1Q82T 3P4UB 3CJ3A 3ZZRA 3HHEA 1F6TA 1PC5A 1GXTA 5GADU 1R7IA 1F3FA 1QD1A 2L08A 1FE4A 4CLYA 4NXNF 3DLBA 3UVJA 2V63A 1X4CA 2XYHB 2UP1A 1IKXB 2OEMA 2JX2A 3BKFA 4UT4A 3W2VA 1OMSA 3CDEA 4KYZA 5B08A 2QA4S 3SFUA 1RQ0A 2OFGX 3CC7S 2DNQA 3GLJA 2Z2MA 4MYTA 5MLCV 4NXMJ 1OY6A 2DH8A 3FCVA 4IH7A 1RAFB 4WFNQ 4WFZA 1FA0A 1LWXA 3LWMA 4FNHA 5C2GA 3DRYA 2Q79A 4EYIB 5L39A 5HP1A 5T14A 4F25A 4LFBF 2BKOA 5EUHA 4DV5J 3HHLA 4IG3B 3G6YA 4GKJJ 1H38A 1TAQA 1I3OB 2E5IA 5LXRA 4Q43A 4ED2A 2ZHAA 3FC9A 5HQMA 3KK2A 4O3RA 2K1RA 3P6YC 1CG2A 3QO9A 1X0PA 2X3GA 1VRTA 3CMQA 4U7CA 4DR7F 1RAIB 1RAGB 3MEEB 5BYQA 4WKYA 3GYNA 4I56A 1X4GA 2XZTB 4FS2A 1M5OC 3PO4A 3MOJB 1XNRJ 1EJ7L 1WDDA 3OJUA 4OX8A 2HFSA 2MSTA 2WB4A 4DU8A 3CCSS 1X9MA 4ZPBA 2FJVA 4NLQA 2H4YB 4RL1A 4QPXA 3KLGA 1IBKJ 4DV5F 4OX9J 4JV5J 1HR0F 1NJZA 1HWKA 3A13A 3FEXB 3OLBA 1IR2A 2BDPA 5KFVA 2HNDA 1IVZA 4H4KC 2VFVA 4OHWA 2DK2A 2FYXA 4CO3A 1MU2A 2W7AA 5BJRA 3RBZA 1UZHA 2DXDA 4OZ0A 5GVQA 5C24B 3PW4A 2GCFA 3HX9A 3MD1A 2QN6B 2IA6A 2KVIA 3IWXA 3W64A 4E0DA 4K50A 2QMWA 4CCHA 3AOAA 4W98A 3M8QA 1GMUA 2C3OA 3V4IB 4IG3A 5EDWA 1MN7A 1R3NA 4TY8B 4UOFA 1S4FA 2YH0A 3KJNB 3DU5A 4H4OA 2IMOA 1RA6A 1YWXA 1ZM9A 3A8IA 3I5CA 2DGQA 4R5PA 3VAMA 1FDAA 2DRDA 4J37A 3MR2A 3BO4A 4PUOB 1UAWA 4ATNA 1B99A 4DQIA 4DR2F 4RO0A 2IAJA 4P2FA 2FTRA 3AH6A 3KJVA 2NZCA 4QIGA 3BV8A 4MK8A 3SQGA 5HMWA 4X4PA 1SC3B 1P9YA 4MTPA 4X4QA 2HBQB 4C8KA 1WEZA 2UXBJ 1U2CA 1CC7A 2LMIA 2JSXA 2LFVA 2Q66A 4KIAA 4KTQA 3MAAB 1R0BG 4ZKAA 4CT8A 2DTJA 5ETTA 2DR6A 2XI2A 3AFGA 5K20B 2AEJA 1U1NA 2GO9A 2L48A 3M6WA 4DSKA 3SEOA 2VOOA 4YN3B 2F8MA 3CD6S 2HS3A 3QAUA 3Q8RB 1S6QA 1SUQB 2WSEC 1NKCA 4OHVA 4DX5A 2LEBA 1JLEA 3J7YU 4WZQA 4ZVEA 2MMYA 2CPHA 5F9NA 1CJKA 3HD2A 3MCOA 4CLPA 1KC8T 4RUAA 4DL6A 3HFKA 3MEGB 5HROB 4OZ5A 3AJDA 1U26A 1UEUA 5AE1A 3EM1A 3I56S 1XR5A 2LA4A 1TVRA 3BH7B 1WKJA 1KRPA 3BO2A 3MDFA 4MJKA 2V5HG 4DMZA 2HURA 4JUZA 2AYMA 2ZDPA 3TNVA 1U1MA 1U47A 2DIUA 4U67Q 2E1RA 3D1OA 4ZIWA 1UCNA 1VMBA 4RW4A 4AQYJ 3NS6A 1AUSL 2ZOMA 4PXBA 4WYLA 2OPPA 1OYEA 2CYYA 1GMVA 3OPKA 3ZZYA 4HH1A 3H20A 3ENAA 1VQNS 3CJKA 4DV1J 1GK8A 2AKWB 1EKSA 4F4ZA 2RDDA 2KB2A 2XWYA 3NCQA 2MQOA 3HKZD 1F60B 2OO4A 3KUGA 3G6ES 1HNIA 2DCUB 3BQ0A 1WJ9A 4B9UA 5K8NA 1Z2ZA 4K2JA 4WYWA 4C0OC 2XS2A 3MUTP 1RT5A 1HQUB 1SUQA 2E7WA 4ICLA 3C3LA 2AYBA 1EQ0A 3BSCA 5DRKA 3I4HX 2R4FA 3AA8A 4DL7A 1G2EA 1YTYA 1FEHA 1RT2B 4ZVFA 1RHUB 2GVZB 2J0XA 3K7RA 5FDLB 3PYGA 3BGOP 4BBYA 5DO2A 1DTTB 2YTCA 3CIMA 3QBCA 2CWKA 1OY9A 3DU6A 3K5MA 3K58A 1HNVA 1SBRA 3QLHB 1X5PA 4WBFA 4O0IA 2GMJA 4LFAF 2BZ2A 1LEOA 3QSIA 4G6VB 3M9MB 1XNQJ 1FFWB 1SIZA 1FJGF 1XMOJ 2GIQA 2HNYA 3MURP 1V9OA 5GAEU 1J5OB 1HHTP 2CPZA 4A8FA 2ZC3A 5THWA 4DQPA 2VQFJ 4EI2A 2MPUA 3UD3P 1JX4A 4NXMF 3DGPB 3D1HA 3UDVA 4JI5J 3D0HE 2VKRA 4LUBA 5ETQA 1OO0B 4GO7X 4ZCMA 2NUHA 1DRZA 2MQLA 5KFSA 2N4DA 4BWMA 1XWLA 3DFEA 2HS0A 1A6LA 5D6GA 1QSLA 3H59A 2GAGC 3GR0A 1FVSA 5HJYA 2H51B 4YR3A 3W62A 1KFDA 2FJXA 1K47A 2HKEA 1S6PB 2RRBA 2YQ0A 2YXLA 2Z2YB 4KPCA 1FKOA 2CQGA 1S1WA 3GCWP 1NK0A 4IFYB 2XG8A 2VICA 3HK2A 2BKPA 2QGFB 4PKDB 3OVSA 3CNQP 3GG1A 1NJWA 4FBUA 2HQCA 2E9RX 2DD8S 3FFIA 2I6WA 1WWHA 3K5PA 2MGZA 3CCQS 1BWVA 2R7QA 2G0CA 3BS9A 3GYGA 4ZMMA 4RNOA 2RQ4A 4MK9A 3Q2TC 2W2QP 3PX6A 1UTAA 3ENWA 3LP2B 3K89A 2CQDA 3H0PA 2R2SA 3QZ7A 3QATA 4PG6A 2KT5A 4BDPA 3IR7B 1RSCA 5A6WA 2AJ2A 5DG9A 1J2VA 4ID8A 3LP1A 2A3JA 3DXSX 1LFPA 4HACB 4I6YA 6AT1B 5H9EJ 3WQPA 1VBXA 1SQGA 4F4WA 5L9XA 4Q45A 1C4AA 1XC9A 1JNZB 4CTAA 1T03B 1RK8A 3I4PA 1U49A 2VG7A 2ROGA 4NL5A 2B8PA 3PY8A 5A8WB 1HW9A 2OPSA 3M30B 3EZOA 4ZA1A 3V81B 1NDPA 2B8QA 2LU1A 4WXWA 4B3SF 3K0JA 3I5BA 3O8WA 2HAIA 1NXIA 4QR2A 5CD4H 3HVAA 1S6PA 5EX0A 2UUAJ 3DLLQ 2DGOA 4O4GA 1FKOB 3L3CA 4PG7A 4WTOB 2NSBA 4ZK7M 5KFRA 5HL7Q 3M2UA 3D2WA 5KFNA 3ZZZA 2PN6A 3PRDA 1RAEB 4TLRA 4EU0A 1CJTB 1F9EB 3C14B 2B9EA 3KLIA 2IJFA 4KFBA 1TK0A 4L6V3 1SJQA 1VJQA 3VQSA 1IR0A 5CYMA 4ECTA 3DOKB 1LXNA 1S1XA 3QFWA 4OHZA 1RLCL 3HVTA 1LNQA 2E1MC 2I1RA 4LRDA 5KFJA 2UXBF 1N33F 4NCGB 4Y2IA 2ASYA 1RI7A 4CO5A 2UXDF 9ATCB 2QFIA 2XMJA 3DDKA 4HT5A 2BE7D 2GO8A 5CYQA 1S72S 1FX2A 3CJSA 2AIRB 4F67A 2J9CA 3KG0A 4USVA 1K0TA 3VGTA 1U24A 2KYZA 3DC2A 4HR2A 1T03A 2X1GA 1PO6A 4ANEA 2VG7B 1HBUA 4DL0C 1H2UX 3BGRA 1GFWB 2UUWA 3W9JA 2BJ1A 1SIWB 5C25A 1NKEA 4JI3F 4JI8J 2GMHA 4X4OA 3V6DA 1HNZF 2OP5A 3M6VA 3OSNA 3W9IA 1D8ZA 4KGZB 3TAPA 4F02A 1YBUA 2LXFA 1LKZA 3W5YA 1IR1A 2MKJA 5E5NA 5KFAA 2RUSA 3SCKE 4J9SA 1TFWA 2FDNA 2RVJA 5DQHA 3CCTA 1C1CB 3S1TA 2R7WA 4DX7A 1FRKA 1FVQA 4Q2LA 2HFUA 3HT0A 1JIHA 1DHMA 1SC1B 5DGBA 3SMZA 4OV1A 5F3TA 2ZDOA 3R7NB 2G9OA 3TUJC 5HMXA 3MR3A 2PFDA 1FO1A 2PC6A 3AB2B 2RJZA 4OLOA 4N7TA 1S76D 5ETNA 4W4MA 2CUYA 1LW2B 1YRXA 4NLPA 4OX7A 4DS4A 1E6YB 2J7WA 1VGYA 2HSEB 2PA8D 2YNHA 3LH2S 3ZTRA 1R89A 4I68A 5GMDA 2HFZA 3DLKA 3EWGA 4Q5VA 2YX1A 4QIEA 2HQ3A 2WVBA 2XHCA 4NA3A 1KQGB 1JJHA 4CH7A 4DSIA 4OL8A 4OJGA 2AV5A 5M2PA 1LW0A 1WI8A 3OL7A 4RU2A 1NK4A 4DSJA 3CJ4A 4OYZA 4Z7YA 2GGPA 5IWAF 1PYSB 1VRQC 2CXEA 5DDRC 3EX7B 1VC6A 4JI6J 3ISNC 5H9FJ 4MAKA 4F4XA 2B6AB 3ZZUA 3OTCA 1N4LA 5GMKa 4Y3CA 3W60A 2GV1A 2YWHA 3J80U 2YH1A 1YGYA 3W2WA 2IPOB 2WHOA 5CXTA 4ZVTB 3SCIE 2KT2A 3OR2B 3CJ8A 4G1QB 4IRKA 3KDNA 1KLMB 3CDAA 3I0SA 2D3OR 3H5UA 2HNZB 1SC4B 1WKKA 3NXZA 4LF6J 1RUSA 2WAQD 4LFAJ 5RUBA 3EJMA 2DR9A 3VF0B 4CRJA 2XCAA 2F4FA 3KHGA 2F7VA 1VQKS 2DGXA 3MM9A 1VBZA 2GIFA 2C22A 1SI9A 2M8HA 3I82A 4KKOA 2DVIA 3KK1B 1FXDA 3BB5A 3H2LA 2GJFA 1BQMB 1RTZA 2ZEJA 4HTJA 1Q8BA 3VVTA 2DEIA 3UPFA 3PO5A 2F40A 2QRRA 5LT5A 1H72C 4Q8EA 2R7TA 2DXFA 1OS5A 1XMOF 4CLZA 1Q5YA 1RT4A 1GAOA 1S57A 1J5EF 1LW2A 1R8CA 3HD1A 1B0PA 1IXKA 1E6YA 2VFSA 3NCPA 1U02A 1S48A 4C48A 4FF4A 1X4BA 3PX0A 1S59A 3SI8A 2DRAA 3IWNC 2AEFA 1QAYA 5LSRA 4A8MP 3T5LA 3KHRA 1QY7A 4DPYA 4HHJA 2FVCA 2JZ5A 1NU4A 3EZUA 3C6UA 2FGCA 4FF2A 2PFFB 2VFTA 1HWIA 1RT7B 3NRBA 2EEYA 3HSDA 5J2QB 4OMFG 3NGKA 2ACYA 3G6VA 4QYZJ 3ISND 3HMJG 2W9BA 4OHYA 2XM3A 2O1PA 3GZ7A 5HN0A 3LUYA 2RKIA 3OTEA 3RRGA 2KU7A 2CFXA 1UETA 2B4PA 4WFXA 4Z7CA 1N32F 3EICA 1QUVA 4C8OA 1U7LA 2YNGB 2VZ9A 3H98A 3MHYA 1T3NA 2HFVA 1UEVA 1U48A 3A8KA 3D9BA 4I2QA 3EUNA 4C3LA 2YKPA 4JI2F 4DI6A 1REGX 2YPYA 5A8RB 4TU7A 4ZS6A 2NSCA 3IM8A 5KAKA 2HVIA 1CBKA 3UCUP 2HAFA 3MMAA 2B7CB 2OSRA 2VG6B 5ETSA 1FEEA 3RG6A 2QEXS 4ZJLA 3B8HA 4KJIA 1BQXA 1HHSA 4UY8T 4FYXB 2HVHA 4CLKA 3GB0A 2RHSB 1HARA 2RILA 3W65A 3DCAA 4HYKA 5CD4A 3MMBA 3OFEA 1EKRA 3KK3B 1OSDA 2LQ9A 2UZAA 3DOLA 4KHPJ 5C24A 2Y1RI 1RHRB 3SV4A 1QAJA 4UW2A 2GQCA 5KFCA 2XY5A 1N34F 2IRXA 3BZQA 1S0MA 5EHHA 3ADAC 2C2KB 2B4VA 1RWVB 3C19A 3HHLD 4M5GA 2HYIB 3PKMA 4GKJF 3M8PA 3UW1A 1NK6A 1ROFA 2FZCB 2J76E 3L9ZA 4H4OB 2GW8A 2ILZA 2YY3A 3BGUA 3T9ZA 4ZLNA 1QAIA 2HRUA 3VWSA 1VQLS 4FDFA 3ENVA 1KR4A 1HQ2A 3I55S 1NSPA 1RT6B 4LT6A 1LFWA 2OPRB 3TZYA 1ZM4A 1YX2A 4CO2A 5B0BA 4DUZJ 4G1IA 1YQHA 1CQMA 2CZ4A 2HVZA 1IJEB 2JNJA 4O44A 5KFFA 1FWLA 4JI0J 5DLGA 4NEZA 2J8SA 5A76A 4A8QA 1KNZA 2HBRB 1P1LA 2RH3A 3CSKA 2ZOGA 3IRXB 5ADZA 1P8GA 4IDKB 4OI1A 4ANCA 3J7ZT 3JSMA 1PILA 4NMXA 1VRTB 2CJYB 1PIEA 1RU2A 3IM9A 2C2EA 4O3SA 3E2EA 1K0VA 4LF9F 4LR8A 1RWWB 3O44A 3EZ5A 3DRRA 1ZAWA 3S6EA 3W3SA 3FBFA 2RS2A 3JSRA 1FK9A 3POTB 3A8JA 4QR1A 2HHHF 1WD6A 3NAHA 3MCMA 2CQBA 2HQGA 1VQ6S 4X2BA 4D3GA 4HI1A 2BQ3A 3M8RA 2NXNA 1H0HB 1T05A 1TMJA 2DHXA 1XERA 3WX8A 1NH8A 4RW6A 2MQPA 1SB6A 4NEYA 1RT1B 4DR6F 2JH3A 2V4JB 1PG5B 2XMKA 3CJQA 4I2PA 5K9FA 4YUDA 1HYSA 2E5GA 3LGNA 2DPJA 2MZQA 2R8IA 2ZHBA 1IM6A 2APOA 2CRLA 2QL5B 4M5HA 5KFUA 4DFPA 2C2MB 2P9CA 2XS5A 3N5BA 3GV7B 2WBMA 2E1AA 5U47A 3X1LB 1Z4UA 4FBTA 3DM2A 3BQ1A 1RWXB 1M5KC 4KR0B 4NYOA 2J0WA 3PCOB 1F1BB 3W8PA 3UCZP 2BV3A 3ETOA 3RW6A 4AFFA 2FC9A 3LALA 1AA1B 3NG8A 5AJ3J 1NJXA 5F8MA 2PI5A 2BJDA 1TZ0A 2J8AA 4C11B 3VVUA 2VC1A 5HLFB 4IOBA 1WHVA 1Y3KA 3H2VE 4ZVOB 4ECWA 2L9NA 2LA6A 3T19A 7FDRA 3Q8SB 4Q2MA 3UVJB 4DF4A 4QPTA 1SKRA 2AF6A 2Z4PA 1AXQA 1EP4A 2JWNA 4J90A 2IVFB 5DG7A 3POTA 4K0KF 2CPJA 4O3NA 2YKMA 1RYSA 3DLHA 4C8LA 2HZCA 3NMRA 1VRUA 2E9TA 1RISA 1UJ6A 2IFXA 1DY3A 2RNEA 2RQKA 1GX6A 2OFHX 4XDDA 1JMTA 4ZPWR 2CAJA 8AT1B 3KLHA 1FERA 1AW0A 1QVFR 3H5SA 5HAOA 4IH6A 5L1LA 1HBNB 1ZBTA 1HI0P 1OJ4A 2GQQA 2MXYA 1VQ4S 1U0HA 1C0UA 1UWBB 3FMBA 2DNLA 2GJ2A 4DV6F 1J5EJ 5C42B 3QLHA 1RKIA 5AE2A 1TL4A 2MQNA 1FXLA 1NPKA 2B43A 2ZH8A 4YQWA 1JKHA 1D1UA 3PIPQ 2HWHA 1RHMB 1SH2A 1N5YA 3SIPB 2E1PA 1V5IB 2KL8A 1DQAA 1H2TZ 1FCAA 1OWXA 4MIWA 3UDLA 2MKKA 1FRMA 5K8PA 5IM0A 4MKYA 1VK3A 3OR1A 5IV4A 1RTJB 4ZPAA 3N6LA 4G3IA 1TKDA 3DGPA 4LR9A 2D3ZA 3FK4A 5GADI 3R1LA 3QIPB 4ER8A 2IRYA 3MR6A 1MWYA 2BJ7A 1RTIB 4Z2XA 1KFSA 3MR7A 1UWAA 2OIHA 4MT1A 1WTBA 1WG4A 4MFBB 3KYLA 1M1KT 4I6WA 2HHUA 1ZPWX 3LA0A 2I0XA 4NLTA 5E3CA 2E5HA 5LM7E 1BY9A 1PYOB 2BW2A 4IR9A 4B3MJ 1FHTA 2RAQA 1PJ7A 3TR5A 3BYRA 4QWCA 1N5QA 2M2BA 4RW4B 1KOHA 2X51A 4FVCA 1KQKA 4IRDA 4JI7J 3NWGA 4AXIA 3CCES 1S1UA 1TL7A 2EKNA 4IRCA 1XNRF 2FIUA 1EZZB 1HBNA 1GX5A 1SV5B 4F0KA 1W2BR 3QGGA 1RHQB 3OTDA 4UOCA 4O3PA 1WG1A 3RAQA 3JB9k 1R6YA 1U1OA 3V4IA 4ZJQA 4N8NA 4XTTA 1M5VC 1JLGA 3MM5A 1NDCA 3M32B 1WOPA 2PGCA 2IRUA 4LF8J 1SPBP 1HQUA 2V67A 4YHHF 1URRA 3GP9A 1WNEA 4L72B 2VFUA 1X5TA 1F9FA 4RLEA 3IC1A 4UUWA 3AOBA 3NKYA 1HPZB 5HSPA 2I2YA 2ADBA 1N5SA 1H6KX 2BRLA 2HHXA 1Y3JA 1Q1KA 2YPZA 2IC3A 4V1Ak 3VZHA 2Z0GA 3MCSA 4I1TA 4WP3A 2W01A 4HL9A 4LBPA 2HHPA 4PPDA 2FVPA 4JI4F 1NM2A 1TKXA 1YJRA 3PV8A 3RBDA 1TAUA 1VIOA 2YNFA 4FVMA 3E01A 2NXEA 4N47A 3QSYB 4Y6IA 3F41A 5E3RA 2R8KA 1PJ5A 1UKUA 1C1BB 1K73T 4YHHJ 1BGXT 3TW0A 2U2FA 4USMA 3FCWA 2HBZB 2MLXA 3I32A 4I4BA 2XB2D 4IG0A 2J6UA 4I69A 2DHAA 2J6TA 3QT7A 2MZSA 2CDRB 4A46A 3ZZ0A 4CNYA 4A8WA 1I51B 4RUBA 1HBOB 1IQTA 1MLAA 1VJWA 2AJFE 4CQ1A 3IBCB 1YIJS 4U9RA 1V5VA 1SL0A 4JI0F 4LFCJ 4AXJA 2XMWA 3MPWA 4LRFA 2PMZD 4CM2A 3OTOF 2MEWA 1GTEA 5K14B 2DGSA 3KXDA 5HQ8A 4CIOA 3TQEA 1SVDA 1U25A 4DPUA 5KT7A 3RTVA 1EQMA 4DS5A 4F50A 4GRSA 1SL1A 3CF5Q 4TVAB 3OL9A 1VBKA 2MGZB 1HFEL 3GIJA 1TVRB 3H5YA 2N3LA 1O6XA 3I5AA 4WFAQ 1JJCB 3OV7A 3IGVA 2NREA 1W25A 2HHHJ 5KFOA 1G4CA 1Q79A 1U0SA 4RUCA 1PYTA 3WBZA 1IKYA 2CQ3A 4RNHA 3FEZA 3T5KA 2MHEA 3Q89A 1WACA 3RB0A 2BA9A 2V9KA 3BH6B 2YNFB 5CQGA 3TO8A 3EDQB 1ELOA 5DS7A 2ILYA 3S8SA 4D3HA 2YNIB 2HS4A 2MQQA 2NS1B 3KUEA 4Y2AA 2B7BB 3UE2A 1YZ7A 1JK9B 2NLWA 2VD3A 2P5VA 4A47A 4DPTA 5IWAJ 4Y0FA 4USKA 1QJHA 2O3DA 2L41A 4J9QA 2HQIA 1MWQA 1CEZA 2RQCA 3IXQA 3LANA 1ZA2B 2ADCA 2EFNA 2WSFC 1IKVB 3CCWA 2FPHX 3MCNA 2IYGA 1W26A 3O3LA 3DI6B 1BQNA 4K5SA 3GFYA 3D3BJ 3MOZA 3QPIA 4KAIA 1N36F 3G86A 2UXCF 1PBUA 1WF1A 1KN6A 4O3OA 5JMNA 1HHQA 3FSXA 2HVDA 3HI9A 4DV1F 2LCWA 4O4GB 4LJMA 1SKSA 4Q8FA 3JQMA 3PG9A 1GTHA 1RBOB 2GGPB 4I67A 1T11A 2JC1A 1DQ9A 1RT3B 2V2VA 4KQZA 5A2QU 1M90T 1CJTA 4P10A 3I9V9 1NK9A 4HDHA 2W2NP 1D0EA 3DLEA 1JLBA 4RW7A 3UO0A 3W5ZA 1FRLA 2H5EA 2ZVIA 3MZIA 4DU7A 4QWBA 2PMWA 3NAIA 2RE1A 3DLJA 1RAHB 2CKWA 4LREA 3GIMA 3D68A 2HNZA 3PX4A 4B9MA 2GVDB 2RT3A 1RWNB 3AXKA 4LIRA 2G0IA 4NLOA 4F04B 4NOHA 2AGQA 3EDRB 1ZPVA 2DB1A 3G8TA 3I0RA 1X5SA 3MM6B 3TUZC 2VA2A 1V3RA 5ETMA 4P74A 1CC8A 4GVLA 2IDLA 1FKPA 1OQ3A 2GA7A 1BQMA 1WHXA 4DCOB 3B4MA 5EGYA 3NS5A 4ED4A 2N82B 1IM4A 1XNQF 2KKHA 2O5DA 1RTDB 1Q7LB 2JC0A 4DDFA 1RB0A 4CO0A 4DG1B 2F65A 2QMXA 4ZHRB 4USWA 3LOUA 3ZNUA 1LQ9A 4X62F 3O1LA 3N9UC 3M2RA 2V68A 4UOHA 5HBMA 2W8LA 4QJVA 3GMGA 3T1HF 1YLXA 4ZVUB 1R0CB 4DV2J 1T7PA 4OI0A 1N32J 2FQQB 5LSOA 3HSZA 5GAHU 3L7OA 1SJ1A 1Y10A 4K4ZA 3LPEA 1RAAB 3DKDA 3DGVA 5L46A 3HFVA 2OMOA 1SH0A 2UUAF 2PEHA 2FGOA 2YWWA 3OUYB 3MUMP 1EETA 4PR6A 1ZM3A 3PFOA 1NHUA 3IR5B 3GJRB 1WC0A 4KE5A 4P52A 4NLSA 3RUBL 3FDSA 3U7JA 4P6QA 2W9BB 2V34A 1GQEA 2JEFA 4FYDA 1AB8A 1T94A 1RJJA 4EMDA 4ETZA 1IKXA 1KVIA 2XHWA 2HHWA 3PIOQ 5HATA 3TVZA 5KFBA 5H9EK 1YJWS 2ZH4A 3MTKA 3D3CJ 4WIQA 1YITS 4YS2A 1UL3A 1WORA 3TAMA 3M05A 2GHWA 3QT5A 4DUZF 4LF7F 2ASLA 4M94A 4DR1F 3DDNA 4EZ9A 4WP9A 2X1BA 2ZNZA 4NA2A 4PQUA 3MPYA 1NPPA 1U8SA 2IM3A 4N56A 1RZMA 1B3TA 1FRHA 4LF8F 1S0OA 3ZO7A 4UQGA 2BJ3A 2V50A 1RCXB 4J5OA 3AQOA 3GYXB 5E3QA 4DHVA 4QWEA 1RA7A 3RYLA 4PWDB 3PTWA 2DYAA 2RUGA 2W4DA 3K5OA 5D77A 2KG1A 2CDQA 5FLXY 2ZH7A 2I9SA 2P2CB 3LO3A 1A7GE 3HVTB 3MM9B 1UVMA 4LMZA 4QIVA 5DDOC 2CVEA 2CG4A 2XULA 4ZP6A 5KFKA 1KVKA 1Y00A 4KV8B 5F9LA 1U1KA 1NK8A 1R6VA 1KTVA 1OPIA 5B0CA 4DSFA 3V81A 1LWEB 3IAM9 3MTJA 2C2DA 3QJPA 2NCKL 1V3SA 4PXCA 1NH7A 2YWKA 4K5RA 2VPZB 4P7TA 4Y2MA 3CMAS 2BXJA 3QT6A 4J9VA 1N0UA 1TL1B 1N56A 1BMQB 2OGUA 4RW8A 1M5PC 4ZLLA 4DPOA 2ZH2A 5JVHQ 4RBUA 4HHHA 2H1YA 3PR5B 3V6DB 3GG0A 4GVBB 3CCZA 4R8UA 1HWJA 3NLCA 4PAAA 4ZP8A 2R7UA 3KLFB 2ZJQQ 2Y8WA 3UI3A 2OELA 1GNKA 2KHDA 2WW4A 4WWSA 1FNOA 3CCVS 1KOOA 4PQAA 1VHIA 2BEFA 5CA5A 4YY3F 2G4BA 2VJUA 3N5FA 2OMLA 4KRWA 4LBHA 5DDPC 4FF3A 1NZ8A 4MH8A 4ZPCA 4EUVA 5IT9U 2VL1A 4DEZA 4RZRA 3PJXA 5FD1A 1WF0A 4JI1J 2QV6A 1S4EA 5D4OA 2IY5B 1WEXA 2ZJPQ 1PCAA 2R3VA 3NNAA 4JI8F 2FHOB 2YKNB 3NEKA 4YB1P 1DFDA 4IOCQ 4X64F 3ET6A 3AJ1A 2QYGA 1V3ZA 2MLYA 1QE1A 3M1VB 1KQFB 3G6XA 3MMCA 1JB0C 4UF4A 2B5JA 2JOQA 2VQEJ 2RD5C 1K1QA 2MQMA 3DRRB 3TYTA 4DLEA 3SYZA 2CPXA 3FRZA 4Z37A 2AX1A 2DY9A 2F8EX 2WBRA 2Y0BB 4H54A 2KDOA 1LWEA 4YY3J 3P45B 2EI5A 3M6XA 2ZH9A 3QRQA 4S0MA 1GMWA 2BABA 2HEKA 5DGAA 2DR8A 2JHEA 5BYRA 3R5GA 4ZCIA 4DR3J 3MM7A 1GH8A 3DLKB 4P2SA 4R0JA 4X4RA 1VQ5S 3MAAA 1GEHA 1MMLA 2FC8A 1Q78A 1YK9A 2I5JB 3CO9A 3VAKA 1KLMA 3CDUA 3I0SB 2K7JA 1NMEB 1S6OA 1MMDA 3QMQA 2Y1IA 2R8JA 2V2QA 3IS9B 2HHVA 3OD2A 3KK2B 1S1VA 1Y0HA 2PDAA 4M95A 3T9NA 1VLOA 8ATCB 4FXDA 1NUEA 3DM2B 2W2OP 3D7SB 5KFEA 4B3TF 1RWMB 2AJ1A 2OEKA 1E6VA 2ROEA 3QQCD 5ETLA 3QWPA 3GCXP 4DX8H 3G2XA 2QYCA 1H98A 2RS8A 2V69A 4OYMA 5DQIA 3OL8A 3TANA 2ZBCA 2A10A 1QE1B 3M1VA 1HNXJ 4LF4J 3Q8VA 2PA3A 4CO1A 4CYUA 1S10A 2BE2A 3K57A 3CMES 4O3QA 1IWGA 3CD7A 3D6HB 5KFZA 2W8KA 1YI2S 1JXVA 1WHWA 4ENOA 2CQ0A 1N48A 1BXNA 1L5UA 5A0YA 3LP0B 1S9EA 4TU8A 3J7Z5 1NHVA 5HMZA 3ICLA 5CZVA 1VRUB 2XLJA 4HTIA 3UQSA 2F3JA 3A4TA 3W8GA 7FD1A 4V19X 4B17A 1AFJA 2DO0A 2GX8A 1RT7A 2YX4A 2Y3YA 1RABB 2V2KA 3IRXA 5DDQC 4AL6A 5MAOA 3T5HA 4MYUA 2HGNA 2OHDA 3SFGA 2G1HA 1IBLF 2R7VA 1LWCA 1MWZA 2UVUA 4ELUA 4C8ZA 3US5A 5D15A 1FJGJ 1N5YB 2R7OA 4C7QA 1H7WA 4KGMA 4DR2J 4DLGA 1XMBA 1KHVA 3JTPA 4QWDA 4OZNA 1YRUA 3DMJA 3CCLS 2RRAA 1SL2A 4C2MA 2EFOA 5I3QA 4BLGA 1VISA 1WTFA 1MG7A 2FJDB 4JI7F 3S01A 2K8GA 1E6VB 4C9DA 4L76A 4XAKA 2GZOA 2Z8QA 3NCRA 4OIXA 2BE9B 2QLJB 1YBAA 3UN2A 5F8LA 1TP7A 1LOUA 4DOZA 1P6TA 3TZXA 4FS1A 5CAAA 2JEJA 2UU9J 3SQGB 5T41A 5J1PA 4OYBA 4ZLPA 4CYUB 3OT9A 1EHWA 1M0SA 1OQ6A 1T9YA 1JJ2R 1QAXA 3AD7C 5A2QY 1S9GA 1VS3A 1X4HA 1UA1A 1RXOB 2AJQA 3MMBB 4ANDA 2KG0A 1TFYA 3LP0A 1SKUB 4EWTA 2IVYA 2WOMB 3MEEA 4KHMA 3I6PA 1YJVA 2DNPA 5T7LB 4UTGA 2J7KA 3OQ2A 4JP8A 4OZ1A 2XSJB 4DR1J 1S1TB 3ZTPA 3N79A 2OJ3A 1WC1A 2VUGA 7AT1B 5GAEI 5F8IA 1C0TA 2EG2A 5KFQA 2KYXA 3R5JB 4PZVA 3I9ZA 4IH5A 1ZETA 1PKUA 3CTRA 3R27A 1VDHA 3K5LA 4DR3F 1N52B 3THVA 1O8BA 3WX4A 1KSPA 4FNIA 3TAQA 4K8RA 3J80Y 1VC0A 4NWBA 4NZ7A 4EO6A 5D0RA 3KJQB 4URQU 4WE1B 3V6JA 1KHWA 1TL5A 1B70B 4ES2A 4DR7J 1XR6A 1QM9A 1RT6A 2FD2A 4ZP9A 4KB7A 2YKAA 5FJ4A 3FGVA 2KZMA 3KLEB 1JNRB 4ZN3A 2RMLA 3B4DA 1TUVA 1VFJA 3W66A 2XC9A 4F0MA 1S49A 4M5MA 4RPFA 1T95A 3PHEA 3QT8A 4A8OA 4YR2A 2V4RA 4DV0F 3R1HA 2EC2A 2B9WA 2ATCB 2UVWA 2OPPB 4JV5F 3H25A 2MJNA 1TKXB 1JLAA 1YDLA 2Z30B 3HFZB 4QW9A 3IRWP 1RACB 1S9GB 2ZC4A 3ULHA 2WVCA 2V2ZA 3SQOP 5ETVA 2H5JB 1PSDA 1HNZJ 2E9ZA 4RU9A 3OR1B 2BX6A 3SCLE 3BDPA 1REVB 2FLOA 5DM7Q 3R7BB 5F8GA 1K9MT 1MW7A 3CJKB 2XTJP 1H7XA 2GFFA 3CJ2A 3TQ1A 4F8RA 4O4RA 4DWIA 2FJBB 1LWFB 3GE9A 1TK5A 3R5BA 4KC5A 4F7VA 3MI7X 4ZJOA 4Y28C 3K59A 3TUIC 3BJYA 3RR7A 3SV3A 3KJFB 2XZWA 3AB4B 3KKFA 4WE1A 2RDJA 2VHGA 3ZZPA 3T5JA 2VA3A 2AMCB 4B9VA 1NCLA 2IMWP 4JI5F 3IN5A 3BPDA 3C14A 5D0EA 4TLQA 2ATLA 4NMLA 1OIAA 2FB0A 4JB8B 3X3UA 1HLWA 5HQLA 1DQ8A 3BR9A 3HHNB 3MAQA 3NGRA 3R2CJ 1HNVB 1DARA 3LWLA 2CPYA 4ID5A 2VH7A 1TV6A 1Z1ZA 1DBDA 2E1CA 3Q86A 4UOGA 3ENQA 3GFZA 1L3KA 4PG5A 4UQTA 3RB4A 1MSWD 2HNYB 1J5OA 4CLLA 3UCGA 4DSEA 5KT3A 3CWJA 2KFYA 2WVEA 3EVOA 2NXCA 4FKXA 4DL4A 2D74B 4B9SA 4U96A 1VQYA 4LQ3A 3FBEA 3T1HJ 4QYZK 4H4MB 2R7XA 1RWOB 4DUYF 2DNGA 4QW8A 3V4MA 1WC6A 2DRBA 5C7PA 4USUA 1QVGR 2POKA 4YDXA 3RW7A 1XK8A 4CDIA 4M5KA 2NQPA 3GWCA 3Q24A 3RBEA 2CPIA 1SKWA 1N5TA 1RLDA 2ZHOA 4M1KA 4N5SA 2V94A 3QGHA 2J6SA 3KUHA 3VHQA 1R8HA 1X60A 4OYAA 5KFWA 2DJWA 1VOMA 4IFYA 5CHCB 1JLCA 2G1DA 3MEKA 2YKOA 3ZNJ1 4J9PA 2ASDA 1HNXF 3W61A 1X9WA 4ILMA 5HVFA 1FX4A 1FNXH 4FF1A 1KTQA 2BVZA 1R43A 2F63A 2QMUB 4WZMA 5L1JA 4C3MA 1T9VA 2EPIA 2GMLA 2B56A 2XYGB 3MPDA 1Q5VA 1S7HA 3H4DA 4NLGA 1N5VA 1AT1B 1S79A 1YVFA 2MYFA 5IM0B 2W7PA 3WHIA 1TTHB 3VV2B 1CJUB 4MMOA 2B51A 4CNZA 1UP1A 4LSLA 3RBXA 2JVOA 4KY3A 2ZJRQ 1NK5A 4K7QA 3HJVA 3Q22A 3PW0A 1SJFA 4X4TA 1VBYA 3K8WA 2KT3A 3AODA 5GAGI 3GJSB 2ZWOA 1NDLA 2JVRA 3PJWA 1EIYB 1RTIA 1UEKA 2CQCA 4MKBA 1GXUA 2WB1D 5C2CA 3MM6A 4URSA 3MR5A 3M7VA 3P49B 5IXUA 1U4BA 1L3UA 3SBMA 2V8GA 4X65J 4LSNA 3TRGA 3F44A 1B7FA 3OSPA 1LV5A 5B0DA 1WKLA 2YWFA 5K8MA 4IQXA 3T1AA 2CZ9A 3CE8A 1N36J 1IKYB 3JQJA 3QJJA 1ULRA 1F5CA 3M8ZA 1URNA 4DQRA 1VC5A 4JI2J 3A8EA 2FUG9 4WP8A 1MNEA 4NI2B 4NLUA 2VONA 4TN2A 1XMQF 4P2MA 2VBZA 4DV7J 1JJ4A 1WUUA 3D54A 5SUHA 4A8XA 1JLFA 2AJ4A 2UUTA 3KNGA 4WIIA 2JEIA 1HD1A 1RWPB 3OVAA 3HF5A 3PEJA 1IN0A 1TR0A 2XMTA 2ZWPA 4DFJA 4ZPDA 5DQGA 1XJWB 5B0FA 4QOTA 4PYDA 2CNNB 2EXUA 2VF3A 4ECQA 4JI3J 4Y00A 1FJEB 3S7RA 3D6TB 2HQDA 2KVQE 2PD1A 2KRRA 2CPDA 3EMTA 3H8YA 4ITSA 2ALZA 2RHQB 3A3OB 3CB4A 4OYPA 1DLOA 4LSLB 4B9NA 2IM1A 4NRTA 5AXLA 4F4KA 4EYHB 3MMJA 5G0RB 5A8KB 2EBGA 2HPUA 2AT1B 3BEGB 2ZKTA 1O0PA 4DV4F 1X5OA 4ZCLA 2VBXA 1IBMF 2FLNA 1G3OA 2IC3B 2XZDB 2NPFA 4EEYA 5H9FK 1I94J 3Q8QB 2IM0A 3C16B 1VCTA 1QDUB 4LSNB 4RWXA 2DNOA 2V8VA 3R6LB 4C0HA 3BGRB 5M2UA 1N6QA 4QU6A 3F0NA 2LDIA 2AZ1A 4X64J 1EX8A 3KFWX 4BHQA 2R2TA 4L75A 4FYYB 4TNOA 5CH7B 3CW2C 4ZLJA 4CTAB 3V6KA 3PW2A 2E66A 3MM8B 4JYAF 3C8YA 2RKIB 4C98A 1IBLJ 4HEA9 1HBOA 3R5CA 3WZ0A 4DV4J 1B0TA 1Y5IB 1JLFB 4ECRA 4W92B 2H9ZA 1XTZA 3VGVA 5I42B 2JLGA 2DHHA 3JAMU 2JJ4D 4IR1A 1U1LA 4ZN1A 1A9NB 2C2ZB 3BPSP 4DL3A 2CJBA 1DTQB 5IV3A 1TUGB 2F5GA 2G2OA 3MAHA 2IDEA 2ZM6F 1DJ0A 3HULA 3QGIA 4NX9A 2R9LA 1NK7A 2OPQA 1JLQA 2DNRA 2WVFA 1M1GA 1R27B 5J2NA 4QYRA 5CYMB 4DFMA 5L8RC 5HANA 4A8SA 2SXLA 4USIA 3ELHA 4OZ3A 4GKKJ 1Q95G 4RR5A 2HK3A 4JBCA 6FDRA 2JEGA 4K4VA 1N6QB 1YRTA 4NLDA 2C2NA 1LK5A 4YDDB 3BDEA 3FMWA 2QC3A 2HFOA 2OI2A 3FBCA 1PGZA 4EZ6A 1UVLA 2KFZA 2BACA 1YHQS 2WVDA 2ZKUA 3R5DA 1HBUB 2AYEA 3HHLB 5EWEA 1G7CB 5LMUJ 1EARA 3VZIA 2NZ4A 2COLA 3DI6A 3VR1A 4DL5A 2IIHA 3B6BA 2F1FA 3VALA 4DSLA 4QQBA 2B4UA 4RNMA 3MMCB 4KKOB 1TL3A 2B5JB 3O5TB 2ZUGA 3DRSA 4PXDA 5AT1B 5CCLA 5L1IA 1CS4A 3O2IA 3NGDA 1S0VA 4DCJB 1FDNA 3OHAA 3HM9A 4O0NA 4QIWD 3A3PB 2DITA 3IG1B 4UZBA 2AYGA 1RT4B 2PT0A 3DN9A 1Q86T 2VASA 3KLGB 2K3KA 3CGIA 3HO1A 2MZTA 3FZ2A 2KH9A 3FSIA 5KTQA 2NXUA 4F2RA 2XLKA 3CCJS 4IDKA 3DOMA 4U7UK 1KWMA 2Q43A 2BJEA 3C46A 2A2CA 5DM6Q 2C42A 2OEJA 2GNKA 2VDIA 1NB2A 2YNHB 3NOGA 4NA1A 4Y65A 3M8YA 2QT7A 4CH0S 4PG8A 4I6AA 1KQSR 4B3OA 5KFTA 2J9DE 3KLVA 3CVKA 2KO1A 5F8JA 2KHCA 2YBVA 3O6QA 3IS9A 3BBCA 5D0HA 3W2VB 4OHXA 4C6AA 3NNHA 2M4MA 1LW0B 2QZ8A 2UU9F 1RTHA 5GMEA 5M2RA 5D4PA 4DV6J 4RBTA 2A6MA 3RZAA 2WTFA 4I2QB 2D69A 2CNLB 1HL6A 4KGVB 3LF0A 4WK1A 2J5AA 5A8RA 1TL1A 4C0BA 2B6AA 1CSJA 3TARA 3E8OA 1HWLA 4RNNA 5G4DA 3E3XA 3KHLA 5F41A 2HMIA 2DNYA 4U7UD 3MMAB 4PABA 5HI7A 3AHPA 4J7CA 3M2VA 3R3TA 2VQFF 2OKQA 1N8RT 2C3PA 4YB7A 3AA9A 2Z58B 1YZ6A 4QCLA 3K8VA 2BE2B 2Q6BA 4LBIA 5AXMA 1CS4B 3QFHA 4J9KA 2BBEA 2KM8C 4BWJA 2DNKA 2R42A 3C15A 5J1EA 5L1KA 4ED7A 2B0GA 5HP1B 2DNNA 3DXBA 2DH7A 3BR8A 4ZVRB 4DN0A 5ETOA 4EBDA 1OSCA 2VV5A 4P71A 2F8HA 4B3MF 2GJIA 2JFKA 3Q0AA 1SJ4P 1T8EA 4OJHA 1UVNA 3BF4A 1Q8KA 4QR0A 3VAHA 1A0OB 4NLXA 4OI4A 1LWCB 3H4BA 1U45A 3BN7A 4X62J 3UD5A 2ZVSA 4ILRA 3CXCR 4KHRA 2YVSA 1AZSA 3UR3C 1XMQJ 2XO6A 4B08A 3TWZA 2VPXB 4F3QA 3JYTA 5D4LA 4DV0J 3WIUA 3NGUA 2VKZG 1Q53A 1RTHB 1S6QB 2XY7A 4YR0A 2UUBJ 4OQJA 2M0GB 2JRSA 2C28A 2R7RA 4ZDNA 4HI2A 5H1SV 3CULA 1RDRA 2NPIA 1YJTA 3IBFB 3MECA 1VYAA 4USTA 3G71S 2HMIB 5JUMA 3BSNA 2BQUA 4F3OA 5C42A 1FRIA 2I5JA 4DCPB 5GAGU 4AL7A 3ZXWA 1VHFA 1IKWA 3EVMA 5EX3A 2BUNA 3TOQA 3JXOA 3U27A 4RUHA 4QU7A 2HW3A 4TY8A 1QSYA 3W9HA 3B54A 3N28A 1RU1A 4CM0A 4R5PB 4PG4A 2MY8A 2YNGA 3D4JA 1UJ4A 1U6FA 5KG3A 5D3GB 1I94F 1YJ9S 2GAHC 3EXYA 2D1CA 2EFPA 3EE3A 2FY1A 5HJXA 2AWZA 2LXIA 1SC6A 2XSJA 3HJFA 4Q0BA 4F4YA 2AGPA 1I5OB 1XBWA 2AJ0A 2RF2B 1R0AA 1U2RA 4RW9B 2QL7B 2B3TB 2QSWA 3K17A 5IZHA 4NE9C 3JSMB 2RDIA 2CJQA 2EG1A 3NOCA 3HPOA 2WK4A 3KMQA 1SH3A 3G8QA 5CCMA 1NLKL 2A0FB 1HNIB 2A2DA 3HHKA 1QTNB 2FLLA 5LSLA 3QRPA 1ITPA 2X1FA 2XWXA 2C2OB 3CD0A 1C2PA 4NZ6A 1M5HA 1ZOTA 2Q6CA 1GXLA 4OZ2A 1S9EB 4RNFA 5AXNA 3KK3A 4X4SA 2F4VJ 1Y9OA 4OYWA 3DOLB 4LFCF 2VB6A 3L7PA 3T6BA 1ZS6A 2Z2LA 3P8BB 1FRJA 2LQ8A 1D9DA 2DHGA 4P2XA 3H2UB 3AJ2A 2AGOA 2U1AA 3GSIA 2MKCA 2AU0A 2LYVA 5KG1A 1HYSB 4TYAA 2Z56B 3Q8YA 3JQKA 2ZM6J 5EN1A 2EK1A 4HLBA 3T1YF 2UVVA 4PWUA 5KG2A 4TU9A 1TKZB 2OH2A 4B9LA 3UD4P 2IBOA 3ILOA 1X8DA 4MIBA 3MEGA 3QO9B 2DNZA 3ISZA 3W63A 2C3MA 2E5LJ 2M88A 1CVJA 3Q8UA 2RU3A 1U09A 4KHPF 3ZZTA 3QGPA 3PJ9A 3ZC4A 4FKYA 3HZGA 4J9UE 4BC9A 2HIQA 1HBMA 2RF2A 2ZBQA 3IO1A 3SXLA 4DPWA 2DNHA 3P96A 4RW9A 5BR8J 1O5JA 3R9LA 2Z57B 3MWBA 3U1NA 1UPPA 4KT0C 4IKAA 3G82A 4M63A 5F3ZA 3B82A 5HLFA 4N41A 4PUOA 3J7A1 3KLHB 3RAMA 2KTQA 4QIFA 4TQRA 1UW4A 4F3MA 4U6PA 3QJLA 2XGQA 2VOPA 2HQFA 1Y4ZB 2K7KA 1WC3A 1UFKA 3D28A 1D9AA 2WOMA 1XN9A 1SXLA 1JWWA 2FJWA 2CPFA 1U1QA 3MXHP 4IO9Q 2XY6A 2F9JA 4KH1B 1TKTB 5KG6A 4AE5A 4Q44A 4K0KJ 3PYEA 4F36A 3IWLA 1B4SA 3Q2SC 3SDEB 2N7CA 1C0TB 2CJXB 1NRKA 4MK7A 4P75A 4GKKF 4OX9F 1IBKF 1YJ7A 3ITHA 1EB0A 1TV6B 3GSDA 1YBTA 1VR6A 2OUGA 5E3PA 1R8AA 3OL6A 2VFRA 3WIVA 3KHHA 3VGSA 1S6UA 3U1MA 5IC4B 4AYBD 3VGUA 2QX0A 2A6OA 1OYDA 5LMUF 2GVZA 3GPAA 4UY85 2VODA 4CLFA 1HMVA 4RBVA 4BS2A 1TELA 2N7YA 5KFPA 3JSBA 4LVOP 3NNCA 4HDGA 4ETXA 3RAXA 3J7YI 5LMNF 5D8HB 2ERRA 1CLFA 1HQEB 1NHKL 3TJ9A 3H90A 3OXLA 2BJ9A 3UR0A 2CJKA 1KBRA 1JLCB 4DZ6A 1AROP 4ECUA 3N6NA 3UDCA 4KGXB 2KJWA 3LGMA 4DV3F 2D9OA 1LXJA 2JDJA 1S1UB 1TL7B 1WELA 1YG0A 3LAMA 2RSQA 2WSCC 4OX6A 1AYEA 1Y5LB 1LK7A 2J7UA 2QIFA 3DMJB 2ZITA 3EGVA 4YEAA 3TEHB 3DOKA 1I6JA 4ZIVA 4PPZA 4LIWA 3GU0A 5FIIA 1PBAA 5F0UA 1P27B 3OLAA 3CPWR 1D8YA 1NDKA 2CQ2A 2G13A 2ZFHA 4FPIA 3SSQA 2KFNA 1MROA 3CEDA 5KG4A 4NLRA 1JLGB 3MM5B 4CI0B 1TQLA 3EGWB 3M32A 5HROA 1YJNS 5IT9Y 3TA2A 4O23A 1PAUB 2NYHA 2VG5B 1PJ6A 2UUCJ 3L95X 1JKHB 1HW8A 3E51A 3OJSA 1WG5A 4DV3J 3LW5C 5DJBA 2WONB 3DLEB 1JLBB 3GFHA 1C1BA 4GC6A 4CLWA 1X4AA 4M5DB 3PEHA 2H54B 1HMVB 1B7YB 3BSAA 1RTJA 4R25A 1NPRA 2MZJA 4XK8C 1NZAA 5I3PA 3KDOA 1U1RA 1U8WA 1S1TA 5KFDA 2ZZMA 2W25A 3ZTOA 1AUDA 2RQMA 1HQEA 3NMAA 2M5YA 1U6BA 4MFBA 4LFBJ 1FKPB 5K14A 2AX0A 4TXSA 3THPA 3MEDA 4K59A 3QWUA 2ZBIA 5L9NA 1U6ZA 2L9WA 3KG1A 2JL9A 4USJC 3I87A 4B9TA 5J2PA 2KJVA 3OXFA 1F2GA 2CQPA 3I96A 4ZPVR 1VQ8S 3L7UA 2W24A 2HWIA 3QYYA 5FLXU 1FNMA 3KLIB 4KFBB 5FDLA 1MROB 3A1YG 3ILIA 2R2UA 1G1XA 1B0VA 4P9SA 3THTA 4DBQA 2X1AA 2ZNYA 4AQYF 4ED5A 4HHUA 2I8EA 1PAEX 5LXYA 3MPUB 1NO8A 2AZ3A 1JLAB 5B0GA 3IGNA 2KXFA 4OYIA 5F8HA 1SJRA 2MSSA 1MN9A 4ZOSA 5KG0A 3DYAB 2HK2A 1KD1T 3LGHA 1Y5NB 2GIRA 1W7WA 2XGPA 1CJUA 2HG4A 4EBCA 3OFGA 2RIJA 3GFXA 5J2MB 3VAFA 5ETRA 4RX6A 2BOAA 2P8IA 3NY0A 4FXVA 1NEEA 1UVIA 5E41A 4ZPTR 5KT6A 5F0WA 3GONA 4U95A 4JV2A 4NYZA 3G8SA 4NZ0A 2LEAA 3Q83A 2V6AA 5I42A 1RP5A 3E01B 3LQVA 5D0GA 3UFCX 2XO7A 3MFIA 5AJ3F 2J9EA 2B4OA 3PM9A 4RJVA 1UZDA 1T9TA 2K06A 4KGKA 5J2PB 2ZH3A 3PW7A 2E5LF 3NS7B 4DL2A 3C2PA 4J9LA 4LF9J 2IYIA 4WK3A 4NXNJ 2H65B 2OLWA 1W2IA 4PWDA 5KT4A 1T9XA 3CIZA 1C1CA 1H2VZ 1APSA 5J2NB 1NBEB 2H5IB 3DRPB 3T3FA 1QSSA 1ZTWA 2QTWA 2OD6A 1YKWA 3AOCA 3MPVA 4G1PA 3UN5A 5KOWA 1M1HA 1HD0A 3SSRA 4DR6J 2KI2A 3OFFA 2G2ZA 2ASJA 5JJBA 4DXLA 3TVKA 4F2SA 4PEOA 1UFWA 4RW7B 2DKOB 1RADB 4M5NA 2IBKA 3G87A 4YP3A 2K3IA 3DLGA 1DLOB 3UDEA 4OJ1A 1FT8A 4WFBQ 1UW9A 4P73A 2QFJA 5HMYA 2FLPA 2HBYB 1QUPA 3QIDA 1X4EA 2MHNA 5A8WA 2GVDA 4L73A 3W2WB 4L3KA 4M5IA 4GVBA 5KFLA 4IYQA 2CZVC 4DPXA 4TQSA 5CYJA 2Y8YA 2RU9A 1NSQA 1F2HA 1X4DA 4B3TJ 3M2RB 5HBMB 1P9QC 1TL3B 4OI2A 1BC6A 2FHJA 4OI3A 2P9GA 4ERDA 1WI6A 5LJ5Y 3CDWA 2QLWA 2AP6A 1VK8A 2W2MP 3P5TL 3G4SS 4ECSA 4JI6F 2RRNA 1F5BA 3SZ2A 2EFVA 6FD1A 2LKZA 4PWWA 5IT4A 4DR4J 2CADA 1YJUA 2M52A 2YKNA 4XIUA 2DEJA 2IM2A 4EFAC 3AD9C 4EGLA 3OUYA 1KP6A 3ET6B 2K1RB 4U8YA 4ZVHA 3TZWA 2V4QA 1RYRA 1SQEA 2HLTA 3R5AA 2EK6A 4B3SJ 4B3OB 3CJ5A 3CUNA 4UUXA 4HT7A 2M70A 1CPZA 1FJCA 3L4BC 4X4NA 5CYQB 2A1BA 5KFHA 2IJNA 4WF9Q 1EETB 1CULA 1N54B 3HZEA 4C3KA 1FRXA 1RT3A 4NLYA 2KXHA 3DLGB 2QE5A 5E7OB 5KFYA 1ZAVA 4E98A 1JLQB 4C8NA 1BLUA 1EAYC 3NBPB 5KFMA 2A18A 4WCEQ 1TU0B 1IQZA 3PNIA 3UWTA 5C25B 2XLIA 2IHR1 1U2FA 4X65F 5J2QA 2CWXA 3RR8A 1V6HA 2HRTA 2HZVA 2XCPA 4K4SA 3GR1A 2ZE2A 3AQPA 2W7OA 4CLSA 4AL5A 3K5NA 5D78A 5IOLA 4OZLA 4DJBA 3HVRA 1HWUA 4Y2KA 4ZCKA 1Q16B 2FZGB 1R0AB 2DT9A 5J1NA 5C5JA 4DFKA 2V8HA 4O44B 1G6BA 3NGTA 3IMQJ 1HR0J 4YB6A 3M8QB 3AY0A 4J9NA 5I4MA 1BUXA 2WW8A 2YKQA 3V2UC 4CP5A 3D66A 2M7SA 2XMUA 5B0AA 1VQMS 2D3O1 4OFZA 4PXEA 1BWEA 4L74A 3D1QA 1UMJA 4USHA 5JXSA 3FSYA 4XDCA 4DR5F 1YSJA 3B78A 3VCDA 1D3WA 4DZDA 2QA4G 4C8MA 4BC7A 1FD8A 2DBBA 3JTNA 4Y2CA 3VAGA 4DQQA 1HA1A 1T0TV 1U1PA 2HVEA 4DV7F 1ZH5A 3K2YA 1WC4A 1CJVA 3FNNA 1FK9B 3HSJA 2XEXA 5B0EA 3U02A 2IAJB 3TX0A 4ED0A 2CG8A 3KLFA 3AAWB 4DN9A 2VG6A 3M8WA 4JI1F 2K2PA 2Y1LB 3H7HB 3PW5A 1T05B 1N88A 2BANB 2V8DA 3GV8B 3NL0A 4DUTA 4EBEA 3TZZA 4HKQA 2BKNA 3RRKA 4C8YA 4W90B 2WRMA 3CO0P 2H3EB 2QO3A 3IBWA 2E7VA 4TKTA 1S0NA 1FJ7A 2ZE2B 3CJ0A 1WHYA 3I31A 3R6GB 2LU2A 4NPOA 2BOPA 1QTMA 2M8DB 2YX7A 4M5JA 1FDDA 3GQCA 5CZXA 2LXUA 2PE8A 4Q7AA 3TP2A 1IBMJ 1O51A 2VBYA 2Q1LA 2FVRA 2XS7A 4PRFA 2Y0SD 1FI4A 1UJ5A 3CT9A 3DDIA 4KH0B 3T41A 4F26A 4V19J 1UFLA 4FP9A 1XR7A 4IUFA 1FFGB 3JS9A 3WC2A 1CJKB 3BGFA 4PQUB 5E2QA 3FUYA 2CQIA
chains in the Genus database with same CATH topology
5LL6d 1C4CA 2OPQB 3M6UA 3IA0A 1K0VA 3FVYA 1TK8A 3CCUS 1NJIT 2XMVA 1L3TA 4LF6F 2WCXA 5IFMA 3IR6B 3C6TA 1S99A 3HLUA 3N0VA 5KFXA 2EWHA 2QSFA 1NNDA 3FEYB 1RKJA 2DPIA 2PIIA 2LDYA 2DIVA 3CC4S 2BRKA 4IQMA 4ELTA 3HVWA 4C97A 2BANA 4ZP7A 4XPCA 2JLFA 1ZAXA 2DR5A 1M5SA 5EWGA 5DLFA 3JSYA 3G9CA 3BM7A 3KTQA 5I3UB 4PCQA 1HNWF 3PXGa 4MKAA 2M3DA 3D0IE 2PSZA 3GILA 3H40A 4A8KA 2VBWA 2XI3A 4WF9Q 1RT5B 2FJEB 2XBPA 3G96A 4GO5X 3FQLA 2EKYA 2FJAB 1KONA 2KRBA 2DGTA 3M4XA 5D4NA 5B7WA 2D3UA 1FTRA 4KPYA 2D7SA 3NP5A 3JAMY 3CCMS 3MECB 4B02A 1VQ7S 2KN4A 5E0OA 3OVBA 4HH0A 3KJVB 1ZTTA 5HO4A 2NR0A 1R8BA 4R0EA 4K4WA 1Q7YT 1IKWB 3VAJA 1UVJA 3EGZA 3RU0A 1JXEA 2I38A 4ES3A 2KXNB 2DCLA 4OLPA 4C11A 4RWWA 1ZZFA 2HGMA 3HHDA 2RB7A 1Q4RA 2FHJD 4IOAQ 5D3GA 2V0NA 1REVA 1EP4B 1X7VA 1TKTA 4E8UA 1SV5A 4FXWA 2MKIA 1IJFB 2FVQA 2BQRA 2UUCF 2R8GA 4NCAA 2C3UA 3ITHB 1VQPS 3TVYA 5I3UA 3DLKA 2CJAA 2BYCA 2VPWB 2ABYA 2MY7A 3BGLA 2MKHA 2HNDB 3HKWA 3MF5A 2HRYA 3M2VB 1MU2B 4KBIA 1F5AA 2ZH5A 2L9DA 3KNAA 4TYBA 2VQEF 1KVJA 1ZM2A 5KG7A 2LQ5A 2OPRA 1UA0A 1DZ5A 4DQSA 2ZH1A 3BQ2A 4ECZA 2DGWA 1HPZA 1P1TA 5J1EB 1NJYA 1C0UB 1UWBA 2MKSA 4WFYA 2P9EA 1D9FA 2EC0A 3PACA 3TA0A 1VQSA 3PZPA 2P6TA 2YQ3A 3QIPA 2V9WA 1TKZA 3EGNA 1IUJA 1KS2A 2HWTA 3MFHA 5KFGA 4JV0A 4YB5A 1VQ9S 3GIIA 5IQ6A 1Q81T 5DG8A 4IG0B 3GV5B 2NUUG 3J81Y 2F9DA 5ITHA 3CD5A 4HVZA 4XPEA 3JYTB 2LEPA 1HBMB 2M9KA 2OPSB 3M30A 3OFHA 4EO8A 2N4CA 5SZTA 2EBEA 4ECYA 4ICLB 4IO1A 2PO4A 3KLEA 1KLNA 1CQNA 1RT2A 4LVNP 4CZCA 1X0FA 1BD6A 3UNGC 2ZOFA 3VTIA 3N4WA 1DTTA 2V4JA 3OTBA 2XMMA 2MJUA 4I2PB 3F73A 1S77D 2DISA 3ONQA 4LF4F 1RGVA 5A6PA 5KG5A 3CC2S 1FD2A 2XNRA 3WC0A 3OW2R 3D5MA 2PI4A 2KM8B 2C3YA 1NAQA 2Y1JA 2LLZA 2WONA 1SJ3P 3U1LA 4YOEA 3RB6A 4ECXA 1JLEB 5K5MA 3HXMA 3EPGA 2FVSA 1N0VC 2BM0A 4X84A 1H3DA 5E3AA 2KZZA 3OBIA 4X4VA 3ZFVA 4KSEB 3BREA 2PMHA 3EYZA 2AW0A 2B9YA 1K1SA 2EFGA 3V6HA 1VIXA 4OZJA 3H5XA 2EFQA 2C2RA 3L09A 1X9SA 5B09A 4NLVA 2BR0A 3VQTA 2OTLS 1Z2LA 2GHVC 2DNMA 2YKMB 1DURA 1FXRA 4NRUA 2VC0A 3T6JA 3FFIB 3CDBA 5T7LA 1NKBA 4FZVA 2MB0B 1LWFA 3WDOA 2J0QD 4JOUA 3TI0A 2ZD1B 2D9PA 4WJBA 5K8OA 1NB7A 4XO0A 4NCBA 5BR8F 3LP2A 1FF2A 2QLXA 3PRBA 4ECVA 2YWEA 1Y7PA 3C66A 2OD4A 2JLEA 2CQHA 3PKYA 3LP1B 2O67A 2ZZNA 1VLYA 4B3RF 2LECA 3DYAA 3MGJA 3OHBA 3DHWC 2E7XA 4ED8A 1VQOS 2CPEA 2HGLA 3PVXA 4X4UA 4LF5F 1F0XA 2FHMA 2OSQA 1JXLA 5J2MA 2HHTA 3M9OB 3GIKA 2L3MA 5DETA 4OJ3A 5LJ3Y 3I0RB 4L3NA 1AFIA 4NYPA 1FESA 2IA0A 2W4PA 4BHQA 2O66A 3VAIA 2VG5A 4K4XA 1RWUA 4URGA 4I0WA 4YMEA 2LVWA 2YNIA 4H4MA 4CH1A 5IQQA 4H4KA 2R2RA 2P6SA 3M2UB 4FPRA 3HDSA 3QZ8A 2CJ9A 1ZYQA 2DGVA 5AE3A 2ZD1A 3RRHA 1R31A 2HHSA 3SDEA 2MZ1A 1S1XB 4ED3A 1KEKA 2UUBF 4JV1A 2E44A 4X66F 4GC7A 3SSSA 3MEDB 1S1WB 1T02A 2R8HA 2B9XA 2E29A 3DRXA 1DTQA 2QA1A 1BQNB 2IVMA 1R8PA 2FHKA 1WF2A 1GT8A 1DAXA 4OI6A 2LQBA 4DR4F 5KT2A 4NLWA 3HHLC 4K4UA 1PC4A 4ID5B 3M9NB 1S97A 4Y34A 5E33A 3ZZOA 1QLNA 4BCAA 3BO3A 1HI1A 5L38A 4FN5A 3EPIA 5F8NA 3P3DA 2ZH6A 4J9OA 4A4JA 4QWAA 2UV8A 2VPYB 1T3OA 1X4FA 2YWGA 4ILLA 3FCHA 3JTOA 3CCRS 1RTDA 2DO4A 4GMKA 1FTCA 2GC8A 2NYIA 3KG4A 2CQ1A 2BM1A 1I1GA 5JVGQ 1B64A 4MIAA 3TX8A 4ED1A 4N77A 3FZBA 4LQ9A 4KV8A 2EW9A 4WKRA 1MMNA 5IT0A 4I7FA 5IS2A 2HFNA 4N8OA 3HP6A 3Q23A 2R7SA 2XNQA 2O01C 4DG1A 1Q8IA 2Q3PA 4ZHRA 2XSFA 4I64A 5KOXA 4RW8B 2W9CA 5G0RA 3W7BA 3F56A 5A8KA 2UVRA 4M5DA 4DF8A 3MUVP 4J9MA 3OR2A 4G1QA 3KWMA 1FE0A 4NCGA 4YFUA 4ES1A 4DV2F 2HLUA 3LPYA 1ZZNA 1VI7A 4C4WA 3MD3A 3TAMB 2GHPA 2UV8G 4WTYA 2CVIA 5BYSA 3FQKA 4KO0B 2DR7A 3PFEA 1FDBA 3M8PB 1IKVA 1L3VA 3SCJE 4RKUC 3HT3A 3PDNA 4IFVA 3FRYA 4AUKA 4K4TA 4Q0BB 1HI8A 1K8AT 1Q8LA 3IFEA 1WEYA 3N6MA 2D41A 4I7FB 2DH9A 5EWFA 4A48A 4WXOA 3D0GE 1S9FA 3N01A 5KFIA 4ALZA 3C6UB 3FJ2A 4ELVA 3DHXA 2LQJA 2JFDA 1UVKA 2W9CB 3MM7B 3PR4A 3EXCX 2N3OA 2QA2A 2F4VF 1OPZA 3BN4A 3DNCA 4WU2A 2ROPA 4ED6A 3TA1A 4ZVGA 2CIMA 2E5JA 1S1VB 4QBUA 2DGUA 2OAUA 2HHQA 2MZRA 4M8LA 4P7VA 3V5RA 4TY9A 2GQ2A 4QZVB 5AXKA 3KMSA 1RAJA 4J9RA 4KO0A 3NBPA 2CQ4A 4A8YA 2W4CA 4RW6B 1RT1A 2J9DA 3IG1A 5GAHI 4K2XA 4R8UB 3MM8A 4IFVB 3M8SA 1L3SA 3RB3A 1XEZA 3DRSB 3LAKA 4CO4A 2W9AA 2MDAA 3C6TB 3OXGA 3DRPA 3QAEA 2AQ4A 5KT5A 3IAS9 4K4YA 1FKAF 5A0YB 4CT9A 2EVZA 3KK1A 4WU3A 2DHSA 1Q82T 3CJ3A 3ZZRA 3HHEA 1PC5A 1GXTA 5GADU 1R7IA 2L08A 1FE4A 4NXNF 3DLBA 1X4CA 2UP1A 1IKXB 2JX2A 3W2VA 5B08A 3CDEA 2QA4S 3CC7S 3SFUA 1RQ0A 2OFGX 2DNQA 2Z2MA 4MYTA 5MLCV 2DH8A 4IH7A 4WFNQ 4WFZA 1FA0A 3LWMA 4FNHA 3DRYA 2Q79A 4EYIB 5L39A 5HP1A 5T14A 4F25A 4LFBF 5EUHA 3HHLA 4IG3B 3G6YA 1H38A 1TAQA 2E5IA 5LXRA 4Q43A 4ED2A 2ZHAA 4O3RA 3KK2A 3P6YC 2K1RA 1CG2A 3QO9A 2X3GA 1X0PA 1VRTA 4U7CA 4DR7F 3MEEB 5BYQA 4WKYA 3GYNA 4I56A 1X4GA 4FS2A 1M5OC 3PO4A 3MOJB 3OJUA 4OX8A 3CCSS 2MSTA 2WB4A 2FJVA 1X9MA 4ZPBA 4NLQA 4QPXA 3KLGA 4DV5F 1HR0F 1NJZA 1HWKA 3FEXB 3OLBA 2BDPA 5KFVA 2HNDA 4H4KC 2VFVA 4OHWA 2DK2A 4CO3A 1MU2A 2W7AA 5BJRA