4QUNA

Crystal structure of the ptpn3 (ptph1) catalytic domain c842s mutant
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
283
structure length
283
Chain Sequence
NADTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGLAITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMNHGGFHIQCQSEDCTIAYVSREMLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDSEPVLVHSSAGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reciprocal allosteric regulation of p38 gamma and PTPN3 involves a PDZ domain-modulated complex formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Tyrosine-protein phosphatase non-receptor type 3
total genus 98
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00102 Y_phosphatase Protein-tyrosine phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 4qunA00
4BPCA 1Q6NA 4D3PA 5LXQB 4OHDA 1OESA 2PBNA 3MMJA 2HNQA 1U26A 1ZZWA 2HC1A 1MKPA 2R0BA 4Z6BA 4TVVA 2B4SA 1YTNA 3V0JA 4R0TA 1XRIA 1I9SA 1ECVA 1V3AA 2GP0A 4H1OA 2CMCA 1YWFA 2F6YA 3QCCA 1FPZA 4QAHA 4HJQA 2I3RA 5K22A 3AWEA 2CNGA 2F46A 1T48A 2QBPA 4GRZA 3GXHA 1G1GA 3O4TA 2VEVA 4YR8B 4IKCA 4KYRA 1YZ4A 2B4UA 3SMEA 4H34A 2I6MA 1G7FA 2I42A 1GFYA 4ZN5A 2CNEA 1ONZA 3BLTA 2IMGA 1PTTA 3RGQA 1NNYA 2CM2A 2QDMA 1YGRA 3QCMA 5KA2A 2NLKA 1X24A 3F41A 5IBSA 1C83A 4NX8A 3QCFA 2F71A 2ZN7A 3QCNA 3RGOA 1LARA 2G59A 2F6TA 2VEXA 4ICZA 1C85A 2BGEA 4GRYA 3S3EA 4RH5A 5KA1A 3I36A 1OHCA 3D42A 4PYHA 1YFOA 2P6XA 1C87A 3AWFA 1BZHA 3V0GA 1LQFA 2FJMA 3CWEA 1Q6SA 2B3OA 1RXDA 4QUMA 2Q47A 1XXVA 3OMHA 5M43A 3D1HA 4WU2A 4ERCA 1WRMA 2J16B 2CFVA 1OHDA 3S3FA 1RPMA 1SUGA 4HRFA 3ZM3A 3MOZA 3N0AA 1NL9A 2F6FA 4JMKA 3F99A 4OHHA 4QAPA 2I5XA 5BZXA 2HNPA 3S3KA 5BX1A 3I7ZA 1XXPA 2HCMA 1T4JA 1FPRA 4GE5A 4R0SA 4BJOA 3S4EA 3D44A 1EEOA 4RI5A 2H4GA 2I6OA 5GTJA 2CM3A 5EHRA 1PYNA 3O5XA 4D3QA 2HB1A 2HY3A 3D1QA 5K24A 2QBRA 2A3KA 2I6PA 4D3RA 3RZ2A 5KACA 1I57A 2B49A 3QCLA 4KYQA 1AAXA 3QCGA 1T49A 2BGDA 2C46A 2YDUA 2CM8A 2CJZA 3GXGA 1LYVA 2AZRA 3ZV2A 1PH0A 2F70A 2MBCA 1ZC0A 2I4EA 1YGUA 3QCDA 5BZZA 1Q6PA 3D1OA 2F6WA 2ESBA 2BZLA 1NWEA 3I80A 2VEUA 3A5KA 3H2XA 2QBSA 1G4US 4WOHA 4OHEA 1J4XA 1L8KA 1VHRA 1EENA 2OUDA 2I4GA 4YAAA 3ZM2A 1OEVA 4JNBA 1OEOX 1YN9A 2ZMMA 4WU3A 2OOQA 3QCEA 4DGXA 1Q6MA 1G1HA 2QDPA 2I4HA 1ZCKA 1U24A 1C86A 3CM3A 2NT2A 1BZCA 1YTWA 3O4UA 1R6HA 1JLNA 2PQ5A 1P15A 1OHEA 3AWGA 1G4WR 4GWFA 5IBMA 1PTVA 1WCHA 4AZ1A 3SR9A 2C7SA 1YPTA 2P4DA 4OHLA 2VEYA 1ZCLA 4J51A 2H02A 3QKQA 4ZI4A 2I1YA 1YTSA 4GFVA 3OLRA 4GS0A 2CMBA 3EMUA 3F9AA 3QCHA 5KA3A 3U96A 3O3LA 2QBQA 1WAXA 1PTYA 2F6VA 3F81A 2BV5A 1OETA 2GWOA 2QCTA 2OZ5A 2PA5A 4QBWA 4NYHA 5MMZB 4S0GA 4KI9A 1PA9A 2Y96A 3O4SA 2JJDA 1PTUA 3S3HA 2J16A 4ZRTA 3V0DA 1BZJA 2B4PA 2B07A 5K25A 2G6ZA 2FH7A 2H4KA 5K23A 1Q1MA 3QCKA 3EZZA 2F6ZA 4GE6A 3MOWA 2PI7A 5I6VA 1NZ7A 5K9WA 1JF7A 4QUNA 2BIJA 3PS5A 3EU0A 4QBEA 5EHPA 3V0EA 1D5RA 3QCIA 5BUGA 3LJ8A 4RH9A 2J17A 2RF6A 2AHSA 1KAKA 2H4VA 4MBBA 2Y2FA 2OC3A 1OEMX 3EAXA 2PT0A 1ONYA 3D9CA 2NT7A 2I6IA 2QCJA 4GFUA 3NMEA 2WGPA 5KA0A 1QXKA 1G1FA 2HXPA 3BM8A 2NV5A 3S4OA 2M3VA 2I3UA 5KAAA 1QZ0A 3BLUA 1A5YA 4NWFA 3V0IA 4HJPA 1C84A 2CNIA 5AWXA 1XM2A 4WTYA 5KADA 2VEWA 2PSZA 1C88A 5KA9A 3QCJA 2Q05A 2CM7A 1G7GA 4Y2EA 4RKKA 2GJTA 4PVGA 5KA8A 4R30A 1NO6A 3ZMPA 5J8RA 4RHGA 2FJNA 2NTAA 2H04A 3QKPA 2E0TA 5KA4A 1GWZA 5K9VA 3BRHA 4GE2A 4JBCA 4RI4A 4DGPA 4NNDA 1Q6JA 3M4UA 2SHPA 2I6JA 1PXHA 3QCBA 4JMJA 3EB1A 3V0FA 1NWLA 2HC2A 4OHIA 1U25A 3V0HA 2I75A 2CNHA 2HVLA 1Q6TA 4NWGA 1M3GA 3B7OA 3ZMQA 2QDCA 3F9BA 2NZ6A 4Y14A 2QEPA 3A5JA 4RDDA 5KABA 4B04A 2CMAA 2DXPA 1OEUA 2B4OA 1PA1A 1XBOA 2CNFA 2A8BA 2H03A 1I9TA 5HDEA 1KAVA 3ZM0A 1FQ1A 5KA7A 1L8GA 3ZM1A 3RO1A 4I8NA
chains in the Genus database with same CATH superfamily
1GG4A 4BPCA 2VTDA 1Q6NA 4D3PA 5LXQB 4OHDA 1OESA 2PBNA 3MMJA 2HNQA 1U26A 1ZZWA 2HC1A 1GQQA 1MKPA 3NRSA 3ZM5A 2R0BA 4Z6BA 4TVVA 2B4SA 4HV4A 1YTNA 3V0JA 4R0TA 1XRIA 1I9SA 4CVMA 2XJAA 1ECVA 1V3AA 2GP0A 4H1OA 2CMCA 1YWFA 2F6YA 2VTEA 3QCCA 1FPZA 4QAHA 2JFHA 2GCBA 4HJQA 2I3RA 5K22A 3AWEA 2CNGA 2F46A 1T48A 2QBPA 2UUOA 4GRZA 3GXHA 1G1GA 3O4TA 2VEVA 4YR8B 4IKCA 4KYRA 1YZ4A 2B4UA 3SMEA 4H34A 2I6MA 1G7FA 2I42A 1GFYA 4ZN5A 2CNEA 1ONZA 3BLTA 2Y68A 2IMGA 1PTTA 3RGQA 1NNYA 3PYZA 2CM2A 1E0DA 2QDMA 1YGRA 3QCMA 2VOSA 5KA2A 2NLKA 1X24A 3F41A 5IBSA 1C83A 2JFGA 4ZIYA 4NX8A 3QCFA 2F71A 2ZN7A 3QCNA 3RGOA 1LARA 1O5ZA 2G59A 2F6TA 4CVKA 2VEXA 4ICZA 3QCZA 1C85A 2BGEA 4GRYA 3S3EA 4RH5A 5KA1A 3I36A 5A5FA 1OHCA 3D42A 4PYHA 1YFOA 2P6XA 1C87A 3AWFA 1BZHA 3V0GA 1LQFA 3HN7A 2FJMA 3CWEA 4CVLA 3MVNA 1Q6SA 2B3OA 1RXDA 4QUMA 2Q47A 2WJPA 1XXVA 3OMHA 5M43A 3D1HA 4WU2A 4ERCA 1WRMA 2J16B 2CFVA 1OHDA 3S3FA 1RPMA 1SUGA 4HRFA 3ZM3A 3MOZA 3N0AA 1NL9A 2F6FA 4JMKA 3F99A 4OHHA 4QAPA 2I5XA 5BZXA 2HNPA 3S3KA 5BX1A 3I7ZA 1XXPA 2HCMA 1FPRA 1T4JA 4GE5A 1W78A 4R0SA 4BJOA 3S4EA 3D44A 1EEOA 4RI5A 2H4GA 2I6OA 5GTJA 2CM3A 5EHRA 1PYNA 3O5XA 4D3QA 2HB1A 2HY3A 3D1QA 5K24A 2QBRA 2A3KA 2I6PA 4D3RA 3RZ2A 5KACA 1I57A 2B49A 2X5OA 3QCLA 4KYQA 1EEHA 1AAXA 3QCGA 2GCAA 1T49A 2BGDA 2C46A 2YDUA 2CM8A 2CJZA 3GXGA 1LYVA 2AZRA 3ZV2A 1P3DA 1PH0A 2F70A 2MBCA 1ZC0A 2I4EA 1YGUA 3QCDA 5BZZA 1Q6PA 3D1OA 2F6WA 2ESBA 2BZLA 1NWEA 3I80A 2VEUA 3A5KA 3H2XA 1JBVA 2QBSA 1G4US 4WOHA 2VORA 4OHEA 1J4XA 1L8KA 5A5EA 1VHRA 1EENA 2OUDA 2I4GA 4YAAA 3ZM2A 1OEVA 4JNBA 1OEOX 1YN9A 2ZMMA 4WU3A 2OOQA 3QCEA 4DGXA 4BUCA 1Q6MA 1UAGA 2AM1A 2Y67A 1G1HA 2QDPA 2I4HA 1ZCKA 1U24A 1C86A 3CM3A 2NT2A 1BZCA 1YTWA 3O4UA 1R6HA 1JLNA 2PQ5A 1P15A 1OHEA 3AWGA 1G4WR 4GWFA 5IBMA 1PTVA 1WCHA 4AZ1A 3SR9A 2C7SA 1YPTA 2P4DA 4OHLA 2VEYA 1ZCLA 4J51A 2H02A 3QKQA 4ZI4A 2I1YA 1YTSA 4GFVA 3OLRA 4GS0A 2CMBA 3EMUA 3F9AA 4UAGA 3QCHA 5KA3A 3U96A 3O3LA 2QBQA 1WAXA 1PTYA 2Y66A 2F6VA 3F81A 1JBWA 2BV5A 1OETA 2GWOA 2QCTA 2OZ5A 2PA5A 4QBWA 4NYHA 5MMZB 4S0GA 4KI9A 1PA9A 2Y96A 3O4SA 2JJDA 1PTUA 3S3HA 2J16A 4ZRTA 3V0DA 1BZJA 2B4PA 2B07A 5K25A 2Y1OA 2G6ZA 2GC6A 2FH7A 2UAGA 2F00A 2H4KA 2JFFA 5K23A 1Q1MA 3QCKA 2AM2A 3EZZA 2F6ZA 4GE6A 3MOWA 2PI7A 5I6VA 1NZ7A 5K9WA 1JF7A 4QUNA 3UAGA 2BIJA 3PS5A 4BUBA 3EU0A 4QBEA 5EHPA 3V0EA 1D5RA 3QCIA 5BUGA 3LJ8A 4RH9A 2J17A 2RF6A 2AHSA 1KAKA 2H4VA 4MBBA 2Y2FA 2OC3A 3EAXA 1OEMX 2PT0A 1ONYA 4C12A 3D9CA 2NT7A 2I6IA 2QCJA 4GFUA 3NMEA 2WGPA 5KA0A 1QXKA 1G1FA 2HXPA 3BM8A 2NV5A 1FGSA 3S4OA 2M3VA 2I3UA 5KAAA 1QZ0A 3BLUA 2UUPA 1A5YA 4NWFA 3V0IA 4HJPA 1C84A 2CNIA 3N2AA 4QF5A 3LK7A 5AWXA 1E8CA 1XM2A 4WTYA 5KADA 2GC5A 2VEWA 2PSZA 1C88A 5KA9A 3QCJA 2Q05A 2CM7A 1G7GA 4Y2EA 4RKKA 2GJTA 4PVGA 5KA8A 4R30A 1NO6A 3ZMPA 5J8RA 4RHGA 2FJNA 2NTAA 2H04A 3QKPA 2E0TA 5KA4A 1GWZA 5K9VA 3BRHA 1W7KA 4GE2A 4JBCA 4RI4A 4DGPA 4NNDA 1Q6JA 3M4UA 2SHPA 2I6JA 1PXHA 3QCBA 4JMJA 2XPCA 2WTZA 3EB1A 3V0FA 1NWLA 2HC2A 4OHIA 1U25A 3V0HA 3ZL8A 2I75A 2CNHA 2HVLA 1Q6TA 1P31A 4C13A 4NWGA 1M3GA 3B7OA 3ZMQA 2QDCA 3F9BA 2NZ6A 4Y14A 1J6UA 2QEPA 3A5JA 4RDDA 5KABA 4QDIA 4B04A 2CMAA 2DXPA 1OEUA 2B4OA 1PA1A 1XBOA 2CNFA 2A8BA 2H03A 1I9TA 5HDEA 1KAVA 3ZM0A 1FQ1A 5KA7A 1L8GA 1GQYA 3ZM1A 3RO1A 3ZM6A 4I8NA
chains in the Genus database with same CATH topology
4BPCA 1Q6NA 4D3PA 5LXQB 4OHDA 1OESA 2PBNA 3MMJA 2HNQA 1U26A 1ZZWA 2HC1A 1MKPA 2R0BA 4Z6BA 4TVVA 2B4SA 1YTNA 3V0JA 4R0TA 1XRIA 1I9SA 1ECVA 1V3AA 2GP0A 4H1OA 2CMCA 1YWFA 2F6YA 3QCCA 1FPZA 4QAHA 4HJQA 2I3RA 5K22A 3AWEA 2CNGA 2F46A 1T48A 2QBPA 4GRZA 3GXHA 1G1GA 3O4TA 2VEVA 4YR8B 4IKCA 4KYRA 1YZ4A 2B4UA 3SMEA 4H34A 2I6MA 1G7FA 2I42A 1GFYA 4ZN5A 2CNEA 1ONZA 3BLTA 2IMGA 1PTTA 3RGQA 1NNYA 2CM2A 2QDMA 1YGRA 3QCMA 5KA2A 2NLKA 1X24A 3F41A 5IBSA 1C83A 4NX8A 3QCFA 2F71A 2ZN7A 3QCNA 3RGOA 1LARA 2G59A 2F6TA 2VEXA 4ICZA 1C85A 2BGEA 4GRYA 3S3EA 4RH5A 5KA1A 3I36A 1OHCA 3D42A 4PYHA 1YFOA 2P6XA 1C87A 3AWFA 1BZHA 3V0GA 1LQFA 2FJMA 3CWEA 1Q6SA 2B3OA 1RXDA 4QUMA 2Q47A 1XXVA 3OMHA 5M43A 3D1HA 4WU2A 4ERCA 1WRMA 2J16B 2CFVA 1OHDA 3S3FA 1RPMA 1SUGA 4HRFA 3ZM3A 3MOZA 3N0AA 1NL9A 2F6FA 4JMKA 3F99A 4OHHA 4QAPA 2I5XA 5BZXA 2HNPA 3S3KA 5BX1A 3I7ZA 1XXPA 2HCMA 1T4JA 1FPRA 4GE5A 4R0SA 4BJOA 3S4EA 3D44A 1EEOA 4RI5A 2H4GA 2I6OA 5GTJA 2CM3A 5EHRA 1PYNA 3O5XA 4D3QA 2HB1A 2HY3A 3D1QA 5K24A 2QBRA 2A3KA 2I6PA 4D3RA 3RZ2A 5KACA 1I57A 2B49A 3QCLA 4KYQA 1AAXA 3QCGA 1T49A 2BGDA 2C46A 2YDUA 2CM8A 2CJZA 3GXGA 1LYVA 2AZRA 3ZV2A 1PH0A 2F70A 2MBCA 1ZC0A 2I4EA 1YGUA 3QCDA 5BZZA 1Q6PA 3D1OA 2F6WA 2ESBA 2BZLA 1NWEA 3I80A 2VEUA 3A5KA 3H2XA 2QBSA 1G4US 4WOHA 4OHEA 1J4XA 1L8KA 1VHRA 1EENA 2OUDA 2I4GA 4YAAA 3ZM2A 1OEVA 4JNBA 1OEOX 1YN9A 2ZMMA 4WU3A 2OOQA 3QCEA 4DGXA 1Q6MA 1G1HA 2QDPA 2I4HA 1ZCKA 1U24A 1C86A 3CM3A 2NT2A 1BZCA 1YTWA 3O4UA 1R6HA 1JLNA 2PQ5A 1P15A 1OHEA 3AWGA 1G4WR 4GWFA 5IBMA 1PTVA 1WCHA 4AZ1A 3SR9A 2C7SA 1YPTA 2P4DA 4OHLA 2VEYA 1ZCLA 4J51A 2H02A 3QKQA 4ZI4A 2I1YA 1YTSA 4GFVA 3OLRA 4GS0A 2CMBA 3EMUA 3F9AA 3QCHA 5KA3A 3U96A 3O3LA 2QBQA 1WAXA 1PTYA 2F6VA 3F81A 2BV5A 1OETA 2GWOA 2QCTA 2OZ5A 2PA5A 4QBWA 4NYHA 5MMZB 4S0GA 4KI9A 1PA9A 2Y96A 3O4SA 2JJDA 1PTUA 3S3HA 2J16A 4ZRTA 3V0DA 1BZJA 2B4PA 2B07A 5K25A 2G6ZA 2FH7A 2H4KA 5K23A 1Q1MA 3QCKA 3EZZA 2F6ZA 4GE6A 3MOWA 2PI7A 5I6VA 1NZ7A 5K9WA 1JF7A 4QUNA 2BIJA 3PS5A 3EU0A 4QBEA 5EHPA 3V0EA 1D5RA 3QCIA 5BUGA 3LJ8A 4RH9A 2J17A 2RF6A 2AHSA 1KAKA 2H4VA 4MBBA 2Y2FA 2OC3A 1OEMX 3EAXA 2PT0A 1ONYA 3D9CA 2NT7A 2I6IA 2QCJA 4GFUA 3NMEA 2WGPA 5KA0A 1QXKA 1G1FA 2HXPA 3BM8A 2NV5A 3S4OA 2M3VA 2I3UA 5KAAA 1QZ0A 3BLUA 1A5YA 4NWFA 3V0IA 4HJPA 1C84A 2CNIA 5AWXA 1XM2A 4WTYA 5KADA 2VEWA 2PSZA 1C88A 5KA9A 3QCJA 2Q05A 2CM7A 1G7GA 4Y2EA 4RKKA 2GJTA 4PVGA 5KA8A 4R30A 1NO6A 3ZMPA 5J8RA 4RHGA 2FJNA 2NTAA 2H04A 3QKPA 2E0TA 5KA4A 1GWZA 5K9VA 3BRHA 4GE2A 4JBCA 4RI4A 4DGPA 4NNDA 1Q6JA 3M4UA 2SHPA 2I6JA 1PXHA 3QCBA 4JMJA 3EB1A 3V0FA 1NWLA 2HC2A 4OHIA 1U25A 3V0HA 2I75A 2CNHA 2HVLA 1Q6TA 4NWGA 1M3GA 3B7OA 3ZMQA 2QDCA 3F9BA 2NZ6A 4Y14A 2QEPA 3A5JA 4RDDA 5KABA 4B04A 2CMAA 2DXPA 1OEUA 2B4OA 1PA1A 1XBOA 2CNFA 2A8BA 2H03A 1I9TA 5HDEA 1KAVA 3ZM0A 1FQ1A 5KA7A 1L8GA 3ZM1A 3RO1A 4I8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BPC A;  1Q6N A;  4D3P A;  5LXQ B;  4OHD A;  1OES A;  2PBN A;  3MMJ A;  2HNQ A;  1U26 A;  1ZZW A;  2HC1 A;  1MKP A;  2R0B A;  4Z6B A;  4TVV A;  2B4S A;  1YTN A;  3V0J A;  4R0T A;  1XRI A;  1I9S A;  1ECV A;  1V3A A;  2GP0 A;  4H1O A;  2CMC A;  1YWF A;  2F6Y A;  3QCC A;  1FPZ A;  4QAH A;  4HJQ A;  2I3R A;  5K22 A;  3AWE A;  2CNG A;  2F46 A;  1T48 A;  2QBP A;  4GRZ A;  3GXH A;  1G1G A;  3O4T A;  2VEV A;  4YR8 B;  4IKC A;  4KYR A;  1YZ4 A;  2B4U A;  3SME A;  4H34 A;  2I6M A;  1G7F A;  2I42 A;  1GFY A;  4ZN5 A;  2CNE A;  1ONZ A;  3BLT A;  2IMG A;  1PTT A;  3RGQ A;  1NNY A;  2CM2 A;  2QDM A;  1YGR A;  3QCM A;  5KA2 A;  2NLK A;  1X24 A;  3F41 A;  5IBS A;  1C83 A;  4NX8 A;  3QCF A;  2F71 A;  2ZN7 A;  3QCN A;  3RGO A;  1LAR A;  2G59 A;  2F6T A;  2VEX A;  4ICZ A;  1C85 A;  2BGE A;  4GRY A;  3S3E A;  4RH5 A;  5KA1 A;  3I36 A;  1OHC A;  3D42 A;  4PYH A;  1YFO A;  2P6X A;  1C87 A;  3AWF A;  1BZH A;  3V0G A;  1LQF A;  2FJM A;  3CWE A;  1Q6S A;  2B3O A;  1RXD A;  4QUM A;  2Q47 A;  1XXV A;  3OMH A;  5M43 A;  3D1H A;  4WU2 A;  4ERC A;  1WRM A;  2J16 B;  2CFV A;  1OHD A;  3S3F A;  1RPM A;  1SUG A;  4HRF A;  3ZM3 A;  3MOZ A;  3N0A A;  1NL9 A;  2F6F A;  4JMK A;  3F99 A;  4OHH A;  4QAP A;  2I5X A;  5BZX A;  2HNP A;  3S3K A;  5BX1 A;  3I7Z A;  1XXP A;  2HCM A;  1T4J A;  1FPR A;  4GE5 A;  4R0S A;  4BJO A;  3S4E A;  3D44 A;  1EEO A;  4RI5 A;  2H4G A;  2I6O A;  5GTJ A;  2CM3 A;  5EHR A;  1PYN A;  3O5X A;  4D3Q A;  2HB1 A;  2HY3 A;  3D1Q A;  5K24 A;  2QBR A;  2A3K A;  2I6P A;  4D3R A;  3RZ2 A;  5KAC A;  1I57 A;  2B49 A;  3QCL A;  4KYQ A;  1AAX A;  3QCG A;  1T49 A;  2BGD A;  2C46 A;  2YDU A;  2CM8 A;  2CJZ A;  3GXG A;  1LYV A;  2AZR A;  3ZV2 A;  1PH0 A;  2F70 A;  2MBC A;  1ZC0 A;  2I4E A;  1YGU A;  3QCD A;  5BZZ A;  1Q6P A;  3D1O A;  2F6W A;  2ESB A;  2BZL A;  1NWE A;  3I80 A;  2VEU A;  3A5K A;  3H2X A;  2QBS A;  1G4U S;  4WOH A;  4OHE A;  1J4X A;  1L8K A;  1VHR A;  1EEN A;  2OUD A;  2I4G A;  4YAA A;  3ZM2 A;  1OEV A;  4JNB A;  1OEO X;  1YN9 A;  2ZMM A;  4WU3 A;  2OOQ A;  3QCE A;  4DGX A;  1Q6M A;  1G1H A;  2QDP A;  2I4H A;  1ZCK A;  1U24 A;  1C86 A;  3CM3 A;  2NT2 A;  1BZC A;  1YTW A;  3O4U A;  1R6H A;  1JLN A;  2PQ5 A;  1P15 A;  1OHE A;  3AWG A;  1G4W R;  4GWF A;  5IBM A;  1PTV A;  1WCH A;  4AZ1 A;  3SR9 A;  2C7S A;  1YPT A;  2P4D A;  4OHL A;  2VEY A;  1ZCL A;  4J51 A;  2H02 A;  3QKQ A;  4ZI4 A;  2I1Y A;  1YTS A;  4GFV A;  3OLR A;  4GS0 A;  2CMB A;  3EMU A;  3F9A A;  3QCH A;  5KA3 A;  3U96 A;  3O3L A;  2QBQ A;  1WAX A;  1PTY A;  2F6V A;  3F81 A;  2BV5 A;  1OET A;  2GWO A;  2QCT A;  2OZ5 A;  2PA5 A;  4QBW A;  4NYH A;  5MMZ B;  4S0G A;  4KI9 A;  1PA9 A;  2Y96 A;  3O4S A;  2JJD A;  1PTU A;  3S3H A;  2J16 A;  4ZRT A;  3V0D A;  1BZJ A;  2B4P A;  2B07 A;  5K25 A;  2G6Z A;  2FH7 A;  2H4K A;  5K23 A;  1Q1M A;  3QCK A;  3EZZ A;  2F6Z A;  4GE6 A;  3MOW A;  2PI7 A;  5I6V A;  1NZ7 A;  5K9W A;  1JF7 A;  4QUN A;  2BIJ A;  3PS5 A;  3EU0 A;  4QBE A;  5EHP A;  3V0E A;  1D5R A;  3QCI A;  5BUG A;  3LJ8 A;  4RH9 A;  2J17 A;  2RF6 A;  2AHS A;  1KAK A;  2H4V A;  4MBB A;  2Y2F A;  2OC3 A;  1OEM X;  3EAX A;  2PT0 A;  1ONY A;  3D9C A;  2NT7 A;  2I6I A;  2QCJ A;  4GFU A;  3NME A;  2WGP A;  5KA0 A;  1QXK A;  1G1F A;  2HXP A;  3BM8 A;  2NV5 A;  3S4O A;  2M3V A;  2I3U A;  5KAA A;  1QZ0 A;  3BLU A;  1A5Y A;  4NWF A;  3V0I A;  4HJP A;  1C84 A;  2CNI A;  5AWX A;  1XM2 A;  4WTY A;  5KAD A;  2VEW A;  2PSZ A;  1C88 A;  5KA9 A;  3QCJ A;  2Q05 A;  2CM7 A;  1G7G A;  4Y2E A;  4RKK A;  2GJT A;  4PVG A;  5KA8 A;  4R30 A;  1NO6 A;  3ZMP A;  5J8R A;  4RHG A;  2FJN A;  2NTA A;  2H04 A;  3QKP A;  2E0T A;  5KA4 A;  1GWZ A;  5K9V A;  3BRH A;  4GE2 A;  4JBC A;  4RI4 A;  4DGP A;  4NND A;  1Q6J A;  3M4U A;  2SHP A;  2I6J A;  1PXH A;  3QCB A;  4JMJ A;  3EB1 A;  3V0F A;  1NWL A;  2HC2 A;  4OHI A;  1U25 A;  3V0H A;  2I75 A;  2CNH A;  2HVL A;  1Q6T A;  4NWG A;  1M3G A;  3B7O A;  3ZMQ A;  2QDC A;  3F9B A;  2NZ6 A;  4Y14 A;  2QEP A;  3A5J A;  4RDD A;  5KAB A;  4B04 A;  2CMA A;  2DXP A;  1OEU A;  2B4O A;  1PA1 A;  1XBO A;  2CNF A;  2A8B A;  2H03 A;  1I9T A;  5HDE A;  1KAV A;  3ZM0 A;  1FQ1 A;  5KA7 A;  1L8G A;  3ZM1 A;  3RO1 A;  4I8N A; 
#chains in the Genus database with same CATH topology
 1GG4 A;  4BPC A;  2VTD A;  1Q6N A;  4D3P A;  5LXQ B;  4OHD A;  1OES A;  2PBN A;  3MMJ A;  2HNQ A;  1U26 A;  1ZZW A;  2HC1 A;  1GQQ A;  1MKP A;  3NRS A;  3ZM5 A;  2R0B A;  4Z6B A;  4TVV A;  2B4S A;  4HV4 A;  1YTN A;  3V0J A;  4R0T A;  1XRI A;  1I9S A;  4CVM A;  2XJA A;  1ECV A;  1V3A A;  2GP0 A;  4H1O A;  2CMC A;  1YWF A;  2F6Y A;  2VTE A;  3QCC A;  1FPZ A;  4QAH A;  2JFH A;  2GCB A;  4HJQ A;  2I3R A;  5K22 A;  3AWE A;  2CNG A;  2F46 A;  1T48 A;  2QBP A;  2UUO A;  4GRZ A;  3GXH A;  1G1G A;  3O4T A;  2VEV A;  4YR8 B;  4IKC A;  4KYR A;  1YZ4 A;  2B4U A;  3SME A;  4H34 A;  2I6M A;  1G7F A;  2I42 A;  1GFY A;  4ZN5 A;  2CNE A;  1ONZ A;  3BLT A;  2Y68 A;  2IMG A;  1PTT A;  3RGQ A;  1NNY A;  3PYZ A;  2CM2 A;  1E0D A;  2QDM A;  1YGR A;  3QCM A;  2VOS A;  5KA2 A;  2NLK A;  1X24 A;  3F41 A;  5IBS A;  1C83 A;  2JFG A;  4ZIY A;  4NX8 A;  3QCF A;  2F71 A;  2ZN7 A;  3QCN A;  3RGO A;  1LAR A;  1O5Z A;  2G59 A;  2F6T A;  4CVK A;  2VEX A;  4ICZ A;  3QCZ A;  1C85 A;  2BGE A;  4GRY A;  3S3E A;  4RH5 A;  5KA1 A;  3I36 A;  5A5F A;  1OHC A;  3D42 A;  4PYH A;  1YFO A;  2P6X A;  1C87 A;  3AWF A;  1BZH A;  3V0G A;  1LQF A;  3HN7 A;  2FJM A;  3CWE A;  4CVL A;  3MVN A;  1Q6S A;  2B3O A;  1RXD A;  4QUM A;  2Q47 A;  2WJP A;  1XXV A;  3OMH A;  5M43 A;  3D1H A;  4WU2 A;  4ERC A;  1WRM A;  2J16 B;  2CFV A;  1OHD A;  3S3F A;  1RPM A;  1SUG A;  4HRF A;  3ZM3 A;  3MOZ A;  3N0A A;  1NL9 A;  2F6F A;  4JMK A;  3F99 A;  4OHH A;  4QAP A;  2I5X A;  5BZX A;  2HNP A;  3S3K A;  5BX1 A;  3I7Z A;  1XXP A;  2HCM A;  1FPR A;  1T4J A;  4GE5 A;  1W78 A;  4R0S A;  4BJO A;  3S4E A;  3D44 A;  1EEO A;  4RI5 A;  2H4G A;  2I6O A;  5GTJ A;  2CM3 A;  5EHR A;  1PYN A;  3O5X A;  4D3Q A;  2HB1 A;  2HY3 A;  3D1Q A;  5K24 A;  2QBR A;  2A3K A;  2I6P A;  4D3R A;  3RZ2 A;  5KAC A;  1I57 A;  2B49 A;  2X5O A;  3QCL A;  4KYQ A;  1EEH A;  1AAX A;  3QCG A;  2GCA A;  1T49 A;  2BGD A;  2C46 A;  2YDU A;  2CM8 A;  2CJZ A;  3GXG A;  1LYV A;  2AZR A;  3ZV2 A;  1P3D A;  1PH0 A;  2F70 A;  2MBC A;  1ZC0 A;  2I4E A;  1YGU A;  3QCD A;  5BZZ A;  1Q6P A;  3D1O A;  2F6W A;  2ESB A;  2BZL A;  1NWE A;  3I80 A;  2VEU A;  3A5K A;  3H2X A;  1JBV A;  2QBS A;  1G4U S;  4WOH A;  2VOR A;  4OHE A;  1J4X A;  1L8K A;  5A5E A;  1VHR A;  1EEN A;  2OUD A;  2I4G A;  4YAA A;  3ZM2 A;  1OEV A;  4JNB A;  1OEO X;  1YN9 A;  2ZMM A;  4WU3 A;  2OOQ A;  3QCE A;  4DGX A;  4BUC A;  1Q6M A;  1UAG A;  2AM1 A;  2Y67 A;  1G1H A;  2QDP A;  2I4H A;  1ZCK A;  1U24 A;  1C86 A;  3CM3 A;  2NT2 A;  1BZC A;  1YTW A;  3O4U A;  1R6H A;  1JLN A;  2PQ5 A;  1P15 A;  1OHE A;  3AWG A;  1G4W R;  4GWF A;  5IBM A;  1PTV A;  1WCH A;  4AZ1 A;  3SR9 A;  2C7S A;  1YPT A;  2P4D A;  4OHL A;  2VEY A;  1ZCL A;  4J51 A;  2H02 A;  3QKQ A;  4ZI4 A;  2I1Y A;  1YTS A;  4GFV A;  3OLR A;  4GS0 A;  2CMB A;  3EMU A;  3F9A A;  4UAG A;  3QCH A;  5KA3 A;  3U96 A;  3O3L A;  2QBQ A;  1WAX A;  1PTY A;  2Y66 A;  2F6V A;  3F81 A;  1JBW A;  2BV5 A;  1OET A;  2GWO A;  2QCT A;  2OZ5 A;  2PA5 A;  4QBW A;  4NYH A;  5MMZ B;  4S0G A;  4KI9 A;  1PA9 A;  2Y96 A;  3O4S A;  2JJD A;  1PTU A;  3S3H A;  2J16 A;  4ZRT A;  3V0D A;  1BZJ A;  2B4P A;  2B07 A;  5K25 A;  2Y1O A;  2G6Z A;  2GC6 A;  2FH7 A;  2UAG A;  2F00 A;  2H4K A;  2JFF A;  5K23 A;  1Q1M A;  3QCK A;  2AM2 A;  3EZZ A;  2F6Z A;  4GE6 A;  3MOW A;  2PI7 A;  5I6V A;  1NZ7 A;  5K9W A;  1JF7 A;  4QUN A;  3UAG A;  2BIJ A;  3PS5 A;  4BUB A;  3EU0 A;  4QBE A;  5EHP A;  3V0E A;  1D5R A;  3QCI A;  5BUG A;  3LJ8 A;  4RH9 A;  2J17 A;  2RF6 A;  2AHS A;  1KAK A;  2H4V A;  4MBB A;  2Y2F A;  2OC3 A;  3EAX A;  1OEM X;  2PT0 A;  1ONY A;  4C12 A;  3D9C A;  2NT7 A;  2I6I A;  2QCJ A;  4GFU A;  3NME A;  2WGP A;  5KA0 A;  1QXK A;  1G1F A;  2HXP A;  3BM8 A;  2NV5 A;  1FGS A;  3S4O A;  2M3V A;  2I3U A;  5KAA A;  1QZ0 A;  3BLU A;  2UUP A;  1A5Y A;  4NWF A;  3V0I A;  4HJP A;  1C84 A;  2CNI A;  3N2A A;  4QF5 A;  3LK7 A;  5AWX A;  1E8C A;  1XM2 A;  4WTY A;  5KAD A;  2GC5 A;  2VEW A;  2PSZ A;  1C88 A;  5KA9 A;  3QCJ A;  2Q05 A;  2CM7 A;  1G7G A;  4Y2E A;  4RKK A;  2GJT A;  4PVG A;  5KA8 A;  4R30 A;  1NO6 A;  3ZMP A;  5J8R A;  4RHG A;  2FJN A;  2NTA A;  2H04 A;  3QKP A;  2E0T A;  5KA4 A;  1GWZ A;  5K9V A;  3BRH A;  1W7K A;  4GE2 A;  4JBC A;  4RI4 A;  4DGP A;  4NND A;  1Q6J A;  3M4U A;  2SHP A;  2I6J A;  1PXH A;  3QCB A;  4JMJ A;  2XPC A;  2WTZ A;  3EB1 A;  3V0F A;  1NWL A;  2HC2 A;  4OHI A;  1U25 A;  3V0H A;  3ZL8 A;  2I75 A;  2CNH A;  2HVL A;  1Q6T A;  1P31 A;  4C13 A;  4NWG A;  1M3G A;  3B7O A;  3ZMQ A;  2QDC A;  3F9B A;  2NZ6 A;  4Y14 A;  1J6U A;  2QEP A;  3A5J A;  4RDD A;  5KAB A;  4QDI A;  4B04 A;  2CMA A;  2DXP A;  1OEU A;  2B4O A;  1PA1 A;  1XBO A;  2CNF A;  2A8B A;  2H03 A;  1I9T A;  5HDE A;  1KAV A;  3ZM0 A;  1FQ1 A;  5KA7 A;  1L8G A;  1GQY A;  3ZM1 A;  3RO1 A;  3ZM6 A;  4I8N A; 
#chains in the Genus database with same CATH homology
 4BPC A;  1Q6N A;  4D3P A;  5LXQ B;  4OHD A;  1OES A;  2PBN A;  3MMJ A;  2HNQ A;  1U26 A;  1ZZW A;  2HC1 A;  1MKP A;  2R0B A;  4Z6B A;  4TVV A;  2B4S A;  1YTN A;  3V0J A;  4R0T A;  1XRI A;  1I9S A;  1ECV A;  1V3A A;  2GP0 A;  4H1O A;  2CMC A;  1YWF A;  2F6Y A;  3QCC A;  1FPZ A;  4QAH A;  4HJQ A;  2I3R A;  5K22 A;  3AWE A;  2CNG A;  2F46 A;  1T48 A;  2QBP A;  4GRZ A;  3GXH A;  1G1G A;  3O4T A;  2VEV A;  4YR8 B;  4IKC A;  4KYR A;  1YZ4 A;  2B4U A;  3SME A;  4H34 A;  2I6M A;  1G7F A;  2I42 A;  1GFY A;  4ZN5 A;  2CNE A;  1ONZ A;  3BLT A;  2IMG A;  1PTT A;  3RGQ A;  1NNY A;  2CM2 A;  2QDM A;  1YGR A;  3QCM A;  5KA2 A;  2NLK A;  1X24 A;  3F41 A;  5IBS A;  1C83 A;  4NX8 A;  3QCF A;  2F71 A;  2ZN7 A;  3QCN A;  3RGO A;  1LAR A;  2G59 A;  2F6T A;  2VEX A;  4ICZ A;  1C85 A;  2BGE A;  4GRY A;  3S3E A;  4RH5 A;  5KA1 A;  3I36 A;  1OHC A;  3D42 A;  4PYH A;  1YFO A;  2P6X A;  1C87 A;  3AWF A;  1BZH A;  3V0G A;  1LQF A;  2FJM A;  3CWE A;  1Q6S A;  2B3O A;  1RXD A;  4QUM A;  2Q47 A;  1XXV A;  3OMH A;  5M43 A;  3D1H A;  4WU2 A;  4ERC A;  1WRM A;  2J16 B;  2CFV A;  1OHD A;  3S3F A;  1RPM A;  1SUG A;  4HRF A;  3ZM3 A;  3MOZ A;  3N0A A;  1NL9 A;  2F6F A;  4JMK A;  3F99 A;  4OHH A;  4QAP A;  2I5X A;  5BZX A;  2HNP A;  3S3K A;  5BX1 A;  3I7Z A;  1XXP A;  2HCM A;  1T4J A;  1FPR A;  4GE5 A;  4R0S A;  4BJO A;  3S4E A;  3D44 A;  1EEO A;  4RI5 A;  2H4G A;  2I6O A;  5GTJ A;  2CM3 A;  5EHR A;  1PYN A;  3O5X A;  4D3Q A;  2HB1 A;  2HY3 A;  3D1Q A;  5K24 A;  2QBR A;  2A3K A;  2I6P A;  4D3R A;  3RZ2 A;  5KAC A;  1I57 A;  2B49 A;  3QCL A;  4KYQ A;  1AAX A;  3QCG A;  1T49 A;  2BGD A;  2C46 A;  2YDU A;  2CM8 A;  2CJZ A;  3GXG A;  1LYV A;  2AZR A;  3ZV2 A;  1PH0 A;  2F70 A;  2MBC A;  1ZC0 A;  2I4E A;  1YGU A;  3QCD A;  5BZZ A;  1Q6P A;  3D1O A;  2F6W A;  2ESB A;  2BZL A;  1NWE A;  3I80 A;  2VEU A;  3A5K A;  3H2X A;  2QBS A;  1G4U S;  4WOH A;  4OHE A;  1J4X A;  1L8K A;  1VHR A;  1EEN A;  2OUD A;  2I4G A;  4YAA A;  3ZM2 A;  1OEV A;  4JNB A;  1OEO X;  1YN9 A;  2ZMM A;  4WU3 A;  2OOQ A;  3QCE A;  4DGX A;  1Q6M A;  1G1H A;  2QDP A;  2I4H A;  1ZCK A;  1U24 A;  1C86 A;  3CM3 A;  2NT2 A;  1BZC A;  1YTW A;  3O4U A;  1R6H A;  1JLN A;  2PQ5 A;  1P15 A;  1OHE A;  3AWG A;  1G4W R;  4GWF A;  5IBM A;  1PTV A;  1WCH A;  4AZ1 A;  3SR9 A;  2C7S A;  1YPT A;  2P4D A;  4OHL A;  2VEY A;  1ZCL A;  4J51 A;  2H02 A;  3QKQ A;  4ZI4 A;  2I1Y A;  1YTS A;  4GFV A;  3OLR A;  4GS0 A;  2CMB A;  3EMU A;  3F9A A;  3QCH A;  5KA3 A;  3U96 A;  3O3L A;  2QBQ A;  1WAX A;  1PTY A;  2F6V A;  3F81 A;  2BV5 A;  1OET A;  2GWO A;  2QCT A;  2OZ5 A;  2PA5 A;  4QBW A;  4NYH A;  5MMZ B;  4S0G A;  4KI9 A;  1PA9 A;  2Y96 A;  3O4S A;  2JJD A;  1PTU A;  3S3H A;  2J16 A;  4ZRT A;  3V0D A;  1BZJ A;  2B4P A;  2B07 A;  5K25 A;  2G6Z A;  2FH7 A;  2H4K A;  5K23 A;  1Q1M A;  3QCK A;  3EZZ A;  2F6Z A;  4GE6 A;  3MOW A;  2PI7 A;  5I6V A;  1NZ7 A;  5K9W A;  1JF7 A;  4QUN A;  2BIJ A;  3PS5 A;  3EU0 A;  4QBE A;  5EHP A;  3V0E A;  1D5R A;  3QCI A;  5BUG A;  3LJ8 A;  4RH9 A;  2J17 A;  2RF6 A;  2AHS A;  1KAK A;  2H4V A;  4MBB A;  2Y2F A;  2OC3 A;  1OEM X;  3EAX A;  2PT0 A;  1ONY A;  3D9C A;  2NT7 A;  2I6I A;  2QCJ A;  4GFU A;  3NME A;  2WGP A;  5KA0 A;  1QXK A;  1G1F A;  2HXP A;  3BM8 A;  2NV5 A;  3S4O A;  2M3V A;  2I3U A;  5KAA A;  1QZ0 A;  3BLU A;  1A5Y A;  4NWF A;  3V0I A;  4HJP A;  1C84 A;  2CNI A;  5AWX A;  1XM2 A;  4WTY A;  5KAD A;  2VEW A;  2PSZ A;  1C88 A;  5KA9 A;  3QCJ A;  2Q05 A;  2CM7 A;  1G7G A;  4Y2E A;  4RKK A;  2GJT A;  4PVG A;  5KA8 A;  4R30 A;  1NO6 A;  3ZMP A;  5J8R A;  4RHG A;  2FJN A;  2NTA A;  2H04 A;  3QKP A;  2E0T A;  5KA4 A;  1GWZ A;  5K9V A;  3BRH A;  4GE2 A;  4JBC A;  4RI4 A;  4DGP A;  4NND A;  1Q6J A;  3M4U A;  2SHP A;  2I6J A;  1PXH A;  3QCB A;  4JMJ A;  3EB1 A;  3V0F A;  1NWL A;  2HC2 A;  4OHI A;  1U25 A;  3V0H A;  2I75 A;  2CNH A;  2HVL A;  1Q6T A;  4NWG A;  1M3G A;  3B7O A;  3ZMQ A;  2QDC A;  3F9B A;  2NZ6 A;  4Y14 A;  2QEP A;  3A5J A;  4RDD A;  5KAB A;  4B04 A;  2CMA A;  2DXP A;  1OEU A;  2B4O A;  1PA1 A;  1XBO A;  2CNF A;  2A8B A;  2H03 A;  1I9T A;  5HDE A;  1KAV A;  3ZM0 A;  1FQ1 A;  5KA7 A;  1L8G A;  3ZM1 A;  3RO1 A;  4I8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...