4QURA

Crystal structure of stachydrine demethylase in complex with cyanide, oxygen, and n-methyl proline in a new orientation
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
415
structure length
415
Chain Sequence
GTENLYFQSMMTANPTSIHQRLDRRLSGFSLEQPFYTSPEVYALDLQHIFYKQWLYAVPVCQLAKAGSYTTLRVGAYEVVIVRSRDGEVRAFHNSCRHRGSLICKARQGQVAKLVCPYHQWTYELDGKLIWANDMGPDFDASKYGLKPVNLRNLDGLIYICLSDTPPDFQTFAQLARPYLEVHDLKDAKVAFTSTIIEKGNWKLVWENNRECYHCSSNHPALCRSFPLDPEVAGVQADGGVSKKLQAHFDRCEAAGTPAQFVLAGDGQYRLARMPLQEKALSYTMDGKAAVSRHLGRVAPPDAGTLLMFHYPSTWNHFLPDHSLTFRVMPISPTETEVTTTWLVHKDAVEGVDYDLKRLTEVWIATNDEDREIVETNQQGILSPAYVPGPYSPGQESGVMQFVDWYAASLERALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords monoxygenase; demethylase
publication title Tracking photoelectron induced in-crystallo enzyme catalysis
rcsb
source organism Sinorhizobium meliloti 1021
molecule tags Oxidoreductase
total genus 133
structure length 415
sequence length 415
ec nomenclature ec 1.-.-.-:
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4qurA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 4qurA01
5BOKA 3BCCE 3GKQA 1KB9E 1NTKE 3EN1A 1UUWA 4QDDA 3CWBE 2FYUE 3VMGA 1P84E 2XSHA 1ULJA 1L0NE 2Q3WA 4QUPA 2I7FA 1FQTA 4NBEA 4NBHA 5KKZC 1JM1A 3GL2A 4H44D 4NBHD 2E75D 2ZT9D 1SQVE 2YVJB 4HJLA 2E4PA 3L70E 1SQQE 3GCEA 3H1HE 3N0QA 1NDOA 1ZRTE 4OGQD 3H1JE 3L73E 3CXHE 2A06E 2HMKA 4HM4A 3GZYA 3TGUE 1EZVE 1WQLA 4NB9A 2XRXA 2QPZA 4H0LD 4AAYB 1NU1E 4NBBA 4NB9D 2DE5A 3VCAA 4NBBD 2DE5D 2JZAA 1SJGA 2HMJA 2QJYC 1G8JB 2FYNC 3DQYA 2NUKA 3GTSA 2B24A 1O7PA 4HM8A 3GL0A 2NVEA 3GOBA 1RFSA 2CKFA 1EG9A 1WW9A 1O7MA 2IBZE 1NTZE 1G8KB 1RIEA 1SQPE 4HM0A 1PPJE 2GBXA 3L71E 4NBCD 1Z01A 4HM7A 3GKEA 4H13D 4HKVA 4QDFB 1BE3E 1VCKA 3VMHA 2BMRA 4HM5A 4NBAA 3VMHD 3L74E 2BCCE 1L0LE 2E4QA 1O7HA 4NBAD 4HM6A 2E76D 3GTEA 3C0DA 4P1BH 1BCCE 2NWFA 4HM3A 1Q90C 3H1KE 2YFLA 1ULIA 2NVFA 3VCPA 2ZYLA 1O7GA 2XR8A 4QUQA 4EMJB 2BMOA 3H1IE 2HMMA 5KLVE 2B1XA 2NUMA 4QCKA 4NBCA 1O7NA 4QDCA 3VMIA 5HL4A 4QURA 4P1CH 1UUVA 3VMID 2XSOA 3L72E 4NB8A 3L75E 5CXMA 1NTME 5AEUA 1Z02A 2DE7A 1VF5D 3H1LE 3D89A 4NB8D 2DE7D 3GB4A 5AEWA 4QDFA 4NBFA 1Z03A 2GBWA 2DE6A 4NBGA 4NBFD 4NBDA 2DE6D 2QJPC 2D2CD 4NBGD 4NBDD 3VMGD 3CX5E 3GCFA 3EQQA 1NYKA 4HM2A 4PV1D 1SQXE 2YFIA 4NBED 4PD4E 2HMLA 2NVGA 5KLIC 3GZXA 2E74D 1VM9A 2QJKC 2HMNA 4AIVA 1SQBE 1O7WA 1PP9E 2YFJA 2JO6A 4U3FE 1KYOE 2HMOA 4HM1A 2BMQA 3FOUA 2YIUC 3AZCA
chains in the Genus database with same CATH superfamily
5BOKA 3BCCE 3GKQA 1KB9E 1NTKE 3EN1A 1UUWA 4QDDA 3CWBE 2FYUE 3VMGA 1P84E 2XSHA 1ULJA 1L0NE 2Q3WA 4QUPA 2I7FA 1FQTA 4NBEA 4NBHA 5KKZC 1JM1A 3GL2A 4H44D 4NBHD 2E75D 2ZT9D 1SQVE 2YVJB 4HJLA 2E4PA 3L70E 1SQQE 3GCEA 3H1HE 3N0QA 1NDOA 1ZRTE 4OGQD 3H1JE 3L73E 3CXHE 2A06E 2HMKA 4HM4A 3GZYA 3TGUE 1EZVE 1WQLA 4NB9A 2XRXA 2QPZA 4H0LD 4AAYB 1NU1E 4NBBA 4NB9D 2DE5A 3VCAA 4NBBD 2DE5D 2JZAA 1SJGA 2HMJA 2QJYC 1G8JB 2FYNC 3DQYA 2NUKA 3GTSA 2B24A 1O7PA 4HM8A 3GL0A 2NVEA 3GOBA 1RFSA 2CKFA 1EG9A 1WW9A 1O7MA 2IBZE 1NTZE 1G8KB 1RIEA 1SQPE 4HM0A 1PPJE 2GBXA 3L71E 4NBCD 1Z01A 4HM7A 3GKEA 4H13D 4HKVA 4QDFB 1BE3E 1VCKA 3VMHA 2BMRA 4HM5A 4NBAA 3VMHD 3L74E 2BCCE 1L0LE 2E4QA 1O7HA 4NBAD 4HM6A 2E76D 3GTEA 3C0DA 4P1BH 1BCCE 2NWFA 4HM3A 1Q90C 3H1KE 2YFLA 1ULIA 2NVFA 3VCPA 2ZYLA 1O7GA 2XR8A 4QUQA 4EMJB 2BMOA 3H1IE 2HMMA 5KLVE 2B1XA 2NUMA 4QCKA 4NBCA 1O7NA 4QDCA 3VMIA 5HL4A 4QURA 4P1CH 1UUVA 3VMID 2XSOA 3L72E 4NB8A 3L75E 5CXMA 1NTME 5AEUA 1Z02A 2DE7A 1VF5D 3H1LE 3D89A 4NB8D 2DE7D 3GB4A 5AEWA 4QDFA 4NBFA 1Z03A 2GBWA 2DE6A 4NBGA 4NBFD 4NBDA 2DE6D 2QJPC 2D2CD 4NBGD 4NBDD 3VMGD 3CX5E 3GCFA 3EQQA 1NYKA 4HM2A 4PV1D 1SQXE 2YFIA 4NBED 4PD4E 2HMLA 2NVGA 5KLIC 3GZXA 2E74D 1VM9A 2QJKC 2HMNA 4AIVA 1SQBE 1O7WA 1PP9E 2YFJA 2JO6A 4U3FE 1KYOE 2HMOA 4HM1A 2BMQA 3FOUA 2YIUC 3AZCA
chains in the Genus database with same CATH topology
5BOKA 3BCCE 3GKQA 1KB9E 1NTKE 3EN1A 1UUWA 4QDDA 3CWBE 2FYUE 3VMGA 1P84E 2XSHA 1ULJA 1L0NE 2Q3WA 4QUPA 2I7FA 1FQTA 4NBEA 4NBHA 5KKZC 1JM1A 3GL2A 4H44D 4NBHD 2E75D 2ZT9D 1SQVE 2YVJB 4HJLA 2E4PA 3L70E 1SQQE 3GCEA 3H1HE 3N0QA 1NDOA 1ZRTE 4OGQD 3H1JE 3L73E 3CXHE 2A06E 2HMKA 4HM4A 3GZYA 3TGUE 1EZVE 1WQLA 4NB9A 2XRXA 2QPZA 4H0LD 4AAYB 1NU1E 4NBBA 4NB9D 2DE5A 3VCAA 4NBBD 2DE5D 2JZAA 1SJGA 2HMJA 2QJYC 1G8JB 2FYNC 3DQYA 2NUKA 3GTSA 2B24A 1O7PA 4HM8A 3GL0A 2NVEA 3GOBA 1RFSA 2CKFA 1EG9A 1WW9A 1O7MA 2IBZE 1NTZE 1G8KB 1RIEA 1SQPE 4HM0A 1PPJE 2GBXA 3L71E 4NBCD 1Z01A 4HM7A 3GKEA 4H13D 4HKVA 4QDFB 1BE3E 1VCKA 3VMHA 2BMRA 4HM5A 4NBAA 3VMHD 3L74E 2BCCE 1L0LE 2E4QA 1O7HA 4NBAD 4HM6A 2E76D 3GTEA 3C0DA 4P1BH 1BCCE 2NWFA 4HM3A 1Q90C 3H1KE 2YFLA 1ULIA 2NVFA 3VCPA 2ZYLA 1O7GA 2XR8A 4QUQA 4EMJB 2BMOA 3H1IE 2HMMA 5KLVE 2B1XA 2NUMA 4QCKA 4NBCA 1O7NA 4QDCA 3VMIA 5HL4A 4QURA 4P1CH 1UUVA 3VMID 2XSOA 3L72E 4NB8A 3L75E 5CXMA 1NTME 5AEUA 1Z02A 2DE7A 1VF5D 3H1LE 3D89A 4NB8D 2DE7D 3GB4A 5AEWA 4QDFA 4NBFA 1Z03A 2GBWA 2DE6A 4NBGA 4NBFD 4NBDA 2DE6D 2QJPC 2D2CD 4NBGD 4NBDD 3VMGD 3CX5E 3GCFA 3EQQA 1NYKA 4HM2A 4PV1D 1SQXE 2YFIA 4NBED 4PD4E 2HMLA 2NVGA 5KLIC 3GZXA 2E74D 1VM9A 2QJKC 2HMNA 4AIVA 1SQBE 1O7WA 1PP9E 2YFJA 2JO6A 4U3FE 1KYOE 2HMOA 4HM1A 2BMQA 3FOUA 2YIUC 3AZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BOK A;  3BCC E;  3GKQ A;  1KB9 E;  1NTK E;  3EN1 A;  1UUW A;  4QDD A;  3CWB E;  2FYU E;  3VMG A;  1P84 E;  2XSH A;  1ULJ A;  1L0N E;  2Q3W A;  4QUP A;  2I7F A;  1FQT A;  4NBE A;  4NBH A;  5KKZ C;  1JM1 A;  3GL2 A;  4H44 D;  4NBH D;  2E75 D;  2ZT9 D;  1SQV E;  2YVJ B;  4HJL A;  2E4P A;  3L70 E;  1SQQ E;  3GCE A;  3H1H E;  3N0Q A;  1NDO A;  1ZRT E;  4OGQ D;  3H1J E;  3L73 E;  3CXH E;  2A06 E;  2HMK A;  4HM4 A;  3GZY A;  3TGU E;  1EZV E;  1WQL A;  4NB9 A;  2XRX A;  2QPZ A;  4H0L D;  4AAY B;  1NU1 E;  4NBB A;  4NB9 D;  2DE5 A;  3VCA A;  4NBB D;  2DE5 D;  2JZA A;  1SJG A;  2HMJ A;  2QJY C;  1G8J B;  2FYN C;  3DQY A;  2NUK A;  3GTS A;  2B24 A;  1O7P A;  4HM8 A;  3GL0 A;  2NVE A;  3GOB A;  1RFS A;  2CKF A;  1EG9 A;  1WW9 A;  1O7M A;  2IBZ E;  1NTZ E;  1G8K B;  1RIE A;  1SQP E;  4HM0 A;  1PPJ E;  2GBX A;  3L71 E;  4NBC D;  1Z01 A;  4HM7 A;  3GKE A;  4H13 D;  4HKV A;  4QDF B;  1BE3 E;  1VCK A;  3VMH A;  2BMR A;  4HM5 A;  4NBA A;  3VMH D;  3L74 E;  2BCC E;  1L0L E;  2E4Q A;  1O7H A;  4NBA D;  4HM6 A;  2E76 D;  3GTE A;  3C0D A;  4P1B H;  1BCC E;  2NWF A;  4HM3 A;  1Q90 C;  3H1K E;  2YFL A;  1ULI A;  2NVF A;  3VCP A;  2ZYL A;  1O7G A;  2XR8 A;  4QUQ A;  4EMJ B;  2BMO A;  3H1I E;  2HMM A;  5KLV E;  2B1X A;  2NUM A;  4QCK A;  4NBC A;  1O7N A;  4QDC A;  3VMI A;  5HL4 A;  4QUR A;  4P1C H;  1UUV A;  3VMI D;  2XSO A;  3L72 E;  4NB8 A;  3L75 E;  5CXM A;  1NTM E;  5AEU A;  1Z02 A;  2DE7 A;  1VF5 D;  3H1L E;  3D89 A;  4NB8 D;  2DE7 D;  3GB4 A;  5AEW A;  4QDF A;  4NBF A;  1Z03 A;  2GBW A;  2DE6 A;  4NBG A;  4NBF D;  4NBD A;  2DE6 D;  2QJP C;  2D2C D;  4NBG D;  4NBD D;  3VMG D;  3CX5 E;  3GCF A;  3EQQ A;  1NYK A;  4HM2 A;  4PV1 D;  1SQX E;  2YFI A;  4NBE D;  4PD4 E;  2HML A;  2NVG A;  5KLI C;  3GZX A;  2E74 D;  1VM9 A;  2QJK C;  2HMN A;  4AIV A;  1SQB E;  1O7W A;  1PP9 E;  2YFJ A;  2JO6 A;  4U3F E;  1KYO E;  2HMO A;  4HM1 A;  2BMQ A;  3FOU A;  2YIU C;  3AZC A; 
#chains in the Genus database with same CATH topology
 5BOK A;  3BCC E;  3GKQ A;  1KB9 E;  1NTK E;  3EN1 A;  1UUW A;  4QDD A;  3CWB E;  2FYU E;  3VMG A;  1P84 E;  2XSH A;  1ULJ A;  1L0N E;  2Q3W A;  4QUP A;  2I7F A;  1FQT A;  4NBE A;  4NBH A;  5KKZ C;  1JM1 A;  3GL2 A;  4H44 D;  4NBH D;  2E75 D;  2ZT9 D;  1SQV E;  2YVJ B;  4HJL A;  2E4P A;  3L70 E;  1SQQ E;  3GCE A;  3H1H E;  3N0Q A;  1NDO A;  1ZRT E;  4OGQ D;  3H1J E;  3L73 E;  3CXH E;  2A06 E;  2HMK A;  4HM4 A;  3GZY A;  3TGU E;  1EZV E;  1WQL A;  4NB9 A;  2XRX A;  2QPZ A;  4H0L D;  4AAY B;  1NU1 E;  4NBB A;  4NB9 D;  2DE5 A;  3VCA A;  4NBB D;  2DE5 D;  2JZA A;  1SJG A;  2HMJ A;  2QJY C;  1G8J B;  2FYN C;  3DQY A;  2NUK A;  3GTS A;  2B24 A;  1O7P A;  4HM8 A;  3GL0 A;  2NVE A;  3GOB A;  1RFS A;  2CKF A;  1EG9 A;  1WW9 A;  1O7M A;  2IBZ E;  1NTZ E;  1G8K B;  1RIE A;  1SQP E;  4HM0 A;  1PPJ E;  2GBX A;  3L71 E;  4NBC D;  1Z01 A;  4HM7 A;  3GKE A;  4H13 D;  4HKV A;  4QDF B;  1BE3 E;  1VCK A;  3VMH A;  2BMR A;  4HM5 A;  4NBA A;  3VMH D;  3L74 E;  2BCC E;  1L0L E;  2E4Q A;  1O7H A;  4NBA D;  4HM6 A;  2E76 D;  3GTE A;  3C0D A;  4P1B H;  1BCC E;  2NWF A;  4HM3 A;  1Q90 C;  3H1K E;  2YFL A;  1ULI A;  2NVF A;  3VCP A;  2ZYL A;  1O7G A;  2XR8 A;  4QUQ A;  4EMJ B;  2BMO A;  3H1I E;  2HMM A;  5KLV E;  2B1X A;  2NUM A;  4QCK A;  4NBC A;  1O7N A;  4QDC A;  3VMI A;  5HL4 A;  4QUR A;  4P1C H;  1UUV A;  3VMI D;  2XSO A;  3L72 E;  4NB8 A;  3L75 E;  5CXM A;  1NTM E;  5AEU A;  1Z02 A;  2DE7 A;  1VF5 D;  3H1L E;  3D89 A;  4NB8 D;  2DE7 D;  3GB4 A;  5AEW A;  4QDF A;  4NBF A;  1Z03 A;  2GBW A;  2DE6 A;  4NBG A;  4NBF D;  4NBD A;  2DE6 D;  2QJP C;  2D2C D;  4NBG D;  4NBD D;  3VMG D;  3CX5 E;  3GCF A;  3EQQ A;  1NYK A;  4HM2 A;  4PV1 D;  1SQX E;  2YFI A;  4NBE D;  4PD4 E;  2HML A;  2NVG A;  5KLI C;  3GZX A;  2E74 D;  1VM9 A;  2QJK C;  2HMN A;  4AIV A;  1SQB E;  1O7W A;  1PP9 E;  2YFJ A;  2JO6 A;  4U3F E;  1KYO E;  2HMO A;  4HM1 A;  2BMQ A;  3FOU A;  2YIU C;  3AZC A; 
#chains in the Genus database with same CATH homology
 5BOK A;  3BCC E;  3GKQ A;  1KB9 E;  1NTK E;  3EN1 A;  1UUW A;  4QDD A;  3CWB E;  2FYU E;  3VMG A;  1P84 E;  2XSH A;  1ULJ A;  1L0N E;  2Q3W A;  4QUP A;  2I7F A;  1FQT A;  4NBE A;  4NBH A;  5KKZ C;  1JM1 A;  3GL2 A;  4H44 D;  4NBH D;  2E75 D;  2ZT9 D;  1SQV E;  2YVJ B;  4HJL A;  2E4P A;  3L70 E;  1SQQ E;  3GCE A;  3H1H E;  3N0Q A;  1NDO A;  1ZRT E;  4OGQ D;  3H1J E;  3L73 E;  3CXH E;  2A06 E;  2HMK A;  4HM4 A;  3GZY A;  3TGU E;  1EZV E;  1WQL A;  4NB9 A;  2XRX A;  2QPZ A;  4H0L D;  4AAY B;  1NU1 E;  4NBB A;  4NB9 D;  2DE5 A;  3VCA A;  4NBB D;  2DE5 D;  2JZA A;  1SJG A;  2HMJ A;  2QJY C;  1G8J B;  2FYN C;  3DQY A;  2NUK A;  3GTS A;  2B24 A;  1O7P A;  4HM8 A;  3GL0 A;  2NVE A;  3GOB A;  1RFS A;  2CKF A;  1EG9 A;  1WW9 A;  1O7M A;  2IBZ E;  1NTZ E;  1G8K B;  1RIE A;  1SQP E;  4HM0 A;  1PPJ E;  2GBX A;  3L71 E;  4NBC D;  1Z01 A;  4HM7 A;  3GKE A;  4H13 D;  4HKV A;  4QDF B;  1BE3 E;  1VCK A;  3VMH A;  2BMR A;  4HM5 A;  4NBA A;  3VMH D;  3L74 E;  2BCC E;  1L0L E;  2E4Q A;  1O7H A;  4NBA D;  4HM6 A;  2E76 D;  3GTE A;  3C0D A;  4P1B H;  1BCC E;  2NWF A;  4HM3 A;  1Q90 C;  3H1K E;  2YFL A;  1ULI A;  2NVF A;  3VCP A;  2ZYL A;  1O7G A;  2XR8 A;  4QUQ A;  4EMJ B;  2BMO A;  3H1I E;  2HMM A;  5KLV E;  2B1X A;  2NUM A;  4QCK A;  4NBC A;  1O7N A;  4QDC A;  3VMI A;  5HL4 A;  4QUR A;  4P1C H;  1UUV A;  3VMI D;  2XSO A;  3L72 E;  4NB8 A;  3L75 E;  5CXM A;  1NTM E;  5AEU A;  1Z02 A;  2DE7 A;  1VF5 D;  3H1L E;  3D89 A;  4NB8 D;  2DE7 D;  3GB4 A;  5AEW A;  4QDF A;  4NBF A;  1Z03 A;  2GBW A;  2DE6 A;  4NBG A;  4NBF D;  4NBD A;  2DE6 D;  2QJP C;  2D2C D;  4NBG D;  4NBD D;  3VMG D;  3CX5 E;  3GCF A;  3EQQ A;  1NYK A;  4HM2 A;  4PV1 D;  1SQX E;  2YFI A;  4NBE D;  4PD4 E;  2HML A;  2NVG A;  5KLI C;  3GZX A;  2E74 D;  1VM9 A;  2QJK C;  2HMN A;  4AIV A;  1SQB E;  1O7W A;  1PP9 E;  2YFJ A;  2JO6 A;  4U3F E;  1KYO E;  2HMO A;  4HM1 A;  2BMQ A;  3FOU A;  2YIU C;  3AZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...