4QURA

Crystal structure of stachydrine demethylase in complex with cyanide, oxygen, and n-methyl proline in a new orientation
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
415
structure length
415
Chain Sequence
GTENLYFQSMMTANPTSIHQRLDRRLSGFSLEQPFYTSPEVYALDLQHIFYKQWLYAVPVCQLAKAGSYTTLRVGAYEVVIVRSRDGEVRAFHNSCRHRGSLICKARQGQVAKLVCPYHQWTYELDGKLIWANDMGPDFDASKYGLKPVNLRNLDGLIYICLSDTPPDFQTFAQLARPYLEVHDLKDAKVAFTSTIIEKGNWKLVWENNRECYHCSSNHPALCRSFPLDPEVAGVQADGGVSKKLQAHFDRCEAAGTPAQFVLAGDGQYRLARMPLQEKALSYTMDGKAAVSRHLGRVAPPDAGTLLMFHYPSTWNHFLPDHSLTFRVMPISPTETEVTTTWLVHKDAVEGVDYDLKRLTEVWIATNDEDREIVETNQQGILSPAYVPGPYSPGQESGVMQFVDWYAASLERALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tracking photoelectron induced in-crystallo enzyme catalysis
rcsb
source organism Sinorhizobium meliloti 1021
molecule tags Oxidoreductase
molecule keywords monoxygenase; demethylase
total genus 133
structure length 415
sequence length 415
ec nomenclature ec 1.-.-.-:
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4qurA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 4qurA01
2DE6A 3EN1A 3L73E 1KB9E 3BCCE 2BMRA 1EZVE 3L72E 1WQLA 2D2CD 4NBFD 4HM3A 3L70E 1ULIA 3VCPA 2NUMA 1SQQE 2BCCE 2E76D 3VCAA 1NU1E 1JM1A 2HMKA 1ULJA 3VMID 3GB4A 3CX5E 3GKQA 5HL4A 1UUWA 3GKEA 4NBDD 2HMJA 3GOBA 1NTZE 4AIVA 1PPJE 1RIEA 1SJGA 2DE5A 1Q90C 1WW9A 4NB9A 2QPZA 2ZT9D 3GTEA 4QUPA 2E74D 3GZXA 1KYOE 3H1HE 2XSHA 1Z01A 4HM2A 1O7GA 5KLIC 3H1KE 2HMMA 2I7FA 4NBHD 2YFJA 2NVGA 2QJYC 3EQQA 2YIUC 4QDFB 4HJLA 2A06E 4PV1D 2GBXA 1SQXE 4NBAD 1EG9A 1G8JB 4H0LD 4P1CH 4U3FE 3VMGA 2B1XA 3DQYA 4P1BH 5AEUA 1L0LE 4NBHA 2DE6D 1O7HA 1SQBE 2IBZE 2NUKA 4HM8A 1L0NE 4NBAA 1BE3E 5AEWA 2BMOA 3C0DA 1UUVA 1FQTA 4EMJB 4HM7A 3L71E 4QURA 4NBCA 1PP9E 1BCCE 4NBBA 3GZYA 2E4QA 2E75D 1NTME 2QJKC 3GCFA 4NBGA 4HM6A 1ZRTE 2XSOA 5CXMA 4NB8D 1O7NA 2YFIA 4H13D 3VMHD 3D89A 2NVEA 3TGUE 4HM1A 5KLVE 2FYUE 1O7MA 1VF5D 2XR8A 2HMOA 2JZAA 4NB9D 2E4PA 4HM0A 2DE5D 2B24A 4QDDA 1Z02A 1O7PA 4HKVA 2FYNC 4QDCA 2HMLA 4NBDA 1VCKA 2HMNA 2ZYLA 3H1LE 3VMIA 2GBWA 4HM5A 3L74E 3CXHE 3AZCA 3FOUA 1O7WA 2XRXA 3H1IE 2CKFA 1VM9A 4NBBD 4OGQD 1NDOA 4NBCD 5BOKA 4NBFA 3VMHA 3CWBE 1G8KB 4NB8A 1RFSA 3L75E 2DE7D 4NBGD 4PD4E 2QJPC 3GL2A 1Z03A 1NYKA 4H44D 4QDFA 1P84E 3N0QA 3GTSA 3H1JE 4NBEA 4QCKA 3GL0A 5KKZC 2JO6A 4NBED 2NVFA 3VMGD 1SQVE 2BMQA 2YFLA 2YVJB 4AAYB 4HM4A 1SQPE 2Q3WA 3GCEA 2DE7A 1NTKE 4QUQA 2NWFA
chains in the Genus database with same CATH superfamily
2DE6A 3EN1A 3L73E 1KB9E 3BCCE 2BMRA 1EZVE 3L72E 1WQLA 2D2CD 4NBFD 4HM3A 3L70E 1ULIA 3VCPA 2NUMA 1SQQE 2BCCE 2E76D 3VCAA 1NU1E 1JM1A 2HMKA 1ULJA 3VMID 3GB4A 3CX5E 3GKQA 5HL4A 1UUWA 3GKEA 4NBDD 2HMJA 3GOBA 1NTZE 4AIVA 1PPJE 1RIEA 1SJGA 2DE5A 1Q90C 1WW9A 4NB9A 2QPZA 2ZT9D 3GTEA 4QUPA 2E74D 3GZXA 1KYOE 3H1HE 2XSHA 1Z01A 4HM2A 1O7GA 5KLIC 3H1KE 2HMMA 2I7FA 4NBHD 2YFJA 2NVGA 2QJYC 3EQQA 2YIUC 4QDFB 4HJLA 2A06E 4PV1D 2GBXA 1SQXE 4NBAD 1EG9A 1G8JB 4H0LD 4P1CH 4U3FE 3VMGA 2B1XA 3DQYA 4P1BH 5AEUA 1L0LE 4NBHA 2DE6D 1O7HA 1SQBE 2IBZE 2NUKA 4HM8A 1L0NE 4NBAA 1BE3E 5AEWA 2BMOA 3C0DA 1UUVA 1FQTA 4EMJB 4HM7A 3L71E 4QURA 4NBCA 1PP9E 1BCCE 4NBBA 3GZYA 2E4QA 2E75D 1NTME 2QJKC 3GCFA 4NBGA 4HM6A 1ZRTE 2XSOA 5CXMA 4NB8D 1O7NA 2YFIA 4H13D 3VMHD 3D89A 2NVEA 3TGUE 4HM1A 5KLVE 2FYUE 1O7MA 1VF5D 2XR8A 2HMOA 2JZAA 4NB9D 2E4PA 4HM0A 2DE5D 2B24A 4QDDA 1Z02A 1O7PA 4HKVA 2FYNC 4QDCA 2HMLA 4NBDA 1VCKA 2HMNA 2ZYLA 3H1LE 3VMIA 2GBWA 4HM5A 3L74E 3CXHE 3AZCA 3FOUA 1O7WA 2XRXA 3H1IE 2CKFA 1VM9A 4NBBD 4OGQD 1NDOA 4NBCD 5BOKA 4NBFA 3VMHA 3CWBE 1G8KB 4NB8A 1RFSA 3L75E 2DE7D 4NBGD 4PD4E 2QJPC 3GL2A 1Z03A 1NYKA 4H44D 4QDFA 1P84E 3N0QA 3GTSA 3H1JE 4NBEA 4QCKA 3GL0A 5KKZC 2JO6A 4NBED 2NVFA 3VMGD 1SQVE 2BMQA 2YFLA 2YVJB 4AAYB 4HM4A 1SQPE 2Q3WA 3GCEA 2DE7A 1NTKE 4QUQA 2NWFA
chains in the Genus database with same CATH topology
2DE6A 3EN1A 3L73E 1KB9E 3BCCE 2BMRA 1EZVE 3L72E 1WQLA 2D2CD 4NBFD 4HM3A 3L70E 1ULIA 3VCPA 2NUMA 1SQQE 2BCCE 2E76D 3VCAA 1NU1E 1JM1A 2HMKA 1ULJA 3VMID 3GB4A 3CX5E 3GKQA 5HL4A 1UUWA 3GKEA 4NBDD 2HMJA 3GOBA 1NTZE 4AIVA 1PPJE 1RIEA 1SJGA 2DE5A 1Q90C 1WW9A 4NB9A 2QPZA 2ZT9D 3GTEA 4QUPA 2E74D 3GZXA 1KYOE 3H1HE 2XSHA 1Z01A 4HM2A 1O7GA 5KLIC 3H1KE 2HMMA 2I7FA 4NBHD 2YFJA 2NVGA 2QJYC 3EQQA 2YIUC 4QDFB 4HJLA 2A06E 4PV1D 2GBXA 1SQXE 4NBAD 1EG9A 1G8JB 4H0LD 4P1CH 4U3FE 3VMGA 2B1XA 3DQYA 4P1BH 5AEUA 1L0LE 4NBHA 2DE6D 1O7HA 1SQBE 2IBZE 2NUKA 4HM8A 1L0NE 4NBAA 1BE3E 5AEWA 2BMOA 3C0DA 1UUVA 1FQTA 4EMJB 4HM7A 3L71E 4QURA 4NBCA 1PP9E 1BCCE 4NBBA 3GZYA 2E4QA 2E75D 1NTME 2QJKC 3GCFA 4NBGA 4HM6A 1ZRTE 2XSOA 5CXMA 4NB8D 1O7NA 2YFIA 4H13D 3VMHD 3D89A 2NVEA 3TGUE 4HM1A 5KLVE 2FYUE 1O7MA 1VF5D 2XR8A 2HMOA 2JZAA 4NB9D 2E4PA 4HM0A 2DE5D 2B24A 4QDDA 1Z02A 1O7PA 4HKVA 2FYNC 4QDCA 2HMLA 4NBDA 1VCKA 2HMNA 2ZYLA 3H1LE 3VMIA 2GBWA 4HM5A 3L74E 3CXHE 3AZCA 3FOUA 1O7WA 2XRXA 3H1IE 2CKFA 1VM9A 4NBBD 4OGQD 1NDOA 4NBCD 5BOKA 4NBFA 3VMHA 3CWBE 1G8KB 4NB8A 1RFSA 3L75E 2DE7D 4NBGD 4PD4E 2QJPC 3GL2A 1Z03A 1NYKA 4H44D 4QDFA 1P84E 3N0QA 3GTSA 3H1JE 4NBEA 4QCKA 3GL0A 5KKZC 2JO6A 4NBED 2NVFA 3VMGD 1SQVE 2BMQA 2YFLA 2YVJB 4AAYB 4HM4A 1SQPE 2Q3WA 3GCEA 2DE7A 1NTKE 4QUQA 2NWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DE6 A;  3EN1 A;  3L73 E;  1KB9 E;  3BCC E;  2BMR A;  1EZV E;  3L72 E;  1WQL A;  2D2C D;  4NBF D;  4HM3 A;  3L70 E;  1ULI A;  3VCP A;  2NUM A;  1SQQ E;  2BCC E;  2E76 D;  3VCA A;  1NU1 E;  1JM1 A;  2HMK A;  1ULJ A;  3VMI D;  3GB4 A;  3CX5 E;  3GKQ A;  5HL4 A;  1UUW A;  3GKE A;  4NBD D;  2HMJ A;  3GOB A;  1NTZ E;  4AIV A;  1PPJ E;  1RIE A;  1SJG A;  2DE5 A;  1Q90 C;  1WW9 A;  4NB9 A;  2QPZ A;  2ZT9 D;  3GTE A;  4QUP A;  2E74 D;  3GZX A;  1KYO E;  3H1H E;  2XSH A;  1Z01 A;  4HM2 A;  1O7G A;  5KLI C;  3H1K E;  2HMM A;  2I7F A;  4NBH D;  2YFJ A;  2NVG A;  2QJY C;  3EQQ A;  2YIU C;  4QDF B;  4HJL A;  2A06 E;  4PV1 D;  2GBX A;  1SQX E;  4NBA D;  1EG9 A;  1G8J B;  4H0L D;  4P1C H;  4U3F E;  3VMG A;  2B1X A;  3DQY A;  4P1B H;  5AEU A;  1L0L E;  4NBH A;  2DE6 D;  1O7H A;  1SQB E;  2IBZ E;  2NUK A;  4HM8 A;  1L0N E;  4NBA A;  1BE3 E;  5AEW A;  2BMO A;  3C0D A;  1UUV A;  1FQT A;  4EMJ B;  4HM7 A;  3L71 E;  4QUR A;  4NBC A;  1PP9 E;  1BCC E;  4NBB A;  3GZY A;  2E4Q A;  2E75 D;  1NTM E;  2QJK C;  3GCF A;  4NBG A;  4HM6 A;  1ZRT E;  2XSO A;  5CXM A;  4NB8 D;  1O7N A;  2YFI A;  4H13 D;  3VMH D;  3D89 A;  2NVE A;  3TGU E;  4HM1 A;  5KLV E;  2FYU E;  1O7M A;  1VF5 D;  2XR8 A;  2HMO A;  2JZA A;  4NB9 D;  2E4P A;  4HM0 A;  2DE5 D;  2B24 A;  4QDD A;  1Z02 A;  1O7P A;  4HKV A;  2FYN C;  4QDC A;  2HML A;  4NBD A;  1VCK A;  2HMN A;  2ZYL A;  3H1L E;  3VMI A;  2GBW A;  4HM5 A;  3L74 E;  3CXH E;  3AZC A;  3FOU A;  1O7W A;  2XRX A;  3H1I E;  2CKF A;  1VM9 A;  4NBB D;  4OGQ D;  1NDO A;  4NBC D;  5BOK A;  4NBF A;  3VMH A;  3CWB E;  1G8K B;  4NB8 A;  1RFS A;  3L75 E;  2DE7 D;  4NBG D;  4PD4 E;  2QJP C;  3GL2 A;  1Z03 A;  1NYK A;  4H44 D;  4QDF A;  1P84 E;  3N0Q A;  3GTS A;  3H1J E;  4NBE A;  4QCK A;  3GL0 A;  5KKZ C;  2JO6 A;  4NBE D;  2NVF A;  3VMG D;  1SQV E;  2BMQ A;  2YFL A;  2YVJ B;  4AAY B;  4HM4 A;  1SQP E;  2Q3W A;  3GCE A;  2DE7 A;  1NTK E;  4QUQ A;  2NWF A; 
#chains in the Genus database with same CATH topology
 2DE6 A;  3EN1 A;  3L73 E;  1KB9 E;  3BCC E;  2BMR A;  1EZV E;  3L72 E;  1WQL A;  2D2C D;  4NBF D;  4HM3 A;  3L70 E;  1ULI A;  3VCP A;  2NUM A;  1SQQ E;  2BCC E;  2E76 D;  3VCA A;  1NU1 E;  1JM1 A;  2HMK A;  1ULJ A;  3VMI D;  3GB4 A;  3CX5 E;  3GKQ A;  5HL4 A;  1UUW A;  3GKE A;  4NBD D;  2HMJ A;  3GOB A;  1NTZ E;  4AIV A;  1PPJ E;  1RIE A;  1SJG A;  2DE5 A;  1Q90 C;  1WW9 A;  4NB9 A;  2QPZ A;  2ZT9 D;  3GTE A;  4QUP A;  2E74 D;  3GZX A;  1KYO E;  3H1H E;  2XSH A;  1Z01 A;  4HM2 A;  1O7G A;  5KLI C;  3H1K E;  2HMM A;  2I7F A;  4NBH D;  2YFJ A;  2NVG A;  2QJY C;  3EQQ A;  2YIU C;  4QDF B;  4HJL A;  2A06 E;  4PV1 D;  2GBX A;  1SQX E;  4NBA D;  1EG9 A;  1G8J B;  4H0L D;  4P1C H;  4U3F E;  3VMG A;  2B1X A;  3DQY A;  4P1B H;  5AEU A;  1L0L E;  4NBH A;  2DE6 D;  1O7H A;  1SQB E;  2IBZ E;  2NUK A;  4HM8 A;  1L0N E;  4NBA A;  1BE3 E;  5AEW A;  2BMO A;  3C0D A;  1UUV A;  1FQT A;  4EMJ B;  4HM7 A;  3L71 E;  4QUR A;  4NBC A;  1PP9 E;  1BCC E;  4NBB A;  3GZY A;  2E4Q A;  2E75 D;  1NTM E;  2QJK C;  3GCF A;  4NBG A;  4HM6 A;  1ZRT E;  2XSO A;  5CXM A;  4NB8 D;  1O7N A;  2YFI A;  4H13 D;  3VMH D;  3D89 A;  2NVE A;  3TGU E;  4HM1 A;  5KLV E;  2FYU E;  1O7M A;  1VF5 D;  2XR8 A;  2HMO A;  2JZA A;  4NB9 D;  2E4P A;  4HM0 A;  2DE5 D;  2B24 A;  4QDD A;  1Z02 A;  1O7P A;  4HKV A;  2FYN C;  4QDC A;  2HML A;  4NBD A;  1VCK A;  2HMN A;  2ZYL A;  3H1L E;  3VMI A;  2GBW A;  4HM5 A;  3L74 E;  3CXH E;  3AZC A;  3FOU A;  1O7W A;  2XRX A;  3H1I E;  2CKF A;  1VM9 A;  4NBB D;  4OGQ D;  1NDO A;  4NBC D;  5BOK A;  4NBF A;  3VMH A;  3CWB E;  1G8K B;  4NB8 A;  1RFS A;  3L75 E;  2DE7 D;  4NBG D;  4PD4 E;  2QJP C;  3GL2 A;  1Z03 A;  1NYK A;  4H44 D;  4QDF A;  1P84 E;  3N0Q A;  3GTS A;  3H1J E;  4NBE A;  4QCK A;  3GL0 A;  5KKZ C;  2JO6 A;  4NBE D;  2NVF A;  3VMG D;  1SQV E;  2BMQ A;  2YFL A;  2YVJ B;  4AAY B;  4HM4 A;  1SQP E;  2Q3W A;  3GCE A;  2DE7 A;  1NTK E;  4QUQ A;  2NWF A; 
#chains in the Genus database with same CATH homology
 2DE6 A;  3EN1 A;  3L73 E;  1KB9 E;  3BCC E;  2BMR A;  1EZV E;  3L72 E;  1WQL A;  2D2C D;  4NBF D;  4HM3 A;  3L70 E;  1ULI A;  3VCP A;  2NUM A;  1SQQ E;  2BCC E;  2E76 D;  3VCA A;  1NU1 E;  1JM1 A;  2HMK A;  1ULJ A;  3VMI D;  3GB4 A;  3CX5 E;  3GKQ A;  5HL4 A;  1UUW A;  3GKE A;  4NBD D;  2HMJ A;  3GOB A;  1NTZ E;  4AIV A;  1PPJ E;  1RIE A;  1SJG A;  2DE5 A;  1Q90 C;  1WW9 A;  4NB9 A;  2QPZ A;  2ZT9 D;  3GTE A;  4QUP A;  2E74 D;  3GZX A;  1KYO E;  3H1H E;  2XSH A;  1Z01 A;  4HM2 A;  1O7G A;  5KLI C;  3H1K E;  2HMM A;  2I7F A;  4NBH D;  2YFJ A;  2NVG A;  2QJY C;  3EQQ A;  2YIU C;  4QDF B;  4HJL A;  2A06 E;  4PV1 D;  2GBX A;  1SQX E;  4NBA D;  1EG9 A;  1G8J B;  4H0L D;  4P1C H;  4U3F E;  3VMG A;  2B1X A;  3DQY A;  4P1B H;  5AEU A;  1L0L E;  4NBH A;  2DE6 D;  1O7H A;  1SQB E;  2IBZ E;  2NUK A;  4HM8 A;  1L0N E;  4NBA A;  1BE3 E;  5AEW A;  2BMO A;  3C0D A;  1UUV A;  1FQT A;  4EMJ B;  4HM7 A;  3L71 E;  4QUR A;  4NBC A;  1PP9 E;  1BCC E;  4NBB A;  3GZY A;  2E4Q A;  2E75 D;  1NTM E;  2QJK C;  3GCF A;  4NBG A;  4HM6 A;  1ZRT E;  2XSO A;  5CXM A;  4NB8 D;  1O7N A;  2YFI A;  4H13 D;  3VMH D;  3D89 A;  2NVE A;  3TGU E;  4HM1 A;  5KLV E;  2FYU E;  1O7M A;  1VF5 D;  2XR8 A;  2HMO A;  2JZA A;  4NB9 D;  2E4P A;  4HM0 A;  2DE5 D;  2B24 A;  4QDD A;  1Z02 A;  1O7P A;  4HKV A;  2FYN C;  4QDC A;  2HML A;  4NBD A;  1VCK A;  2HMN A;  2ZYL A;  3H1L E;  3VMI A;  2GBW A;  4HM5 A;  3L74 E;  3CXH E;  3AZC A;  3FOU A;  1O7W A;  2XRX A;  3H1I E;  2CKF A;  1VM9 A;  4NBB D;  4OGQ D;  1NDO A;  4NBC D;  5BOK A;  4NBF A;  3VMH A;  3CWB E;  1G8K B;  4NB8 A;  1RFS A;  3L75 E;  2DE7 D;  4NBG D;  4PD4 E;  2QJP C;  3GL2 A;  1Z03 A;  1NYK A;  4H44 D;  4QDF A;  1P84 E;  3N0Q A;  3GTS A;  3H1J E;  4NBE A;  4QCK A;  3GL0 A;  5KKZ C;  2JO6 A;  4NBE D;  2NVF A;  3VMG D;  1SQV E;  2BMQ A;  2YFL A;  2YVJ B;  4AAY B;  4HM4 A;  1SQP E;  2Q3W A;  3GCE A;  2DE7 A;  1NTK E;  4QUQ A;  2NWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...