4QURA

Crystal structure of stachydrine demethylase in complex with cyanide, oxygen, and n-methyl proline in a new orientation
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
415
structure length
415
Chain Sequence
b'GTENLYFQSMMTANPTSIHQRLDRRLSGFSLEQPFYTSPEVYALDLQHIFYKQWLYAVPVCQLAKAGSYTTLRVGAYEVVIVRSRDGEVRAFHNSCRHRGSLICKARQGQVAKLVCPYHQWTYELDGKLIWANDMGPDFDASKYGLKPVNLRNLDGLIYICLSDTPPDFQTFAQLARPYLEVHDLKDAKVAFTSTIIEKGNWKLVWENNRECYHCSSNHPALCRSFPLDPEVAGVQADGGVSKKLQAHFDRCEAAGTPAQFVLAGDGQYRLARMPLQEKALSYTMDGKAAVSRHLGRVAPPDAGTLLMFHYPSTWNHFLPDHSLTFRVMPISPTETEVTTTWLVHKDAVEGVDYDLKRLTEVWIATNDEDREIVETNQQGILSPAYVPGPYSPGQESGVMQFVDWYAASLERALA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords monoxygenase; demethylase
publication title Tracking photoelectron induced in-crystallo enzyme catalysis
rcsb
source organism Sinorhizobium meliloti 1021
molecule tags Oxidoreductase
total genus 133
structure length 415
sequence length 415
ec nomenclature ec 1.-.-.-:
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4qurA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 4qurA01
5BOKA 1ULJA 3EQQA 2ZYLA 1O7PA 4P1BH 4NBGA 3GTSA 3H1KE 3VCPA 2DE7A 4QDFB 1NTME 3BCCE 3GKEA 4NBCD 4HM0A 4QUQA 1Z03A 1VCKA 2QJPC 3CWBE 3GL0A 1KYOE 4HM4A 4NBEA 1O7MA 1KB9E 5HL4A 4NB8D 4QCKA 2JZAA 4HJLA 1FQTA 2E74D 2FYUE 2QJYC 3GKQA 2DE5D 4NBCA 2HMKA 1SJGA 1NDOA 1NTKE 2B1XA 1L0LE 1UUVA 5KKZC 2E75D 2BMRA 3FOUA 1G8JB 2QPZA 3L71E 4OGQD 3VCAA 4PD4E 4QDCA 4NB8A 4U3FE 4AAYB 2JO6A 2NUKA 1SQBE 2XSHA 1EZVE 2B24A 2YFJA 3VMIA 4NB9A 3L75E 1VF5D 2YFLA 3H1HE 2BCCE 3L74E 4NBFA 4NBDD 3GOBA 3VMGD 4AIVA 2IBZE 3L70E 2HMJA 5KLIC 1RFSA 4P1CH 5AEUA 1O7HA 1PP9E 2XRXA 3H1LE 4H13D 4H44D 3GZXA 4NBHD 4HM7A 1WQLA 1NTZE 1WW9A 3DQYA 1RIEA 1ZRTE 3CX5E 4NBBD 2HMMA 4HKVA 1SQPE 1Q90C 4QDDA 1ULIA 1O7GA 2XSOA 4PV1D 4NBHA 5CXMA 3TGUE 3CXHE 3H1IE 4HM5A 2DE5A 1SQXE 2FYNC 4HM8A 3VMHD 4NBBA 1SQVE 1NYKA 2D2CD 2Q3WA 3EN1A 2NUMA 2NVEA 2E76D 4HM3A 2BMOA 3C0DA 1G8KB 2DE6D 2I7FA 3AZCA 1Z01A 3L72E 3GCFA 4HM6A 2E4QA 4QURA 3GL2A 2NVFA 1O7WA 1JM1A 2YIUC 2HMLA 2E4PA 4NBDA 3VMGA 4HM1A 1Z02A 2BMQA 1UUWA 3D89A 3GZYA 1BCCE 2QJKC 2NWFA 4EMJB 2YVJB 4H0LD 5AEWA 2ZT9D 5KLVE 2DE6A 2GBWA 4NBAD 4HM2A 1PPJE 2HMOA 2A06E 3GTEA 1EG9A 3N0QA 1P84E 4QUPA 3H1JE 3L73E 2NVGA 2GBXA 4NBGD 1O7NA 3VMID 2DE7D 2CKFA 4NB9D 4NBAA 1SQQE 2XR8A 4NBFD 4QDFA 1L0NE 2YFIA 3GB4A 3GCEA 3VMHA 1NU1E 1BE3E 4NBED 2HMNA 1VM9A
chains in the Genus database with same CATH superfamily
5BOKA 1ULJA 3EQQA 2ZYLA 1O7PA 4P1BH 4NBGA 3GTSA 3H1KE 3VCPA 2DE7A 4QDFB 1NTME 3BCCE 3GKEA 4NBCD 4HM0A 4QUQA 1Z03A 1VCKA 2QJPC 3CWBE 3GL0A 1KYOE 4HM4A 4NBEA 1O7MA 1KB9E 5HL4A 4NB8D 4QCKA 2JZAA 4HJLA 1FQTA 2E74D 2FYUE 2QJYC 3GKQA 2DE5D 4NBCA 2HMKA 1SJGA 1NDOA 1NTKE 2B1XA 1L0LE 1UUVA 5KKZC 2E75D 2BMRA 3FOUA 1G8JB 2QPZA 3L71E 4OGQD 3VCAA 4PD4E 4QDCA 4NB8A 4U3FE 4AAYB 2JO6A 2NUKA 1SQBE 2XSHA 1EZVE 2B24A 2YFJA 3VMIA 4NB9A 3L75E 1VF5D 2YFLA 3H1HE 2BCCE 3L74E 4NBFA 4NBDD 3GOBA 3VMGD 4AIVA 2IBZE 3L70E 2HMJA 5KLIC 1RFSA 4P1CH 5AEUA 1O7HA 1PP9E 2XRXA 3H1LE 4H13D 4H44D 3GZXA 4NBHD 4HM7A 1WQLA 1NTZE 1WW9A 3DQYA 1RIEA 1ZRTE 3CX5E 4NBBD 2HMMA 4HKVA 1SQPE 1Q90C 4QDDA 1ULIA 1O7GA 2XSOA 4PV1D 4NBHA 5CXMA 3TGUE 3CXHE 3H1IE 4HM5A 2DE5A 1SQXE 2FYNC 4HM8A 3VMHD 4NBBA 1SQVE 1NYKA 2D2CD 2Q3WA 3EN1A 2NUMA 2NVEA 2E76D 4HM3A 2BMOA 3C0DA 1G8KB 2DE6D 2I7FA 3AZCA 1Z01A 3L72E 3GCFA 4HM6A 2E4QA 4QURA 3GL2A 2NVFA 1O7WA 1JM1A 2YIUC 2HMLA 2E4PA 4NBDA 3VMGA 4HM1A 1Z02A 2BMQA 1UUWA 3D89A 3GZYA 1BCCE 2QJKC 2NWFA 4EMJB 2YVJB 4H0LD 5AEWA 2ZT9D 5KLVE 2DE6A 2GBWA 4NBAD 4HM2A 1PPJE 2HMOA 2A06E 3GTEA 1EG9A 3N0QA 1P84E 4QUPA 3H1JE 3L73E 2NVGA 2GBXA 4NBGD 1O7NA 3VMID 2DE7D 2CKFA 4NB9D 4NBAA 1SQQE 2XR8A 4NBFD 4QDFA 1L0NE 2YFIA 3GB4A 3GCEA 3VMHA 1NU1E 1BE3E 4NBED 2HMNA 1VM9A
chains in the Genus database with same CATH topology
5BOKA 1ULJA 3EQQA 2ZYLA 1O7PA 4P1BH 4NBGA 3GTSA 3H1KE 3VCPA 2DE7A 4QDFB 1NTME 3BCCE 3GKEA 4NBCD 4HM0A 4QUQA 1Z03A 1VCKA 2QJPC 3CWBE 3GL0A 1KYOE 4HM4A 4NBEA 1O7MA 1KB9E 5HL4A 4NB8D 4QCKA 2JZAA 4HJLA 1FQTA 2E74D 2FYUE 2QJYC 3GKQA 2DE5D 4NBCA 2HMKA 1SJGA 1NDOA 1NTKE 2B1XA 1L0LE 1UUVA 5KKZC 2E75D 2BMRA 3FOUA 1G8JB 2QPZA 3L71E 4OGQD 3VCAA 4PD4E 4QDCA 4NB8A 4U3FE 4AAYB 2JO6A 2NUKA 1SQBE 2XSHA 1EZVE 2B24A 2YFJA 3VMIA 4NB9A 3L75E 1VF5D 2YFLA 3H1HE 2BCCE 3L74E 4NBFA 4NBDD 3GOBA 3VMGD 4AIVA 2IBZE 3L70E 2HMJA 5KLIC 1RFSA 4P1CH 5AEUA 1O7HA 1PP9E 2XRXA 3H1LE 4H13D 4H44D 3GZXA 4NBHD 4HM7A 1WQLA 1NTZE 1WW9A 3DQYA 1RIEA 1ZRTE 3CX5E 4NBBD 2HMMA 4HKVA 1SQPE 1Q90C 4QDDA 1ULIA 1O7GA 2XSOA 4PV1D 4NBHA 5CXMA 3TGUE 3CXHE 3H1IE 4HM5A 2DE5A 1SQXE 2FYNC 4HM8A 3VMHD 4NBBA 1SQVE 1NYKA 2D2CD 2Q3WA 3EN1A 2NUMA 2NVEA 2E76D 4HM3A 2BMOA 3C0DA 1G8KB 2DE6D 2I7FA 3AZCA 1Z01A 3L72E 3GCFA 4HM6A 2E4QA 4QURA 3GL2A 2NVFA 1O7WA 1JM1A 2YIUC 2HMLA 2E4PA 4NBDA 3VMGA 4HM1A 1Z02A 2BMQA 1UUWA 3D89A 3GZYA 1BCCE 2QJKC 2NWFA 4EMJB 2YVJB 4H0LD 5AEWA 2ZT9D 5KLVE 2DE6A 2GBWA 4NBAD 4HM2A 1PPJE 2HMOA 2A06E 3GTEA 1EG9A 3N0QA 1P84E 4QUPA 3H1JE 3L73E 2NVGA 2GBXA 4NBGD 1O7NA 3VMID 2DE7D 2CKFA 4NB9D 4NBAA 1SQQE 2XR8A 4NBFD 4QDFA 1L0NE 2YFIA 3GB4A 3GCEA 3VMHA 1NU1E 1BE3E 4NBED 2HMNA 1VM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BOK A;  1ULJ A;  3EQQ A;  2ZYL A;  1O7P A;  4P1B H;  4NBG A;  3GTS A;  3H1K E;  3VCP A;  2DE7 A;  4QDF B;  1NTM E;  3BCC E;  3GKE A;  4NBC D;  4HM0 A;  4QUQ A;  1Z03 A;  1VCK A;  2QJP C;  3CWB E;  3GL0 A;  1KYO E;  4HM4 A;  4NBE A;  1O7M A;  1KB9 E;  5HL4 A;  4NB8 D;  4QCK A;  2JZA A;  4HJL A;  1FQT A;  2E74 D;  2FYU E;  2QJY C;  3GKQ A;  2DE5 D;  4NBC A;  2HMK A;  1SJG A;  1NDO A;  1NTK E;  2B1X A;  1L0L E;  1UUV A;  5KKZ C;  2E75 D;  2BMR A;  3FOU A;  1G8J B;  2QPZ A;  3L71 E;  4OGQ D;  3VCA A;  4PD4 E;  4QDC A;  4NB8 A;  4U3F E;  4AAY B;  2JO6 A;  2NUK A;  1SQB E;  2XSH A;  1EZV E;  2B24 A;  2YFJ A;  3VMI A;  4NB9 A;  3L75 E;  1VF5 D;  2YFL A;  3H1H E;  2BCC E;  3L74 E;  4NBF A;  4NBD D;  3GOB A;  3VMG D;  4AIV A;  2IBZ E;  3L70 E;  2HMJ A;  5KLI C;  1RFS A;  4P1C H;  5AEU A;  1O7H A;  1PP9 E;  2XRX A;  3H1L E;  4H13 D;  4H44 D;  3GZX A;  4NBH D;  4HM7 A;  1WQL A;  1NTZ E;  1WW9 A;  3DQY A;  1RIE A;  1ZRT E;  3CX5 E;  4NBB D;  2HMM A;  4HKV A;  1SQP E;  1Q90 C;  4QDD A;  1ULI A;  1O7G A;  2XSO A;  4PV1 D;  4NBH A;  5CXM A;  3TGU E;  3CXH E;  3H1I E;  4HM5 A;  2DE5 A;  1SQX E;  2FYN C;  4HM8 A;  3VMH D;  4NBB A;  1SQV E;  1NYK A;  2D2C D;  2Q3W A;  3EN1 A;  2NUM A;  2NVE A;  2E76 D;  4HM3 A;  2BMO A;  3C0D A;  1G8K B;  2DE6 D;  2I7F A;  3AZC A;  1Z01 A;  3L72 E;  3GCF A;  4HM6 A;  2E4Q A;  4QUR A;  3GL2 A;  2NVF A;  1O7W A;  1JM1 A;  2YIU C;  2HML A;  2E4P A;  4NBD A;  3VMG A;  4HM1 A;  1Z02 A;  2BMQ A;  1UUW A;  3D89 A;  3GZY A;  1BCC E;  2QJK C;  2NWF A;  4EMJ B;  2YVJ B;  4H0L D;  5AEW A;  2ZT9 D;  5KLV E;  2DE6 A;  2GBW A;  4NBA D;  4HM2 A;  1PPJ E;  2HMO A;  2A06 E;  3GTE A;  1EG9 A;  3N0Q A;  1P84 E;  4QUP A;  3H1J E;  3L73 E;  2NVG A;  2GBX A;  4NBG D;  1O7N A;  3VMI D;  2DE7 D;  2CKF A;  4NB9 D;  4NBA A;  1SQQ E;  2XR8 A;  4NBF D;  4QDF A;  1L0N E;  2YFI A;  3GB4 A;  3GCE A;  3VMH A;  1NU1 E;  1BE3 E;  4NBE D;  2HMN A;  1VM9 A; 
#chains in the Genus database with same CATH topology
 5BOK A;  1ULJ A;  3EQQ A;  2ZYL A;  1O7P A;  4P1B H;  4NBG A;  3GTS A;  3H1K E;  3VCP A;  2DE7 A;  4QDF B;  1NTM E;  3BCC E;  3GKE A;  4NBC D;  4HM0 A;  4QUQ A;  1Z03 A;  1VCK A;  2QJP C;  3CWB E;  3GL0 A;  1KYO E;  4HM4 A;  4NBE A;  1O7M A;  1KB9 E;  5HL4 A;  4NB8 D;  4QCK A;  2JZA A;  4HJL A;  1FQT A;  2E74 D;  2FYU E;  2QJY C;  3GKQ A;  2DE5 D;  4NBC A;  2HMK A;  1SJG A;  1NDO A;  1NTK E;  2B1X A;  1L0L E;  1UUV A;  5KKZ C;  2E75 D;  2BMR A;  3FOU A;  1G8J B;  2QPZ A;  3L71 E;  4OGQ D;  3VCA A;  4PD4 E;  4QDC A;  4NB8 A;  4U3F E;  4AAY B;  2JO6 A;  2NUK A;  1SQB E;  2XSH A;  1EZV E;  2B24 A;  2YFJ A;  3VMI A;  4NB9 A;  3L75 E;  1VF5 D;  2YFL A;  3H1H E;  2BCC E;  3L74 E;  4NBF A;  4NBD D;  3GOB A;  3VMG D;  4AIV A;  2IBZ E;  3L70 E;  2HMJ A;  5KLI C;  1RFS A;  4P1C H;  5AEU A;  1O7H A;  1PP9 E;  2XRX A;  3H1L E;  4H13 D;  4H44 D;  3GZX A;  4NBH D;  4HM7 A;  1WQL A;  1NTZ E;  1WW9 A;  3DQY A;  1RIE A;  1ZRT E;  3CX5 E;  4NBB D;  2HMM A;  4HKV A;  1SQP E;  1Q90 C;  4QDD A;  1ULI A;  1O7G A;  2XSO A;  4PV1 D;  4NBH A;  5CXM A;  3TGU E;  3CXH E;  3H1I E;  4HM5 A;  2DE5 A;  1SQX E;  2FYN C;  4HM8 A;  3VMH D;  4NBB A;  1SQV E;  1NYK A;  2D2C D;  2Q3W A;  3EN1 A;  2NUM A;  2NVE A;  2E76 D;  4HM3 A;  2BMO A;  3C0D A;  1G8K B;  2DE6 D;  2I7F A;  3AZC A;  1Z01 A;  3L72 E;  3GCF A;  4HM6 A;  2E4Q A;  4QUR A;  3GL2 A;  2NVF A;  1O7W A;  1JM1 A;  2YIU C;  2HML A;  2E4P A;  4NBD A;  3VMG A;  4HM1 A;  1Z02 A;  2BMQ A;  1UUW A;  3D89 A;  3GZY A;  1BCC E;  2QJK C;  2NWF A;  4EMJ B;  2YVJ B;  4H0L D;  5AEW A;  2ZT9 D;  5KLV E;  2DE6 A;  2GBW A;  4NBA D;  4HM2 A;  1PPJ E;  2HMO A;  2A06 E;  3GTE A;  1EG9 A;  3N0Q A;  1P84 E;  4QUP A;  3H1J E;  3L73 E;  2NVG A;  2GBX A;  4NBG D;  1O7N A;  3VMI D;  2DE7 D;  2CKF A;  4NB9 D;  4NBA A;  1SQQ E;  2XR8 A;  4NBF D;  4QDF A;  1L0N E;  2YFI A;  3GB4 A;  3GCE A;  3VMH A;  1NU1 E;  1BE3 E;  4NBE D;  2HMN A;  1VM9 A; 
#chains in the Genus database with same CATH homology
 5BOK A;  1ULJ A;  3EQQ A;  2ZYL A;  1O7P A;  4P1B H;  4NBG A;  3GTS A;  3H1K E;  3VCP A;  2DE7 A;  4QDF B;  1NTM E;  3BCC E;  3GKE A;  4NBC D;  4HM0 A;  4QUQ A;  1Z03 A;  1VCK A;  2QJP C;  3CWB E;  3GL0 A;  1KYO E;  4HM4 A;  4NBE A;  1O7M A;  1KB9 E;  5HL4 A;  4NB8 D;  4QCK A;  2JZA A;  4HJL A;  1FQT A;  2E74 D;  2FYU E;  2QJY C;  3GKQ A;  2DE5 D;  4NBC A;  2HMK A;  1SJG A;  1NDO A;  1NTK E;  2B1X A;  1L0L E;  1UUV A;  5KKZ C;  2E75 D;  2BMR A;  3FOU A;  1G8J B;  2QPZ A;  3L71 E;  4OGQ D;  3VCA A;  4PD4 E;  4QDC A;  4NB8 A;  4U3F E;  4AAY B;  2JO6 A;  2NUK A;  1SQB E;  2XSH A;  1EZV E;  2B24 A;  2YFJ A;  3VMI A;  4NB9 A;  3L75 E;  1VF5 D;  2YFL A;  3H1H E;  2BCC E;  3L74 E;  4NBF A;  4NBD D;  3GOB A;  3VMG D;  4AIV A;  2IBZ E;  3L70 E;  2HMJ A;  5KLI C;  1RFS A;  4P1C H;  5AEU A;  1O7H A;  1PP9 E;  2XRX A;  3H1L E;  4H13 D;  4H44 D;  3GZX A;  4NBH D;  4HM7 A;  1WQL A;  1NTZ E;  1WW9 A;  3DQY A;  1RIE A;  1ZRT E;  3CX5 E;  4NBB D;  2HMM A;  4HKV A;  1SQP E;  1Q90 C;  4QDD A;  1ULI A;  1O7G A;  2XSO A;  4PV1 D;  4NBH A;  5CXM A;  3TGU E;  3CXH E;  3H1I E;  4HM5 A;  2DE5 A;  1SQX E;  2FYN C;  4HM8 A;  3VMH D;  4NBB A;  1SQV E;  1NYK A;  2D2C D;  2Q3W A;  3EN1 A;  2NUM A;  2NVE A;  2E76 D;  4HM3 A;  2BMO A;  3C0D A;  1G8K B;  2DE6 D;  2I7F A;  3AZC A;  1Z01 A;  3L72 E;  3GCF A;  4HM6 A;  2E4Q A;  4QUR A;  3GL2 A;  2NVF A;  1O7W A;  1JM1 A;  2YIU C;  2HML A;  2E4P A;  4NBD A;  3VMG A;  4HM1 A;  1Z02 A;  2BMQ A;  1UUW A;  3D89 A;  3GZY A;  1BCC E;  2QJK C;  2NWF A;  4EMJ B;  2YVJ B;  4H0L D;  5AEW A;  2ZT9 D;  5KLV E;  2DE6 A;  2GBW A;  4NBA D;  4HM2 A;  1PPJ E;  2HMO A;  2A06 E;  3GTE A;  1EG9 A;  3N0Q A;  1P84 E;  4QUP A;  3H1J E;  3L73 E;  2NVG A;  2GBX A;  4NBG D;  1O7N A;  3VMI D;  2DE7 D;  2CKF A;  4NB9 D;  4NBA A;  1SQQ E;  2XR8 A;  4NBF D;  4QDF A;  1L0N E;  2YFI A;  3GB4 A;  3GCE A;  3VMH A;  1NU1 E;  1BE3 E;  4NBE D;  2HMN A;  1VM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...