4QVKA

Apo-crystal structure of podospora anserina methyltransferase pamth1
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
235
structure length
235
Chain Sequence
LGSILPFNEETADRVSAYCEKNSHGIPDALVEHWEWTRTRFPDADKMSSRLQGSWMIFTARDRKPKRILEIGCYSGYSALAWYEGTRDTKAEIVTLEYSPKMIAASREAFKKYGVGDRVKLIEGPAENTLKTLEGEFDLIFVDANKDGYAGYVKTILDQGLLSANGIILCDNVFARGLTIGPDCAPWLNDHVRPYWNGCGQALDKFSAGLMEDPRIDVLLLPVFDGVTQIRWKDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Biophysical Characterization of the S-Adenosylmethionine-dependent O-Methyltransferase PaMTH1, a Putative Enzyme Accumulating during Senescence of Podospora anserina.
pubmed doi rcsb
source organism Podospora anserina
molecule tags Transferase
molecule keywords PaMTH1 Methyltransferase
total genus 87
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4qvkA00
1RJDA 2GAFA 3KQWA 3DXXA 3ELYA 2YR0A 3HVIA 1ZGAA 2JJQA 2P35A 3NVKI 3NW9A 1PJZA 2ZZNA 3DXZA 3OFJA 1Q0TA 3OFKA 1HMYA 1XDUA 1NBHA 3PFHA 4PNEA 4QPNA 2K4MA 3OU2A 3JWHA 4AZTA 4RTOA 1YFLA 3EGEA 4EKIA 5DX8A 3OE5A 3T7SA 2JH8A 5FUBA 1F38A 4E2WA 3F4KA 2P1DA 4EKGA 4GC5A 2G8NA 4QDJA 3MCTA 1BHJA 1SUSA 3KQTA 1MHTA 3I58A 1WG8A 2FK7A 4C07A 4E2YA 1IY9A 3HP7A 3HEMA 2AN5A 3IEIA 3KKZA 1XCJA 5EHIA 2OYRA 3ER8A 1B42A 1AQJA 4KDCA 3VC2A 4DM3A 1WZNA 5EZQA 2FHPA 3L8DA 1G38A 5KQRA 2OXTA 3LBYA 4A6EA 1EJ0A 2ESRA 2ZZKA 1M6EX 4U7TB 4RTQA 1O9HA 3B3FA 5EEHA 4FSDA 2NP7A 4AX8A 1KR5A 5BW5A 1I4WA 5CVJA 2ZFUA 2ZIFA 4F86A 4CKEA 3B89A 4KRGA 1YF3A 4IKPA 4PYJA 1FPQA 1H1DA 1YZ3A 3I64A 3UA4A 2Q41A 4KVZA 1VIDA 5C1IA 2WK1A 5DPMA 5LQNA 3A25A 9MHTA 2VDVE 3TMAA 2ONYA 5DM1A 3GU3A 3RODA 3KQQA 4U7PB 2P3QA 3H2BA 3FTFA 1SG9A 3QV2A 5LQJA 1Y8CA 4X61A 2QYOA 5BXYA 5EIFA 3ID6C 1SUIA 2PBFA 1JG4A 4E30A 1FBNA 3TKYA 2OPBA 3G2OA 1P1BA 4E2XA 5H02A 3DP7A 5GM2A 10MHA 3UJAA 1NW7A 2PGXA 1VPTA 1XDSA 3UA3A 1R8YA 1NV9A 5CCXA 5E2BA 1QAQA 4AZSA 3MTEA 5F2OA 5KS2A 1WXWA 2AOWA 1NE2A 3DULA 3R6TA 4Y2HA 3TM5A 2AOUA 2VDUE 5K0JA 2JH9A 1VP3A 2GS9A 4HTFA 1JSZA 1ZKDA 3G5LA 1VP9A 3GNLA 1DL5A 3KR0A 3OZRA 4BY9E 3TKAA 3CJTA 3A4TA 5K01A 2ZBPA 4QQKA 3DMGA 2ZSUA 2I7CA 4UOEA 1IXKA 3FUWA 1FP2A 1T43A 5FADA 5FA8A 4C05A 4DQ0A 2I9KA 5G02A 5C0OE 2CMHA 4YMGA 4ER0A 4ER7A 4BP1A 3DOUA 5DM2A 4P7KA 5KVAA 2WA2A 1F3LA 2IPXA 4X60A 2OB1A 5K0GA 1G8AA 3TR6A 2PT9A 3MHTA 2G1PA 2HV9A 3MGGA 4ATNA 4MIKA 5DTQA 3FTCA 1XXLA 3S68A 3DTNA 3KQOA 4IV8A 5DWQA 5DXAA 5LQRA 3WSTA 3GRVA 3LL7A 3C3PA 8MHTA 3B7PA 3EMDA 3G5TA 2PT6A 5JUWA 5FA5A 2PX5A 3AJDA 3V8VA 4CKCA 4F84A 2YXLA 4B17A 5CM2Z 3EGVA 2ZTHA 4R8RA 4XCXA 4CTJA 5E1DA 3JWIA 3EVZA 2C7OA 1UFKA 1R6AA 2QY6A 3Q87B 3TPZA 4C04A 4YV2A 2NXNA 1RI1A 4DMGA 4RTNA 2GB4A 4RV9A 4RSRA 5LR6A 5K0NA 2R6ZA 3BKWA 1KPGA 3EVDA 4FGZA 3A7DA 1JG2A 1HNNA 3G2MA 4BLUA 3GXOA 3HA3A 4XUCA 2OY0A 2IH5A 2R3SA 2PKWA 4V0QA 3M6XA 3NWEA 2PXAA 4A6DA 3FRIA 1AF7A 3C0KA 4P58A 4R6WA 5BW4A 2ADMA 3TQSA 4ZTBA 3LKDA 5LQUA 2DULA 2I6GA 4R8SA 4LG1A 3KPWA 3JWGA 5D1NA 3GCZA 3BKXA 5DXJA 4QQNA 4G56A 2B3TA 3UJ6A 4AZWA 4EQZA 3KQSA 5E1MA 4FR0A 1G55A 4ER6A 2O0LA 4X41A 4POOA 3FTEA 1QZZA 1RI3A 2B2CA 2FCAA 2AOUB 3A26A 1INLA 3IHTA 5HOQA 3NMUF 1JQEA 1L3CA 2V74B 3ELUA 5DTMA 3LCUA 3DLIA 3R3HA 5EKXA 1X1CA 2BR5A 3LPMA 2Z6QA 1JG1A 5CVDA 3V97A 3LCCA 1TPYA 4GF5A 4RVGA 2HNKA 4FSXA 4KDRA 2CL5A 1SVUA 3OPNA 1JG3A 2FYTA 3P9KA 2PVCA 2AS0A 3EMBA 5LSAA 1N7IA 2O06A 1VBFA 4GBED 4OX9Y 2H11A 3IV6A 3PX3A 1NW5A 5T6BA 1O9GA 1AQIA 1PRYA 3ER9A 3GO4A 4RWZA 2Z6AA 5D1HA 2BR3A 3KQPA 5IH3A 3E7PA 5HIKA 2C7RA 4MWZA 3OU7A 4YUYA 1FJXA 4BLVA 1ORHA 2JHAA 5K03A 3LSTA 2CMGA 3KPYA 5JR3A 2AVDA 1EAMA 1V39A 5DRYA 5ERGB 4PONA 2VP3A 3HTXA 3R0QA 3FPEA 3B3JA 3LBFA 3MTIA 3OE4A 1QYRA 4WVLA 1NBIA 4FS8A 3REOA 1RJEA 4M38A 1XVAA 3UJ9A 2YX1A 3OZSA 4RTKA 3CC8A 3B5IA 4FT2A 4HSGA 5EQJB 3SSNA 3UJCA 3OCJA 5K0CA 2G71A 3FUXA 2GPYA 3SR4A 4PYLA 3HVKA 2IFTA 4YUZA 1JSXA 2AOVA 1SQFA 3FPGA 1EJ6A 4GUAA 2H00A 2PXCA 3KPVA 4PCAA 2OKCA 4P7FA 1P91A 2EJUA 1ZQ9A 3GGDA 2UZ4A 2ZWVA 3I5UA 5E9QA 5FHRA 3KR2A 3FYCA 3KR9A 5KQSA 1D2HA 3R24A 3LGAA 4GQBA 1ZHFA 4KIGA 4EK9A 3AWIA 4MTLA 5BP7A 1R8XA 1VE3A 2ZWAA 3FZGA 1G6Q1 3JWJA 2ZZMA 2A14A 3CGGA 1X1AA 4GOLD 5DM0A 4QDKA 1RJFA 3HCDA 5LQKA 3GRZA 3PX2A 3SM3A 1Q0SA 1KPIA 1UWVA 3EEYA 4CKBA 4Y30A 4ER3A 3O7WA 4HGYA 2N47A 2IGTA 3LHDA 5DX1A 4OA8A 2HWKA 5ICFA 4AUKA 1EG2A 5K0FA 1EIZA 1ZG3A 3E23A 2BM9A 3EGIA 2P3LA 3KR1A 4KWCA 4QTTB 4R05A 5E8JA 3SGLA 3U81A 2XYQA 2OBFA 3CVOA 1KHHA 3LDGA 4RTPA 4P7JA 2AR0A 4RX1A 2V7EA 2BM8A 5E1OA 5EHGA 4LECA 2IBTA 1Z3CA 2ZBQA 3HA7A 5GWXA 4CWAA 1OR8A 3UJ7A 2B25A 3GWZA 3HA5A 3P9NA 3CBGA 3P9CA 3O4FA 4QTUB 5FULA 1RJGA 3GJYA 4ISCA 3LX6A 2YXDA 3DMHA 2NXCA 4HTFB 4PYIA 5FQOA 4RTRA 1SKMA 2LD4A 4PIMA 4C03A 1YZHA 2ZLBA 1JQDA 3M4XA 2BR4A 3G89A 4HGZA 1I1NA 1QAMA 4FP9A 3LECA 3TFWA 3BT7A 1P1CA 1XTPA 1BKYA 3OU6A 4OBXA 2C7QA 1N7JA 2EFJA 3PB3A 1RI5A 3KQMA 2ZVJA 1O54A 2PX8A 4PYMA 2P40A 5CVEA 4F85A 3M6WA 2AOXA 3EVCA 3K0BA 3ME5A 5EG5A 3NJRA 2GH1A 3BGDA 3LKZA 5HIJA 3KPJA 3P71T 3D2LA 5EGSA 3NTVA 4JXJA 4MQ4A 1VQ1A 4QVGA 4GOMD 3SSOA 1L9KA 2O05A 5ICGA 3P2KA 3BZBA 1YUBA 2B9EA 1L1EA 2HMYB 1JTFA 4E32A 2CWWA 5E1BA 2QM3A 5HEKA 2DPMA 2KW5A 3C6KA 3FUVA 1VLMA 4OA5A 3BWMA 3G88A 4HH4A 4PYNA 4NECA 2IP2A 3LDUA 5HZMA 2IH4A 3PTAA 2VZ9A 2IDJA 2PJDA 5LQCA 3HNRA 4HC4A 5K8VA 5EZSA 5EMMA 4KIFA 1X1DA 3RIEA 1U2ZA 4R6XA 3UFBA 3A27A 5HILA 3FTDA 5U4XA 2OZVA 5E2AA 3DMFA 1KYZA 1M6YA 3G8BA 5GINE 5FTWA 4RVDA 1WY7A 3P2IA 3UJDA 2YXEA 3BUSA 4FZVA 4DCMA 3FRHA 3UWPA 5MHTA 2H1RA 1R74A 3PVCA 5EKUA 2PSSA 4CTKA 3MERA 3AY0A 5LQAA 3EEOA 1NW8A 1RI4A 1R00A 3I9FA 2P3OA 4OQEA 2BH2A 2AN4A 3G2QA 1JR4A 4IV0A 2P7IA 3E05A 3UBTA 4LWOA 1EQAA 4GC9A 1BOOA 3RW9A 2QE6A 1NW6A 4YV0A 3SX0A 3FPFA 1L3BA 2NYUA 3HCAA 2XVAA 2JHCA 3DUWA 1XCLA 3P2EA 5DSXA 4O29A 4YUWA 1RI2A 4OQDA 4RYLA 2JG3A 1I9GA 3KPUA 4YV1A 2NNWB 2G72A 3FPHA 3SSMA 5GIPE 2NP6A 4QVKA 2Y1XA 4AZVA 3AXSA 2CKDA 5ICEA 2O57A 2VDWA 5K05A 5T64A 1M0EA 4KW7A 2GA9A 5C9ZA 5DT2A 4WXHA 2NXEA 3G7UA 2ORED 3A7EA 3HVHA 1X1BA 3SMQA 4DCGA 2PY6A 3THSA 4EVIA 5K09A 2AOTA 2G70A 5P8WA 3HCEA 3VYWA 2I62A 3GRUA 4IWNA 2PX4A 4RVHA 4YMHA 3THRA 5T67A 4K6MA 3FUTA 3CCFA 2FK8A 4LWPA 4PINA 3GIWA 3OZTA 1WS6A 4PGHA 5EOVA 4PYKA 3UZUA 4GOND 4E31A 1DUSA 3GRYA 2XVMA 3EVAA 3DLCA 1ZGJA 2PWYA 2ZIEA 5M5BA 1D2GA 3VSEA 4PIPA 1JQ3A 5HIMA 2Y1WA 2YQZA 3EPPA 4GOOD 4E33A 2IBSA 3PLAE 1IM8A 2OO3A 1KYWA 3HVJA 3M6UA 3ORHA 4P7GA 4RVFA 5FQNA 3BWYA 4PYQA 5DX0A 4PCLA 5DLYA 1NW3A 2PXXA 2B78A 3MCZA 4HRAA 5DSTA 3P9IA 3UJ8A 3EVEA 4X63A 1L3IA 1XJ5A 3B3GA 5F2KA 2EG5A 5GIOE 3ANXA 1XDZA 5E9JA 1N2XA 5CUQA 3ELWA 5ICCA 5IKMA 5K0EA 4RTLA 5EMJA 3BWBA 3GRRA 3KU1A 4BP3A 2ZCJA 2ONZA 2QRVA 2E5WA 3PS9A 5EIWA 4OBWA 5GM1A 4CXMA 1ORIA 4PWYA 4V0RA 2AN3A 3I53A 4YUXA 3PT9A 3BGVA 1DCTA 1AV6A 3EVGA 4YUVA 4PGGA 3TLJA 2NXJA 3LDFA 3HCFA 2ZW9A 5HIIA 3X0DA 4C06A 4DKJA 3C6MA 4L7VA 2F8LA 4RTMA 1YB2A 5CD1A 4XUDA 1UIRA 5FHQA 5GP1A 2FRXA 3NDIA 3QOXA 4M7RA 5DM4A 5KYGA 7MHTA 3TM4A 4PYOA 3M33A 2YVLA 1WXXA 1KXZA 5HFJA 5FCDA 4EMSA 5EPEA 5GOZA 2PV0A 1YFJA 1SQGA 4E70A 3G8AA 2OB2A 2P41A 5CCBA 3AXTA 2PWPA 1TW2A 3CJQA 2AOTB 4FT4A 4BLWA 2UYQA 5E9WA 4DF3A 4Z2YA 5B1SA 3R9XB 2BZGA 2PLWA 5F2NA 4M37A 5CIYA 2ZIGA 5CVVA 5E8RA 3SVZA 2XYVA 2JHPA 2ZBRA 3P97A 1QAOA 2P7HA 3NDJA 3T7TA 3C3YA 4HG2A 4C4AA 4DZRA 2IH2A 1KP9A 3T0IA 5FWAA 2AVNA 2UYCA 3ERCA 3MAGA 2QRVB 5EC8A 4H0NA 3TRKA 2P8JA 3M70A 1D2CA 3EVBA 2YUIA 4XUEA 1G8SA 2GLUA 3G2PA 4M36A 4DA4A 5DRTA 2HR1A 3Q7EA 2O07A 3IYLW 2FPOA 3VC1A 3PFGA 1TW3A 3ELDA 3HCBA 4QPPA 2ERCA 3FUUA 3GDHA 3QOWA 1G60A 2UYOA 2HTEA 2VS1A 3DXYA 3KHKA 3FPJA 2YTZA 3UJBA 1NT2A 2AZTA 3E8SA 3HCCA 3CKKA 2XYRA 2EX4A 3NWBA 5DTRA 5EMKA 2Z6UA 3BWCA 2UYHA 1X19A 3BGIA 5EVJA 3SXJA 3T7RA 4ER5A 2XBMA 5K0BA 5EEGA 3DH0A 5FWDA 2ZULA 3MQ2A 1KPHA 1KIAA 1R18A 2WA1A 3K6RA 2EJTA 1NKVA 2C7PA 4GEKA 3TOSA 1MJFA 2PX2A 3EVFA 3M6VA 5CVUA 3DR5A 3LCVB 1BC5A 3BXOA 3HM2A 2IDKA 3KQVA 3O31A 1QANA 2IIPA 3P8ZA 3NVMB 1VL5A 1FP1D 3KQYA 5K0LA 4C08A 4E2ZA 4RTSA 5EMLA 4X1OA 1NV8A 4MHTA 1P39A 4RTJA 1JTEA 3CJRA 3FYDA 3MB5A
chains in the Genus database with same CATH superfamily
4JROA 3IFSA 1O94D 2W2KB 3EIWA 3WYBA 1ESDA 2JJQA 4B6EA 1PJZA 2OBMA 1DXHA 2Z57A 3GYGA 1U3GA 3NORA 4LZLA 4KREA 1O95A 1NBHA 4EYOA 3FCOA 2HTFA 3OU2A 1R0CA 5ENVA 4QJ4A 5C1BA 1X8XA 3VTAA 5HXAA 1X6VA 3OE5A 4I6EA 1XE3A 4DT1A 1DXOA 3KT3A 2BFDB 4EF4A 5LP1A 1G66A 1OLOA 2P4EA 2OHXA 2BGJA 3E8XA 5LXTB 4QDJA 3CNEA 1U0LA 1WG8A 2WQ7A 4EG6A 3DE7X 1IY9A 1TU4A 2C2HA 4ZOLA 2G40A 2VP9A 2Z09A 2ZBUA 4NH0A 5AHRA 4HS4A 1DWOA 2JI4A 4QYTA 5TGTA 5A5VA 5JXHA 2C3YA 2VAWA 1QG4A 3UQYS 4DQKA 1NZDA 3MPUA 1XPRA 4KKXB 4OQ4A 3ZDZB 4B35A 3QKWA 3AVWA 1HV8A 5LMNB 1TNDA 4HGPA 1KS2A 2GUGA 4Z3OA 5LWQA 4KNVA 2HPVA 1I4WA 1IDOA 1PT8A 4Z4EA 4KRGA 2FPWA 4RMHA 3V1KA 2WAXA 3QYPA 4XYBA 2OWDA 3Q72A 3CEMA 4D92A 3FMGA 4D0RA 1C3LA 3ETLA 4ID3A 5GJBA 4J1TC 4HAWA 5A0FA 3AKDA 2XOXA 3GGGA 4UNPA 2ONYA 5DM1A 4ZT5A 1IU9A 4KO2S 2DBZA 4U7PB 3JTEA 4OAPA 5GAJA 3UJ3X 4J75A 4AX4A 1Q5PA 5ALQA 5CEEA 1VHQA 3QV2A 2F48A 2P0YA 2V3CC 2J0VA 5DZSA 4OATA 2QYOA 1ZONA 4N5IX 2O3UA 2PBFA 2MSWA 1E6UA 1RNLA 3DVAA 3IO3A 3KS9A 3VKUA 2QJOA 2WDPA 2A1TS 1DO0A 2QI9C 4JLBA 4JKIA 3O3CA 3U19A 1JR2A 4AT1A 3SIPA 3PPIA 1NW7A 4J0CA 3KXLA 1BIFA 1BMTA 2GWHA 4NS4A 1NONA 1OPXA 3TRIA 5GVRA 4M53A 3T3MB 2D0DA 3GQBB 1XYVA 1RLJA 3FPCA 4Y2HA 1KI6A 3VNUA 4QPJC 2LCIA 3Q7SA 1SB8A 4YRMA 3AF2A 3IBSA 2CLHB 5HCUA 4MQLA 3CRVA 3EG5A 1DL5A 1EBFA 3D6MA 3HJAA 3KT0A 3SHWA 3A04A 3CT4A 3I9OA 4DMCA 4ZAZA 1HSOA 3AF3A 1ODIA 5EWLA 2E49A 3KVNA 4M1ZA 1NJFA 4RLHA 3WK9A 1XXHA 1L5HA 3QBJA 3RC1A 4ER7A 3P5SA 3EDCA 3S8YA 3BBLA 5HKAA 3OJ0A 1ZLYA 2BE7A 4NCNA 4UEOA 2BFDA 4K7JA 1L5NA 3S8MA 1KSFX 3F6BX 3MTGA 1LDGA 1B8OA 1RDFA 4MIKA 1BW9A 3EA0A 3ESRA 3A05A 4AP9A 5KNDH 5EMNA 1URPA 2QYSA 1NBMD 2AWOA 2B7LA 4IDPA 2GZRA 1OH6A 4HNRA 1JAXA 1L4GA 2IT1A 5DXAA 1Y8RA 2XITA 3F6CA 4QT4A 2O5RA 2XCQA 2OM6A 3A4VA 2BLLA 1LS6A 1AZWA 5CM2Z 4R8RA 2VNSA 1FQJA 4Q12A 5AKHA 4E5UA 5AI4A 3SICE 4KR0A 4A8JB 3IDQA 4BKOA 3K05A 2PPLA 2ODPA 4H0FA 1WXQA 1QQ7A 4UXIA 1RI1A 1XDDA 4ENRA 1Y1PA 4LNAA 4RKQA 2AEEA 4JLPA 1WD7A 3CLTC 5T3YA 5KVVA 5JMOA 1I0ZA 3VZDA 1NN0A 3K0EA 3PD1A 4CIBA 3A70A 5U4QA 3TTWA 1N57A 5EWJB 3STXA 5AVSA 1LK7A 2B69A 1XWIA 3FNFA 1SRQA 3JQGA 4D57A 2ABWA 1PFWA 2P30A 3L05A 1AF7A 1HPLA 4C7BA 4ALMA 4E2WA 1CDOA 3DVAB 1P5HA 4FGWA 3WIVA 3FOWA 4CG2A 3NATA 1E2UA 2NZJA 5BV1A 4EQZA 5JYBA 1KIMA 3KXPA 1J8YF 1P2BA 1QQTA 3O38A 4HBGA 2NYVA 4JI7B 2WOJA 1Z38A 1R6DA 2RHMA 4CKZA 5DM60 5C8ZA 1GTRA 3MRTA 2CJWA 1NWCA 1Z6ZA 2RAVA 3P2YA 2YNMC 3ZDFA 3WGJA 2OHOA 2V74B 3UK2A 1V35A 4DPKA 5KYYA 3DLIA 3R3HA 2IVFA 1Z4OA 3LPMA 4MRNA 1ULTA 4DIKA 1GL7A 4TSKA 4R2HA 1Q1BA 3G0HA 5HMMA 4KDRA 3ZPXA 4YRRA 3DDHA 3AI7A 3FLAA 4H60A 2CV2A 3AP3A 4IXMA 3OPNA 1PNRA 2AXNA 3R1IA 3LLCA 4NBLA 2FTKE 3X1DA 3T9EA 4Z51A 1H5UA 1KRXA 3BERA 4TYWA 3EFHA 3W9UA 4IVPA 5TV2A 3W7AA 4DZZA 3GZTB 4MH0R 5ICMA 3L92A 4HFJA 3ZGNA 5KKAA 1EFAA 3QMPA 4MNTA 1QQAA 4OGWA 1I7NA 4RU1A 1TK3A 2IEZA 3KQPA 3PPWA 2JGIA 4NFSA 1XKXA 2SKCA 2JJ2A 2V0GA 1ORHA 2QMYA 3ASUA 3IMFA 4U6NA 4O2AA 1T6BY 2QEQA 3O94A 4A8JA 3NVAA 3QZUA 2OO5A 4RUKA 1UJ6A 2Q6KA 4KBYA 1QK5A 2C96A 3I04M 3NDRA 4EJMA 4KNYA 4MQ6A 4J07A 1YA6A 3REOA 1M74A 3FM9A 3NHSA 4V03A 4FE7A 3A06A 5IAOA 2G9RA 3PNYA 4CM5A 2HIHA 3D4PA 3PGA1 1JECA 2IFTA 1EYZA 2I2CA 4D8VA 2ZREA 2EC5A 1YDWA 3H0KA 2RGGA 3JQGB 5HBGA 3U7EB 2C3OA 3GG9A 2BC9A 3HUDA 1SXHA 1ZGHA 2R5WA 4LHYA 4PCAA 4E51A 4C21A 2EJUA 1CJTC 3R09A 3W78A 5C7YA 2AUMA 2ZWVA 2FMHA 2UYYA 1L9XA 1EK2A 1BMFA 2R1TB 3FWPA 3HDHA 3IVAA 3KR9A 4HLCA 4N4AA 4UBOA 4A27A 1BFDA 4DV7B 3LGAA 2QG4A 3RU9A 4HNVA 3VO2A 5BP7A 4Y2VA 1R8XA 5BN3A 1LPPA 2RGNA 3Q5DA 4RZUA 4BNTA 3U56A 1XDBA 5BWMA 1G8JA 1G6Q1 1YS2X 4RD3A 2OEPA 4DSAA 2ZZMA 3L8MA 2WV9A 3FCEA 2A5YB 1E7QA 3H6HA 3NHUA 3L1HA 4JBYA 1R4AA 2J3JA 4GZ6A 4WLEA 1YJCA 4EJSB 3MS4A 4GYJA 2CUKA 2GHQA 4LPKA 3LHDA 3A4MA 3UWKA 2RHHA 4KXQA 1AZTA 1EDZA 2PDAA 3QWFA 2Q45A 2QU7A 5I3ZA 2WFMA 1G59A 1UBOS 2BM9A 3N6XA 5E8JA 2FEXA 3C6ZA 3JZMA 4DTIA 3DV9A 1G6HA 1RIFA 1RQGA 3G2JA 4WFJA 1C0LA 1LBHA 4YLYA 1XNQB 1Z6AA 3H1PA 4LECA 4FGSA 4EYEA 5DGTA 5IM5A 3R7AA 4EAQA 3IUQA 3T52A 1L5SA 5FR2A 5LDDC 1NN1A 1K63A 4QTXA 5I7AA 3O9ZA 3LX6A 1N7HA 1CQIA 3E3MA 3U3OA 4E03A 2JIOA 4G0OA 2I7TA 1YZHA 3ECSA 1TJ4A 3G89A 4MB6A 4W9RA 5AI9A 1BH6A 1P4GA 3BTVA 4R31A 1O94C 2YBEA 5CB4B 3CVWA 1P1CA 1JPNA 4TZ0A 4G36A 3RBAA 5LNK6 1GAJA 1YBFA 1X80B 4FCCA 4ZEXA 1V8ZA 3AM1A 4IDBA 1K4YA 1EVJA 2W4MA 1TA9A 4MQ5A 1ABFA 4QRIA 1V5FA 1J70A 4YP7A 3PV0A 1VJTA 4U6SA 1ODLA 2I34A 3LCRA 1Q2UA 4LISA 2V45A 2XNCA 1IJKA 1K5PA 1NLYA 4JXJA 4RQUA 4WJLA 1TM5E 1M2KA 2FFQA 3ASYA 3O74A 1U2PA 3B6KA 3JARB 3TLGB 2JLWA 1L9KA 2P2SA 4DBLC 1ZM9A 2ZTVA 5DKFA 1HNWB 1UFRA 1YVUA 3P2KA 3BZBA 4R7TA 1JTFA 1L1EA 4JJEA 3EHDA 1DZIA 3ETCA 5GZ6A 1K27A 5MDHA 1M2JA 3KLMX 2UAGA 4P92A 3H4MA 1WQ4A 1VLVA 1WPRA 4IO1A 5A3RA 1UDXA 1EINA 3K9LA 1W47A 3PFWO 4YX9A 1GADO 2WTEA 2ZXEA 5F98A 5GJWC 4TTAA 5TJ9A 1YL7A 3KAJA 1LZKA 5EMMA 1FDRA 1SBQA 1IBKB 4AJHA 3GRKA 3JVDA 4NDAA 1VBNA 3ZX4A 4DADA 3FTDA 1XLTC 2GPTA 1U7XA 2FZ4A 3EXAA 3OJCA 4HVTA 1XMXA 4YCAA 3TO5A 1CUXA 2AJCA 1P1JA 3HKDA 3PVCA 2ZQ5A 2EATA 2ZIXA 2NACA 2GF0A 5DGCA 5ALXA 5HK8A 3TWOA 4BFLA 1DFIA 1JE0A 2GPBA 2W2OA 3KD2A 3PDIA 4J90A 3I9JA 3NEAA 4O4JF 5AP9A 4D4IA 1KFCB 4D8UA 2ZAIA 3U61B 2AD1A 2H4XA 3TF5A 1IH8A 2B0JA 1HC7A 3GG2A 3AL2A 4PGAA 2XA1A 3KUKA 4CM6A 4E5PA 2Z8ZA 4LOHA 4LJ8A 1GQFA 4YXFA 1F7UA 1GZDA 3PNVA 4JH0A 3O90A 4P8RA 1E2HA 4RCYA 4BJ3A 5JRJA 4GPEA 3H9QA 3M3PA 5K3OA 3L0BA 2H54A 5KOHB 1SUDA 1NXWA 5GIPE 2MYUA 3GLIE 1U7UA 2NP6A 1K98A 5CLJA 1W2WB 1P45A 4KUGA 2B1GA 2VAVA 2VYND 1SVMA 3ROTA 3DEHA 2A7QA 2ODAA 3VH4A 5LLTA 4Y9SA 3HVHA 1Z0SA 1CUIA 4FCWA 3L1VA 4GLOA 4XJTA 2G70A 3IBYA 2XUHA 4N3GA 1BQEA 4PLCA 2ZI5A 3T3OA 1AGXA 3UJPA 4DB2A 3OFVA 2GYWA 4RVHA 1ZL0A 4K9OA 3R0JA 5LC1A 4ARIA 1YV9A 4K6MA 3QE9Y 3FUTA 3BICA 4W5OA 4FI3C 4LWPA 1FL9A 5ILOA 2IY9A 1MU0A 4M6WA 3RQIA 3OY7A 2Y2UA 1EMDA 1QO0A 2YQ5A 1OIXA 2QTWB 1V1RA 2NZXA 1IK6A 2OBNA 3KEGA 3NIGB 5K9ZA 2KSQA 2V03A 3IEPA 4F9TA 1CUDA 3ECCA 2OAP1 4RKRA 2OXIA 2XNDD 2I91A 3BC1A 4EG7A 1E2FA 1NC3A 2YVQA 4FYIA 5DCLA 4AP6A 5C8YF 4IIJF 2IBSA 4RVFA 4DQVA 1EESA 2FVYA 2J6IA 3MT0A 5HF9A 3GC6A 4IVNA 1EUQA 2B6NA 4CLOA 3IGFA 1RXUA 1BVUA 1J7JA 1H8HD 3MCZA 4YCDA 4DY4A 3IUEA 3LBIA 1SKYE 2IYQA 3ANXA 3IVRA 4BMPB 5BRNA 4EHBA 1RBMA 2FW7A 4YMSA 1IWPB 4PZUA 2BHNA 3II6X 4ND3A 4BVKA 1CQJB 2ONZA 3PS9A 4JODA 4JVSB 1VDMA 1VYHA 3EGDB 4OXQA 2B8WA 3AILA 5FIUA 1S0UA 3FYTA 3HL4A 1QJ4A 3OPYB 4B9EA 4S1WA 2AXPA 2C83A 4ND1A 2O7QA 4WGFA 5HE8A 3X0DA 2ZW9A 2PEYA 1BNCA 2IYEA 3F6EX 4G24A 2YMQA 5ELMA 3DFIA 1Q0PA 1KFKB 1XKTA 4YJ2B 1W1IA 5DM4A 3USES 3M33A 1VG9B 4O4LA 3BFKA 1OZAA 1U2QA 2XTJA 5E0OA 4EMSA 4LXIA 1YFJA 3KQUA 3WB2A 4CM8A 4ENVA 5D84A 4I8IA 5AUQA 2AQKA 5I7UA 4Z7NB 2Y4OA 1OX4B 4CL3A 4M37A 3ROEA 3MHPA 2ZIGA 4BFCA 1ZZEA 3NDJA 4LRSB 2YV3A 4ACBA 1SRRA 4FK8A 3WLLA 4A8JC 2OV3A 4KIUA 3UUGA 4Z4CA 3FIUA 4K0RA 3V34A 1C2TA 1PEKE 1PK8A 1MIOA 2C7GA 2D5AA 3F8SA 5BOSB 2RGBA 3I9LA 4B3CA 1USKA 3CCCA 4TYPA 3FYUB 2D74A 3ELDA 1ADJA 4OM7A 4QPPA 1PD1A 5MGBA 4JI4B 4LCBA 3RHSA 2OGTA 4ZV4A 1Q95A 1JZTA 4HAOA 2B5VA 4B79A 1G5TA 3EODA 3CKKA 3MSXA 4RYDA 1TE2A 3T7IA 1U5BB 5JYEA 8LDHA 4BJ5A 3A9SA 1HL7A 3BWCA 2OFPA 3H9EO 5CT4A 1DX6A 1R9MA 3N7TA 5TY0A 5EEGA 1SVLA 2O6HA 1PJQA 2O8FA 1RABA 2I6TA 2O4CA 3PQ2A 2NSDA 2VWGA 5L7WA 1QQ6A 2XA9A 4AB1A 1LI7A 5JCZA 1CZOA 3QXHA 2A3RA 1Z47A 2Z9BA 3P8ZA 4D6PA 3NVMB 1QFMA 4GM1A 2YWEA 2JFBA 4ZQHA 3TZHA 3BE8A 1NV8A 2VXYA 4XFKA 3NPMA 1WHTA 2KJQA 2DQZA 3AU9A 1MVOA 1UP6A 1IM5A 3ELYA 2V4ZA 1BXKA 4URYR 4KQKA 4CIVA 1C8KA 2UUCB 2QV7A 1ADYA 1QHIA 2IL1A 3MMPA 2COEA 3ZW7A 4DUZB 1U11A 5EINA 4D9FA 3EGEA 1DAHA 1Q3HA 3ILXA 1QBGA 2PTGA 3PYMA 3T7SA 4X1IB 1E2MA 4XASA 1H0RA 1V8OA 2HKIA 2P2GA 3JQ6A 4BVLA 1V6AA 2G8LA 4GC5A 1AMOA 1T25A 1OVMA 4BU0A 3CZAA 3W5CA 1BHJA 3D8NA 3KQTA 2WR8A 1JA1A 1LPNA 2FK7A 2CHQA 1FMJA 1QTIA 5CFLA 2C31A 2QAGA 3GRCA 3OI7A 2HSDA 2E4WA 1F1BA 3GAMA 3EGWA 3ENVA 5FEUA 1VSVA 3L8DA 1UH5A 3EC1A 4EM6A 1EJ0A 4WZAB 4ZZIA 4CDMA 1ZSNA 5JC8A 2PR7A 5B58C 3ZZMA 2RH8A 1D4AA 1CW2B 1N92A 2YICA 2HRDA 4Q9NA 2XQJA 4XGRA 2FAXA 5CVJA 4EL5A 4LXHA 4HXFB 4CKEA 5ERYA 4LXQA 2BIFA 4X7BA 1YZ3A 1L7AA 4MSUA 4TTVA 5FLKA 4C4ZA 2QP9X 1TPZA 1HLDA 1UT6A 1V3QE 2QVGA 2ZSHA 2AN9A 4W7IA 3KV1A 3CONA 4BRZA 2CMDA 1QGED 4PLFA 1FSZA 3GZJA 1IMJA 2HQ1A 4RACA 4WZBE 4P3OA 1VYUA 4N7RA 3T3GA 3EZLA 1Y1TA 4OSEA 3GVIA 2Q1WA 5CW2A 5LYJF 3N8HA 3D7RA 4J0FA 3OOWA 1KY5A 3VJKA 4F5YA 3JVEA 1RM5A 3QU4A 4TV9A 2BHLA 1TEVA 4F9FA 3K0CA 7REQA 3OA0A 4R1NA 5EQTA 5BOVA 3ZGYA 4ZYTA 4PQYA 4EA7A 2RKOA 4FW9A 2PGXA 2XQGA 1I2MA 1FFDA 3FFAA 3AB7A 3N8IA 3N0XA 5KS2A 3GEDA 2UYGA 3RQSA 1EXWA 4QLBA 2W58A 1QV7A 3CSUA 3GZNB 5CM9C 5CA1F 5FWXB 4IIVA 4B87A 1BEZA 3PQ6A 1RYZA 5BNFA 4CM9D 1VP9A 2GSDA 2GZSA 1Q7GA 1QWOA 2ZVDA 3OJLA 3OZRA 4MVJF 2QS9A 1Y7LA 3ZD8A 6Q21A 3AVTA 5BY2A 2C8LA 4Z8XA 5FBVB 3VH1A 2BTEA 2WSBA 4IY1A 5CA1A 3LUCA 2ZUUA 3Q0IA 4OKNA 1KJWA 2ODQA 4KE9A 2W0SA 1LDEA 1QR2A 3R0IA 5K0GA 3MHTA 2QD4A 3IEUA 2XXAB 3AYZB 3MUFA 3DOCA 1Z33A 2CLDX 3I6MA 3KDPA 1DC8A 2Q9UA 1FW6A 3PEYA 2NNLD 5BVGA 2G9QA 3AEZA 4DSTA 3HZOA 3LKVA 3F49S 3WKAA 1U8CB 2PGOA 3T1HB 5FWNA 2ET6A 3SEFA 5KWIA 5AXCA 5BORA 3U1BA 4R1QA 1OAOA 4TRNA 1D5CA 621PA 4KOAA 4ZWNA 1MTZA 1BDIA 4OK3A 3SC6A 2B9VA 2D5BA 5AQEA 3U26A 2ZSBA 5ALYA 5H68A 1DOAA 4MWSA 1IUPA 1ML4A 4GBGA 3DXFA 5HF6A 2HBQA 1I13A 3S44A 4OL0A 4YGYA 5KNBA 5KHOC 3W5DA 1JJAA 1A9TA 3EE6A 1ODSA 1NN3A 1PT6A 1GLVA 3E1GA 1ZESA 3KX2A 4K1XA 3CO5A 3V8BA 2AQIA 5EZ6B 3BXEA 2HPAA 3RTAA 4JLJA 4R6WA 5EE3A 4IIEA 2PKQO 2ADMA 5LU8A 3WYNA 2H1OA 2UUBB 1IEVA 1DX4A 2V97A 3KB8A 2QZ4A 2WAOA 3KOUA 4K8OA 3HVRA 5DK4A 5D1NA 3D81A 4EA6A 1JFLA 3U6KA 4WAUA 1M8PA 1QHYA 4NE7A 1OXXK 4BJ1A 2OQRA 1XZ8A 3AHGA 3R5FA 4LQDA 5L4LA 3QF7A 5ARBA 4KDEA 1I7SB 4MGIR 3TI7A 1B76A 4HEA1 2V7XA 2FCAA 4RM2A 3KQHA 2DX7A 2BFEA 2CE2X 5G40A 1GCIA 4TWZA 2KQUA 5DI9A 3GLFB 1Z56C 1E1QD 4B83A 3L4KA 1JL3A 2A0UA 2W6OA 4MQMA 4DLNA 2LDBA 1ZMOA 3IT0A 1AO3A 4IGFA 4PBSA 4A73A 3K71B 1YBMA 2VBGA 3K9GA 3KXKA 2EKDA 3DYBA 1ZK1A 1EVIA 4I4CA 2C9YA 2NZ8A 4PQGA 4Q4JA 1E6CA 1K92A 1TTPB 5C4MA 1YRBA 2UZ1B 1WB5A 4PLVA 4R9UC 2P2ZA 4DLTA 1NUSA 1ZBQA 3OTWA 4KGZA 4NONA 3UWSA 2AKYA 3K1AB 3USZA 4RWZA 1I7LA 4B82A 3FHTA 1E3WB 4KZKA 4G2NA 1JPUA 3LQ4A 3H83A 3N0VA 4IW3B 4KJXA 4MWZA 5AO9A 3D3EA 4CFZA 3FGPA 1F9AA 3U37A 3N59A 3ZDDA 5GONB 1R4NB 1VL0A 3ZZ1A 1BXZA 3E5MA 4Z4GA 2P9BA 2F3RA 4ND2A 4GS5A 4JLNA 4FN5A 3CV3A 3FPEA 4IFIA 2XKKA 2IYSA 3HBLA 4HAZA 3O1IC 4JVNA 4JEUA 2C54A 4DV1B 1P1FA 2XDYA 2P5YA 4FT2A 5DF1A 4EJ6A 2A67A 2C9ZA 2AMVA 2G71A 2QXUA 3H1EA 4EG0A 2ZSKA 3CLKA 1R5OA 1P60A 1P9RA 8GPBA 2IZ1A 4G67A 3GJ4A 4LHEA 5IT0A 2X0JA 2GVNA 1VHWA 3FPGA 4E46A 2PEZA 4TT8A 3TDNA 2O0HA 1HZZA 2GNAA 4OXRA 3HUTA 5ARDA 1IEWA 2D3TA 3WB9A 3ZLVA 5B3JC 2C98A 1VXRA 2A0YA 1P91A 4JI8B 2J0SA 3GGDA 1E3QA 4R83A 4GXRA 1T1JA 1E6EA 1XCPA 3LQRA 3OHSX 3TG8A 1Q1EA 2W6PA 3S8EA 2AHRA 4QXQA 1PWEA 2JGEA 3CLSC 1C1DB 3BPSA 3WR5A 4EGJA 4I50B 1KAQA 2G09A 5F1OA 4TRRA 4OB8A 3ZBQA 4ZT4A 5K4AA 4AMBA 2PXHA 3B2QA 3FF4A 4EZEA 5FWYA 1G6OA 1G1MA 4WH0A 2Q0HA 4MA5A 3UENA 1IVSA 2DXIA 2AV6A 4BTVA 4DA6A 1JR3D 3RSCA 4CTOA 2VPXA 4ZQIA 3W6UA 4WESB 2EWMA 3M5WA 1HEIA 4JQCA 5E95A 2HJWA 3G0BA 3CKMA 1IBSA 2D4HA 3QVOA 4KGXA 4EHHA 1GYRA 3OQIA 5KINB 2X8AA 4BQQA 3H9GA 1WCYA 3D6UA 3H1AA 4QRDA 1IWOA 5F2EA 4RKWA 4C5CA 3CMCO 5BV8A 1U2DA 2RHOA 2YJGA 4NBTA 1FFCA 3E23A 3JQAA 3KDAA 4ZOLF 2YIDA 4KWCA 3SXUB 5KKNB 1AGPA 1OAOC 5ESXA 3RVRA 3TIVA 1MF7A 3BH6A 4P7JA 4EZBA 2UZ1A 4P0TA 5ITZA 5E1OA 4DLUA 2BMWA 5DTIA 2EKZA 1AIPA 1Z34A 2DTXA 2HF7A 4RHEA 2Q3DA 1P61B 3A6PC 1QIGA 4MV1A 4A5OA 4MXDA 4WVFA 5FULA 3GJYA 1EBBA 2GSWA 3UGTA 3EPJA 2LTAA 2NV2B 3HLKA 3OT1B 1HDRA 2JLQA 3SF0A 1M8FA 3KALA 4Y2TA 4C03A 5ABPA 3GCWA 2CDCA 2V58A 1KO8A 3V9AA 5AVYA 4BNVA 4KVFA 4GKAA 4P38A 3KD3A 1M6VB 1YRHA 3LECA 1H9BA 2HIMA 1QX4A 4DQ0A 2LIVA 1RI5A 2BI8A 3U4DA 3KDSE 3VOBA 1JBEA 2D62A 2OV1A 1YAHA 2X5XA 5A71A 3IEMA 1OD6A 4JK3A 1VG0B 3GRAA 1H2ZA 1OA1A 2G0TA 3MT7A 3PHBE 2Q29A 3K4PA 3UC9A 3ZWWA 2GHIA 2M6KA 4E5SA 2FF7A 3ESYA 1QE0A 2GI4A 3IEXA 1NHGA 4JITA 1QC5B 4CLRB 4ZREA 5JAPA 3LNCA 5JBQA 3QVTA 3WGMA 2QROA 1U9IC 1JXOA 4H3KB 1NQWA 4X71A 1KOLA 3UJHA 3WMEA 2CT8A 1PSDA 1MA0A 2CBZA 1T36B 4BZWA 5KO2A 1ZW1A 2P2CA 4I50A 3RSQA 5D87A 1F4LA 1V95A 2A9VA 3NT4A 4H4CA 1TM1E 1HYGA 5SZHB 3VVLA 3HNRA 2O7RA 2IYTA 5A9SB 2VSOA 5EIEA 1SUPA 3RIEA 3DBRA 1Q50A 2GM3A 1YQTA 2J33A 3FY4A 3T7CA 1E3TA 1AKYA 2KBEA 2DUNA 3TZQA 1RYMA 1B00A 2Z2JA 2ID7A 1RHJA 1TUIA 3LOQA 2HWYA 4BFXA 4PEVA 4W1RA 4WIAA 2YFKA 1YI0A 3EUWA 2JI7A 1Y3DE 3U60B 1DWPA 5ES3A 3JALA 2B20A 4V2UA 1P9WA 1YD7A 4RK7A 1Y0BA 3FCCA 2WAYA 2R62A 1RMTA 2V7WA 3RVJA 1A9RA 1ZC3A 2IP4A 4IS3A 3GFVA 5A5GA 2B4QA 5KX5A 4G0QA 2O14A 1A2QA 3AVOA 3RAJA 3DBVO 2VYCA 2EQAA 4NZZA 1JH9A 2HZ7A 3KPUA 2VIIA 2XZOA 3QYAA 4HAUA 3FPHA 4XQEA 4MB0A 4OGFA 3VHQA 2JW5A 2X9VA 3UBMA 4LAFA 1VKNA 4A1OA 3V1UA 4B7AA 4FDAA 5JMWA 2ZANA 2CVFA 3WXMA 2QUIA 3CE9A 4RD2A 1CUAA 4WFQA 1M6VA 1T9HA 2GKSA 1U2TA 4C0QC 1JV2B 3ANYB 4B4WA 2FPRA 5JRDS 5K09A 3JQ9C 4FJ1A 4G1EB 2C5EA 3ZXSA 2I62A 3CIOA 3SHQA 2QMUA 2FWIA 3HN7A 3W8DA 4YCLA 3ESXA 3X1KA 2COKA 1E1KA 4NAUA 1W6RA 1TCUA 4XGQA 1M8KA 1V5WA 2DFDA 3EIOA 1J5XA 3FW1A 2HCFA 3L7DA 4S1OA 3ST7A 1TEZA 2FZ5A 2PGIA 3HSYA 4I66A 1CIVA 3VGPA 3MIIA 1RYEA 3HJGA 4Q4HB 2PR2A 4XQCA 3VAYA 2JAUA 4CFYA 2OO3A 2XXJA 4B6QA 2FPPB 4O6VA 2JCVA 2X1HA 3GPDG 4S0XA 4F2GA 1UJNA 2ZAYA 3FF1A 4QREA 1P80A 2GN6A 1L7XA 3RLIA 4HVCA 1XPJA 3EZNA 4AUMA 2J9RA 2GMWA 3HV0A 1PS8A 2O5VA 4FXOA 1CY2A 1UOPA 5E9JA 4GH5A 1Y1KE 1T0UA 1JP7A 3WKBA 1G63A 2JLCA 1DV2A 2QJWA 2A5JA 2C42A 5BSFA 1HQCA 3CLRD 5K8UA 1A71A 3KQNA 2ZYAA 5IULC 1T2DA 3UOGA 2GCEA 4X92A 3AUKA 4UU1A 1TTQB 2JCBA 5DOVA 3PEWA 4OREX 2ZCUA 2DBVO 3I53A 3N86A 2WD7A 4PANA 3QITA 3EVGA 3SX2A 1QR6A 2NXJA 3B1KA 3LDFA 5G0SA 2ZE7A 2ZK7A 3BSWA 3DLHA 3UHAA 1P0IA 3DZHA 2H9AA 1TAGA 2X7XA 1CHDA 4JBLA 1KMCA 4NBSA 3GW8A 3GP5A 5KYGA 4WBNA 2PA3A 4DV2B 4PYOA 4O2AF 2RIPA 4BLQA 5BYKA 2I22A 2ZB4A 3FTNA 2I2BA 2BSQA 3ADKA 2PV0A 1C7FA 1JIKA 1KZYC 1QZTA 1SCDA 3IAM1 3T5DA 4D0SA 2Q1UA 1A9XB 3VC7A 1E3JA 4JP5A 2O59A 4EFMA 1QIFA 1G5IA 2WNHA 3BS4A 4XD7A 2KM1A 3TN7A 3FYUC 5REQA 1AXGA 1ZNXA 4WUVA 4YCSA 2BGWA 1DC4A 1REQA 4KR9A 1RQRA 3NBUA 4Z9AA 3TRKA 1EP1B 4WZAE 1AO0A 2X5NA 3E9ZA 3U6BA 3C70A 1ZCFA 3NUGA 4PX3A 3WK5A 1S89A 1Z5ZA 4FVTA 4R9RA 3PFNA 3VNAA 3CG4A 3V4FA 3ZXXA 3CNQS 5KYUB 2G4CA 1MCZA 1Z0IA 2VHXA 2XI4A 5AW5A 2YJ6A 5HW0A 3BE5A 3Q8LA 1ZAYA 4NXNB 1PJ4A 4I50F 5DTRA 1M7GA 1X7ZA 2F64A 3S6JA 4COOA 1H2AS 2VDMB 3O2JA 2ZITA 3SS8A 2ZULA 5AOBA 1J1ZA 1WEHA 4UDXX 3IA2A 2YW9A 2DOKA 3DNPA 3KL4A 5CVUA 3FD8A 3H8JA 4A26A 4F21A 4DR5B 3WYGA 5EUCA 2DHRA 3EMKA 5A2QA 3AY3A 4GQBA 2CJYA 2PGAA 2QTHA 3ITKA 2D7DA 1DTWB 5EMLA 3ABZA 3RVPA 3CJRA 3V4ZA 2XUKA 5K3BA 2R1ZA 3H5TA 1RM0A 3HVIA 4LVCA 3WRYA 4PLHA 3UUFA 1E2PA 1FRQA 3K6JA 3OFJA 4LVNA 1SM4A 4WSOA 1W1UA 5IZCC 3MAAC 4TV8A 2X7HA 4KR6A 5JXIA 5KYKA 1GZ6A 1ZO8A 3AFNA 5H81A 1SXPA 4AWBA 3CSSA 3LE8A 5BXQC 4M0CA 1RXSA 3WXBA 4XARA 4WBNB 3U7HB 1WL8A 1FP6A 3UUEA 4OUKX 3W6PA 1GFSA 1D3AA 4NS1A 1K7XB 1CR6A 1V7QA 4MS1A 4MKRA 3WA6A 2HAEA 1LQ2A 1NM5A 1DKLA 2HRQA 5HJ2A 4DCJA 5HUJA 2G5CA 3W3ZB 5HVNA 4ES6A 2P6UA 4HS9A 4KE8A 5CA0B 1ZSVA 2HDWA 1YH3A 2X7JA 2R6DA 4IRXA 4UATA 2HMWA 3SC3A 421PA 2Z43A 1R8SA 1C0KA 4AJPA 2VUHB 3LFTA 2VSFA 5J4YA 4X9XA 5FO1A 2ZIFA 2XT6A 3PXXA 1XUOA 3GUYA 2JD0A 2HRRA 3H8VA 5AMXA 4XB6B 4KGDA 1OMOA 3ZYCA 1X1QA 4C4XA 5T4HA 3OD1A 3P7MA 4HXYA 5KYUA 4TXJA 4KH0A 3TL6A 2X9LA 1UXGA 4H9GA 1GTMA 1J33A 1TMKA 4RW0A 2V1XA 2C0CA 1KTVA 1QYCA 1L4UA 4BFWA 1B14A 1QYVA 2XUFA 1S96A 1X7ZB 2VO1A 1HF3A 2QRLA 4GRDA 1JNYA 1Q84A 2QAIA 4DWOA 1OXKB 3V6MA 1N8NA 1TF2A 2FKNA 5HCNA 3ZTTA 3U3MA 3L46A 5ALVA 2YVAA 1RRKA 4Q1EA 1NMZA 5CCXA 5E2BA 4CMIA 4Z54A 1LW6E 4ZHSA 1M6WA 3KTAB 2M6RA 1RHRA 3QVGA 1HI9A 1UJCA 3PJGA 4GD3Q 3L8EA 4KFRA 2GESA 1BDMA 1G8HA 1DQSA 3LGXA 4N41A 4D81A 3RUPA 3NEJA 1VMDA 3HDGA 3JVUA 4DSNA 1ZKDA 2V7TA 4CM4B 3LHSA 4CF6A 1G21A 2GD1O 5DVZA 3F5SA 3G68A 2ZBPA 1FDWA 4G63A 4DXDA 4ZT6A 3AO0B 2REQA 3ZU5A 1PIWA 1NX9A 1Q91A 1RAIA 1X7XA 5K7SA 4LS3A 4BP1A 4OXNA 1NPYA 1P44A 1GITA 1HYBA 4P33A 1V1MB 1G8AA 1X8JA 2O2EA 1U31A 1VC2A 4JSTA 1GXSA 2RJOA 3QBVA 4R8LA 5IDXA 1I4DD 1PR5A 2OCLA 4QGFA 1DC7A 5B1DA 4CE6A 4DHWA 4UVGA 1FXWF 1DBQA 3TR0A 1FX0B 1P5ZB 3O2NA 3REQB 5CT5A 5K3AA 2W2VA 2ZWIA 3RS3A 4MV7A 3H5LA 3PP8A 4D6YA 5BN5A 1N5MA 2C5SA 3ZJ4A 4DB4A 2E3JA 1K7FB 2PMCA 4CKCA 3CHYA 1TKAA 2CK3A 4MYDA 3TD9A 5JS2A 4QASA 4MWGA 1MEEA 3M6IA 3OX3A 3T5CA 1D1PA 2D8MA 1UP7A 3FNGA 1A04A 1E7MA 5HQTA 2RI0A 3A11A 3A0UA 2V5AA 2GETA 2P9ZA 1P7ZA 3RRZA 1BMQA 1U4OA 5JH7B 4OMDA 4KR7A 4NEHB 2N9UA 4CUKA 5CDTA 1I30A 1AHPA 3O8CA 1ND5A 3BAZA 3A7DA 4X20A 4F7WA 1MB0A 2HJGA 4BLUA 3PJEA 3GFOA 721PA 4NL4H 4KQ6A 2J9XB 3M9WA 3LG2A 1JHVA 2P79A 2WMOB 2D3WA 1OHHD 1EX1A 1NYTA 2VUUA 1JSCA 3B2EA 5HF5A 1JFTA 3L93A 2CLFB 2HA6A 4Q82A 5CEFA 1VRVA 1K3FA 1HOTA 3AV0B 5I3CA 4FFSA 1RADA 2GDZA 5L6MB 2E4YA 1KI6B 2DWPA 3H8WA 5IJ0A 3S2IA 2CNDA 2FPUA 2ZRAA 1UOQA 3FPLA 4NU5A 3BSSA 3BEOA 3DCIA 4PHGA 2RC5A 3PI7A 3NP7A 2R97A 1I3LA 4POOA 3MILA 1JI3A 4HNGA 3VR2A 1I4TD 1T4BA 1V7ZA 2Z30A 4FSHA 4DNQA 1L7OA 4KH1A 4DJFC 5JCJD 1CP2A 2C4VA 4PPFA 1A1VA 3S70A 5B2FA 2RIRA 2E5FA 2WTUA 1RHQA 3CPSA 3NAQA 4O4IA 5A6SB 5LP6A 4PQEA 4TSRA 1J2EA 1IJEA 2O3TA 3C5VA 3QG1A 3KHSA 1SEPA 1NUAA 1VMEA 2CNWD 4FMPA 1JG1A 2C1ZA 4TZ6A 5HBRA 3GROA 5A62A 4LF9B 3GRFA 3Q3JB 4GF5A 1I32A 1OLSA 4MGHA 3DT8A 1F7VA 1JYSA 2C07A 2PJUA 5EKTA 1EM8B 1Q0LA 1JG3A 1WVGA 4L08A 1YBHA 3L8ZA 4B7ZA 1SXIA 1A76A 1E9SA 2AS0A 3EMBA 2ZJ5A 5JJ5A 2F8TA 3M6LA 2VPIA 2VYVA 3D5QA 3RSLA 3IV6A 1GOTA 4U0JA 1J9ZA 1DX9A 1PRYA 2UKDA 3BXXA 4ME6A 1V9SA 2X0IA 3DYVA 1TO2E 4RFSB 4JC4A 2BR3A 2HA7A 3GT3A 1LX6A 3P96A 4ZDWA 1BHQ1 1G4HA 1YMQA 4HLNA 5HIKA 1T9AA 1Z2PX 4K9MA 1EU1A 1YZVA 4C0BA 1E60A 5JR3A 4IPTA 3VNVA 4GI5A 4WNYA 3ZS8A 5DNUA 2O9JA 1H3FA 1TZCA 3CLSD 4NATA 5KWEA 1FXUA 2A6PA 1E63A 2VKTA 2CCGA 3K35A 4KO3S 3IV9A 1S2OA 1OFIA 3MTQA 4BB6A 2HXSA 4KO8A 4KQMA 2A1UB 4D8TA 1UDCA 2R47A 5EQJB 2YWGA 1PFGA 3F5MA 4LXTA 4CDGA 3M0EA 1VTKA 3M1LA 4XKJA 2PRSA 1XXHE 1Y9DA 2EP7A 3DLAA 1H9AA 1YSCA 2CHFA 2AOVA 2FLWA 4UU8A 3IUJA 1N6NA 2NZWA 3KOXA 3BHNA 4GUAA 3B7WA 1W5SA 4RHYA 4D9CA 1JEDA 2CE7A 3DJFA 4WUTA 1KVSA 1ZIYA 3ENNA 3HB5X 3AC0A 5ALEA 2BGUA 1Z5PA 4Y98A 3TL3A 1RM3A 4TUYB 4Z99A 2R4UA 4TWAA 5EE5B 1PBNA 4URUR 5IHPA 5J4VA 1FUIA 1ISIA 1DE0A 1D2HA 2DMRA 1FUKA 2PS3A 1DMSA 1WMSA 3Q0EA 1QG6A 1EHCA 4MYSA 3AWIA 2PX3A 2VA8A 1VJCA 5EXTA 4L5CA 3LC1O 1A2BA 3FB1A 3L0IB 2VYFA 2V4MA 2QGFA 2X2FA 3QHPA 4Q93A 4HX5A 5E6RB 1NFRA 2CCJA 5DM0A 2H63A 4M4SA 4A0HA 3DOIA 4JLOA 3BF8A 3LXUX 4GEGA 3DAOA 1C3VA 5JSUA 3DZBA 3RS9A 4OKSA 3L7JA 3B1XA 2I7DA 4DIMA 2O52A 4IUCS 4P80A 5G3ZA 1I01A 1E0AA 2QRGA 2IXTA 3Q6IA 3ONWA 3X2FA 1CBUA 5TMEA 3GUUA 5K0FA 1CU1A 1CUCA 3MK31 5F7JA 3HU5A 2Z83A 1VL6A 2PBRA 3IALA 4BO9A 3E2PA 1GQ2A 2AG0A 4MO9A 3EX7C 4ASUA 3KJEA 1U5AA 2AR0A 2HT6A 2WU0A 2HFKA 2DQKA 1VSTA 5GWXA 3BXGA 2A0KA 4LYYA 2X8BA 4PSKA 4IVRA 1N9KA 5FUYA 3S3TA 3UJ7A 1QHFA 1VJ1A 4EX6A 2RMKA 2XZPA 2XMBA 4ZOBA 3O4FA 1M0SA 3FG9A 1DRJA 3DMHA 2XWJI 1QGZA 1GL9B 4ZCIA 4TKZA 1TQ2A 1NM5C 3HYRA 1U5CA 4MCAA 1GTSA 1O89A 1D7OA 4YRDA 3WMGA 4C7JA 3WL3A 4JYPA 4B3XA 1KS9A 4OBXA 1KAEA 1E3LA 3PB3A 3BFPA 4YAFA 5JTTA 4OQXA 4G0VA 5ER9A 4F85A 2RHCA 3M6WA 1FFWA 1N5RA 5C8VA 1SBYA 5EERA 4K86A 1UUFA 2J3IA 1OI3A 2PWAA 1QZXA 5DO9A 5F51A 3E48A 3NTVA 1EUDA 1GGKA 2SHKA 2FN3A 2HU7A 3ROPA 4P3YA 2Z2KA 4XLLA 5DN6A 1PJLA 5ICGA 2ZRBA 1QGDA 3G82C 2EVWX 2HMYB 1XYGA 4C7KA 1SXJB 3GVXA 1GTG1 3RANA 3ROMA 2DPMA 4OA5A 1SZJG 3ZCUA 2PFGA 1YVDA 4Z9YA 3CG0A 4YJ2F 3EGXB 2REXB 4D97A 2EBWA 2W70A 3LIPA 2YUTA 1KY2A 2H4HA 3RV3A 1S3SA 1L7BA 1E79A 1N6HA 1Z06A 2O8VA 2FG5A 3LWBA 2Z3VA 4JB0A 1LBIA 1E20A 5K8VA 1FLDA 3A1FA 2FUCA 3PCXA 3UFBA 1VE7A 4HGNA 4QWMA 4YI5A 1M6YA 4IFTA 4BV8A 1WY7A 1V5GA 4GRIA 4TL8A 5CB6A 3LVRE 5DN9A 3V2HA 1R74A 4L2IB 3OPYI 4GL4A 5AKIA 2GXSA 5T4BA 1SQSA 4MULA 3AY0A 4RD6A 2H3EA 3RIHA 4MWTA 4ZHQB 3JQ8B 1KR2A 4NYMR 1GFWA 1VCIA 4D3FA 2GHTA 1AMUA 4ERNA 4IV0A 1ODTC 1GNRA 1Q92A 1UEXC 4X95A 3SIRA 2TMKA 2QL6A 3PZRA 1KDYA 2OV2A 5ER6A 2GZMA 5C51B 4RSHA 3GEBA 4DIEA 4DS3A 1DQPA 2QTTA 2YZMA 3ZD6A 3RRNA 5BR8B 1JG6A 3W5IA 3NDBB 3ZJ5A 3TOZA 1TVKA 5AI8A 4LF6B 4TM8A 4QHTA 1BEUB 3M9XA 2Q9AA 1NU6A 3MQFA 4MROA 1SOWA 2NXEA 4RJLA 2ORED 3URMA 4QBTA 4BUCA 4W5TA 2PY6A 3K6SA 2HJVA 2OXCA 1ZD8A 1K8XB 4HB3A 1GSAA 5CFZA 1ZUWA 3S27A 3SNKA 2VDNB 3FJ1A 1ZI6A 4G0YA 3O1LA 3B36A 4GM0A 4NYIR 2FEOA 2ZJ1A 4X1KA 4BO0A 1RXVA 1N3BA 3KT8A 3IQDB 3ET5A 1P7WA 3BMOA 4QXMA 2A94A 3W5HA 1WXGA 1XZLA 2J9GA 3HFJA 1XOIA 1WABA 2A5GA 2ZBGA 1KDPA 4HWGA 4NBWA 4F5WA 3DHYA 1KA9H 3I1IA 4ZMSA 1RRGA 5EJ6A 4HDOB 3TPCA 3AIOA 1GO2A 3M6UA 4PZZA 5BURA 1P1HA 4WLUA 3BWYA 4NTZA 5JWRA 3BORA 2ZIUB 2QMZA 5ENZA 4CV3A 1L5RA 4DLRA 4DV5B 3R7LA 3CRZA 1UZUA 3VHLB 1E92A 4MVYA 2XQFA 1UK6A 3ITEA 4UNQA 4UTVA 3G6WA 2ZIXB 2RI6A 2XXBA 4IRMA 4O2RA 1ISJA 2PUWA 4JZKA 4A6PA 2G08A 4W82A 3U13A 4Y9RA 1U81A 5K0EA 3CB2A 3MLBA 2ZCJA 3CNBA 2QRVA 2O8DA 3T0FA 3R3JA 1ORWA 5CFRA 1OV6A 1QHHB 4G5XA 1ID8A 2XZTA 1CVLA 4L2IA 4PG5A 3RKUA 3X43A 4JU9A 1Y1RA 2H0RA 3QVKA 1ZA2A 1Y6FA 5IK2D 1FF9A 1Z2CA 1KQPA 4PGGA 4C1NA 1L5OA 5AM5A 1SBTA 1G4UR 5AI0A 3C6MA 4C30A 2F8LA 4HXEB 3K8YA 3RS2A 1PG0A 1UBJS 1G5HA 4LHWA 5IK2A 1R0SA 4NARA 5JWOA 4UUQA 3UVEA 1DEHA 3N05A 3ZWOA 1R9GA 1ZCBA 4K2HA 3WKEA 3AQIA 4TKVA 2Q6LA 1WEKA 2GK4A 2BEUA 5DMHA 1PV2A 3GFRA 4A3SA 1G2QA 1WXIA 5FBQB 1TJYA 5CDYA 5AW2A 2RK4A 2G80A 2GCNA 4LSZA 4O4HB 1TW2A 1HZJA 2BBWA 3AI3A 4BNKA 5BVHA 3U4QB 3F9CA 4L16A 3VVBA 3AVQA 4RMGA 4HUTA 1S7CA 1PGOA 1QKJA 3HDJA 1FEZA 3NWPA 4TLLB 1MT3A 1B3RA 3TH5A 3CPEA 3C3YA 1OAKA 3IUMA 4QBGB 5E7JA 2BFWA 3QVXA 2OORC 2OAQ1 2XRFA 3CZQA 3WK8A 3O95A 1YA4A 4H0NA 5AUPB 4MQFA 4XUEA 3J81k 1NAHA 1G8SA 5KNLA 2ZRFA 4NY1A 3PEVA 5SY9A 4TTQA 4TN1A 1IDN1 3IVXA 3R9WA 4PVDA 1DG1G 1JDTA 1R0WA 2B5WA 2Q1YA 3PUIA 4KQWA 1E2GA 2A8YA 2VS1A 1GNTA 1UJ4A 2NTNA 3G2IA 1PNVA 4N8SA 5DIFA 3W8NA 3G1TA 5G1PA 4O8CA 2Z6UA 1PJSA 1HL3A 2A9PA 2UYHA 1X19A 5J58A 1XZMA 4BQRA 4MMXB 1Y9JA 1IAVA 1B2RA 1HETA 3HJUA 3KVRA 4FMDF 4P6VF 5AKEA 3U44B 3E0XA 3F9RA 4GWLA 2Q0XA 1OV4A 2IC5A 1SU8A 4Y9DA 4AN0A 2A9OA 4NOKA 3PXDA 1YKGA 2Z0MA 3AU8A 3GJZA 3HM2A 3LXMA 4XUGB 1ZICA 4PG7A 1IQUA 2BI7A 5AXBA 4QD3A 3PQ3A 2R68A 4B3HA 5H9WA 3ND9A 3PUWA 5COBA 3TQFA 2B36A 1CUEA 3G23A 4JT9A 1J0DA 3ZI0A 2D59A 4EMUA 3ZVMA 2F1OA 1RJDA 3QYFA 4X5OA 3R3ZA 4WY8A 4KSCA 3WGHA 2VJCA 1XPUA 3JATB 2H2WA 4QTYA 4AQYB 2Z95A 3DD5A 5C8XA 4O4LB 1R4MB 3DCNA 3KVOA 3SJ7A 4QPNA 5FFFA 3EDOA 1T2FA 1LS1A 3IKJA 3P0HA 1XTRA 4EKIA 4FDLA 5JVDB 2IV3A 1U6KA 1C7QA 1ML3A 3RS8A 4TVBA 1MPXA 2EBHX 3SC2A 4B6GA 3HKEB 3NHZA 3R0ZA 3D6HA 3A58B 1HORA 1WRBA 2BEUB 3HJHA 2G17A 2DB3A 1CJSA 1YCFA 3U17A 2VF2A 3ZH2A 2JK1A 2JIRA 2YOHA 4O4HA 3ZY5A 1P72A 3IEIA 2NUTA 5DCWA 5BVHB 3U4QA 1XIVA 3I61A 4EEKA 2CLOB 1PGQA 1WIWA 1WF3A 3VVCA 2W4IA 4JLWA 4IIYA 4DR4B 2BYTA 5H16A 4BJHB 1KQGA 4H2DA 1I33A 1IIBA 1ZM3A 3DL4A 5BNWA 1C4KA 1QP8A 3SKVA 3TZ6A 1ICIA 2ECQA 2HV8A 2Q3LA 4DV3B 3Q1KA 5K8CA 1UBSB 1SCUB 2PVSA 2UZ0A 3UA4A 1P5FA 2QMQA 2NO4A 4JOCA 1M1UA 3C3MA 1D2MA 3IUPA 5DPMA 4MVJA 1UC4B 4BOYA 2BFCB 1CZNA 2E89A 4PQRA 3QI7A 1J23A 3DOHA 3KLBA 3M81A 2C4HA 2P3QA 1VM6A 221PA 3RYTC 5LQJA 1R3UA 1W5AA 4EW2A 2R8RA 4QUKA 4Z4HA 1GAQA 2PM8A 2ZB8A 2EKPA 2VP5A 1C30A 2D2VA 2ECKA 3HH8A 3H86A 3H5OA 3I1FA 5GM2A 2B2NA 1T91A 4RFVA 5TC4A 4MYUA 3B48A 1R8YA 2W22A 1EUYA 4EKDA 1LSUA 2C7VA 1WXWA 2AOWA 3I34X 5KQMA 4RCVA 1FP4B 3HUUA 4OQMA 2VNIA 2WJ6A 3THOA 3IOBA 4EHLA 4IDOA 3EVNA 3PDIB 3TTTA 2GZHA 3ZX5A 4U7JA 4Z49A 5JXGA 1VJDA 2IPOA 4MOWA 1OVGA 1DEAA 4D98A 3IOEA 4F2DA 1TFUA 5J40A 2XKBA 5JALA 1LWOA 3JATA 4UOEA 1ISRA 2W6MA 1F4PA 2ETXA 1MDBA 4WERA 5FADA 1NP3A 4ER0A 1NULA 4M55A 1OXMA 3TQOA 1DAGA 1MP0A 5B30A 4ZFNA 4HNQA 2NQ2C 2FGKA 3NWJA 3DMTA 3HKEA 2CJFA 1OGIA 3R41A 3AOEA 1A27A 4JB2A 2DR0A 4X64B 5LQMA 5AJHA 2VTBB 3UT0A 4DNFA 1JQBA 1YULA 4J29A 2G0AA 1DG9A 1W94A 3GRVA 4MR8A 4V0MA 4HJRA 4R8KA 1CFZA 4QODA 5F9FA 1RT9A 3AJDA 5F9HA 1C14A 3SWWA 3RPEA 1KRWA 2ZDHA 2AX3A 2C7OA 3K0SA 5EIOA 3WQHA 2OHVA 2XNJA 3PWKA 3QXJA 4QFBA 4L9WA 3R8CA 5C35A 5SYMA 4RV9A 3GHHA 4GOKA 4X6LA 4HAVA 5K0NA 3EW9A 4FLEA 3WIBA 1QRSA 1XAIA 1TUEA 3N2YA 3PEEA 4EY3A 4BJ6A 1PWHA 1I3OA 5CK5A 2NUBA 1KK3A 4H7FA 4NZ9A 4DLBA 2IUEA 4CLOB 5I9IA 1XAJA 2NO9A 1JEQB 4ZOQI 1Z7GA 2GDJA 1E9RA 3ZWCA 3E9EA 2OCAA 2LZ0A 4G4GA 4HTAA 5ARCA 3AVUA 3NOOA 1USIA 1WXDA 2C78A 2W5UA 3WG9A 5HRUA 1D2NA 5KSZA 2B3TA 1RKQA 2O7VA 1QRTA 2W2QA 3N2GB 4HFRA 4CL8A 3Q6NA 1WULS 2FR8A 4P86A 1G20B 2O0LA 4N0MA 2WKQA 5DSZA 1T2EA 2Q2OA 1FUEA 3ZWKA 3WHPA 1IUOA 3FJOA 3K73O 1KDVA 2BBTA 4DUYB 1C1HA 3AVVA 3N0TA 3DKPA 2F43B 5C7OO 1GCOA 1JDBB 3T95A 4M1QA 1YRQA 3AF5A 2J0EA 3ED5A 3KAKA 3IXLA 2QSZA 1ENPA 4MR7B 1HY3A 1UKVY 1TIPA 1V7PC 1FS6A 1QYIA 2V0NA 4RWEA 4URWR 2ACVA 2PLNA 5KUTA 3K32A 4KC0A 5IF3A 3NTXA 1OE0A 3EC7A 3JD3A 4PAWA 4HRYA 4G9BA 4TQAA 4WLFA 1OHHA 4YBZA 2VWHA 5AOVA 3FWNA 4I1SA 1QIIA 4OK5A 2B1JA 521PA 5JROA 4RAOA 2GYYA 3A28A 4XPIB 2EG9A 4A0SA 3QP9A 1YIOA 1TK2A 2OG1A 2HYIC 4KXFB 4EFDA 4ETIA 2GM4A 1YRAA 4LDZA 2R44A 5TX7A 4DIBA 5DWDA 3WO0A 1C50A 4EO4A 2YYZA 4ZKDA 1S9HA 2ID8A 4WDQA 1SKAA 4KQ1A 4Z1MA 4CYMA 4F1WA 2XVXA 2EEPA 2IEBA 3OU7A 4IJKA 2WWRA 3IR7A 1Y63A 4MHSA 1Z0DA 3SS9X 2OYCA 3T9FA 2PUGA 1N2HA 5JISA 3FNIA 1V39A 2AZ4A 4L4YA 4QIHA 3WWPA 3CN7A 3GMDA 3R0QA 4AU1A 2YWRA 3PTZA 4G4IA 1U7WA 3TLZA 2Q5JA 2HY7A 2IUYA 1GA4A 2YX1A 3WFIA 2JAPA 1WXHA 4NULA 5A5DA 1RZRA 2HMVA 1MVNA 1Q7BA 4EUKA 1FMLA 3D7KA 1QPZA 4V24A 4YECA 2QSUA 1T15A 3VTFA 4BLPA 3SF8A 1H2FA 1R27A 3RVKA 4LNHA 4DGSA 1KGDA 3IKVA 5TVKA 3UT5A 3L7NA 4U2DA 3TCKA 4YCCA 4UU7A 1I9CA 1O03A 1Y5NA 1FQOA 4O08A 2ZTMA 4QX6A 1DC5A 4II3A 5E9QA 3W3AA 3S2SA 2VG8A 5FOVA 3A6EA 3ZJUA 2ZIVB 3TKLA 3DMYA 2ZI4A 1Q2XA 3WYFA 5ESWA 1EGQA 4UHHA 2W7TA 3RVSA 4WOPA 1EXVA 3O3MB 4FILA 3UQZA 1V5EA 4PPGA 3R76A 4MUGA 1PZXA 1AC5A 1IN8A 2C5GA 2WM2A 3NHPA 3WKDA 3NP9A 4MRRA 2CK3D 1N3YA 5KTRA 3GLFA 1A8IA 8OHMA 3TR5A 4C3OB 2E6KA 2ZVQX 4EB6A 2ZIAA 1E9EA 1EFPB 5I47A 3K9QO 3QWHA 1IPHA 2ZXUA 4G07A 1Q57A 1ADFA 3N70A 5ENDA 3K1AA 1OWNA 3AJEA 1MABA 1W44A 3O73A 2J5XA 2O8NA 1YDMA 1CZLA 4RORA 4ZGBA 4FE4A 3M5DA 3I28A 2JFWA 4JKOA 3N8DA 1R4NA 2VYQA 2ZBQA 4BPRA 5AKYA 1OR8A 1L0BA 1P31A 3ZHBA 3WY9A 1IYZA 3WDMA 4JT4A 4JA0A 1GR0A 3O84A 1XZKA 4HTFB 2JA1A 5JCJA 2CLCX 2LD4A 4ZGWA 1NRIA 2JFXA 3T5MA 4MQEA 2ZLBA 2VPTA 5IDYA 1EJBA 3K3PA 3ZHTA 3C3JA 1T6XA 2QD3A 1FS5A 3N2KA 4HF7A 4FJ2A 4JN6B 1X7GA 1U2GC 1QFJA 2C7QA 3NUQA 1DT5A 5EHNA 5CDFE 3D3NA 3GY0A 2CB0A 2P40A 2ZYRA 2JJ1D 4MVJP 5IYZF 1UZMA 1KJQA 4NMXB 3MQ4A 2PLRA 3NJRA 3BGDA 3SF8B 4UE3S 3LRTA 4C76A 2GM9A 3P71T 5BN4A 3IP6A 3A1VA 4I4IA 1O9BA 4GX2A 4AYXA 4E21A 2W11A 4V1CA 4GOMD 2GRAA 4L1KA 1TZKA 2P78A 4Q37A 1G5PA 4R0NA 1EXNA 1WB6A 1FP7A 2GTIA 4MYRA 4NZOA 1JSRA 2O1WA 5D2CA 3WDSA 1JZQA 4K81B 5FA6A 1QK4A 1G8YA 4PLGA 5A02A 1ATIA 3BWMA 4FFNA 4O2BB 4O1MA 2IP2A 1VG1A 3OLYA 3OKFA 3KEOA 3PC2A 3ZZUA 2I4TA 1RHMA 4Q9KA 4XM0A 4YP1A 1TFRA 4LBVA 5A7FA 1C9YA 2XF8A 4Z86A 1YMVA 2X4LA 4S1TA 3ONNA 1MQ9A 3C6QA 3FWZA 3EGOA 5J3JA 2PUJA 3SP1A 3SG0A 4BXOB 1BE0A 2OCXA 3B2NA 2VJPA 3DCJA 5KTPA 3KKEA 4QG3A 1VCNA 4JQSA 3UWPA 5IABA 2QVYX 2NUAB 1B6TA 3I45A 4ML3A 4XDGA 5IJXA 3F73A 3QKTA 1DQNA 3Q2IA 3GCXA 3GX1A 2NU8B 2I2XB 3C7CB 4LQLA 5BVGB 1ESCA 5EZYB 5FH9A 2UZ3A 4CVNA 5JNLA 4UCXA 1DQZA 3QMMA 5ALHA 3QEKA 5LPNA 1NMEA 4QAQA 3IAM6 3KETA 4H6XA 2Z8YA 4XGKA 1M67A 1P75A 4NJEA 1XQ6A 2BFFA 5CT6A 5BQPA 5DULA 5FD8A 4MI1A 3AOGA 1N78A 4XYMA 1FTYA 3ZIAD 3VOSA 3W2GA 4B75A 2WUGA 2OGUA 2X0KA 4G97A 4Y6RA 1W59A 3NYRA 2ZUVA 3O47A 1ZBDA 4NIMA 4V2IA 1RPAA 5DYNA 3TXAA 2I54A 1E4VA 2QVXX 3OCCA 3STHA 1CF4A 3COSA 4KVGA 3C8MA 1B1CA 4AIIA 1X74A 5B6JA 1C0EA 2JGDB 4H16A 4J2OA 2ZP1A 1UPBA 2SCUA 2OAEA 1XQYA 3LX5A 3JQFC 2MR6A 3IV7A 4IWNA 1PYDA 2GK6A 1MOZA 5THKA 2B4AA 3CISA 1GPLA 3JQBC 1FQWA 1VI5A 3CCFA 4L4RA 1Z12A 4M1MA 2PZMA 2GYVA 2HSGA 2QN1A 1Z0KA 3SM9A 3FOFC 3NXSA 2DM6A 1YUNA 2GHRA 1C9EA 1KNXA 4OLBA 1DQYA 5IXSA 3VX3A 1D2GA 1V9LA 3FA2A 1UWLA 3WGZA 4NCBA 3UK0A 5B57C 3EPPA 1J00A 3PDCA 4BAUA 3PQ4A 4RELA 4D4KA 2PU5A 1ZGCA 2P9QA 2R4QA 3ENQA 3TBHA 3DBRB 2G7ZA 2CXUA 3SR3A 4BRWA 1CNEA 3EWSA 3H2YA 3FSRA 1FTNA 4HRAA 3QLTA 2RG7A 4XH9B 1E18A 3FZQA 2QUBA 4B8ZA 1XJ5A 2JRCA 3RV4A 5A2GA 4PTLA 2A57A 5CUQA 2FR8C 1N36B 2XMZA 3B1WA 2HBRA 4LDQA 4W8OA 2M1ZA 3GBVA 3GLHE 3G3EA 1ZAKA 3QWIA 4HKTA 4UBKA 4URFA 5E1MA 2WI8A 3ZE2B 5C52B 2E5WA 3I6ZA 4MLPA 1V47A 4U5XA 5SZKB 2VUSA 3UHJA 1AA6A 1Q12A 3VR5H 2CYBA 4PWYA 4TKUB 1ZM7A 3JD1A 5EJ8A 1TUGA 2E87A 3GWGA 5JAHA 2AW3A 1Z28A 1HO3A 1ULAA 1YB2A 2W6CX 3B70A 4HQNA 4K6KA 4LBYA 4YJGA 5EE1A 3WYEA 4H7EA 4N6NA 4NYMQ 3HM9A 4RA6B 2GNOA 4OX9B 2CF5A 1XF9A 4BN4A 2QBYA 1YL6A 3ESQA 2BH9A 4XFJA 4Q24A 5JS1A 4MJXA 5IBCA 3NOXA 3OEHD 4GGOA 4TL6A 5FCDA 5J5VA 2O8BA 2X1VA 4BEWA 3BJZA 2VXBA 3GGOA 3IILA 3NASA 3QJYA 3MJTA 3PD0A 1ZVJA 1B6GA 1RWMA 3CJQA 1TLTA 3EQ6A 3MSCA 4JEIA 3PNMA 4Q3OA 1YQWA 1JDZA 2BF7A 2YJTD 1J21A 1V11A 3KLPX 2AJDA 2JIQA 3OOYA 3VYTB 3UOWA 1U3VA 1K89A 1ZOPA 3U09A 3W90A 3ZDCA 2NAPA 4NFLA 4YLEA 2GLXA 4QBIA 3EXEA 1SQ0A 1XT6A 2XT0A 3T0IA 2QMEA 2AC4A 1N6OA 3JVVA 4IJUA 1MQ8B 3UCXA 5HR5A 2ZVPX 2QD5A 4M36A 1M3SA 5FEMA 2I1WA 5K4HA 2N75A 5LZ4A 1YO6A 4NYIQ 5ITWA 1UAGA 2FX2A 2AMJA 1E4EA 4I3GA 1KEEB 1JAIA 5JS8A 5EMKA 3ETEA 1T5IA 3VDRA 3U1TA 1NPDA 1QPBA 4FUQA 3L6RA 1E5QA 2JIMA 5EPOA 2BCGY 3JW8A 5FWDA 2YJZA 4GR4A 2PVPA 2BKUA 4KUHA 2YOFA 2EJTA 4DG5A 3TOSA 1G2PA 3GRPA 4IDCA 5EJ2A 2W2MA 4RVCA 4UTOA 3G8CA 4B40A 4C08A 3A1TA 4D9HA 2Q46A 3SDSA 1OW3B 3HMKA 5EXDA 5A4IS 3NTQA 4FYXA 1G9SA 3EULA 1UQTA 4Q01A 4RBNA 2JIZA 3EOAI 1GPMA 4YXWA 3FYDA 3WL8A 1PGPA 1QYXA 4YQZA 1UPCA 2OZLA 3OP1A 4C6HA 4LA4A 1V1JA 1A8SA 2QLNA 2YS6A 3CH5A 3B53X 4JENA 3COYA 2OK8A 1SBCA 2VK1A 3KJGA 4BMDA 2Q5CA 1CJMA 1OC2A 3PF9A 3D0KA 1SCNE 1SKUA 1U0JA 1U94A 3OFKA 4WNIA 5I51A 4EI9A 4IX1A 3OQMA 4QKQA 1LEHA 3H6KA 3FDIA 4TXMA 5FPKA 5HYVA 1V4NA 1E6KA 4P4SB 4KMRA 1W35A 2DQ4A 1EVZA 1STOA 5E4YA 3VMFA 2QBYB 2I33A 1MN6A 2WHPB 2REBA 2RGWA 3N1UA 3EXHA 3JQAD 4NHEA 1B8VA 3GVCA 3UPUA 1ISMA 1QFXA 1B2LA 1MAAA 2G8NA 1T8TA 3MJCA 3CWQA 4GDMA 3RSFA 3VR1A 1RWPA 3ZV3A 4DWWA 4CT4B 1W9MA 1GQQA 1L4MA 1R66A 3EQ2A 3P45A 1VIAA 4JLSA 4P4NA 3MWEB 2A5FA 1XKLA 1TL7C 2ECOA 2BCJQ 3WGKA 4DBZA 4LRUA 3MXTA 4DM3A 1BDHA 2J9FB 3F6YA 4UHCA 4E4TA 1YGYA 4DA9A 1X92A 5JARA 4A6EA 3N28A 4FX5A 5HWSA 9ABPA 2BRUA 1OX6A 4F91B 2A9RA 1W48A 4DQLA 4E5KA 3VJRA 3GELA 1RKXA 4F46A 3JZDA 4D9GA 1EWQA 1P74A 4CF4A 4MUNA 4ZAYA 16PKA 4OJYA 1WZ2A 3LL4A 4I7EA 2RONA 3OHPA 5EP3A 3UAGA 2B1RA 5BWNA 1H1DA 3BB1A 3W5AA 4JT8A 1W25A 3IELA 2JZCA 1T36A 3NHMA 3KUUA 3AMVA 4N8EA 1E98A 2Y6UA 4QUAA 3W34A 4KN8A 3FKSD 1SG9A 4EW6A 4OHKA 1YHZA 1E99A 3IOMA 1HE5A 3KRTA 2IYPA 3LFHA 3TDKA 3RJ5A 1N6RA 4MICA 4QYWA 2WUWE 2DFPA 1A5AB 3DV2A 1P81A 1VJ0A 1T3TA 2FP4A 2YKGA 2WU3A 5DDIP 3RF7A 5DW3A 5JY1A 4ACAA 4OQNA 4PU0A 3RR2A 1RHUA 4TT3A 3ZGLA 1FXWA 1XDSA 3OF3A 3HG7A 5ECWA 5FOTA 1NUPA 4RY8A 5LJLA 4UUPA 3F5FA 1DLIA 1JLSA 4L9RA 4RF4A 3NC0C 4B6RA 1VHTA 4CF7A 5JSFA 2FUG1 1RWKA 1HLGA 3OSUA 2L42A 1RCFA 2VDUE 2VHJA 4G84A 4MP6A 1AHNA 4U1RA 3TNJA 2WMDA 4P84A 5K01A 1QE3A 1U1DA 4OLFA 4EPXA 2HX1A 4RHCA 4YP9A 3OZIA 3FVRA 1F1JA 2PFKA 2I4IA 2VRCD 2XCIA 4OUDA 5IUJC 3DBOB 3K20A 2IPXA 4G5SA 1U9CA 1KZ7B 2PBZA 4EUHA 1KFJB 2COUA 4JUAA 1U6JA 3MGGA 4MI3A 4Q00A 3SJZA 5CYGA 1MJGA 3EBLA 3ENZA 4PWZA 5H0IA 3VO8A 3QKSB 2NO1A 1XD2A 3OH8A 3R2JA 3N2LA 4YO8A 1C5KA 3KQOA 3LW7A 5DWQA 1GVNB 1NNUA 2VI5A 5FI1B 3H3FA 2V6MA 1Y3AA 2WWHA 1T5SA 3C3PA 1Q6YA 3B7PA 1N75A 1YU6A 5TQ2B 3V8VA 3FB4A 1JUDA 1LA2A 3O82A 1SCQA 3ZV6A 4G9EA 2DWUA 2HF2A 3EVZA 4LYAA 5YASA 1SAYA 3EMVA 1ECCA 1YQ9A 3EXG2 4DMGA 3UTDA 3IIEA 2BW0A 2C1XA 1P5RA 4BVAA 3G0CA 2K2QB 3TFOA 3SE7A 2JLYA 2JDIA 3JYOA 1HNNA 5FL3A 1QLJA 1GFIA 4BFYA 1KERA 4N65A 3IT2A 3OT5A 1MEJA 2FOXA 2IKQA 2IH5A 3MEQA 3KXIA 5TMBA 1JHXA 2CHUA 3DTVD 3NCTA 3NWEA 4JEMA 1OTHA 3S40A 2D1RA 3N0WA 2UXCB 1TYZA 2DF8A 4IDEA 4FUTA 3ZVRA 5BR4A 1OUMA 2BGLA 4NEQA 4R8SA 4FQ7A 5JAOA 1YK1A 3OWXA 5LYYA 5MN5A 3K70B 4Y2XA 2HDHA 3ZK9A 1XVVA 1T34A 3PDHA 3SR0A 4EGFA 2HNAA 4ZT2A 1EEHA 1KI3A 3CXRA 3SPXA 3TIFA 2OC4A 4U7DA 4GPZA 3ICQB 1S4MA 3A2LA 2XE7A 1ENOA 2IX3A 1GJRA 5B1IA 5GZ3A 1PV4A 1PDVA 1UJBA 1MKYA 1GYPA 5DCYA 4B5LA 4EF6A 2Q9CA 4H1WA 3EQ9A 3UG7A 1XZGA 5KYTA 1ADGA 1HDOA 3LHIA 3GPLA 2DUUA 2XB9A 2VTEA 4FLFA 4L76A 4MB2A 3M6AA 1YJQA 3QY0A 2ZJ0A 3BIJA 3BIFA 1HDYA 5BPFA 4TS1A 4ZOLB 5EI5A 4N76A 4PG4A 4C7XA 2QN3A 1ZVMA 1JHYA 3OUZA 1PR2A 4GBED 3CLHA 1EG7A 5JCOA 3GJ6A 3PX3A 3VFDA 3Q41A 5C4GB 2O8CB 2GFIA 4N5LA 1Y4DE 5C5IA 2X0DA 1UADA 1W4ZA 4HZUA 4Z53A 4KQXA 5KU1A 4ZT3A 5BW6B 2HRBA 3B1VA 4F1JA 2HC9A 4ZYVA 3LSTA 1Z88A 3QHQA 3VGJA 4KPYA 1D1QA 1EAMA 2II6A 4AULA 1VMIA 1QS0B 1EZ1A 2HO4A 2PGJA 2RJNA 3C3BA 3HWSA 4JL5A 2R8YA 4X3CA 4Y7CA 3OZ7A 3VPDA 3HO6A 1BU5A 4UMVA 4RF3A 1U7ZA 2FSVC 5L3VA 2QTRA 3NANA 1XMVA 1UKCA 1SCBA 2O3QA 3KJQA 3MLAA 2X0RA 3AESB 1MRZA 4BVGA 1OB2A 2H8GA 2WF5A 3CRNA 1UMBA 4BCDA 1NVXQ 4C4TA 4W1SA 1BGVA 2VDKB 1SULA 5ALDA 3V2UA 4AUNA 2OD9A 1PFVA 1M10A 1E0DA 2HL6A 2QW0X 3LD9A 3V46A 1K8QA 3WLQA 4LF7B 3I2YX 1V45E 1T2UA 4UM9D 4CI0B 4U9IS 1EFHA 2AD5A 4ND4A 4BO1A 4CKYA 1XCMA 2VN8A 5B7GA 3EUAA 3HZHA 5D3QA 5TNXA 3EDQA 2D7JA 4AVYA 2QW1A 4IIUA