4QVKA

Apo-crystal structure of podospora anserina methyltransferase pamth1
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
235
structure length
235
Chain Sequence
LGSILPFNEETADRVSAYCEKNSHGIPDALVEHWEWTRTRFPDADKMSSRLQGSWMIFTARDRKPKRILEIGCYSGYSALAWYEGTRDTKAEIVTLEYSPKMIAASREAFKKYGVGDRVKLIEGPAENTLKTLEGEFDLIFVDANKDGYAGYVKTILDQGLLSANGIILCDNVFARGLTIGPDCAPWLNDHVRPYWNGCGQALDKFSAGLMEDPRIDVLLLPVFDGVTQIRWKDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PaMTH1 Methyltransferase
publication title Structure and Biophysical Characterization of the S-Adenosylmethionine-dependent O-Methyltransferase PaMTH1, a Putative Enzyme Accumulating during Senescence of Podospora anserina.
pubmed doi rcsb
source organism Podospora anserina
molecule tags Transferase
total genus 87
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4qvkA00
4R6XA 4RTNA 4RX1A 5FADA 3MAGA 3HA5A 5LQNA 2V7EA 4Z2YA 1X1BA 2AOTA 3DH0A 3PB3A 1NW6A 3D2LA 3GU3A 3KPYA 3FUTA 4M38A 3EEOA 1G55A 2IBTA 1L9KA 2YX1A 3NDIA 4PYKA 3EGEA 2IFTA 4P7FA 5GINE 1IM8A 2IDKA 2OPBA 4DF3A 5FA5A 4GOLD 1UIRA 2FRXA 3KPVA 3HA3A 2UYOA 3NW9A 5CVJA 5EZQA 3Q87B 5T67A 3DULA 3SSNA 1RI2A 4YUWA 3PX2A 1KYZA 4RTLA 4HC4A 5T64A 3DP7A 2OKCA 3UZUA 5ERGB 4WXHA 5M5BA 4GC9A 3A4TA 1FJXA 2PX5A 3LKDA 3TM5A 1YB2A 4PGHA 4JXJA 3DR5A 3R3HA 5K0CA 5K8VA 4DQ0A 2K4MA 4RVHA 1ZG3A 1H1DA 4ATNA 3EVDA 3M6WA 1RI1A 2P40A 3A26A 4QQKA 2ZCJA 2DULA 3DMGA 3EGIA 3GRZA 4XUCA 5CVVA 3GWZA 2G71A 2ZIEA 3I9FA 4MIKA 5DX8A 3TR6A 5CIYA 2XBMA 4QDJA 5EHIA 3G5TA 2CL5A 1SG9A 3K6RA 3EGVA 4E2YA 2AOVA 3M6XA 5P8WA 2QM3A 4KDCA 4BLVA 1X19A 1AQJA 3UJ9A 3NWEA 4L7VA 4PYIA 4F86A 1FP1D 3DXXA 5E9WA 2C7RA 1D2GA 1P91A 3BXOA 1R6AA 2ZWAA 3LCVB 1RJGA 3EVBA 4OBWA 3FUWA 4R8SA 4X60A 3HNRA 2ZW9A 3FUUA 2I62A 4LG1A 4ZTBA 2GH1A 4NECA 1ORHA 1P1BA 3MCZA 3MCTA 1JG2A 1NV8A 5DXAA 5K0EA 1G6Q1 3B3FA 4YUZA 1YFJA 5K0LA 3FTDA 4PCAA 1NW5A 2AOUB 3JWGA 4AZWA 4DCGA 2ZZMA 5H02A 1QAMA 4PNEA 3MGGA 4UOEA 2CWWA 3GRYA 1SKMA 5FWDA 4CKBA 3PVCA 4LECA 2UYHA 10MHA 4ER5A 5K05A 3GCZA 3FUVA 4DKJA 3BGDA 3T7RA 5DX1A 3R6TA 4GUAA 3PTAA 3EVEA 5FCDA 3G5LA 1UWVA 1INLA 4PWYA 4QVKA 3TRKA 2C7QA 1YUBA 3QV2A 1JG4A 1VLMA 5LQUA 1VIDA 5E8JA 4QTUB 4FZVA 1R00A 3OFJA 2WA1A 4OX9Y 1BKYA 5DTQA 2ZWVA 3GIWA 5HILA 1FP2A 5DT2A 1QZZA 2IIPA 2JHAA 3GO4A 3WSTA 4PYNA 3I58A 3KQYA 4FT2A 1KYWA 2YXLA 4PYJA 5DSTA 2HTEA 3LCUA 4EKGA 4XCXA 5EHGA 3M6VA 3JWHA 3UJAA 3P9KA 4ER6A 5BW4A 3CJQA 2XVMA 2XYQA 5CCBA 2EJUA 2HNKA 5EZSA 3KQTA 5DM1A 2QRVB 2V74B 4IV8A 1KHHA 4QVGA 1WXXA 5DRTA 3B7PA 2PXXA 3OU2A 5DTMA 5ICCA 5EMKA 2ERCA 4PYLA 4E33A 3BT7A 4OBXA 1ZQ9A 2WK1A 3S68A 3KPJA 3LPMA 3VC1A 5K0FA 2Z6UA 3DLIA 3QOXA 4LWPA 3UJDA 5LSAA 3FPEA 3CCFA 2JJQA 5GP1A 4DZRA 3G8AA 4RTJA 3GXOA 3B3GA 4E2ZA 3UBTA 5IKMA 4E31A 2YTZA 3DUWA 2AOUA 5FHQA 3M33A 1EQAA 2ZIFA 4GOOD 2GS9A 4A6EA 3ER8A 3PS9A 1RJFA 2O06A 5E2BA 3Q7EA 3GRUA 5C9ZA 5EVJA 1WY7A 4RTOA 2VZ9A 1VQ1A 2JH8A 5B1SA 3HEMA 3FTFA 1MJFA 1JQEA 1YZ3A 2PX4A 4R6WA 2PT9A 1M0EA 1DUSA 3KQSA 1YFLA 1HNNA 5LQRA 1EIZA 3TM4A 5EEHA 1AV6A 1P39A 4ISCA 3KQMA 3LCCA 4PONA 4YUYA 2UZ4A 5DSXA 3OCJA 4M36A 3KQPA 3OZRA 5FULA 1XDSA 3HCBA 4C06A 4AX8A 1XVAA 2PKWA 5GM1A 1WG8A 5DLYA 3NVMB 2FK7A 4IWNA 3UA3A 4C05A 4YMGA 1L3BA 1X1AA 3OE4A 5HZMA 3F4KA 1JSXA 1VL5A 1BHJA 1N7IA 2AN5A 3IEIA 4FT4A 3HCFA 4GBED 4V0QA 3BKXA 3DXYA 1L3IA 4QTTB 2QRVA 4C07A 2IBSA 2BR3A 2ZVJA 3C3YA 4PYOA 5DX0A 3MTIA 1RI4A 3HM2A 4FGZA 3T7TA 2NYUA 1EJ6A 3MB5A 3G7UA 3FRHA 4B17A 3EPPA 3ID6C 3NJRA 4P7JA 2ONYA 2PJDA 2YXDA 1KPIA 1XXLA 2O05A 5U4XA 2A14A 5KQSA 3MERA 5JR3A 2GA9A 4G56A 4QDKA 5DWQA 1KXZA 4YV0A 5CVEA 1FPQA 2NXEA 3TMAA 2OB2A 4BP1A 4CKCA 3R24A 3LBFA 5DPMA 2XVAA 4EKIA 4OA8A 1IXKA 3CVOA 2HWKA 1G8SA 2BH2A 3FUXA 3P2IA 3BWYA 4Y2HA 3P9NA 2P3LA 4MTLA 3SVZA 3ER9A 3FTEA 4PYMA 4E32A 3ME5A 2PBFA 4OA5A 4AZSA 4RVFA 2PY6A 3CJRA 3A7DA 1G38A 2P3OA 2VS1A 1R18A 3X0DA 1ZHFA 2BR4A 1TW3A 3HA7A 3OU7A 5G02A 1YF3A 3AXSA 5E2AA 3P2KA 4HG2A 1IY9A 3K0BA 2UYCA 2EJTA 3EVCA 3I53A 2GLUA 3ORHA 5FWAA 3OZSA 4RVGA 4EQZA 4E70A 2O07A 3UJ6A 2AVDA 4KIGA 4CTJA 2P8JA 5DRYA 3T7SA 1TW2A 1Z3CA 2XYRA 4MWZA 4FSDA 5LQCA 1RJDA 4FS8A 4GOMD 2JHCA 3PT9A 2ZIGA 5EGSA 3OE5A 3G8BA 3RIEA 3EEYA 2YXEA 2R3SA 5F2OA 5K09A 2FCAA 1ORIA 1JSZA 1XDZA 2CMGA 2ZBQA 3TKYA 1DCTA 3H2BA 2HMYB 3C3PA 4OQDA 5K0NA 2DPMA 5KVAA 5GIOE 1G60A 3AJDA 3LDFA 2P7HA 1NT2A 1PRYA 4AUKA 1YZHA 5ICFA 1JG3A 4AZVA 3EMBA 2FK8A 2Z6AA 3ELDA 3HCCA 4KW7A 5EEGA 3V8VA 1VPTA 1ZKDA 2R6ZA 4R05A 2BM9A 2CKDA 5HIJA 3THSA 2FPOA 4LWOA 4RWZA 3UJ8A 5E1BA 5HIKA 5HIMA 3CC8A 5CM2Z 4YMHA 1XTPA 3TKAA 3NVKI 1RJEA 5DTRA 3R0QA 2N47A 5CVUA 3LSTA 5EG5A 4CTKA 2P35A 5EMJA 4DMGA 3FYDA 4K6MA 1VP3A 3B5IA 3IHTA 4GOND 1PJZA 2G72A 3ANXA 3JWIA 1QAOA 5E1OA 3ELUA 2PVCA 2O57A 5EC8A 3KQWA 3G2MA 4HGYA 3BWCA 3CJTA 1P1CA 2KW5A 2PX2A 2NXNA 4RTMA 4X1OA 3CKKA 3AY0A 3T0IA 9MHTA 1M6YA 4DM3A 3REOA 2PXCA 2JHPA 2PWPA 3BWBA 3LDUA 5LQAA 4P7GA 5FA8A 3HCEA 2AS0A 4PIMA 3HVIA 4E30A 3TLJA 1JTEA 1D2CA 2YR0A 3KR1A 3PFGA 1KIAA 2VDVE 4U7TB 3TOSA 3E23A 3GGDA 1O9GA 1NBIA 2AOWA 3FPGA 1N2XA 3KU1A 2PT6A 2IDJA 3P97A 5EIWA 2NXJA 2ZFUA 4F84A 3SR4A 5FQOA 1N7JA 3UJBA 3MHTA 3P9IA 1ZGAA 4PGGA 2PV0A 2Y1XA 3UJCA 4BLWA 1QANA 2ZZKA 3FYCA 3HVKA 3SGLA 2F8LA 4RTSA 3FRIA 3HVHA 3EMDA 2VDWA 1SVUA 4KVZA 4EK9A 3KPWA 3DTNA 3I5UA 4YV2A 3E7PA 4QQNA 1EG2A 2NXCA 4GF5A 5LQJA 3GJYA 4EVIA 2QE6A 3KQQA 3P9CA 4RTKA 1QYRA 2IGTA 2NP6A 1SUIA 3LKZA 1X1DA 2PSSA 3I64A 2E5WA 1Q0SA 1V39A 3BGVA 3SM3A 1F38A 3FPHA 3O7WA 4HTFB 3TQSA 3NMUF 3BKWA 2O0LA 5IH3A 3M6UA 4RTPA 1L1EA 2HV9A 5JUWA 1VP9A 1JR4A 2AOXA 2GAFA 2OZVA 4KRGA 5EKUA 4WVLA 5EMLA 3SX0A 2OO3A 3UFBA 1KP9A 2I9KA 3FPFA 3NWBA 5E1DA 2I7CA 4H0NA 3GDHA 4IKPA 3GRVA 1AF7A 1JTFA 1R8XA 1UFKA 2AN4A 2ZBPA 3MTEA 3EVGA 2B2CA 4MHTA 3B3JA 3JWJA 2YVLA 1RI3A 3EVAA 2IH5A 1G8AA 1VBFA 2QY6A 3PLAE 2P41A 1BC5A 1R74A 2AR0A 3C0KA 3G89A 3GNLA 4X63A 4C4AA 3RW9A 3V97A 1NE2A 2B78A 2ZTHA 5FUBA 3UA4A 3NTVA 1NKVA 3BGIA 5DM4A 5K0JA 5K01A 4CXMA 3KR2A 2WA2A 1ZGJA 1NW3A 2P7IA 4PIPA 5CVDA 3SSOA 4A6DA 1XCJA 3HCDA 3LL7A 2PX8A 4RYLA 5EPEA 4YUXA 3SMQA 4EMSA 2VDUE 1DL5A 3P2EA 1TPYA 4R8RA 4YUVA 1QAQA 4ER0A 4E2XA 3AXTA 3FTCA 3IYLW 3QOWA 2OBFA 3PX3A 5D1HA 2EG5A 1SQFA 4F85A 3A27A 4PYQA 4ER7A 4RTRA 1U2ZA 2UYQA 5E1MA 3SSMA 3BZBA 3IV6A 3LHDA 4HTFA 1JQ3A 1JQDA 3OFKA 4YV1A 1RI5A 3OZTA 4RSRA 4QPPA 2YQZA 1AQIA 3GRRA 3A7EA 1Y8CA 2AZTA 2G70A 3DMFA 4KWCA 4MQ4A 2ORED 4AZTA 3PFHA 1F3LA 2OYRA 4GC5A 2G8NA 4Y30A 5BXYA 3E05A 2H11A 3KKZA 4KIFA 5HEKA 5F2KA 2NP7A 4C04A 1Q0TA 5GM2A 5KS2A 2VP3A 5C0OE 1B42A 4POOA 3CGGA 5GOZA 1L3CA 3KQVA 3KQOA 2ZLBA 3LGAA 3M70A 3SXJA 2C7OA 1D2HA 1OR8A 1FBNA 5ICEA 2ESRA 2FHPA 1SUSA 2GPYA 4RVDA 5BW5A 5HIIA 4DCMA 3HTXA 4GEKA 3U81A 5KYGA 4GQBA 4CKEA 2B3TA 5CCXA 1KPGA 2JH9A 3G88A 5ICGA 1WS6A 8MHTA 2P3QA 2OB1A 1I9GA 4BY9E 1XJ5A 1VE3A 3C6KA 2NNWB 2CMHA 3UWPA 3HCAA 2PXAA 4M7RA 4X61A 1M6EX 3KHKA 3UJ7A 2IPXA 2Y1WA 1O9HA 4E2WA 1EJ0A 5F2NA 4HH4A 3ELWA 3P71T 2XYVA 1XDUA 2EX4A 1NW7A 1NW8A 2FYTA 4ER3A 3OPNA 2PGXA 3P8ZA 5MHTA 5DM2A 3VSEA 5D1NA 4BP3A 2JG3A 3O4FA 4U7PB 5EOVA 1R8YA 3FPJA 3MQ2A 2LD4A 3O31A 3HVJA 4KDRA 1XCLA 3RODA 1JG1A 2I6GA 5EKXA 2ZULA 1BOOA 4C03A 5EMMA 4FSXA 2EFJA 3BUSA 2B9EA 5T6BA 2IP2A 3CBGA 3L8DA 2OY0A 3BWMA 2Q41A 5HFJA 2G1PA 1HMYA 2AOTB 2QYOA 4HRAA 5DXJA 7MHTA 4O29A 3DXZA 2HR1A 1X1CA 3LX6A 2ZBRA 5C1IA 3G2PA 4M37A 3B89A 4BLUA 4P7KA 4FR0A 4HSGA 2BM8A 3DLCA 5E8RA 3THRA 1KR5A 2IH2A 1I4WA 2AN3A 2BZGA 3ELYA 3FZGA 5DM0A 4OQEA 1EAMA 2YUIA 1KPHA 3EVFA 2BR5A 3HP7A 3EVZA 3LDGA 3LBYA 3NDJA 3OU6A 5EQJB 1MHTA 2GB4A 5FHRA 4XUDA 2H00A 2PWYA 4XUEA 5KQRA 4RTQA 4PINA 4C08A 4P58A 2AVNA 1SQGA 3G2OA 2P1DA 5E9JA 5LQKA 2IH4A 3AWIA 5K0GA 2ZSUA 4DA4A 4PCLA 5GIPE 1WXWA 2PLWA 2ADMA 1T43A 4RV9A 5EIFA 1WZNA 2B25A 3DMHA 3TFWA 1NV9A 5CD1A 4X41A 2ONZA 4CWAA 2Z6QA 1I1NA 5E9QA 5K03A 3R9XB 2ZZNA 5CUQA 3A25A 5FTWA 2OXTA 3M4XA 5BP7A 3KR0A 5HOQA 2C7PA 3C6MA 4V0RA 3VC2A 3E8SA 1O54A 3LECA 5GWXA 3VYWA 2H1RA 5K0BA 3KPUA 4HGZA 3DOUA 3KR9A 3G2QA 3TPZA 5LR6A 5FQNA 3ERCA 4IV0A 4FP9A 1NBHA 4QPNA
chains in the Genus database with same CATH superfamily
1QCYA 2F1RA 4YT4A 5IBPA 1XGKA 4NS4A 1B6GA 2AFIB 1Y1PA 1TVKB 5LQNA 1G6KA 2NZ8A 3TI9A 2XH8A 3RG8A 3WLNA 3EEQA 4KGZA 4LJ6A 4U8GA 1X13A 1PK8A 4EJ0A 2XQJA 2FPXA 3EIEA 1IM8A 4ZMSA 3F5MA 1AQ6A 4UXJA 4IZIA 2BH9A 3F6SA 5LVAA 1KZGB 3QUCA 1H4QA 3ESZA 2GUGA 1ORWA 2O2XA 1TTHA 2CCGA 2GO7A 3DXFA 4P08A 3KC2A 1D1TA 1R10A 3T5AA 3GJ4A 4GC9A 1BNCA 5HMLA 1DBPA 3KZVA 1XCOA 4WFQA 5ALLA 2BKUA 4DQ0A 2AD5A 4ATNA 1M1YE 2ZKLA 2WJPA 4AZ0B 4URVR 2DHDA 4GKVA 4TVBA 1R4NB 3X2EA 1F2UB 5A5FA 4MIKA 1DIBA 5T6MA 1PGQA 2SKCA 2WYIA 1GT91 2AQKA 2FVXA 1R8SA 2Q3MA 3LT0A 3P9XA 4IH9A 4LN1A 3U3MA 3VNAA 2X0IA 1VMKA 1RR6A 2XGOA 4M8LA 5AM3A 5J2UF 3WYNA 5CFMA 2LPMA 4NV0A 4IOKA 1XRSB 2NZXA 4X6LA 1P0MA 4L4YA 4CLXA 3KK0A 2BEVA 5ED4A 3C3BA 2P79A 1KTVA 1C7ZA 4R8SA 4K03A 3RC7A 1YR7A 3O21A 4X54A 4BX0A 3IJ5A 3ROZA 5IAKA 3TGPA 5J59A 4DJFC 3LY9A 4B3SB 2EBWA 3KEFA 1DTSA 4DRXB 1O6FA 4KR9A 1ZRSA 5AJZA 5L45A 4YUZA 3CW9A 1QDUA 4R2IA 3LUPA 3ROFA 2H1CA 1IUKA 2V65A 2ZDQA 1EP3B 4OK6A 1J8QA 2VAMA 3HR4A 2PRYA 4HEHA 1XVTA 4DEXA 1SKMA 4MHOA 2AFRA 2CHFA 3KJIA 16PKA 5FTMA 4B5LA 5K05A 2JLZA 3EE6A 4FYXA 1A2OA 2R8XA 4ACBA 2H7CA 3B1KA 1LJUA 3IDQA 3KZKA 4PFQA 4V3BA 4UVEA 3ZWNA 2WZBA 4EJ2A 1LDEA 4UVHA 3GFBA 4G4SP 4UXIA 1VLMA 4C43A 1K7YA 1CFZA 1CKEA 1ZOIA 5DASA 1Y6JA 2GFIA 2X0DA 3I76A 2DJIA 2SNIE 2GZAA 4R4JA 3OFJA 4BMXA 3QNMA 2Q1YA 4ZHQF 5KSYA 1DKQA 4I0WB 4N3AA 1G9SA 1BCRB 3ASVA 3ITEA 3GO4A 2HGZA 4K8OA 5IT9A 5AKXA 1VRCA 1G16A 1WLYA 1OC4A 3USCS 3E9YA 4OATA 2PMEA 3M6VA 4JSRA 1FDOA 2DX7A 1IHPA 1ECFA 3NBUA 5FL3A 4G37A 2QTLA 2XV1A 5JARA 4L3OA 1PT8A 3KFXA 4HN4B 5DM1A 2VT3A 5A3JA 2XT9A 2B4TO 2C96A 5BOSB 5B12A 1J2RA 2C04A 3BD9A 3C7TA 4C4RA 4CV0A 4ETNA 1UWKA 1T4CB 3CU5A 5A5VA 4Z7NB 1SXQA 1VLLA 4TN5A 3E03A 2JNWA 2XUKA 3VPCA 4DZRA 3LLMA 3KXIA 3VUFA 4A4DA 1JDBC 2MSNA 2WFZA 3C5CA 2FPIB 4ZAZA 1SVSA 2YTZA 2A5GA 2GK3A 1HRKA 1A9XB 1V71A 1UKAA 3P9QA 1PV4A 1E6KA 4J07A 2YNMD 4XQ0A 3ER8A 5AP9A 1P3Y1 1SULA 1KDZA 3Q7EA 4HH0A 2VJLA 5AK6A 1FTWA 2ZP1A 3QITA 1HEUA 4J0DA 3I5YA 1Q0HA 3F3KA 4N9QA 5IAJA 1I2ZA 3WWCA 4RHEA 1NYLA 1I14A 4U2KA 5HE9A 3UV7A 2RHDA 3G1WA 3DBRA 4NMHA 3R3ZA 4QNMA 4G97A 3NKFA 3KKPA 3SOZA 5JYBA 4N40A 4BRZA 4ZEOA 4Z4HA 4MUHA 4PONA 4NRDA 3LF1A 2R7NA 4YUYA 4N0MA 4O5OA 2BV3A 3K1AB 1VHWA 4Q7JB 4C06A 5IS2A 3O5AA 1SQ6A 4LYFA 2VTEA 1PGJA 3I04A 3CTPA 5A9TA 1N0IA 3QLVC 4INPA 1RP1A 1QGUA 3G59A 5G3YA 1TZKA 5TF4A 5C5EA 4C21A 4FNMA 3UJ3X 1QYIA 3E18A 3LI2A 3OCUA 2OD7A 2NTJA 2YWCA 3D2AA 3ADKA 3K1JA 1V3UA 3PWZA 1HXHA 3UJPA 4D4KA 2R8YA 3HL0A 3QVUA 3ODGA 3WADA 4BFSA 5DX0A 5AW4A 5EA2A 3GLKA 1U0RA 1MV8A 4ZYYA 2PH1A 1O3YA 4JKOA 4LY9A 3ECAA 1G3IA 1NIPA 1XX6A 1ORDA 1UEJA 3PRYA 4WJZA 1JZTA 5CYOA 3KSMA 2IT1A 3ZQKA 1K4YA 3OMWA 5AQ1A 4P7JA 2TYSB 1QQ5A 4US2R 3D1VA 4FE3A 1UOPA 1C1XA 3UOAB 4RDCA 3OEED 1XNHA 2PEYA 1BYUA 1E5QA 4AX4A 1A7JA 5PGMA 2A9JA 4ND4A 4N7JA 3TOZA 4TYPA 4R71A 3U5ZB 1G1AA 4U2GA 2OD9A 3GUVA 4LOAA 2PSJA 1TJPB 3EC7A 1DEXA 4JLWA 2Q2WA 4LCJA 3ISVA 4FFLA 1E7YA 4HR7A 3JPYA 4TSFD 4C1BA 4JUIA 4DDKA 4D4GA 2JB9A 2P3OA 2Q0HA 3IUYA 3R0IA 2VT7A 1WTAA 4MICA 4F21A 5C81A 3G02A 1TW3A 2DLCX 3S29A 1YF3A 3ADCA 1QVRA 5A6SA 4OF4A 2XTJA 3D5QA 3SKXA 2BDEA 4B85A 1TC2A 1X8JA 3FA2A 2C2ZA 3TTVA 4GNRA 5KYYA 3OLWA 2XWPA 2EW8A 1DBWA 2GXQA 3NNSA 2PU5A 3KYDA 3RROA 4KIGA 2QX8A 2D54A 2ZIUB 4DJDC 2HWWA 3MJ4A 2ZRDA 5KYUA 3G7NA 2QUBA 1C4KA 1EWKA 2C2HA 1MABA 1NC1A 3ZVKA 4HCJA 1IMJA 4EHAA 1KE1A 4ARCA 1Z35A 1XROA 1XZLA 3KELA 1ICIA 2FZGA 2QA5A 3TPCA 3PXDA 4UFNA 1L7AA 2WT9A 4DG5A 4OH1A 4U8HA 2HSWA 5AMXA 1KOFA 5AOVA 5G0TA 1XD2B 3CG4A 5EZYA 4BWFB 5AVRA 1NT2A 1TK9A 1OTYA 4H17A 5H3LA 3ZDZB 3H04A 2WU8A 3EMBA 4A1OA 3W90A 3HMQA 3IDOA 1MQAA 3DT6A 4QOSA 4F6RA 4O0MA 1MX1A 3DLPX 3WNCA 3L9XA 4B3GA 2JGEA 1G19A 3QP9A 4D9MA 3N3AC 3EYWA 4LWOA 3UJ8A 2DM6A 3GBVA 4ZPXA 4E4RA 4XYMA 2V6BA 4ZJUA 3NVKI 2I1WA 3DMRA 1R4AA 3PFIA 3DSRA 1PR0A 2FPWA 1Z17A 2GEKA 3AEKA 4NNJA 3EWNA 1TU4A 2I03A 2GQ0A 1DOZA 2AE1A 2OC9A 2P4UA 3JWIA 3NHKA 1L4UA 5EZ6B 4JENA 5TRTA 3LDHA 4WNAA 3WJ1A 1ULAA 2VZ8A 2XXBA 3LX5A 3ZHUA 4FFWA 3LXMA 2JS7A 2NPFA 1R1DA 2HF7A 4UTRA 4UBOA 4NMWA 5JZVA 5F7OA 4YDHB 3P1JA 3D8BA 3W2IA 1JI3A 1KJIA 3Q72A 1ZW6A 4WBNA 5M2QA 1M6VB 4GQAA 3SBEA 1YR9A 4FHCA 2R79A 3C3AA 1Y89A 2GJ8A 3Q98A 4BLSA 1R0KA 2HK8A 2Y1EA 3KT6A 3R5JA 4ZQEA 4Y2SA 3KCNA 2XUIA 1PO7A 1AA9A 2BSAA 4X9XA 1I6WA 4F60A 1MAUA 3GUYA 3FFTA 4NI5A 2WT8A 3DTVA 3E2MA 4NJMB 2PGDA 5FQOA 2CXHA 5C5IA 5B5SA 3OE7D 4W5HA 1KAHA 3NAMA 4JOCA 3A36A 4JBWA 1ZC4A 5TNXA 1YQUA 2PRZA 1AKYA 5LJIA 3QPBA 1ZPDA 5K99A 1Z6GA 1BX0A 1EWRA 2AJ8A 2IOQA 1OI4A 2CT8A 2JATA 3HU2A 5CLIA 3RBZA 3TD9A 3OP1A 3TDKA 3ZY2A 4E11A 1G2OA 2RJ3A 3RRZA 3T61A 1KIMA 3BH6A 4EGCB 4PSUA 1YE3A 3OTIA 3OZBA 5I9TA 1X1DA 3JZIA 5LA6F 3R7FA 3TD2A 3VU8A 5A0TA 3LK6A 3CRQA 2BTQA 1DAFA 1W0JD 3T3DA 1PDOA 4J43A 3E7FA 4H1HA 1GNLA 4XJXA 4CEIA 3BSWA 4HTFB 5FKJA 4E21A 1S8FA 1UZLA 2FQQA 1LRLA 3JQFA 4W9RA 4EB3A 4F5DA 1APBA 1JSRA 2IP4A 3KP1A 4ZARA 2XCLA 2JAUA 5ALFA 2IUFA 1I6LA 1I4LD 1KP9A 1V1JA 3K2EA 3K9GA 4FZJA 4EGQA 3NQ41 1WEKA 4U2CA 5KIAA 4UU7A 3UK6A 2GLXA 3WLHA 2X9LA 3K9LA 4GLBA 1RKVA 1UFKA 4UHBA 4F2HA 3IMEA 4AW9A 3E9DA 4IIYA 5ELXA 3H8WA 3EJWA 2ZBVA 3KD2A 3S2EA 3ED5A 2OXCA 3PEVA 1RLJA 4G3XA 1DB3A 3AUXA 3JWJA 1XE3A 4YCAA 1G8AA 3X1XA 2R9VA 1KAMA 4WACA 3C0KA 5D86A 2FZVA 4BATA 1ADYA 4P5PA 4NTZA 1NE2A 4Y0NA 4TN1A 3V4LA 3Q8WA 2KPOA 2ERYA 1NQUA 1GHTA 4UJ5A 3GFPA 1E3WB 3EODA 1QRTA 4OHUA 1CEXA 2R6HA 2H07A 4MQBA 2B35A 2ZTUA 2YRXA 3QEJA 1GCGA 3AK4A 4FDUA 3RE1A 3TFQA 4YUXA 5BMVA 3RQIA 3SJZA 4ESOA 5HQ3B 2ZVDA 3DS8A 1FXWA 3PUYA 4N8SA 4OHMA 1A2KC 1PCXA 1BOFA 2V54A 3FOAA 3HBNA 2P1RA 3PEFA 4QUAA 2ZJ0A 2QVCA 3VNVA 1U3UA 1PX0A 2ATIA 2SECE 3EZXA 4JBYA 4DSUA 1ISSA 3C85A 3QU7A 2EEPA 2OXEA 5DGIA 5EE0A 3U3JA 3VJLA 5HVNA 4B83A 1KP3A 4LMRA 3E1GA 4G63A 3JQFC 4AWAA 3FDJA 4IQ8A 2B7CA 5JQGF 1Z4PX 4IP0A 4YV1A 2RG1A 3AEQB 1NJ2A 1AMUA 1R0BA 4CMCA 1ZD3A 2H1SA 3HADA 4ETWA 4C20A 1E3IA 2JIBA 4GZ3A 5JS2A 3U1BA 1GPH1 2Y1FA 2WTNA 3OZDA 2G8NA 4ZVSA 4PCUA 5JFGA 4PG7A 3ZV7A 2IZ7A 4QT0A 1XWWA 1NRJB 4ZI7F 1TM5E 5JWRA 3DR3A 2DG2A 1T8WA 1PJBA 5KI6A 4C0BA 1HEYA 4D9KA 3MJDA 1AKUA 2B21A 3U40A 5J43A 3EBPA 1QZXA 2FR1A 4U6SA 5ER6A 3VHRA 1RYNA 1L7DA 1WMEA 1YQEA 3TEMA 5BWOA 3AJAA 4MW1A 3PCTA 3RYCA 3AF0A 1R9GA 3PXUA 2CJPA 3MCWA 3LXRA 4K9SA 1ZGGA 4DCSA 3MYYA 2RHCA 3OT1A 1XA3A 1WNTA 1QO7A 4MV1A 5E2IA 2C7GA 3FWZA 5HK9A 4U5XA 2PQ0A 4LX0A 3JAKA 3NLLA 1U99A 3GX1A 2OEPA 1GPLA 1QKJA 5DGDA 5A4MS 2ENWA 3WL3A 3K6JA 3IUBA 3X1WA 1SIOA 1Q17A 3LWNA 1H2YA 4L1KA 4LJ8A 5ALUA 3BFJA 4GRIA 3ELWA 5AK5A 5DNVA 2X1HA 5JNTA 2F3TA 1GGKA 2Y77A 1EP9A 1NRXA 4WWHA 4HWPA 4JT9A 3L18A 2QX6A 1ISIA 2V9ZA 1IJBA 1Y6RA 1Z3IX 4RAOA 3VSEA 3K9CA 4W5JA 1U31A 4FKMA 3NIFB 5DNCA 3AY3A 4TKLA 5AKYA 3GEIA 1PZXA 2OV2A 2VHUA 4EA6A 3SDSA 1PG5A 2YFYA 1Q3HA 2WSLA 3C1TA 4ZIRB 5IWCA 2UVPA 4RKFA 2O2ZA 4HNRA 4MS4A 1PLKA 5CFPA 2OO5A 1PFUA 3DUFB 4FSXA 4DIEA 4RD1A 1K06A 1IL0A 5E6SB 5IUKC 2C9MA 3WSWA 1H6DA 2QYOA 4LYYA 3RPEA 3DEKA 3L1KA 2RH5A 2BBWA 1SD2A 2EL9A 2FX3A 2OILA 3BL5A 4FR0A 2HAEA 4HSGA 4HXFB 4BLUA 1OYWA 5I9NA 1ABBA 4M0DA 4XM2A 5TQ2A 3THRA 1HQDA 4IDGA 1GRCA 3Q5GA 1P1FA 5EJ2A 3JARB 2JLBA 4IEFB 2QTMA 4RENA 5DOVA 2IKSA 3ELYA 3ESCA 1KKMA 4M1QA 2YUIA 1ZIDA 1Q1BA 3HYCA 5I5EA 1U2GA 1A4UA 1ZN8A 4ZVPA 1LK7A 4M9ZA 3V8RA 3OF2A 3K8YA 1NTOA 2OGZA 3I30X 3ZU6A 2GCIA 1Z63A 4PZ9A 3JYNA 1C41A 4OXNA 4ENRA 3ADOA 4FILA 1FFDA 5JHGB 5K8LA 1JDVA 2XI4A 4JASB 4PGFA 4X85A 3CUWA 3UXHA 2FY8A 2UZ1A 5HCIA 2VYQA 3FSGD 1T1EA 3TX2A 1OZ0A 2WWXA 3CLUD 2O19A 5KTKA 2HHHB 1EK6A 4UM7A 3TF5A 2XKKA 2B36A 3MIIA 3QEMB 4WY2A 4Y6QA 2Y92A 4HDMA 5KQPA 2GM3A 4L5AA 1M2HA 1NQTA 4C7KA 5HSGA 3ERCA 2OO5C 5FFNA 2CJWB 5K9ZA 2XBUA 4CM7A 3HKEA 2QZPA 2K7ZA 4LRTB 5THQA 4X84A 1W5EA 2JFZA 4DLUA 2R87A 1SH7A 1YB7A 2E4WA 3EJ6A 1Y8ZA 1F12A 1DEAA 3OTGA 1A95A 3TTTA 1ANKA 2W6ID 3CV3A 1SC4A 2AT1A 3NPAA 3HCWA 4HNGA 4DVGA 1JAZA 3ZD8A 4XPIB 1F0KA 3E7WA 2YJ5A 3T4XA 4RCYA 3TINA 1OJLA 2DFVA 4BO8A 2UYOA 3SLGA 1XZQA 1ZCFA 5CVJA 1DC4A 1MO4A 1U2GC 4DUGA 4BZPA 2WWFA 4KBYA 2P2DA 2IPNA 2Y4OA 3B82A 4YY3B 3K8QA 1S2IA 1RZ3A 1P18A 5LP6A 3IEMA 3R3XA 3B12A 4JXJA 3EFOB 4WCVA 4BAUA 2W98A 1YVDA 1H1DA 5DGTA 4Y2PA 4IL5A 3W05A 5L51A 3EHDA 3A26A 5IFKA 4YAKA 3THYB 3JZDA 1VB3A 4QPCA 1F0YA 4Q3BA 5DX8A 3QXSA 2C1EA 1CIJA 3FKSA 3AEXA 3I8OA 4YJFB 4RS3A 4XSGA 4WGFA 4X94A 2FUEA 1CY6A 1JIVA 3P19A 3TQQA 1MTZA 1POXA 4Z0TA 1RZVA 4B3BA 3FOFC 2ZQYA 4F86A 3EH1A 2V7XA 1PL6A 4HLUA 4PPFA 3KB1A 2C88A 4G65A 4MUIA 1C0KA 1RBQA 3MTQA 3QIAA 4A26A 1L8XA 1SVLA 1CUFA 1A82A 5DK6A 4NCKA 4M1YA 4MZXA 3NRCA 5AWFC 5THXA 721PA 2XEXA 3VVLA 1Z8HA 2FXIA 4G25A 1TGVA 1MOPA 2B7LA 2FEKA 1RPJA 3Q0TA 4ZU1X 2Q9UA 5ES4B 1ZICA 1GZVA 1FB5A 1L5SA 3RSLA 2Z9CA 4DY6A 1T8PA 3PFNA 1C8BA 2HQBA 2XMSA 3L01A 4OI4A 3C6YA 5FOXA 2PWBA 1E0JA 4KQIA 4J0GA 1DDIA 1OYOA 4BQRA 2HPHA 1EVZA 3BMOB 2ATCA 3IBCA 4H08A 5AUNB 2VF4X 1AHIA 3E81A 3KM0A 4C29A 3D2BA 2UYHA 1PZFA 4UCXA 2BKLA 3BGDA 4IRUB 5FTLA 2I4OA 5LP6C 1FMJA 1N2SA 3G5LA 3WISA 4FYWA 1QYXA 3GA5A 2ZI4A 3RTBA 3TRKA 1EXMA 2HWUA 4Z3DA 4EY3A 5DM70 5E8JA 3IEPA 2JIZA 1W4AA 1V3QE 2XAUA 2C7BA 2XODA 1ACLA 1GU7A 1K8YB 1BKYA 2WJGA 4IDBA 3INRA 4OQMA 4EF6A 4EKNB 1WBJB 4ZMBA 4NJEB 4W7HA 2DY1A 1CV2A 4LE1A 2E6KA 4FT2A 5BYJA 3D2CA 1NSTA 1T91A 2FZ4A 2CK3D 3EGXA 4LZPA 4Q5IA 3ACBA 1XQXA 4N5DA 5U4QA 4URUR 1CG6A 4HDSA 1I0ZA 4HLUC 1JXMA 3PDWA 4B6JA 5IZCA 3GNTA 4AN1A 1I2MA 4KREA 1JIUA 2G7ZA 1PTKA 2V74B 2WV9A 3OOYA 4IV8A 2R85A 3R3YA 1R15A 5F7JA 4F11A 5KNLA 2I71A 4UEWA 3L46A 4LWQA 2WK1A 1NVAA 1TJYA 2ZIXA 4WT7A 4EVSA 1U7HA 5K0SA 3W5DA 5LSAA 3T9CA 4RTJA 3Q1LA 3RLIA 4CMEA 4DQKA 4YAEA 1MT0A 3RVQA 7ADHA 2YJ6A 3UMJA 3SPXA 4V03A 3QA3E 4JQZA 4RADA 4IZ6A 4Z4FA 1CJMA 5DHAA 1QB7A 4BRWA 4D8TA 2EBUA 1JHXA 3ITDA 5CRIA 1RJFA 1G7SA 1HTWA 2V55B 1ZCJA 3VX4A 2EHJA 3LTNC 2RSLA 2YWGA 5EVJA 4RVNA 3TH5A 4RTOA 2C0QA 4FYYA 3PSHA 1M0TA 4FFRA 4MAMA 4ZWNA 1UPXA 1FLDA 3PFCA 4WNIA 4PTLA 1BXGA 2FPSA 4JLKA 4F4DA 1ZKMA 2V8BA 1A98A 1UINA 2IPMA 3PC6A 1MTOA 3PR2B 5A2QA 1EYZA 4CTOA 5TV2A 3S8MA 3VPXA 3CIOA 2HKIA 3F1LA 2VL7A 4HX5A 5EIXA 3LCCA 3RB8A 1O2DA 1H2AS 3AFHA 4HOYA 2IPOA 2QLLA 1YS7A 4L0CA 3AVOA 3QXXA 4Q4JA 3TAXA 3ZY3A 1XVAA 3I34X 4B6SA 1XZNA 2LNDA 2W2KB 3LW7A 5IZCC 1VPLA 2AB0A 4ZQHA 5C52B 4Q66C 2CHUA 1XN4A 2IUYA 2P6OA 1N8SA 1L1QA 2REQA 4DYVA 1MZPA 4NICA 4W82A 5J2TA 2CNLA 4YJ2B 2G08A 2W8ZA 3FHCB 5AR1A 4DMFA 5K8CA 1ETHA 4HATA 2B1JA 3WSVA 4EGSA 1GNVA 5HXAA 3S2UA 1TJNA 1KU0A 4CMEC 4C2TA 4RHFA 3VOAA 1E2LA 2DTEA 1P73A 2O2HA 2HJGA 2JZOA 5FBQB 5ES3A 1KPIA 3C5HA 2BGJA 4W5OA 4OYYA 4EPWA 3IODA 5IW8A 4YT8A 1KXZA 2NUAA 4QOEA 3ZX5A 2GMWA 3AKDA 1OIWA 1YMUA 3WWOA 2OC4A 4OBEA 4PEVA 3ICQB 3CVOA 5FUVA 3DWGA 5AUOB 3FUXA 4RIGA 3PNBA 1M2VA 2P3LA 2VSFA 3CTMA 1TYEB 3P9NA 4D97A 4RDHA 1FYVA 3ETEA 3OA2A 5EJ4A 1X7XA 1Y9AA 1GYRA 1R6UA 2ID9A 5HKLA 1RHKA 1M6NA 1OFIA 4BN0A 1FYDA 2P0AA 5B6IA 2VQ6A 5C5CA 2D8AA 4A16A 1Q11A 1V48A 1MA0A 1R18A 3HXKA 3ESDA 4JJ7A 1WZ2A 1D2RA 5IDQA 5G02A 3A3YA 3AR7A 4QTZA 5I3ZA 1TAQA 2NX2A 4W63A 3LC2O 2LCIA 2IODA 2VDPB 3SC2A 1PQUA 3ORQA 2WJYA 2FX5A 2XCQA 3EVTA 4FSHA 2G0AA 2O07A 1KSHA 3ZNQA 4UUPA 4US0R 3V4ZA 4YMVA 4BFVA 1FP6A 2FWIA 1B6SA 1Z4MA 2BLNA 1BJTA 2CHEA 2W2TA 4ESVA 2R4QA 2ZSDA 2PZJA 3DBIA 4GOMD 4KI0A 1RJ9A 3P52A 3SC3A 1V1RA 4GT1A 5BUSA 2LVBA 1D8TA 3G8BA 2XMBA 5CMLA 3RU7A 2R3SA 4C3OB 1JNXX 2C3PA 2F67A 1Y5IA 1L5MA 1T3HA 2Q5FA 2ID4A 4RELA 3JX9A 3VKFA 3WGGA 2HSJA 4FFOA 3IP3A 4OQDA 3AR4A 5EFZA 4MKGA 4ZVOA 3HYRA 3QQ5A 2AC2A 4YJ3B 1SG0A 2QU7A 4BLTA 3AHCA 5MN6A 1CYEA 1S6YA 3ZE2B 2QQ5A 1E4EB 3CKMA 2PL3A 1VE1A 1RRKA 4UXHA 1YZTA 1Z2AA 3EK2A 4HDNB 1UC4B 5FIUA 4BPRA 2O5CA 1NVVR 2QUIA 4NS1A 1HA3A 4OYHA 1RVV1 1UCFA 3EW7A 3T3MB 2CKDA 4ARZA 4D3FA 2NSJA 3TR5A 2Y67A 4ZT7A 2R60A 5J5CA 4D4MA 5FV4A 4BV9A 4EAAA 3ZJTA 2N47A 5KOYA 1ZOLA 1AOXA 3S99A 1TA4A 1RM5A 1YAHA 1VP3A 2Q3HA 2R47A 2PX0A 2C4KA 1FFWA 3KTAA 4X00A 5HKBA 2OCAA 1A1VA 4CKXA 4BQIA 1EUCB 3CJTA 3USZA 4UQLA 5HKKD 3Q3GE 4J4TA 2RCYA 2ZSBA 1KAOA 4OCZA 1TCCA 5FBVB 3A2MA 3IVRA 1DT3A 1FP4A 2R68A 1T8SA 4URYR 4ECEA 4EKYA 2RJOA 3UOWA 4PYRA 5FA8A 3ZY6A 3HCEA 2AS0A 5IBCA 5JAHA 2FDXA 3DOCA 2LE0A 4FE4A 1UXGA 3OKFA 4GYJA 1E79D 2DP4E 4HVLA 3VOTA 1C9YA 1KIAA 2NUPB 1C0IA 4YYEA 4FMPA 2ZJOA 2SKDA 2NM0A 2NQ2C 1Y3FE 5JVDA 4B4KA 3UHJA 1N2XA 4FOTA 2PT6A 4Q1FA 1Q7TA 1VJRA 2NU6A 4DLBA 5BN4A 4DIKA 4MVWA 4RZUA 2G76A 4G8JA 2PBRA 3PHIA 3FLMA 3DC2A 1YRQA 4A0FA 3DVAA 1NBOA 4BNUA 2NU8A 4MGEA 1R8QA 1CQWA 4FGWA 4NBUA 4Y0AA 1FW6A 5I45A 4ZVMA 2V7VA 1Z6ZA 3H1FA 3KTOA 3NYWA 3BTOA 3GT7A 3P94A 2J0UB 1D7AA 1LV8A 1SKBA 3L79A 1G291 4R1MA 4WXMA 3OQMA 1M83A 1N1EA 2BI7A 1QOZA 3ZBUA 5AVVA 4OHKA 2AHOA 1Q20A 3IQGX 5FTKA 4FXOA 4EVQA 2WHQA 2RHBA 5IJZA 5F7XA 2ZRLA 1H8HD 1E1QD 4EG0A 4GRAA 2PFKA 3GFRA 1A9SA 4HNAA 1XT6A 2IZZA 2ZCUA 1DCKA 1X8KA 5EMLA 2J5BA 2C99A 5BSWA 2BFFB 2Q5CA 2ZVPX 4C2UA 2EJVA 4ZO6A 3O4RA 1YONA 4XWAA 1P4RA 1FYEA 3DDHA 4RMNA 1SUBA 2CF6A 3B3JA 3HXMA 3CZ4A 3HKBB 1XV5A 3EVAA 2IU0A 4NQRA 3HACA 2X6RA 5BVGB 4EW6A 3EAQA 3N07A 1ULBA 2C61A 2ECOA 3K96A 1C0EA 1KK1A 1XJQA 2R6R1 5F21A 2A84A 4JI3B 5B55A 2X2FA 2JAHA 4GI5A 3UA4A 4WMLA 4UTOA 5K0JA 4X6UA 1AKWA 1Q74A 1LFDB 3KBOA 1XCJA 3B70A 3GLHB 4P3YA 3U4MA 3F7NA 3GDWA 1Z6YA 2YQ4A 4DSTA 1DL5A 2FG5A 5KJFA 3AR9A 3K0AA 3NXSA 3DHYA 4EI9A 3U3XA 1OXVA 2L42A 1N9ZA 2X2PA 4XR9A 3BZUA 3UK2A 1MDBA 1JDTA 1L7EA 2QW0X 3GVXA 3H5NA 3IYLW 4HVTA 4CHTA 4DLNA 5NULA 1XXHB 2BBSA 2Q5QA 4Y6PA 3F7MA 4TT3A 2OWDA 2QTBA 3LHDA 1Y80A 3PWSA 4QOGA 1RE1A 4LBWA 3OZTA 5K45A 3LXUX 5CLHA 8ATCA 3ENKA 3T9EA 1E8DA 3WZLA 1GFSA 1PSZA 2Q7XA 2C8LA 2ZAIA 4IF6A 4J49A 1GZSA 3OT4A 3DT9A 4OHRA 2RKOA 1KYQA 1KK2A 3A9RA 2K7FA 3IP8A 3ZUPA 1NM5A 2O8DA 2YJNA 1N33B 1L7NA 1PZMA 1SGWA 3EUFA 1NZFA 1PJ3A 3ZJUA 4LXGA 3VZPA 3ZI0A 4OMCA 3W06A 4NZNA 4KZPA 5TEWA 1XVUA 3PA6A 3UB2A 1JS1X 3M70A 4C0AC 3JYPA 2NVWA 1DWOA 4PR3A 1NUTA 5LOVA 2AL7A 1UT6A 2IEYA 4TMTA 3RJZA 1XZJA 2JBAA 4BRUA 1FNNA 3AUYA 2ESRA 3Q3HA 3ZCVA 2BKEA 2X1LA 1XTSA 4N6NA 3ZPXA 4HWGA 3PGLA 1GXSA 4J0JA 1VHJA 2X3YA 3H6HA 4DCMA 2B3TA 3GEMA 1K97A 4L5IA 4ECAA 1KPGA 1TO2E 1Y7IA 3IUQA 2C3MA 2IYRA 4LJSA 2P3QA 3UG6A 4LMPA 4X1IB 2WP0A 4BY9E 4LF9B 1VE3A 4EFLA 4JBGA 4WINA 4V0OA 3AY6A 2HT6A 1K7EB 4H6VA 3LXXA 3CZPA 4H3KB 4M1EA 3JCZA 3TE6A 4E5UA 1ZUD1 4RY8A 4E2WA 3TAUA 4IG4A 4KOEC 5F2NA 3TRDA 1UAGA 4R0VA 2D0PB 1YBVA 2GVZC 5IKOA 5SY9A 3RT1A 4BFCA 5C2JB 4JA0A 3BTUA 1F2TA 2XMQA 2BW0A 2DWQA 2IIVA 3KHSA 1QHEA 4H15A 4BP3A 3V4VB 1T35A 4FFMA 1K3UB 2H65A 4B7XA 3MMNA 2LDBA 1QO9A 3SIRA 1TDJA 1JUDA 4IM7A 5BP7A 1JKJB 3RODA 1FC0A 1O0BA 3BFKA 3U26A 2A9KA 1NM5C 2KX7A 4L22A 2VA8A 1SURA 3KSDO 3A4NA 3CEMA 5JZ9A 3N1UA 3R40A 1PF7E 4G1VA 3NTOA 1HMYA 2FEXA 1SIUA 2PKEA 2WAXA 4HRAA 1WPGA 4HS9A 1MC1A 1JMYA 1LLQA 3ZQ4A 4JXZA 3MT9A 4QLOA 4HNQA 2XBLA 3IKMB 4BKOA 2W4MA 3E5RA 2PJRA 3DHNA 2BMFA 2IYQA 3B5EA 1TCVA 3M2TA 1XZIA 4H7PA 2ON6A 4GLFA 1QB8A 3H86A 1TYZA 5LDHA 5JSFA 5DP2A 5IBQA 2E4VA 4I08A 5AI9A 3H0KA 1GL7A 1II9A 2MYUA 1G8KA 1IBSA 4TYYA 3DZGA 3UWKA 1L8LA 1U02A 4FU0A 1R8JA 1JH8A 2YJZA 2VCEA 1Z0KA 5JS8A 4IJ5A 4MKRA 5JAOA 3I9KA 3ZLJA 1BROA 4LHYA 3RYHA 1QRRA 2VTBB 5IDVA 3B3AA 1J2JA 1ZK4A 3AKCA 3I8XA 4PCLA 3RFXA 3TYXA 4AJNA 4CQMD 1Z0AA 3E9MA 5D85A 3ZLUA 4RPCA 4EHIA 2O2SA 3BA6A 1YJXA 3TWOA 3OPYB 3BRWA 1NLMA 3QELA 4BMOB 3CPSA 2QT0A 2FZKA 2TMGA 4ZO8A 4Q7LA 1O0CA 3GLGB 5EP3A 1BA3A 4IJMA 1TMKA 1UEXC 2R8PA 3D31A 4F3TA 4FVTA 4KITB 4MKHA 4NABA 5CB4F 2UDPA 2WKRA 3TSCA 2XGMA 4D9EA 1XQ9A 4R6XA 1PE0A 4RTNA 2G9ZA 3FAZA 4GUDA 3I1JA 1Z38A 1E0AA 2JDIA 2CHQA 3LZCA 3U48A 2IHUA 4EMUA 1AX9A 3GU3A 2R7AA 2YN2A 5BQXA 3RFCA 2HUNA 1F6BA 4WKNA 5HKKA 4DY4A 4KVAA 4P7FA 5KNBD 2OECA 2VWPA 2ZE5A 1NNUA 3P20A 4Q6BA 4PX5A 1QHYA 4TV9F 4P93A 3I05A 2QTGA 2DFPA 2AK2A 2ZAGA 3DMYA 4EWLA 3LYHA 2FWAA 4KQMA 1N5LA 5CU7A 3MTDA 1SHTX 3IEKA 4KN5A 4CUZA 2CVOA 1OX4B 4F5ZA 4S1OA 4BNTA 2ID8A 4D3SA 4E5SA 1ZI9A 4DMCA 2Q1UA 1WDLA 4YMUA 3WIDA 2C42A 2AJDA 5F12A 4MVJI 5D7BA 4YXWA 3NONA 3OH8A 4XUCA 3MT8A 1L7VC 4BP9A 1H1LB 1B2LA 1YR2A 3EULA 1Y33E 4C89A 3DG9A 3R9XA 1LJLA 1AVTA 4EQ6A 1OB2A 1E1RA 5I5GA 4HGOA 1TFUA 3MGBA 1Z7WA 2WU0A 2YFQA 2DTDA 3DXXA 2EIHA 1BH2A 4BIIA 2M1XA 3RHSA 3BGWA 2WJVA 3IAFA 2AR7A 3I1FA 1WZIA 3HRIA 2CFTA 1N8TA 1UAYA 2DERA 5DZSA 2HRCA 2O5EA 2B1QA 2V1XA 2W2VA 3L8FA 4RVCA 1N2CE 1NV8A 1PTJA 3UUWA 2OBXA 5DXAA 4TTIA 2JGKA 3EXEB 4MTCA 4UD6A 3FTDA 1CZUA 1NI5A 3EXFB 2ZI7A 4AZWA 4KPEC 2CNOA 1E2KA 4R2XA 3SHWA 1GVNB 3GRYA 2YYSA 2AJCA 3AMVA 3VU9B 2DQZA 1VE5A 3IH5A 4ZGBA 2F1IA 4ER5A 1DS6A 1VL1A 2RBGA 3BRQA 2GHRA 3ICPA 4TMWA 3BQMB 4NLLA 3IOBA 4ZT2A 1X7HA 1L7RA 2WIFA 2WQ7A 2FW1A 2NAFA 1BDJA 1GKLA 1N3LA 4LYDA 4PWYA 1UKEA 2FSSA 1BCSA 2GPJA 1NUSA 4NBVA 1QGAA 1JE1A 1C4OA 4YRLA 4OX9Y 2TMDA 3O9MA 1PGOA 4IIDA 5DO9A 4Z3KA 2OKGA 2CNDA 4HAVA 3I9JA 5LWHA 1PZEA 2NTEA 3LVFO 1CE8A 4GMXA 4I9FA 3V4SA 2YXLA 3L1UA 5C4GB 2EQBA 4OKNA 2PLFA 5BN3A 3LQ4A 1NUPA 2F8SA 1J0EA 2HDNB 3CJQA 4ALLA 1B0AA 2I6TA 3W1VA 2HNKA 3JQRA 3HN7A 3PV0A 2OBBA 1ZM3A 1I4DD 4CKYA 1RHUA 3LHFA 4P0QB 1ZRNA 1QIIA 3PF9A 4OBXA 3UMGA 1PTJC 5F3DA 3SIWA 1TLTA 1Y7HA 3WJAA 4JYAB 4HZUA 4P3PA 1JJAA 1QQ7A 2GPBA 1NMYA 1NVBA 1B73A 1XKXA 3HY6A 2OK7A 3KXLA 3MEQA 2QZ4A 3KUXA 1EWYA 3M33A 3BH0A 3H1BA 4D8WA 2TS1A 1ZK3A 1E3SA 1U1DA 2H16A 5GTDA 1NG1A 2J0VA 1UMBA 1K4KA 2HADA 2YICA 3G9ZA 3MQFA 3MS4A 4Y9RA 5G53C 3ZBPA 3RH0A 5JS6A 5ALPA 1NAHA 2NLOA 3M82A 1C1YA 3ZWOA 3GD5A 3ZV4A 5ALDA 3GGSA 5DTIA 4A9AA 5JZSA 4D02A 1A27A 5FH9A 3OQOA 1NATA 3ILYA 4NXMB 1HKUA 3V1LA 3NTUA 1RHMA 3F5QA 4GPIB 1K9SA 2JEOA 3CN9A 2P2NA 3BL6A 3R6GA 3JZFA 3KXDA 3WDSA 3O7MA 4X1KB 3K9QO 2F48A 4R41A 4XDGA 4I46A 4W9MC 1L1RA 4GBGA 4X6XA 5K3FA 5K2MA 1WVMA 3S1SA 1MRSA 4JR2A 4KEAA 5KYXA 4QRHA 1OFHA 1FP7A 5IMBA 1X9GA 1X6VA 3Q9NA 3COPA 3DXYA 3H75A 4ZANA 3MM4A 3N87A 5I9SA 4J7UA 4AY5A 5FAKA 4CE6A 5HPYB 1P5ZB 1SKYE 4IHJF 1U3FA 3JAWB 4JCCA 4MP8A 4PN3A 3G7UA 1F60A 2CMFA 4HRXA 4QFMA 4QEKA 2NZUG 1DO2A 1ZL0A 4I1UA 2YXDA 4PF1A 1HNZB 4BO0A 1XAIA 4II2A 3WGLA 4ESHA 4PC2A 1EVEA 2X58A 4CDGA 4B47A 2QG4A 4CG1A 1CQIA 3MUOA 5SICE 3NETA 3L4JA 3V2HA 1FQWA 1D2NA 5CFLA 2ISCA 1ABFA 1HZZC 4GVLA 2JRLA 4P1ZA 4WK6A 5E4JA 5GONB 3JD0A 4JX8A 4CKCA 4RD6A 1IIBA 1MFZA 1P0QA 1JE0A 4JKYA 2HWKA 5JO0A 3SVZA 2FEMA 2QLTA 2YIDA 4D8UA 4YO8A 1NQ5A 1QU3A 4UDYX 1LVUA 2ECQA 2QIPA 4RPIA 3D7MA 3W6ZA 4CDNA 4CMJA 4RVFA 2NZWA 2Q46A 3VPSA 2XLBA 3C3XA 3KYJB 4Z1MA 4WKPA 2Q2NA 5CA1B 5IHPA 4NF2A 2APJA 2GWRA 1NVTA 4MJ7A 2QSZA 4RLFA 2FSIA 3ZHQA 4YRKA 1AA6A 3TEFA 3COZA 5BQFA 2AXEA 4R1OA 2Q1SA 4E13A 4EQZA 5B4UA 3FCEA 1UDWA 3KKOA 4DIDA 3ZWQA 5HOEA 2YJTD 1TW2A 3QKSA 3FOEC 2XYRA 3FSEA 4I4CA 4HAWA 3VR4H 1DP4A 3F9IA 3DFMA 4FSDA 3RS0A 2AFHE 3WQRA 2ZRGA 1WPQA 3LT1A 1GD1O 3TNLA 4AF6A 1SXJB 2YXEA 3ZDXB 2O7RA 3NHFA 4EHLA 4RY2A 1XD8A 2A1IA 1PR5A 2WVHA 2FWNA 3H2BA 4H1VA 4NSNA 2WINI 5EJFA 5KSWB 1E1LA 1G60A 3HGTA 4MVJG 2A94A 1YC2A 3U37A 4BVAA 2AW5A 1Y5NA 3TFOA 3ILSA 1VPTA 2F3SA 3KBBA 5AW3A 3ECCA 4D43A 3WKEA 3JY6A 3T0FA 3UT6A 2WYHA 3O3NB 1N6LA 4RWZA 2WPNA 2C77A 4NCAA 1EWTA 5ER9A 5G0SA 2CLCX 4Q9HA 1W47A 1AE1A 1V9SA 4RK1A 3DL7A 1YJQA 4KYTA 2WUFA 5EMJA 1E4YA 3A04A 3PJRA 2BFNA 4BNMA 4LTDA 3OEWA 2QT1A 5KTRA 4DHWA 4AIRA 5H81A 2F43B 1RRMA 4OJNA 1UADA 1XEFA 4D9FA 1NVMB 2ZB7A 1CUIA 3LUHA 3DAOA 3D0OA 4ZCQA 4IXDA 2GF0A 3GPBA 4MW5A 1L1FA 1DBIA 3RD5A 2JHPA 4DWJA 3AO0B 5EHXA 3WIUA 1TTTA 1GA1A 2R8OA 1O4WA 3TSWA 3ZGVA 3LLCA 4M21A 4AJLA 4PX9A 5B7GA 1FNMA 2JARA 1F9EA 3SKVA 3U7JA 4QWWA 4B0OA 5AVKA 5BYKA 2Q4RA 1VHDA 4B81A 2JCBA 3BMQB 3B1ZA 4LGMA 5EIBD 4OHYA 1UK9A 4JYCA 4JKIA 1YDWA 1M5TA 1GQ2A 1Q44A 1W4LA 3HUDA 3ICOA 3P96A 3B20A 2PT7A 2QR3A 2BFDB 1H2XA 1N7JA 2VYCA 5FL7A 6PFKA 2XB8A 1JZQA 2GASA 4FYIA 5I9BA 1P2UA 3L6BA 1C0PA 1OKKA 2J0SA 3SF8B 1SOAA 1ZCBA 1UPTA 1K6EA 2YHBA 2YS6A 4BMPB 3AJRA 4X62B 4HS4A 1MJ5A 2DFNA 3TUIC 1CDEA 1AHNA 4RHXA 3U4QB 2NQTA 2QMZA 2X6TA 1QZUA 4QPZA 1RU3A 3C2QA 3ZE9A 3ZU5A 4HV4A 2EGHA 3BEDA 1THGA 4V1CB 4G0NA 1JIXA 1P45A 3DD5A 2GAOA 3M6IA 1YTUA 3GAAA 2QRZA 4N1AA 2DPHA 1J8DA 3R7AA 1Q0SA 1V39A 4FCVA 2GNOA 2O2DA 1DWUA 3HH8A 3TQSA 3NOQA 3IQZA 3GGJA 1N34B 3PSAA 1RMYA 3GPIA 2J3DA 1P9LA 2HUPA 4KQEA 3OCXA 4MDFA 3EOAI 3DEFA 4PXAA 1RWPA 1VB5A 2V8OA 1VP9A 4ND6A 2OZVA 2X8AA 2OSVA 1RTKA 3IUPA 4ZAFA 3KG2A 4EB6A 3EZLA 4Z0NA 2XQGA 4IKPA 1E63A 1GA6A 2DJ5A 1RIFA 1WXHA 4LYHA 4Q34A 3L8CA 1JA0A 1Q0PA 2VK2A 2AN4A 3H1GA 2AEFA 3TLCA 5A05A 2PMBA 3QVXA 3ABOB 1EU1A 1V4VA 2ZT7A 3N8GA 4CFSA 1E20A 2K6GA 3ZWBA 3W5CA 2YVLA 3ANSA 3H5AA 1R12A 2VQ3A 3CHYA 3DTVD 3N05A 4ARAA 4COKA 5KPDA 2IH5A 2XCRB 3U6BA 1QH1A 1GCOA 3RW9A 3UAYA 1ZK2A 4IJKA 2QX7A 2HA6A 3A2KA 1H6BA 3HUFA 3OQ6A 1W59A 4FN5A 4QBKA 4DUPA 1OVMA 2IDMA 1CB0A 5A62A 1NN1A 2H5JA 2OZKA 4QYIA 1MP0A 2VC2B 5ALXA 2HD4A 3SSOA 3UAWA 1JBKA 1OZFA 1XRLA 2BZ0A 4XB1A 4KIUA 1YFKA 1GG9A 3SMQA 1V6SA 1BVUA 2XIQA 1ZJYA 2BZ1A 4TUYA 5AHWA 2CHGA 3PGKA 1RXYA 4UUQA 2XB2A 3NGLA 1KDYA 4DW8A 4HT3B 4MWCA 1EGMB 2D4HA 4FFBA 1E9VA 4KN9S 1E0DA 4RLHA 5FUXA 3DV0B 5FYDA 2B82A 3V7YA 3KALA 4Z2AA 1U3WA 1FSGA 2WPDA 1Q1GA 4B2IA 4RTRA 4BO2A 4NYJQ 1W36B 2JFWA 1HKHA 5KX5B 4R2LA 3QEAZ 1GSIA 4YROA 3F7TA 3GB9A 1RI5A 1NT4A 1IEXA 3K4PA 5J9FA 3C7CB 4A0RA 4QPPA 4R2WA 4X93A 4TV8B 3A7EA 4O33A 3VOBA 2XNJA 3GG9A 3I45A 4MZDA 5EWMA 3GF4A 3DDZX 3R3VA 1Z62A 1ELOA 3DZFA 3E35A 2EKBA 3KAPA 1LNZA 1RQXA 3K0KA 3O0TA 2DUJA 1UXJA 2D1TA 4BBZA 2XSZA 2PG3A 2BFWA 3KB2A 3KAKA 2A0YA 1D0SA 1NUAA 2QYTA 1BGVA 3CEHA 1SNYA 1KO5A 4ZYWA 1YL6A 3C3DA 3URMA 3LUFA 1FMFA 1X3SA 2Y1GA 3VNBA 4CF3A 5HNKA 4MR9B 4N41A 2WM3A 3KQVA 1ICEA 1J23A 1VMIA 2WFLA 2ZLBA 3OZFA 4L0DA 1A0OA 1H2ZA 1I30A 2BFEA 2JFNA 3FLEA 4EA9A 1TL7C 3GFQA 1GKIA 4Y67A 3QXJA 3AILA 4GQBA 4UE3S 2PLRA 3BWEA 1US8A 3AF3A 3CF6R 2JH9A 3LKBA 2K2QB 4G5QA 8MHTA 1YR3A 3BXXA 3TZEA 3WO0A 4PXYA 2LDXA 2WU1A 5KHAA 4MWTA 4R1LA 4IGFA 5E6RA 3REFA 4WBXC 3JYHA 4D5EA 2ZBEA 3GRCA 3OQIB 1U4NA 3CR7A 2I8LA 2YVUA 4LF6B 2N42A 3LNCA 4TRRA 4ZT6A 5GY7A 2YV5A 3J81A 2IYSA 2AHRA 3V1KA 1R88A 1RXIA 5GQSA 3G2JA 3B85A 4G5OA 3U4AA 2ZRBA 1QS0A 1ZD5A 1G64A 3AM3A 1P1RA 3FF4A 1T5BA 2Q99A 2VYND 3ST7A 3U62A 2A4MA 2O1XA 1HBJA 4N6OA 4RMHA 3T1QA 1NMQA 1HG0A 2B92A 4YMWA 4OB8A 1K86A 5AW6A 4M53A 4DB4A 4PLFA 1CUHA 4MUEA 4Q9JA 3SDZA 2MSDB 1JHVA 3AGQA 2DFLA 4BUJA 1JLLA 3FMOB 3QMMA 4I9UA 1TVCA 1XZHA 1XYGA 2VLIA 1R9JA 2N0SA 4QG7A 2PNJA 4DG9A 4JVNA 1EFAA 2QTVA 4O29A 4ZHSA 2HOQA 4V02A 5A0FA 4RMGA 3C3EA 1UQUA 2Q45A 2QN8A 1LQUA 3B89A 3PXEA 3HB5X 3JATB 1J0BA 4DIBA 1RFGE 2QL6A 3B36A 2AH5A 1G41A 1WHSB 2G25A 4XGKA 3FYUA 3JALB 1LSOA 4QDZA 4GLOA 1KPHA 3OLYA 2WILA 3LW8A 1KI1A 4X20A 3T5CA 4IDAA 4F7DA 3FCCA 2BF4A 1PVOA 4P80A 3WL7A 4UVIA 3BGOS 1V7QA 1E6MA 1WXWA 4M60A 3WRYA 1SB9A 4MGHA 4ID9A 3KS9A 2QR5A 3DMTA 1KEKA 2VF7A 3SAJA 3OX1A 3NHJA 4PQEA 4UDOA 2NU9A 1OV6A 5ERXA 3E22B 4I8IA 2YHSA 3REQB 4X5OA 3JW8A 2WAAA 5F51A 1XNGA 3BWDD 3PTZA 4LCBA 5J63A 5K0BA 2XMCA 2J32A 2W7TA 1KKLA 1PT9A 1CNMA 1GU1A 1YU9A 3OE1A 1Z9BA 4FP9A 4K7JA 4R1TA 4Y7DA 3RDPA 5B30A 1F8FA 3AVTA 1AKRA 2WMOB 2Y9PB 4ZP1A 3WGVA 4RX1A 1DC5A 2G9QA 2V7QA 1KARA 4HB0A 4JB0A 2EXXA 2C57A 2VHJA 2GZHA 4YBRA 4FOOA 3S2FA 4PYKA 5C8XA 3N0XA 4WCFB 2MYNA 2ZCVA 4FEEA 5LWQA 1IMOA 2F17A 4RGQA 1LPMA 4Q4HB 2V7BA 2RK6A 3TIGA 3CS3A 4Q1AA 2OGTA 1ENYA 3SSNA 3D3QA 5T64A 4DT1A 1LFAA 2QM8A 2QJWA 1G7CA 1KOGA 1Z5PA 1A96A 1P7WA 1RWKA 1T2EA 2ZYTX 4LXYA 2EFGA 2QRQA 3PPXA 2C59A 3TVDA 4E1AA 1UMDB 3D6UA 4O59O 1O5OA 4YREA 4E3WA 4EGFA 1N9KA 3DMGA 1NXWA 2A1TS 1JYEA 4DSNA 1RVDA 3L92A 1VM6A 4HAOA 1ESDA 5KDDA 2CUKA 1YZVA 2CL5A 5J4LA 3T06B 1KO7A 2GXUA 1C1HA 3EQ6A 1U80A 1E7MA 2ZDHA 1E60A 3HDYA 3LOUA 3A6DA 2IYXA 2BHNA 4FLEA 4OI0A 2RH4A 5DBIA 4W5RA 4GP6A 2OHVA 4MR7B 2AZXA 2IYYA 2GHIA 1Z16A 4ZC8A 1CY0A 2CNBA 1C9NA 1M10A 2W2MA 2X6QA 1FTSA 2J6CA 4V0KA 3FUUA 1VGRA 2BYTA 5AYVA 1MAWA 2O8VA 1P1BA 3TSYA 1TKCA 4G5GA 3VISA 3OUUA 3Q6IA 3LQFA 3TW8A 1N6RA 3WBFA 3MFQA 4DCGA 1T2CA 2J3MA 1HT1E 5EWJB 4Z7JA 2PBLA 1SBZA 2G1KA 4F4HA 5J2UB 4G9BA 1VSQA 2XCIA 3GQBB 3PJFA 4JXXA 1MIOA 4MWEA 10MHA 4DLKA 5FLEX 4DUGD 1VA4A 2GJKA 3OZEA 1RLTA 4FONA 3IBSA 5DT9A 3CZ9A 3WYCA 2DAPA 1LKZA 3D8UA 1KAEA 3EIWA 3PNYA 3BIFA 2OXIA 1DJPA 2C97A 2GZRA 3NRBA 3O92A 1IBMB 1TYAE 1ZVMA 3G13A 3A9TA 2HFJA 4JC8A 1KIFA 1M2NA 2AXPA 3I52A 3PPVA 3TLXA 1CHNA 4MKXA 1V2HE 3GI1A 4HFRA 3GIWA 1U94A 3CCBA 4O2AB 1FP2A 4QWMA 1R6DA 4WECA 3VYRB 3ZE7A 2BFOA 2BJHA 2GBGA 2JFGA 1USVA 3FKSD 3GFVA 1TAHA 2DBZA 3JSAA 3NOOA 3OICA 3W04A 3LCUA 4U6QA 3GZJA 1LXCA 5KREA 5JPIA 4HGRA 4XW2A 3D4LA 4YRAA 3R1IA 1U1GA 2H4HA 3VH2A 1RRPA 4S04A 2E48A 4E03A 5CIQA 2FUKA 6REQA 3FPLA 4ZVQA 2OL4A 2PXXA 2RGNA 2EW2A 3WLPA 2ERCA 4IYJA 1SHUX 4RDXA 3A1VA 3J81k 3O73A 3AI7A 1J2UA 1N8KA 4MW9A 1NOIA 5I6DA 2I4TA 3PTLA 1XU9A 2R1TA 3CCFA 3HSYA 2FDRA 1JQKA 1SHZA 4LXUA 1SOVA 1YIDA 3B3GA 3K0CA 4NYMR 4QU9A 5G4KA 4CM8A 5FUWA 1BDBA 2AOUA 2I1LA 4NFLA 4XVUA 5JJLA 1QIKA 3RIMA 1YHNA 3TTWA 3PS9A 4OXRA 3IIIA 2Q5HA 1RPNA 4FB5A 5IF9A 4D6XA 1WB4A 2JH8A 2R11A 4PVCA 1HORA 3MSXA 3OAAA 1JQEA 1UOQA 4Q1VA 4RK0A 3LT5A 3VXKA 1TM4E 2HA3A 5L4SA 3WGIA 2PHZA 2PZLA 3I2IA 5JFOA 1DGQA 3IELA 2XE4A 2WJIA 4RUKA 1CSEE 3I9MA 5B2ZA 1P39A 3QK7A 3CLSD 5AVTA 4FD2A 1USKA 5A4AA 3I4FA 3CF4G 3KWJA 5KYKA 1BXRB 3ROMA 1VOTA 3J80A 2E55A 4MQEB 3MGCA 4XTCS 3H7AA 4IWNA 1MUUA 3D7LA 3JQDA 4RXUA 4YQZA 6Q21A 2Q6OA 1Y9ZA 3GA0A 3NGXA 2PKRA 2VP9A 4D5GA 4OSPA 2TMYA 3SYRA 4TYQA 1F8GA 5ERYA 1VL6A 1C1DB 1CETA 4GBED 2XECA 3TBHA 2GD0A 1UPUA 1R3DA 2Y2UA 1CUEA 5KDLA 4F8EA 2XRZA 2RB5A 2CY0A 2WWRA 4GM1A 1B0ZA 3QNWA 7REQB 3K0CC 4JUAA 1XMJA 1KJYA 2VRWA 2VATA 1LDGA 3M4YA 3PUIA 2FW6A 4OMDA 4YECA 5EXSA 4ZAXA 3W6UA 3SXUB 1XXLA 4MNTA 4FC6A 4BAGA 3CM0A 1P3DA 3K09A 3ZHCA 2GBFA 4A15A 1IRXA 4O4LA 2EF0A 3TGWA 1IBLB 2Z1NA 1KJ8A 2ODAA 3TZBA 1L4LA 1M72A 4EFMA 2GI4A 2YDXA 2V7TA 3NT5A 2VSNA 1A4RA 1MW9X 3H9GA 3ETLA 4RE5A 4WZBE 3O8CA 3ER9A 3F47A 1QFJA 2BMAA 4O08A 4P31A 3FNIA 1FFYA 5CDHA 2GO1A 3Q4GA 2BR4A 3AESA 1ZU4A 2JGRA 4N3GA 5JXIA 1EXWA 2VVTA 2QAJA 4HG2A 3K8ZA 3PWKA 4RDIA 6CHYA 5IDXA 1Z6XA 2J07A 4C5BA 5TXGA 3INYA 3FMIA 4WKCA 2MSEB 2CL6X 1R27A 4RVGA 1MMFB 1KEWA 2UUBB 4AZ3A 4L57A 1U9CA 3ZEIA 3L7DA 1W4RA 4RA6A 3L1IA 3ENZA 1GGNA 2CCKA 4O2RA 4PFKA 5AVUA 3KLBA 3T99A 4LFBB 1PJCA 3ND8A 4HRVA 3EQ2A 1VECA 1MG5A 3C70A 3UV3A 1DCTA 2XUQA 3C3PA 1KQFA 3NC4A 3EPHA 1RQRA 1ZD2P 2DPMA 4LVNA 4V38A 4FHZA 1KJJA 3K09C 1JG3A 1RHQA 2QKYA 2FK8A 1E7QA 1Y3DE 3M4JA 4GYKA 2H48A 4MCJA 2VAPA 4NHEA 2AJBA 2INGX 4Y9UA 1ZR2A 4F38A 1S4MA 2GRUA 2QRNA 3N53A 4GX0A 3E9RA 2MHCA 1SCIA 4IXWA 4RA9B 3PGMA 1ISHA 5JAZA 3VA7A 4EOGA 4J3NA 3F6RA 4CPDA 3HXOA 3IQIX 3AZOA 1W5TA 1JVSA 2C5EA 2QUHA 2X41A 2HBQA 4FTWA 1DKOA 3KQHA 2KLHA 5KU7A 1YS6A 4K6MA 1DG3A 2RKWA 5JDCA 4KUGA 4DNOA 3AJ9A 1XMQB 3C16C 2ZOSA 1HDZA 1YIAA 2PX2A 2HYDA 2ANCA 3HU5A 3ZWPA 1O94A 3EGWA 4AG5A 1X8LA 5CA0B 4ACAA 1ND5A 3UMVA 1KQOA 1PR2A 3RUCA 4ZI3A 9MHTA 4ZOCA 2P2CA 4IQ4A 3LDUA 5LQAA 5LKRA 3DHEA 4P36A 3FMFA 4LV5B 2LIVA 3KIPA 5BMVF 5H68A 4LE0A 5L4NA 4I1PA 4IUDS 3HVIA 1DG1G 3RABA 4WBSA 3H5IA 4RSMA 2I34A 5AVZA 5KOHB 1N32B 1NUUA 2JCXA 5J23A 1BW9A 1YA8A 4FBGA 4I6EA 4Z1OA 2RH9B 1Z47A 3AKYA 3FG9A 1ZN9A 4ZRMA 4M49A 5FWXB 5KWVA 4X92A 3RUEA 3QE2A 2IDJA 5ECWA 4N7RA 3ZH9B 3LUDA 3TBKA 1MO6A 5TMPA 3DNFA 2HRQA 1OLUB 5FNVF 4UBMA 3UGQA 1UKCA 2EP7A 2Y1XA 3ORYA 5HRUA 4Q7QA 1B7GO 4PICA 4XR4A 3FRIA 3EMDA 4K6FA 2HSZA 4MJLA 3AIIA 4MWDA 2BMEA 3TG8A 3FBWA 2AMYA 2P9CA 2CMKA 4DR7B 5B57C 3Q40A 3FDFA 4RVOA 4Z5XA 4GF5A 4UTPA 4XI9A 4TTRA 2OHIA 3VR6H 4KLAA 2W8BB 3QKIA 1KJQA 1SUIA 4X8LA 4DCCA 2QVZX 2Z83A 3B2NA 5JDCC 3I2FA 4XUGB 5AJWA 1UANA 5INTA 2BEUA 1FSZA 1H3FA 1RRVA 5HG0A 1R16A 3N2GB 4YH1A 1I01A 1O94C 1F38A 1XQWA 2QMQA 4NESA 3ISTA 4PC6A 1QIEA 2QROA 4U02A 3C6QA 4Q9IA 3RVLA 1QLHA 2YZ2A 2O52A 1RLOA 4S0ZA 5DLPA 1UOEA 3AZPA 3SJ7A 3KETA 1X7WA 4ZZ3A 4X3OA 4XDHA 1B26A 3OETA 1KZHA 1U8YA 3NWBA 1NUQA 2JLSA 1Q1EA 1T4CA 1UXHA 4RZ2A 4XOIA 2ZM6B 1BE8A 3ZU3A 4IHQA 2I54A 2OV6A 4INAA 3W34A 2DE0X 2QSYA 5LUBA 1CUWA 1SQSA 2ZRPA 4UNRA 4PQFA 3UICA 5I7VA 3UXEA 5FPSA 2IYVA 4GO1A 4HEA6 1XBTA 2Y66A 3PLAE 1R74A 3QE0A 3ET5A 4GR9A 4I6GA 4C4AA 3B9QA 4MIEA 4UPDA 2BISA 3T4UA 2XRMA 1F51E 4LFCB 3AL0C 1LWNA 3ZOKA 3REGA 2DPXA 3MHPA 5JCOC 4WEQA 4HWSA 1L4FA 4IKOA 4CFZA 5E6UA 3RHTA 3MOGA 4CXMA 4KRYA 1NW3A 1IBRA 2GPNA 5DCLA 3FNGA 5EJIA 3QLEA 2OFFA 2YC4C 3B51X 4I4LA 3ANMA 4MQLA 3VR4A 4IPTA 4LDNA 1IXSB 1HE1C 3X1ZA 2ONCA 2NSLA 1ZRHA 5CFNA 1CY1A 4ER0A 2CE2X 4CMIB 3QWIA 5BO5A 5EQDA 3PUZA 3T34A 3SBXA 4CR8A 3RUAA 4AMUA 5C34B 1K98A 3H3FA 3N9IA 5IVKA 3PNVA 4TYNA 3IV6A 1NVEA 4WKBA 2VJMB 4PN7A 1JQDA 1H65A 5H83A 3OFKA 2O8EA 3U19A 1GG8A 4EHBA 1SBIA 4RSRA 3UWMA 1CY7A 4C0SA 4WLOA 4G0PA 2WKPA 1XRNA 1SVNA 5LFAA 1ODKA 1VYHA 1U1EA 1BE0A 2HA5A 4QYWA 3WNQA 2JCYA 4DN6A 5IEJA 1K5HA 4CTMA 1JAHA 3MLBA 2WLTA 5BXYA 4Q01A 5HHTA 3ZGLA 3UB4A 2VPWA 4FDMA 3RRXA 1JHMA 3BE5A 3OEHA 5KS2A 5DBOA 2YOGA 3CGGA 3PDIA 1FNDA 2AYZA 3T7KA 1L3CA 2WOJA 4D79A 3ZDRA 2RKBA 4HFMA 5CDFA 1PX2A 3BE4A 5J40A 3V32A 3VZQA 3OCYA 1YOVB 2GPYA 5AHXA 1KZYC 1JTVA 3PQDA 4B3CA 3MTAA 5BV2P 1SWVA 1FXSA 5D5HA 4HDRA 4L95C 2Z1DA 2LW7A 4QO8A 1GY8A 2XCOA 4LC0A 2ACEA 3ZC3A 2CDRA 3KKMA 3QMWA 4L78A 4Z9YA 3VUEA 2BGRA 1T1GA 1XP5A 4F5YA 2VAXA 4BCDA 2GILA 2PXAA 4ZI7B 1R6XA 3OD5A 1JG6A 3UJ7A 4UDXX 3CN7A 1XVVA 1XZBA 3U6KA 1XG5A 4HH4A 2E9SA 2DLDA 2WR8A 4EHFA 1BJRE 4MYDA 3UUGA 1EH5A 3M3DA 1XDUA 2C58A 2Z09A 1TGYA 4TT3D 4KQ6A 4G5HA 1QH8A 1FXUA 1QTIA 3ZXSA 3LX8A 3ROPA 4OQQA 1O87A 2GSDA 3AF2A 4BWVA 1BEEA 4QYSA 5AI6A 4OOEA 5DFAA 4F4CA 1EIWA 4MWSA 2YS7A 3MOIA 1XI2A 2NO9A 4JVLA 4MQ6A 4PLYA 5CX1B 1N36B 1EUZA 5CXQA 5GADl 3H11A 2PUGA 4GP9A 2EKZA 3H9JA 3KV1A 5JNVA 4HRYA 3SFTA 3FW1A 3L8DA 4FWBA 1XD2A 2JF0A 2G77B 3GW8A 2MINB 3GGOA 3PR3A 4PSAA 4CU5A 5C53B 3ZGXA 1C3XA 4M37A 3GP8A 4LVUA 4YRPA 4D4JA 4C7OB 1Z7BA 2Z56A 5DBFA 3HXQA 3KSAC 3RJ5A 3Q85A 4B43A 5ALQA 3D9QX 2CFIA 1E5DA 1ZNYA 3IULA 4MCHA 4P4SB 3E3LA 3ZK7A 4B09A 1YXMA 4M9CA 4OQEA 1QP7A 3QV1A 3K32A 5EUQB 5A5GA 3LBYA 3UC9A 5FHRA 1ZBDA 2QLMA 3ER6A 5E9AA 3H8JA 4JEUA 2HMTA 5DYWA 1EFVA 4C08A 1P7ZA 3HJAA 3G9QA 3D4PA 2P9YA 1IVYA 4DQXA 2B30A 1W8IA 1FFHA 1YA6A 1VKZA 2WMYA 3KOXA 4N8EA 5BYBA 1S2NA 3KKQA 4WX2B 3C48A 2X0KA 1HK7A 3H5LA 1H3EA 5ESDA 1GITA 1IY8A 1FRFS 2EC5A 2NV2B 4Q47A 4XFKA 4X41A 5G1PA 4U3JB 2P8SA 2VP6A 3AWDA 4BNZA 5FTWA 4A0SA 4TOIA 3X1MA 3CR3C 3H87A 5BT8A 5BUCA 1KI6A 1Y1TA 3DJYA 5HOQA 5H16A 3X1YA 3OTQA 5A7HA 1EQ2A 2F9FA 3A06A 4I55A 2RIPA 4PBSA 3K1TA 2CLEB 2H4JA 1HYGA 3BHNA 1CF9A 3N0WA 2X2OA 3D64A 4OIMA 4ABYA 4FJ1A 3ZCPA 1FDTA 1JI0A 1CS0B 2A30A 3B6ZA 3HA5A 2P9QA 3O8QB 4LXQA 4C87A 3O8LA 4KHZA 1T2NA 2PX6A 4R81A 3TW4A 4C07A 1NW6A 3C1OA 1KH2A 4I1RA 3HEBA 1IAQA 4M38A 4S12A 1UP4A 3ADDA 3T7IA 4I3FA 2OHOA 2OPBA 1USWA 1YQ9A 4BS9A 2HSEA 4ILKA 4RK7A 1S89A 2XGGA 3NW9A 2NYRA 4ZHQA 2GZDA 1CVRA 3PI7A 1N8NA 1W9HA 3CZCA 1GTSA 3EXIA 3H3XA 2CE7A 1JR3D 1P61B 3N2EA 1E2HA 2AXQA 3BD6A 1QP8A 2Q4EA 3DR5A 1JDNA 1XRMA 2LR0A 2W43A 1KMNA 2ZJ7A 3EQ8A 2CVPA 3IUNA 2Y3IA 4PQYA 2C31A 2EERA 2XWJI 2Z3VA 5BWCA 2P9BA 2RGBA 3PZRA 1MB0A 2NV0A 4PHTA 1TYDE 2X5NA 2C8KA 4J91A 3BRWD 3VYTB 5IFLA 3IMFA 1S96A 1NXPA 4AKHA 2CUTA 4KDCA 4CEHB 2HEIA 2PO7A 2NWQA 4V0ME 1OLXA 4EP1A 2P6NA 1H4VB 1J2YA 2VP0A 4P53A 1Z5NA 2Q28A 4LNAA 3DPUA 2PX3A 4MYUA 1SC3A 4MV0A 4YMSA 4MUKA 3MJSA 3RRFA 5AUPB 1ZMRA 2D2FA 1Z56C 5KCMA 4QYXA 2H0QA 2D2VA 3ANLA 1JG2A 2QU8A 4HWTA 4JU8A 5DI3B 4CMAA 1KVRA 2VXYA 5AKIA 1I5RA 1ODCA 1G5FA 1ZD1A 5CEJA 1KFBB 1ABEA 4UOEA 3IT1A 3MT0A 5LXTB 2CL0X 5JW6A 2Q6LA 2JCGA 3I9V1 2CJFA 1N2CB 2XJ4A 4FYPA 2ACVA 4CKBA 5AOCA 5J2TF 1G3UA 1ZN7A 2D3TA 1D8AA 1VLHA 2HRDA 3OLVA 5TGTA 3L6EA 1T9DA 1JA9A 3WLTA 1U63A 2C5AA 3FDXA 4PZDA 4QBFA 1XYVA 2IOYA 4BFZA 1MXFA 3KHUA 5DNEA 4NBRA 3W4JA 3GJ7A 3NUQA 4LF7B 1ZA2A 1DAIA 2DUNA 5TMBA 1CLEA 3SQOA 5EUMA 4YXWD 2E6UX 3VJRA 2B2NA 1XTIA 3MWDB 3UQYS 2G63A 4MOWA 4WVFA 4CKWB 4YUAA 4I8XA 2MJLA 3UHFA 3Q41A 3K8OE 3G82C 1PS9A 2FE1A 3FTQA 1HLDA 1TT5B 3HE3A 3Q6NA 5DLQC 4ETMA 4UBJA 5JSZA 5IM4F 1WU7A 1ITZA 1E1RD 3JWHA 1Y82A 1ZYUA 3STYA 4FGUA 1D2EA 2OWEA 4D9IA 3ZE6A 2O8CA 5B1HA 4DLTA 2P11A 4FLMA 2C4MA 4PNZA 3HDHA 4TWIA 5IDWA 1XNQB 1E5VA 1KNXA 2V7PA 1WCWA 2AC4A 4HPJB 4HQOA 2VSQA 3I92A 5JEDA 2Z2ZA 5JBNA 2CYAA 3BT7A 2WYOA 3RAPR 3A9UA 3LPMA 3VYSB 4EEXA 1QH0A 5IVIA 4A91A 2P9HA 5GP1A 3HMKA 4BQEA 3DEJA 2W42A 4IMJB 4IGAA 3ORRA 3DUWA 3QUTA 2D5CA 1GGMA 3D6AA 3PG5A 1HYBA 1YVUA 4NBNA 5BNFA 4D0RA 3NI2A 3PHBE 3VU3A 1GQQA 2Q0XA 4MDEA 5ESRA 1E6EA 4Z4CA 2RAPA 2PZ8A 1GDTA 1S5PA 2FMXA 3NCTA 5ENDA 1MJFA 1T1IA 3IVAA 2H85A 3EY9A 5LZ5A 1TUIA 4Z0HO 3O8BA 1GRQA 4DV5B 3NNNA 1OW3B 1ZD4A 4HJXA 2BHSA 3JVUA 1BHO1 1YDHA 3H9BA 2PIDA 2XITA 4IJWA 3VDXA 1XPUA 1TT7A 1IQPA 4BQOA 3HLTA 3N3BC 3T9FA 2PS3A 3T9BA 1PS0A 4CF5A 4PGMA 1QRDA 1P2DA 2MDTA 2FQYA 5HP4A 3PUXA 1ESEA 4FJ2A 1XHFA 4KGVA 2IEZA 1DT5A 4A36A 1U6IA 3WYAA 1GP2A 5AKLA 4X90A 2VP4A 4DQDA 3AIKA 3DE0X 3OF3A 3UUEA 3LCMA 3WVNA 3WGZA 4YBZA 1O8BA 4RFLA 5A7FA 4NOLA 4E46A 2WSSA 4NDZA 1V7PC 3C14C 2I22A 4M88A 3PDCA 1J56A 3UG7A 4X97A 5KQGA 2EZUA 3HFGA 2VHQA 1OAAA 3RK1A 2MU1A 1HETA 2PRJA 3NHMA 1XLWA 1AKMA 2DZDA 2GZSA 1U8CB 1WTCA 1Z2OX 3DAYA 3M3PA 4N5NA 3CPEA 3TPFA 3T5MA 4YV0A 4UTVA 4Q6WA 5I4KA 1DFGA 3OCCA 2XZLA 1Z83A 5JMWA 2JIOA 1ONPA 3FFWA 1XMIA 2GCPA 1ODLA 4H3VA 1EUDB 4JFAA 1DI0A 3BWYA 2P2YA 1DAKA 1ODTC 1GPMA 2CLFB 2FWMX 1ML4A 1SHLA 3P9YA 3RUIA 1CX9B 4K28A 3DEHA 3IJPA 1AURA 3IVXA 4TQ9A 4EH1A 4KTVE