4QVKA

Apo-crystal structure of podospora anserina methyltransferase pamth1
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
235
structure length
235
Chain Sequence
b'LGSILPFNEETADRVSAYCEKNSHGIPDALVEHWEWTRTRFPDADKMSSRLQGSWMIFTARDRKPKRILEIGCYSGYSALAWYEGTRDTKAEIVTLEYSPKMIAASREAFKKYGVGDRVKLIEGPAENTLKTLEGEFDLIFVDANKDGYAGYVKTILDQGLLSANGIILCDNVFARGLTIGPDCAPWLNDHVRPYWNGCGQALDKFSAGLMEDPRIDVLLLPVFDGVTQIRWKDG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PaMTH1 Methyltransferase
molecule tags Transferase
source organism Podospora anserina
publication title Structure and Biophysical Characterization of the S-Adenosylmethionine-dependent O-Methyltransferase PaMTH1, a Putative Enzyme Accumulating during Senescence of Podospora anserina.
pubmed doi rcsb
total genus 87
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4qvkA00
3JWGA 3Q7EA 4CKEA 2EG5A 4HG2A 4JXJA 4YMHA 3P71T 1WY7A 2FPOA 1AQIA 2UYQA 4C08A 1SUSA 3E05A 4HTFB 5F2OA 1VIDA 2PWPA 3B3FA 1RI4A 5EVJA 4NECA 3GWZA 5HIJA 3AXTA 1KR5A 5CCXA 3TKYA 3KQTA 1JSZA 5K0EA 3PX2A 3HA3A 1P39A 3HVHA 5K01A 3EGEA 1IM8A 3GRZA 3KPYA 3VYWA 3HCCA 5EIWA 5EPEA 5F2NA 4KW7A 1Q0TA 2BH2A 3HVKA 4CWAA 4U7TB 4YMGA 2EJTA 5HZMA 1I1NA 3KQPA 3HA7A 1JG1A 4V0RA 3EEYA 5FA5A 2LD4A 3MHTA 3TLJA 3CBGA 2ZCJA 4KDRA 3DR5A 3DOUA 2XVMA 4POOA 2ZIFA 3DUWA 1X19A 3EMBA 2WK1A 1KPHA 2GB4A 4FS8A 5F2KA 3JWHA 3KHKA 2BZGA 3GRUA 4RVHA 4RX1A 4XCXA 2QY6A 1VBFA 3ID6C 4F84A 1AV6A 4C04A 1DCTA 5D1HA 5LQRA 3NMUF 4E2ZA 2PJDA 2HMYB 5K0CA 3A7DA 4PYLA 3UJAA 1TW3A 5DXJA 4EK9A 4ER6A 2AOUB 2Z6AA 1BC5A 4C06A 3P8ZA 2ZLBA 1YZ3A 1VQ1A 3HEMA 1ORHA 4C4AA 3LKDA 2NP7A 2OO3A 3G2MA 3KR1A 4DCMA 1SQGA 2ZSUA 3DULA 3I58A 2ZWVA 3KKZA 5DM1A 3G89A 3V8VA 3CJQA 3SX0A 3FUWA 2F8LA 3G88A 3HVIA 2C7RA 2G70A 1VE3A 1R74A 2OPBA 3PS9A 3GO4A 5ICGA 3C6MA 4RTKA 1X1CA 2ZBRA 3OFJA 1JR4A 5FQNA 4CTJA 2P40A 3VC1A 3WSTA 4YUYA 1MJFA 2O06A 4X61A 4EMSA 3HVJA 3UFBA 2BR4A 5GM1A 4IKPA 4F86A 3P2EA 2YTZA 3THSA 3SGLA 1YFJA 1ZG3A 2XYRA 3I53A 4DCGA 3LDGA 4RTOA 2B9EA 4QVGA 3ELYA 1BKYA 3I5UA 2ZZKA 3KQQA 5ICCA 2OY0A 3M6VA 1FBNA 2OYRA 3VSEA 2P3LA 1JQDA 2PX8A 3EEOA 3BGIA 5HOQA 2V74B 1D2GA 3A26A 4CKBA 2IBTA 4X41A 3UA4A 4RTJA 4OA5A 4YV0A 1ZGJA 3BXOA 1XCLA 4PCAA 1YUBA 3ANXA 1PRYA 4DQ0A 3DMGA 3FPJA 2EJUA 2JH9A 4MQ4A 5EEGA 5DM4A 2UYCA 5KQSA 1MHTA 3NDIA 2YX1A 1XDUA 2ONYA 1XVAA 3O4FA 4HRAA 3EGIA 5HILA 3B89A 2OKCA 1EJ0A 3M6WA 4MWZA 4RTQA 3MGGA 1SVUA 2YVLA 4RTRA 3EVFA 3IV6A 3K0BA 1R00A 1RJGA 1XDSA 2P35A 3B5IA 3FUUA 2JHPA 3BWYA 1ZHFA 3EMDA 5LQNA 5M5BA 4C07A 2AS0A 4C05A 5LQUA 1RI3A 3DTNA 5K0FA 4OBXA 1Z3CA 4OQDA 2PXXA 5DM0A 5K0LA 3ER8A 2FK8A 4KWCA 3TMAA 2GAFA 5T6BA 4Y30A 4KDCA 3PX3A 2KW5A 2ZULA 3OU2A 3DXZA 3SSOA 5DRTA 5K03A 2JG3A 2G8NA 3TOSA 5FHRA 3FPGA 3UJDA 4PIPA 3RW9A 5FHQA 3HTXA 1EG2A 4DF3A 3HA5A 4FGZA 1RJEA 2K4MA 1NT2A 5D1NA 3TQSA 1QAOA 5DTQA 1SKMA 5HIMA 2JH8A 4DM3A 5EMLA 2EFJA 3R0QA 4P7JA 3G5LA 1N7JA 7MHTA 5GOZA 3CC8A 4MTLA 1R8XA 5DX0A 3UJCA 3KR2A 4AUKA 3CCFA 2JHCA 3DH0A 2AOXA 4R6XA 3DLIA 4WXHA 1UWVA 3TR6A 4DA4A 4YUWA 2ERCA 3TM4A 5CIYA 1L3IA 5K0JA 3BWCA 2GH1A 2VP3A 2C7QA 3EVZA 3MQ2A 2ADMA 3BZBA 1QANA 3OCJA 4QQNA 4P7FA 4IV8A 1VP9A 3LCUA 3LSTA 2ZIGA 1QZZA 5CUQA 2ZIEA 5JUWA 1ZKDA 1D2HA 2PX5A 3FRHA 3P2KA 4RVGA 4A6EA 3SXJA 2A14A 1BHJA 2YR0A 4HSGA 3FTDA 2DPMA 4R6WA 2NP6A 1Y8CA 2P8JA 2NXCA 2ZZMA 1ZGAA 1O54A 2QE6A 2O0LA 5EMJA 3ERCA 5DSXA 2ORED 3P9KA 3KPVA 4E33A 4AX8A 5K8VA 1U2ZA 2E5WA 3K6RA 4PYMA 2CWWA 2IFTA 4FT4A 5EZQA 3TKAA 3DXYA 4ER7A 3PTAA 1JG2A 1TW2A 3G8BA 1V39A 3LKZA 5E2BA 1IY9A 3RODA 2IH2A 5CCBA 1G6Q1 5E1DA 4DZRA 4CXMA 4ATNA 4RTLA 3LCCA 3D2LA 2PT6A 3GJYA 3TRKA 2P1DA 4GQBA 3GIWA 2PXCA 1FP1D 2H00A 4FP9A 4QQKA 2UZ4A 1INLA 5LQAA 3ELDA 2EX4A 2PWYA 1L9KA 5CVVA 1FP2A 2PKWA 4AZSA 5E9JA 4PYQA 1XCJA 2GA9A 3UJ7A 4YV2A 2NNWB 5FWAA 2IDKA 3S68A 4GEKA 1L3CA 4LWPA 2P7IA 1QAMA 1HMYA 3P97A 3A4TA 3IEIA 3KPUA 3HCAA 1KPGA 2G1PA 1DL5A 3GU3A 2IP2A 3IYLW 1ZQ9A 4QVKA 3SMQA 4BP1A 4L7VA 1O9GA 2HTEA 5GIPE 3SR4A 3C3YA 2WA1A 2CL5A 3OU7A 4GOLD 3O7WA 4GOOD 4M37A 3JWIA 4PYOA 5E8RA 1JTFA 2BR5A 5MHTA 4DMGA 1IXKA 4M7RA 4LWOA 2ONZA 3UJ8A 3OZTA 2BM9A 4GF5A 4QDKA 3NTVA 4K6MA 4ZTBA 4X1OA 1I9GA 3SSMA 3HCEA 3CJRA 4R8SA 4PYJA 4AZWA 4R05A 5ICEA 3LL7A 3CJTA 2NXEA 3MCZA 5H02A 2PX4A 4HTFA 5BW5A 3QOWA 4E2XA 5FWDA 1X1AA 3C6KA 3LDFA 5HIIA 4KIGA 3AY0A 1PJZA 3BGVA 2QYOA 2IH4A 3BWMA 2GPYA 3GXOA 3P2IA 1KIAA 5C0OE 1QYRA 3BKXA 3UA3A 4XUCA 2HV9A 2AVNA 2OB2A 2OXTA 4EKGA 3E7PA 1NW7A 1VPTA 5DWQA 2UYHA 1DUSA 3HNRA 3HP7A 2XYVA 3MTIA 3T7SA 1T43A 3OE4A 1G60A 4OBWA 2FCAA 3NJRA 4M38A 5EHIA 1F3LA 1KHHA 4P58A 3UJ9A 3I64A 3G2QA 4QTTB 2YQZA 3G8AA 1YF3A 5FA8A 2QRVB 3C3PA 1FPQA 3EVBA 3AJDA 3LPMA 3GRVA 3G7UA 5CVUA 5BXYA 3BGDA 5EEHA 1RI1A 2GS9A 5DTMA 2AOWA 3OFKA 2P3OA 4IWNA 3DLCA 2FRXA 2AZTA 3Q87B 3UBTA 5GIOE 3MB5A 3L8DA 2B2CA 5DXAA 3FTCA 5FUBA 4Z2YA 1YZHA 4X60A 5C9ZA 3O31A 3RIEA 4PIMA 3F4KA 5U4XA 2JHAA 3PLAE 3P9NA 4WVLA 5EMKA 3NW9A 3R9XB 3GCZA 5FCDA 1KP9A 4QTUB 1HNNA 2V7EA 2YXEA 3E8SA 3KPWA 1RJFA 3FYDA 3KU1A 3LHDA 4GBED 5GP1A 2VDWA 3OU6A 4LECA 1G8AA 2CMGA 5CVEA 4PINA 1JG3A 2AOTB 2PX2A 3B3JA 3EGVA 4MIKA 1NW3A 3UZUA 4UOEA 2UYOA 1JQ3A 1QAQA 2Z6UA 2FYTA 4OX9Y 3AXSA 1SUIA 2ZZNA 2C7PA 4KVZA 4P7KA 4AZVA 3DMFA 1BOOA 2ZFUA 4KIFA 4G56A 4C03A 3PFHA 3M33A 3EVEA 2B78A 1M0EA 5HEKA 1KXZA 4IV0A 2O05A 5EHGA 2CMHA 2ZBPA 1N2XA 4O29A 3CGGA 3GNLA 1YB2A 3KQYA 1FJXA 1NBHA 5KVAA 1WXXA 3R6TA 4GC5A 4BLVA 2PT9A 3KQVA 2P7HA 4Y2HA 4A6DA 3NWBA 3DXXA 5EKXA 5EMMA 5DTRA 5K0NA 3HCBA 3LBYA 4FT2A 5C1IA 3LCVB 1SG9A 3FUTA 8MHTA 5K05A 5K09A 3GGDA 1G55A 5LSAA 4GC9A 1NKVA 3MERA 4E30A 5T67A 4RTSA 3PFGA 4EQZA 1NE2A 2WA2A 3R3HA 1OR8A 2PGXA 4HC4A 3EVCA 2PVCA 4X63A 5E9WA 2OBFA 2H1RA 3GDHA 2BM8A 3OPNA 4GUAA 5EG5A 4YUVA 3T7TA 3NVKI 9MHTA 3OZSA 3LDUA 4YV1A 2AOUA 5LR6A 4E32A 1X1BA 2OZVA 2HWKA 4R8RA 5DM2A 3C0KA 4FSXA 3NWEA 2VZ9A 2AVDA 4FR0A 4XUDA 5GWXA 4RV9A 3G5TA 5CD1A 1JQEA 1KYWA 3KQOA 4GOND 2R6ZA 5LQJA 1EIZA 3MAGA 3ER9A 4XUEA 4M36A 2VS1A 2HNKA 4U7PB 5E1BA 3FZGA 3KQWA 2IH5A 1NW8A 2JJQA 2IGTA 1VL5A 3LBFA 4FZVA 3UJ6A 1O9HA 4PGHA 3M70A 4MHTA 5EOVA 3BUSA 2AN4A 1WG8A 3BKWA 3FUXA 1WXWA 3P9CA 5K0BA 4RWZA 5E1MA 2HR1A 3SVZA 1P1BA 2IIPA 5K0GA 5T64A 1XTPA 3B3GA 5FADA 4QDJA 1XXLA 4ER0A 3BWBA 4GOMD 5JR3A 2IDJA 4RTNA 3ORHA 2AOTA 3UWPA 5KYGA 3X0DA 1WS6A 3B7PA 1SQFA 4P7GA 2BR3A 5DRYA 5EKUA 4HGZA 3BT7A 3EVDA 4RTPA 2IBSA 2VDUE 1Q0SA 4CTKA 4PNEA 3HM2A 3E23A 3KQSA 2AOVA 3DP7A 4E2WA 1NV8A 4BLUA 1G8SA 5G02A 1P91A 5EQJB 4RSRA 4AZTA 4E31A 3IHTA 3ELWA 4HH4A 3SM3A 1G38A 1NV9A 1I4WA 1R8YA 4H0NA 2G72A 5GM2A 2FHPA 4ISCA 2ZTHA 5DX1A 2P3QA 2XVAA 2Y1XA 2IPXA 3FPHA 2PSSA 5B1SA 2Q41A 5DX8A 1EJ6A 1L1EA 1NW5A 3G2OA 2NYUA 2QRVA 3GRRA 3KR9A 3FRIA 1M6YA 5GINE 1RI2A 3H2BA 1TPYA 3KR0A 3TPZA 5DT2A 2PBFA 3OZRA 4ER5A 2ZW9A 2XBMA 5KQRA 4BP3A 2Z6QA 4ER3A 1R6AA 1XDZA 3U81A 3T7RA 5DPMA 1B42A 2PXAA 5FULA 1UFKA 1JG4A 2ESRA 2QM3A 3I9FA 2NXNA 1ORIA 3A25A 3LECA 3EPPA 4E2YA 2Y1WA 4HGYA 4YUZA 1XJ5A 1AF7A 4OQEA 2O57A 4PYKA 2DULA 4PYNA 5CM2Z 5HIKA 3QOXA 4B17A 4FSDA 3THRA 3UJBA 3G2PA 2R3SA 2CKDA 3PT9A 3QV2A 4PYIA 4RVFA 4F85A 3T0IA 3ELUA 1X1DA 2FK7A 5EGSA 2ZBQA 3EVGA 4BY9E 2PV0A 4EKIA 2XYQA 3M6UA 4PONA 3ME5A 3MCTA 4PCLA 1VLMA 5EC8A 1F38A 3FPFA 5IKMA 1JTEA 3OE5A 4RTMA 1KPIA 1JSXA 1R18A 3FPEA 3NDJA 3FTEA 3A7EA 3KPJA 2VDVE 4EVIA 4PWYA 2N47A 3EVAA 1NBIA 4QPPA 3PVCA 4E70A 4RVDA 3VC2A 5CVJA 5DSTA 2GLUA 2YXDA 3V97A 1RJDA 5EZSA 2I7CA 3LX6A 1YFLA 3GRYA 1AQJA 2O07A 3R24A 2G71A 3LGAA 4PGGA 1RI5A 5DLYA 2B25A 2B3TA 2ZVJA 3TFWA 3MTEA 1VP3A 2P41A 2AR0A 5E9QA 2I6GA 3KQMA 5E2AA 1L3BA 3FYCA 3TM5A 1H1DA 3FUVA 3PB3A 5LQCA 2I62A 10MHA 3M4XA 5FQOA 1WZNA 2YXLA 5E1OA 2PLWA 4QPNA 5E8JA 3DMHA 3M6XA 2C7OA 4OA8A 2YUIA 5EIFA 1EQAA 1P1CA 3HCDA 5ERGB 5HFJA 4CKCA 3FTFA 1NW6A 5LQKA 3P9IA 1UIRA 3A27A 5BW4A 1M6EX 4DKJA 1N7IA 1EAMA 2PY6A 3NVMB 5CVDA 3SSNA 5BP7A 2I9KA 3HCFA 4V0QA 5FTWA 2AN3A 2OB1A 1KYZA 3AWIA 3JWJA 4LG1A 3REOA 4KRGA 3CKKA 4YUXA 2H11A 4BLWA 4RYLA 2AN5A 5ICFA 5P8WA 2NXJA 1D2CA 2ZWAA 5KS2A 5IH3A 3CVOA
chains in the Genus database with same CATH superfamily
4GPZA 4YROA 2DPYA 4W1SA 4S05A 4KGVA 1ZGGA 2A0KA 2D7DA 3P71T 1AKRA 1Q19A 1KSHA 2BHRA 5FO0A 1KQPA 4E5SA 1DG9A 3HPRA 2H18A 3ILHA 4Z7JA 4H18A 3AXTA 1GAEO 2ENUA 5WRFA 4TSFA 4M9XA 4IXWA 5KSPA 5IAJA 1XQ1A 2F1HA 5EWLB 4EY7A 3Q9SA 4JJGA 1UT6A 3EUAA 3HVHA 5K01A 4DDUA 3GRZA 4PU0A 5FAKA 2OGZA 2VRBA 1KH1A 4OV6B 4IO1A 1LK5A 3A32A 2GRJA 1HQCA 1Z2CA 4FX2A 4V0RA 4EELA 3TE6A 2CYBA 3S2UA 1TM7E 2Q1XA 3O82A 2Z8YA 2LD4A 4K88A 3OLZA 4RGQA 4DW8A 3MRTA 4C87A 1RXIA 3LKBA 4WBNB 3NGXA 2HHAA 2XQJA 4TKVB 4LI0A 1X19A 3KB1A 2WWTA 3WMGA 3C7DB 2UUCB 3VXKA 4IF6A 2WYIA 4YT5A 5F73A 5KDLA 1DKNA 1Q57A 1FTNA 2QX7A 2DF8A 2A67A 2QMEA 4RX1A 3UVEA 5C1OA 3BREA 1LBIA 3F7OA 2O0JA 2ECFA 1H69A 3OLQA 4IIYA 2XE8A 4KEAA 4AMZA 2C57A 3GLHB 1J90A 2VQEB 3B1WA 4UAUA 1II8A 1YCDA 4BAGA 3IULA 3OWOA 3BMCB 1KKMA 3O4RA 1ZI6A 4H16A 4MAFA 1SXJE 1LS1A 3F5FA 5FOTA 3D4IA 3ZIAA 3DFMA 1T9GR 4GG1A 1WU7A 1YZNA 2PX0A 4K3VA 3UENA 1ZMBA 3O92A 4CQLB 3MINA 3U7GA 5KNDA 1RIFA 2WIKA 2C7RA 2INGX 3W5HA 3JQEA 4ARSA 1WUTA 5LWQA 5JAPA 1UC4B 4XSGA 4P0QB 2ZJ5A 2I6XA 1M74A 3LUHA 1N6NA 2NUAA 4RORA 1YR9A 4ZVNA 3ZHBA 1J1ZA 3V6LA 4DPLA 3V7YA 3S3TA 3FCYA 1BXGB 1MC4A 3Q3JB 4QNRA 4E09A 2BR4A 5GM1A 2R6HA 4LRTB 1TVEA 5JTTA 4BL5A 1C0PA 3WG9A 4YT2A 5JANA 4JB2A 4JELA 2GZ1A 1ZA1A 3C3WA 2OCLA 3KTFA 1ZGHA 5F78A 3M82A 2CD7A 4RTOA 4WV3A 1AKEA 5L3VA 3ZVMA 1MOSA 4AY5A 4E6EA 1J0AA 4YR9A 2DEUA 1HDRA 4LVUA 2EYUA 4MUAA 4P7BA 4TT8A 3EYAA 5B37A 3UHAA 3IXMA 3UT0A 2ZJ7A 3E18A 3MAAC 4HCJA 3A2LA 4FR2A 4O1IA 4R3NA 1NI4A 4UUMA 3LFHA 4WUTA 5I9SA 2X8JB 4E5VA 4ZREA 4YV0A 4DRZA 2FWRA 3QWHA 1Z06A 1OH8A 1T2AA 3I12A 4TSKA 5BMVA 2JFFA 3LUPA 3LX4A 4HS4A 1WF6A 4JLAA 4J03A 3IIKA 1XDUA 1TK3A 3QPCA 4IICA 3LX8A 1SBIA 5SZJA 1W88A 5JIBA 2XA2A 2FN4A 2Z09A 3QY0A 4Y9DA 1DRUA 1HKHA 4WEOA 3UF0A 1ESCA 4Q9JA 3H9UA 4EGCB 5IDVA 2YVLA 1F0PA 4M8IA 5CB0A 2CFSA 3VR3D 1QQBA 1P9OA 4PGMA 1QDLB 2BZSA 5SYMA 5TPZA 4F6RB 5AUPB 2HQSA 3IDAA 1WXEA 2ZI7A 1KVRA 4LHYA 4NOMA 1HTWA 1RI3A 4LSMA 3V33A 2Q3HA 3AESA 2Z4SA 4L9SA 4OXIA 3O6VA 3RFXA 1NU6A 1I2CA 3GUCA 3GG9A 3USZA 5C46F 1NSYA 1P45A 2C04A 1WNTA 3IQFA 4GX0A 1N6IA 1OILA 1NQTA 3JQ9A 3OJCA 3VUEA 4G9GA 1LDNA 1RXYA 2H92A 2M98A 3IR5A 4OKIA 3W3AD 1KS2A 4BE7B 4OHYA 1DIOB 3QVGA 4OHUA 1J39A 4R8MA 3SD7A 3FPGA 3VO9A 4BMVA 1YKGA 3D4BA 3D1JA 4EPXA 4OQZA 4AIIA 1QJ4A 3S1AB 4TT3D 4GH5A 1GPYA 4AKHA 4L2IB 1N0HA 2I4TA 5FNVB 2Y68A 5CFOA 2CEAA 1QR2A 3Q7IA 2XUFA 1N6KA 3ZY6A 5B3JC 1F6WA 2WW8A 3CCFA 3I62A 1D2MA 2SNIE 5K6RA 1T4CA 1VI2A 4MPRA 1LQUA 1SEVA 4RS3A 4E1BA 1RQ2A 2I4MA 3O8BA 2GH1A 1RNLA 4FS3A 2XYHA 2OK7A 1PHPA 2AJTA 2X23A 4Q4LA 3TSYA 4BNKA 5GZ3A 5B4UA 4C2UA 3GJXC 4L4ZA 1K66A 2AEMA 2NTVA 4LPKA 4ND4A 3JARB 5ALLA 2PJRA 1EFRD 3TAUA 3JSXA 4K2AA 4F60A 2W6NA 1VKZA 2VVTA 3NORA 1MJGM 2ZT6A 3WMFA 4BAUA 4A6EA 3DKRA 2A14A 1U7OA 2I0FA 1JFVA 1GZ4A 3FTDA 4GVPA 4RZSA 5FAXA 3FGOA 1TK2A 1Y8CA 1A8SA 2JJMA 1WUHS 2C95A 2GERA 3LOQA 1R6VA 1MF7A 2PZMA 1L4YA 1NM5C 1A9YA 2R8PA 3L7MA 4U5QA 1JA0A 3M1IA 3ENQA 1X1SA 3HXMA 2JFVA 4AX8A 4J7AA 2DH5A 1PQ4A 4HGRA 4UVIA 1HK7A 1DX6A 1SBQA 1JKFA 2ORWA 2ZRQA 1M75A 3JRWA 1J8FA 3ZEIA 3A1EA 3DHYA 3PPWA 4BNFA 2VBGA 1GZ7A 3IVRA 2Z1NA 3UKDA 1GGHA 1U9IA 1X2EA 5AESA 1Q21A 1EM6A 2P1DA 1YS7A 3FFBA 1QORA 1TL7C 4FP9A 2VJDA 1V4BA 4YJGA 1IEWA 1WW8A 4WKPA 1GNVA 4FJ0A 4AZSA 4PYQA 3ETCA 3HCPA 3W04A 3GPDG 4YV2A 2A9PA 1VYTA 3TR0A 1R8SA 4B47A 1IEVA 5JXIA 1NC1A 2G5TA 3HRIA 3G0HA 2AZXA 1KPGA 3MJDA 1RYZA 2GEFA 5THQA 1KA9H 3SMQA 4E07A 3PC7A 1O9GA 3SFTA 3WFZA 4OB8A 3H1GA 3PXDA 3OU7A 4GOOD 3V32A 1ZU5A 4LOKA 4YMUA 2BR5A 4MRPA 4MDFA 2EF1A 1IZ9A 1N2CA 1WSDA 4DVGA 2AB0A 4Z99A 3UXEA 4HYYA 3UTCA 3PK0A 1HE5A 2CCKA 1ZD9A 2Q3MA 4ZTBA 3PDHA 1Q0PA 3EX7C 3A1DA 5DFAA 4PLPA 5EQFA 1QE0A 3ADKA 4U8GA 1NUHA 1LY1A 1QYWA 2CLLB 4JBXA 4QBIA 2IWRA 3OMWA 1UADA 4GOXA 4AZWA 1D7OA 1G6HA 4XRGA 2IVFA 2XXAA 1V25A 2E4XA 3NFYA 3WK6A 3CEJA 4ZTUB 4C20A 3DV2A 1VZ2A 1Z0FA 3N70A 2P9BA 5AI0A 1Z82A 1T2EA 1Z4OA 2HZ7A 3FXAA 3HMKA 5IMSA 3ZD8A 2XLCA 4W7SA 1Y6FA 1TM4E 2H4ZA 4IIJA 4MUJA 1Z74A 5LDDC 1CQJB 4D3DA 2QLNA 2HV9A 2OUIA 3L9XA 4QICA 4AJOA 4IJQA 5JNTA 1H2EA 1QO0D 3T5TA 3NDBB 5KMGB 2CJXA 2Z3VA 4D3SA 3WHKA 2FSPA 2ON6A 3B9BA 2HEIA 4PAGA 3N2ZB 4C7MA 4EABA 5G2OA 4CF7A 1SUFA 2W6PA 3GA7A 3JALB 3LUGA 5B36A 3ZWDA 4N8DA 2ODBA 3ZV4A 4BQRA 1VKOA 1DJMA 2CFIA 2BC9A 4QBFA 3ZDQA 3U62A 1S2LA 4G1VA 4QOHA 4C14A 2HDOA 2I5PO 3GRVA 4ZTZB 4PRZA 1X8XA 2IU3A 5EEHA 4H17A 4F91B 3LHFA 1N3IA 2V7QD 2UZ1A 3N9IA 4Q9AA 3NEJA 4KX5A 1DO2A 1QFXA 2HO4A 4A6PA 2QN9A 5JCPA 4RF5A 1UK9A 3I5YA 4ZVRA 4FYPA 1KAMA 5FI1B 1XCOA 4J3JA 4ZCLA 5A5GA 2WOJA 3LY5A 4QM6A 1IMJA 4EA9A 3WK9A 4EUSA 1FMLA 1FFXA 1HNNA 1T5TA 1J42A 3KL4A 1XBTA 5K3EA 3OU6A 1E2NA 3EQ7A 1XP8A 2OCPA 4LECA 3H13A 1D0VA 5L4LA 4K28A 2BFCB 3ZJYA 3LUFA 3PGA1 4OGFA 2HK9A 1MZVA 2W2NA 2PKCA 4GMKA 3NBYC 3VC7A 1NXTA 3CUTA 3WLHA 3G7SA 5JJBA 1IWPB 4O2BA 4EP1A 1TD9A 5FI0B 4TN1A 4WK6A 5FR2A 2R8EA 3DQZA 4CM5A 4W1PA 4QYIA 4TLBA 5HQJA 4EEXA 1CS4C 2RB4A 4J07A 5TB5A 2BEWB 1G20B 3IEUA 3Q5GA 1E3QA 3HABA 3RUCA 4IF4A 2QU8A 3MT8A 3SHVA 3KQVA 2P4HX 3WGMA 1OAAA 1R6TA 3I9JA 1XYGA 1SVIA 3PKJA 3B2EA 5B6JA 2TS1A 1SG9A 3QEKA 1Z88A 3V3TA 5K09A 3ISJA 3L77A 4YBZA 1PVOA 2CWDA 2P75A 1CSEE 4HAOA 3IQXA 1XXHB 2P0EA 3U4GA 1XT6A 4BV3A 4I5GA 4AK9A 2B0CA 4U00A 4XXHA 5HTKA 4OB7A 2B98A 4RWEA 1ZI9A 3VYSB 2FSGA 2HXGA 4X1YA 1Q92A 4B4DA 2HWKA 3RT1A 4JMLA 1U0OC 1QO0A 2R65A 1A2KC 1XMSA 4FCCA 4DVJA 1MT0A 1F2VA 3AFNA 3A3PA 4TVSA 3WGLA 1M1NA 4LOLA 1U3FA 4YRCA 4UTPA 5CDYA 4M36A 3ZXUB 4PLFA 2IYRA 5BW5A 3KQWA 3E9MA 3UBMA 2IGTA 1VL5A 1X7GA 2B94A 2IOQA 2OXRA 2DFLA 4M0FA 1WMSA 5AIAA 5B1IA 3WZ2A 3ZUPA 5G40A 4IIXA 4US1R 2QPAA 2BDUA 4OAPA 3E4DA 3GUVA 3IAS1 5KSWB 2RG1A 2Z8XA 3B3GA 3WJAA 1UK7A 3LBAA 5CXQA 2WP8J 1XQVA 2G1KA 4FDVA 4R8LA 3VZBA 1M6NA 3UT5B 4UNPA 5JR3A 5CEEA 2GCGA 3ZLTA 1YKSA 4BO9A 4EPVA 1ZESA 2QSYA 4MW0A 2CL0X 4S1PA 3O8QB 2W4IA 3TRFA 1SEPA 4XM1A 2PCLA 2TMYA 2VQDA 4PO8A 4TL7A 1ISFA 3HB4X 1ZU4A 1NV8A 2VL7A 4CLXA 2Q5HA 3HXQA 4ZO9A 5BNIA 4KGDA 4KMRA 2PU7A 2RHBA 5F35A 3AF5A 4LYGA 1G9TA 2FFHA 3CZ4A 3HACA 1GL7A 2JLRA 1XLWA 1Y1QA 4K8OA 3MT0A 4L9AA 2QYHA 2WUVA 4MLDA 2J5BA 3FWHA 1HFEL 3FPHA 4QJ5A 1EJ6A 3KWJA 3LT2A 4JHXA 1JW9B 1SUEA 4IDQA 4WAUA 3U3XA 1X9IA 1ISRA 5DTIA 3B38A 4HL6A 3LLCA 2GEJA 2Y0BA 1E2PA 3M83A 3DTVA 1PK7A 2AKYA 2QXYA 4WDQA 5JV5A 5KTPA 4F11A 1PNTA 3IT1A 2BOVA 3SS9X 1B42A 4AUMA 1LC3A 5FULA 1HZJA 2ESRA 2XUJA 3ZE9A 1YTLA 4AG6A 4DREA 2JFBA 4EKEA 3LECA 3GHYA 1YBAA 5H9VA 3SBOA 4EY4A 1EMDA 1TVCA 1Z0SA 1OUMA 1AF7A 5KNLA 3UUFA 1H2XA 2YICA 3NAMA 2QUAA 4C7BA 4NZOA 4B17A 3EG9B 1FYVA 1T8PA 4UEOA 4ND2A 3KZNA 3ELUA 1R0SA 1TC2A 2FK7A 3ZW9A 3QG1A 1J99A 1W44A 2VDPB 3R5HA 1XHFA 1ODFA 2FNAA 3UAGA 1XZCA 3WLPA 1XCBA 1T0PA 3NR2A 3O3NB 1XL1A 1WXGA 1NLFA 3EARA 1R6XA 1PLKA 3BXFA 1K98A 1U7PA 4YRJA 3WYGA 2J45A 3SEAA 5LLDA 1U28A 1VBKA 2CV1A 4CMIA 4NICA 4KMSA 2ZKIA 3AF2A 1RR6A 1W85B 2BGRA 1P7YA 3C2QA 4P4UA 4TMVA 4E70A 4QGSA 1T9GS 1Y37A 2JD2A 2VPTA 1EFLA 4E88A 4Z3OA 1JAZA 6REQB 5JHHB 3QE3A 1DV1A 1SXGA 2D4AA 3DEFA 2ZUBA 1LNSA 2CY0A 2B3TA 4IL5A 4LQ4A 1US8B 1WUYA 3RRJA 1S7CA 3BEOA 2HH9A 5CHYA 3GOHA 4B75A 1E1CB 4MCAA 1CP2A 2WUFA 3LPNA 2JGEA 1YDGA 1SQ0A 2R6CA 2NO7A 3BAZA 4X6XA 3TM5A 3O4JA 4CL8A 3UN1A 1BEUB 1T4BA 4JK3A 4BXOB 2XCSB 2GUWA 1H2FA 3CV3A 1Z8FA 1UBOS 2D7JA 1X7WA 3DMHA 1KMHB 4NPAA 1IB0A 3FYHA 3IHWA 3W3AH 5LU8A 4WEQA 2YZMA 1BW9B 3E35A 3A4IA 1TYEB 4Q4AA 2JVKA 4EO9A 4RACA 4GZMA 3OQ6A 3U4AA 1BEZA 1DXQA 2J3IA 3LBHA 3REQB 3WYAA 1OT5A 2WHQA 3TIGA 4ARIA 1H2BA 4ZDIA 4RK4A 2E4YA 1YA6A 5EAIA 2I9KA 4FOPA 4NARA 4E5MA 2BW0A 1PL0A 2Q6LA 3U1TA 5KVSA 1J0XO 1KSGA 3LQQA 1NBME 2QRGA 5BW6B 1RQPA 2WRZA 1UBSB 5J4LA 4URZR 3ZDEA 2AL7A 1KK2A 4ZEWA 4DAEA 4WXRA 5KHOC 2BI7A 2FPOA 4IJMA 4PFKA 2C3PA 4CMCA 1N2GA 1U0TA 3SC4A 2R8ZA 4S1VA 4CKCB 2RONA 1KJYA 4P81A 5E4FA 4EHHA 4NECA 3GWZA 5DO9A 1GGNA 1WMEA 2DKOA 3U48A 1UWKA 3OTOB 2VP5A 2YHAA 5JH7A 2HL6A 3A4LA 5TMBA 3RKSA 4QJ4A 2XY4A 2HJ9A 3AEQB 1P39A 3CM0A 3P7MA 1UOQA 3NO4A 2ZRDA 3CRRA 3PGVA 4B71A 1U02A 4CU2A 1OU4A 3N7TA 1TYCA 1FFSA 1OPXA 2W2TA 5JISA 2Y66A 5EUBA 4P1ZA 4C4TA 2OKGA 2CVPA 4HQOA 1YK1A 4ZCMA 4YRLA 1HYBA 1LVHA 1R1DA 2FPGB 3IH5A 4JAVC 5KTSA 1PE0A 1ECFA 4FFBB 3DVLA 1M72A 4U2BA 3EMBA 1KEUA 2VQSA 4IEEA 5IDYA 3QVGB 3KHKA 2P2DA 1KI2A 2PSJA 4O2RA 5EWJA 3WY9A 2Q7OE 5KCZA 1GPUA 2ZPUA 4CN8A 4BV2A 3B2NA 4G84A 5JDCC 3NMUF 3V9AA 2PGJA 1Z4KA 2HM7A 2NLOA 3NBUA 4C4XA 1Y4UA 3HUUA 4JX8A 3VSAA 1XQYA 1C3XA 1Z0JA 5IWCA 3TTSA 4CF3A 4I9FA 1E4EA 1AE1A 1U0JA 2E87A 1RP1A 4OJQA 2AFIB 2VAPA 5AT1A 4R3WA 4XD7A 4DV0B 1IBKB 2Q6OA 1GPKA 4BRWA 3B1VA 2JLZA 4WZ6A 4OIFA 1CIPA 1TXGA 3FUWA 4NH4A 1Z2DA 3ADOA 1P74A 4HVTA 2OPBA 1QXSA 4NG5A 5TX7A 4PZAA 2F9FA 2PEYA 5A4AA 2RHDA 2ZBRA 4LBZA 1JR4A 4P22A 1N5OX 3WSTA 4R4JA 4OP1A 2CBXA 1TQ8A 4D0SA 5JZ9A 4RY8A 4EMSA 4TMTA 1I7NA 1UC9A 3SM9A 4AN1A 3NCTA 4YP1A 4IDCA 2CHVA 4M46A 1MJNA 3OH8A 5K4HA 4B80A 3BJEA 3I53A 3PC4A 4DSNA 1DMRA 2JJYA 3AH8A 2M6KA 4ODIA 4CV3A 1EG7A 5A7GA 4O2BB 5C7IO 3UICA 4AIRA 4DXAA 1DCMA 4BAZA 4CT4B 4H6WA 2Q7XA 4KK4A 1BDMA 4MDYA 4X3CA 5CCDA 1N32B 4J49A 3BXOA 2LTAA 3IQHX 1QUEA 1LRLA 1OXBB 3E2PA 4DMKA 1K6JA 4PZZA 3T7KA 1JEEA 2EJUA 2R85A 1SBCA 1MHTA 4KN8A 4LJLA 2P9QA 3KHTA 2ONYA 2ZREA 3K9GA 3RH0A 1K4MA 5JMWA 3K4HA 4V02A 4B2YA 2GA8A 4R1TA 3L8ZA 4A2WA 3B89A 1U2SA 3N8GA 2V6IA 2ZWOA 2VTVA 2QG4A 2MCFA 1QH8B 5L4NA 1UL1X 4BWGA 4KQEA 4Z9FA 1L7PA 4G5QA 4ZWNA 3KV1A 2Q1UA 1KZYC 2R7LA 3TDKA 5FUMA 4OEHA 1AZSC 2WPDD 3T1QA 3VGPA 2QZJA 1KEKA 4OBXA 2JVIA 2JGRA 3EAGA 4UD2A 5K0LA 1BDJA 1NFRA 2COEA 5E7IA 1ISIA 1S6YA 3D5QA 1FMCA 4UM8B 3WWCA 1QGUB 2JRLA 5JROA 5J2TB 5FQOA 2GARA 5H68A 1Y7PA 3HA2A 3OM1A 2R60A 2WJZB 3K9HA 3E53A 1O95D 2HA2A 3IBGA 2W71A 4GDMA 3W7AA 2P6MA 1EI9A 1AM4D 2C20A 4JCCA 3W90A 5ENDA 1ZOLA 4D44A 3E9DA 2DFPA 1LC0A 4N03A 2HA5A 3VPDA 3GROA 3ED1A 4GKKB 1CFZA 3R74A 1B76A 1CZNA 3QVKA 4P2GA 1NNSA 5EP2A 3UH0A 2QW8A 4EJ0A 1CXZA 1NJGA 3V7FA 4ZCQA 3V8QA 2JAWA 4DWVA 1Z4QA 1NONA 5FBZA 4WACA 2AKEA 3M8KA 1W6RA 2V7XA 2QG9A 2OCIA 4YRQA 5DIFA 2OQIA 3LT5A 3IIMA 4WXMA 2ZRHA 4GWKA 1JEJA 1TJYA 4LVOA 3PYMA 5C35A 1F5SA 3QX3A 3ND7A 1PNQA 2GN0A 4UE6A 4BZXA 1O77A 2WYUA 4JCOA 4BASA 2X0JA 1OXMA 4U7DA 2V8OA 5D85A 2D3WA 3D2CA 1E0AA 4ND8B 3IS3A 4PQYA 1MV5A 1P5JA 3A0RB 4R51A 1NF8A 3TEMA 3T9EA 4CKEB 4EFLA 4JLMA 2UUAB 4KVAA 4C1BA 5IAGA 1KMIY 2ASVA 2WWGA 3UPTA 5K5EA 3NRBA 5KPJA 2NP6A 1I01A 1U90A 2C5EA 4UEQA 4BRSA 5A6VA 1IY8A 2EW8A 2Q2OA 1YBFA 3K0AB 2NWQA 3E82A 1KDOA 2X58A 1N4DA 4J8PA 5AJHA 4BO2A 2JLQA 2QE6A 4IIDA 1HE8B 3SDSA 3W2HA 4ARBA 1U4NA 4C7OA 2ZJFA 3RGGA 1LPSA 4Q05A 2NZYA 4C5CA 1N2OA 3DXYA 3UANA 1GYRA 3OSUA 5I7SA 1A1VA 1RVDA 1T5SA 3QVSA 2IH2A 3GFTA 1I2MA 1Z0IA 1NSTA 1HYHA 2B82A 1G6Q1 2FPKA 2PANA 5E1DA 5A9SB 5LL6P 3NHMA 2ANBA 4I8DA 1XMXA 2B1JA 4MZDA 1ADYA 2BI8A 5I7WA 2BGNA 1JV2B 2O23A 3SY8A 5F33A 2BBWA 1B93A 2XWBF 3BL8A 5C7LO 5JOQA 4MIOA 4N6NA 3N87A 4GGPA 1VIMA 3CWCA 4OSEA 3WGNA 2ZAOA 1YJ8A 1FUIA 2Q07A 2XSZD 5BNZA 4L22A 1DBIA 1UEIA 3UJ7A 1GTL1 3MIZA 1U98A 2XDAA 4YNBA 1DLIA 2W8BB 4NYIR 4R2JA 2BMDA 1N57A 3ZCQA 4PQGA 1QQ6A 1UPTA 3IBCA 4KTTE 2BGKA 3ZHZA 2AG6A 2XOKD 2CLEB 3M3DA 5DB4A 2HTEA 2OBLA 2PZJA 3DLTA 3FSGD 2PNFA 2HU7A 3I0MA 5AXCA 4M37A 4K6KA 4Z0PA 3ZHVA 1AU9A 5MHTA 1O8CA 3OD5A 4Q7LA 4YO8A 4CRWB 3ENVA 4HN2A 2KHZA 3JQFA 5F64A 4S2EA 3WFIA 2DLCX 1EXNA 5I7EA 1JKMA 3TF5A 2Z98A 1GCIA 2LR0A 1JXOA 4J16A 3KZVA 3LLSA 1WZUA 3P0IA 4QC2A 2A9KA 2FF5A 4PCUA 5FWDA 3N07A 4XW2A 3WWOA 2YOHA 3MGAA 4GZ5A 3VPXA 4C3UA 5EXSA 3N0WA 1MFPA 2DYKA 4DMCA 1P4GA 4AT1A 1DNPA 1PJZA 4I4NA 5GZ6A 2QYOA 2F1OA 4J0CA 3PZBA 3JPYA 2WWRA 4HLUC 1EGAA 5C0OE 3EHDA 3EEIA 2IZ6A 5BPFA 3TK1A 1RQGA 2GN8A 2FXVA 3RFFA 1YK0A 2DPLA 3UMJA 3VV2A 2NMVA 4YJGB 4RLQA 3AHCA 2JHGA 2A5JA 2OA0A 1UINA 2IPNA 1G60A 3NT4A 1GNLA 3MTAA 2W8ZA 5SZKB 3U19A 3C14C 2ODPA 5DM70 1Y8QA 1RE1A 4P58A 4GI2A 5B30A 3DVRX 3ZHRA 1KI1A 1Z17A 5JNSA 4QTTB 3T5CA 3G8AA 3IT2A 3EFEA 3TW8A 1KJQA 1H4TA 2VSXA 4I8XA 1F9EA 1IOVA 2V6JA 3OCWA 3WX0A 1ID8A 3G2LA 5DTMA 2AOWA 3IDZA 4DOMA 4NS1A 4HUTA 4Q93A 5IEBA 3K2EA 3Q87B 4I4IA 3VZPA 4YX9A 3KLMX 1B0UA 1KJ9A 2OENG 4JUAA 1FOEB 4HY3A 1K8YB 1M2JA 1TTHA 3FMVA 5C9ZA 5IJXA 3H5AA 1T3GA 2Y0CA 3H1AA 2QMQA 1NYTA 3ESZA 3FJ1A 4KE8A 4WVLA 5EMKA 5U4XA 3TD2A 4A16A 4EW1A 5EFOA 1KP9A 2J4FA 3AF3A 2V7EA 4QARA 4JQZA 1DXHA 2P9ZA 3EIFA 5DMHA 2V9CA 3DB1A 4WZZA 1RBMA 4AICA 4X3PA 4WZAE 1JE0A 5BYAA 2NAPA 2CSUA 2O5VA 4ND8A 3QE0A 1T9HA 3KALA 2JGNA 1CNFA 3PQ7A 4Q9NA 3WYNA 2XSZA 5H16A 1JDVA 1I24A 1J7JA 3AETB 3QOFA 4OKNA 4FCTA 2C7PA 3X44A 2P4SA 1Z6XA 4JBGA 3ZZ1A 1JBQA 1M2VB 5IX8A 3Q8MA 4YJHA 2TECE 4UBMA 1CPYA 5JWRA 2QVZX 3GLTA 2WM3A 3F78A 4MULA 1YDWA 4IEIA 3YASA 1OSNA 3PUIA 3HU5A 4UM9D 4XQGA 1ONOA 2O0KA 1GCUA 5F3DA 1A9RA 2AKAB 3R6TA 2ZROA 4LQLA 3D3WA 4BLVA 3WDKA 3CW2A 4Y2HA 3VVLA 2DWCA 1QQ7A 1MOPA 1U94A 1UKYA 4QFBA 4D8XA 821PA 2WSIA 2G04A 3OCUA 3JZFA 4GYJA 5DLPA 4W5HA 2V59A 3P2JA 4MO2A 1G55A 4A9AA 4MH0R 3WB9A 3HXOA 2VQFB 1IM5A 2J59A 3BK7A 3GYGA 3H5IA 3QPAA 4UDOA 3C24A 5FBVB 3A9UA 1EFRA 4YA6A 1FX0A 2H1RA 1SC1A 5A03A 4P80A 5BR1A 2YHBA 1TEZA 2X4GA 4EO7A 1P4JA 5A4JA 2WVHA 2NSHA 1YJCA 4M7WA 2OXFA 2B1QA 2WOOA 4G24A 4F3RA 1UZUA 1Q95A 1X70A 1ZIPA 5EN4A 5TF4A 3KQNA 1TUBA 2A1IA 3ACDA 2NU9B 2BEWA 2VDOB 4AJ1A 4CCWA 3AHJA 1VB3A 3KG2A 3SK0A 4DLRA 5A4KA 1AZLA 2ODTX 2OM2A 3GLVA 3EQZA 3ISVA 4HFJA 1VLLA 3R3JA 4ALKA 2BMAA 1O9HA 3TKLA 3FG9A 1M5RA 1GRRA 3HCWA 4E5DA 1P1BA 3ANTA 2QLFA 2O2JA 3D6NB 2HMTA 4KAXA 4MAAA 3MRXA 3G6KA 3L8MA 1CE8B 1ZM3A 3K4QA 4IH4A 1OKKD 3G7NA 4L3VA 4OHOA 4HQFA 3I6MA 1LQTA 1FFGA 1WXIA 3H11A 3KP1A 3EOBI 4HUQB 4BFLA 1UWCA 1JFTA 4FOOA 1CUIA 2QP4A 2I2WA 4X91A 1T13A 1BO6A 1GGVA 1SO8A 4IHKA 1WKCA 2VJKA 2I9PA 2OESA 3L04A 4KAFA 4V0NA 2Q5CA 3IAHA 1SU7A 3NJ4A 3PFFA 3VR5A 3I1JA 2V4ZA 3JRNA 3IELA 4Q24A 4B31A 4WNCA 4QUIA 2DOKA 3VVMA 1ZOPA 1TEHA 3A6KA 3UWSA 4BFWA 721PA 1R0WA 4ISCA 3HKEA 2CNLA 4UAJA 4I55F 3ENNA 2JEOA 2Q41A 1SCAA 1WL8A 2GZSA 1PFVA 3Q0EA 1VG9B 2RHTA 3HUEA 4X97A 5SY4A 3GRRA 3ZGLA 2Y0PA 3FRIA 4F2DA 1IHYA 3N59A 1RI2A 2EG9A 5D6OA 3C3XA 2PBFA 2F7SA 2A1TS 2W2XA 2Z6QA 4ZT4A 1XDZA 1U1FA 3OZWA 1J8YF 2FW9A 3OX2A 5M2QA 1QGDA 2JH3A 4KQJA 2E1PA 4BFCA 2WWYA 2NXNA 1FNDA 1SU6A 3A25A 3GPCA 3QLVA 3VH4A 2TRSB 1IQPA 2X7JA 1XYVA 1OI7A 3GP3A 4X20B 1XJ5A 3R9KA 3VR4D 3C70A 1KIFA 3G0GA 1KFJB 1THMA 1JKXA 3CA8A 1L5NA 1UFRA 2RI0A 3ILYA 4AWXA 1WD5A 3I4FA 3THRA 2LCFA 3JAWA 3TCXB 3VYVA 3J7TA 1QHYA 1USUA 1XJWA 1YQQA 4EG8A 1R7RA 3ABQB 2ZG6A 4HR7A 4PONA 1SU8A 2QI9F 2RGNA 1RE0A 3SEFA 1IG3A 2CCGA 4PCLA 3VJLA 3D7MA 2PUGA 4MKZA 2VP6A 4Y2RA 1FP7A 3ZVRA 2H9IA 2XUQA 1M2VA 1N0VC 4FD2A 2Y6VA 5DNWA 2I29A 4K5QA 4QPPA 2V58A 4MUYA 4UPDA 2ZYAA 4LW8A 3KVOA 3O83A 2Q3DA 2IC5A 4ZZ0A 3V55A 1JR6A 2HK8A 3A9RA 1ESNA 2PH5A 3K31A 4FYMA 3SOPA 2XZLA 2MYNA 4XVUA 1H6BA 4I1YA 4KE7A 3E22B 1G7CA 1KI6B 4BBPA 3ZXIA 5IUKC 1TLLA 1AGXA 3QVOA 1A4XA 2ZVJA 3VNBA 3L8YA 1USWA 5DYGA 1I2BA 2P41A 1XTIA 4J0DA 1UM9B 2IT1A 3FYCA 1R4NA 5B4TA 4TL9A 2IK8A 1I6WA 3PUJA 1S2GA 4FYJA 1B8UA 2A0YA 2C9OA 2OMKA 3I30X 2PLWA 3M1YA 2HXSA 2JK1A 5AYVA 4K9SA 3K1TA 7REQA 1V37A 2C7OA 1KE1A 1UP7A 1EQAA 2AK2A 2BRUA 2HGSA 2QQ0A 2P91A 4Q3EA 3EE6A 3F2VA 3O84A 3VNUA 2QX9A 1UIRA 1B00A 2X4IA 4TLCA 2QL6A 3L4JA 4DKJA 2HCBA 5FDFA 4ACBA 4XM2A 2ZR0A 4EHIA 1I5OA 1WCXA 3WK7A 3JQQA 2C9ZA 5EJMA 2FW0A 3VNQA 2REQA 3A9SA 1TFUA 3S44A 1LBTA 5JSFA 3GLFE 1B0AA 1JJIA 3E58A 1OV6A 2QUHA 2YOFA 1S2OA 3IR6A 3ENZA 3MYYA 2ACEA 2ZWAA 4ZK6A 4GKBA 4QREA 4JDUA 1PQPA 1J4AA 4V2IA 1DHTA 5I8PA 3W2FA 2ZOSA 1DKOA 3AEKA 1JAIA 4QEZA 3DCNA 3T3PB 3R3WA 3WMEA 3RC1A 3KSRA 1KU0A 4RHFA 5HIJA 1GQSA 1PO7A 2BEVA 1OFUA 3CXRA 1ZEJA 4EUEA 4F2HA 1EFUA 4KR7A 3OUZA 1T6BY 2HXYA 1BJKA 3HM9A 1ZD1A 2J9GA 4AG5A 4JJ4A 3TQTA 4GQAA 4YRZA 4MVJH 2A3RA 4GXNA 2JK0A 5AHWA 1JG1A 3K0FA 4J4BA 2JBWA 2VO1A 2MT9A 3K8OE 4HZUB 2FZEA 2YFKA 521PA 1C1YA 1FP4B 3TLJA 4YRTA 4ASUD 3AI1A 3DR5A 3D59A 3NDPA 4GSLA 1DTWB 2D62A 3WGIA 3BRWD 3RU7A 4WPGA 4UVEA 3IDFA 4WY5A 5M7EA 2GB4A 1NBMD 4XQ9A 1V8PA 4GLOA 3KB8A 5ANRB 4N9WA 1SQSA 3QW4B 4LISA 1E5VA 1V6AA 3GL9A 2GD1O 4MP6A 4EHLA 4F3NA 4FILA 3OT1A 3ZQKA 4P3PA 1V3QE 1DCTA 2ZJAA 3ZW7A 1VM6A 3UFXB 2CE2X 4KL8S 2A7QA 2QGZA 2PA0A 2YVAA 4CL2A 5FOUA 3W7VA 2QZSA 2V6BA 8OHMA 1O5OA 5TS3A 1JXAA 2HYIC 1VC2A 1BC5A 1JR2A 4MQ6A 2ZE7A 3WNDA 1Z75A 2QD5A 2ZLBA 2YZ7A 3CWQA 3L41A 4INJA 4RSGA 5KJ1A 4HEA1 4B6QA 5J2UA 2CFRA 4B1FA 1EE2A 4B3BA 2JCGA 3L8GA 3DBRA 5HR5A 1SHLA 1XDDA 1Z8DA 4FGKA 4QO7A 1T1GA 3UO8B 1ETUA 5JCOC 2RGCA 3N2KA 3JQGB 4W6QA 4WKOA 4DLKA 1M6VA 5B1DA 5LP6C 1KWGA 3H9BA 2QSZA 3TNDA 3C6MA 1E7RA 2FE4A 4TZTA 1RKXA 3TCNA 3W6PA 1GRVA 7YASA 2QTCA 3H6HA 1QU2A 5JD3A 3DEAA 5TNXA 3KCNA 2IW3A 1ZZGA 2VWPA 3P94A 1Y7TA 4B6SA 3R9WA 3AG5A 3JARA 3K0SA 4MHTA 4JROA 4FMCF 3V4SA 2IUYA 4PPQA 5EE9A 5EZYB 3W5SA 3VSBA 1F48A 5ENZA 1J1UA 2JIQA 5TGZA 4WWHA 1RLOA 2GCOA 2OY0A 2V5UA 3NALA 5AHXA 4Z7QB 3WFJA 1MD9A 3GVHA 1CF2O 2YWBA 4FWIB 5I4KA 3DWIA 2FWJA 4YRIA 2NUPB 1KS9A 1FMTA 1SVMA 4AJHA 4ZODA 4ECEA 1L5YA 1G63A 1IY1A 5JLJA 3RANA 1OHHA 1Y8AA 5EJ6A 5JS8A 3C85A 4FGJA 4O25A 3AVYA 3UXYA 1YFKA 4ZP1A 2H2FA 1XZAA 2F64A 4Y67A 2IIVA 2Q27A 4EDHA 2VF5X 2ZXUA 3RIGA 3WV4A 1I3LA 1KY4A 4HEHA 5JRJA 1KAHA 3K0BA 5IFLA 4H59A 3T61A 3KSAC 4JQSA 3ED5A 1HLDA 1DZ3A 1HG1A 4IX9A 1AJEA 1P75A 3NHPA 4NYMQ 3JAKB 1F0KA 8LDHA 1SN7A 3NBZC 1LLFA 1TF2A 4GYKA 1Y7LA 3DAFA 4F1JA 1JU4A 1A7KA 4GP9A 2B2NA 2BAGA 4GLBA 1FDTA 1DBSA 2HB6A 2HYDA 4JYMA 4LQCA 1JLMA 4IOLA 4KSBA 3UWDA 4N65A 4F96A 1Y33E 1C1XA 4KLRA 3MUFA 4LNUA 1ULTA 2ZTVA 2NZUG 4ZQEA 4C4RA 3WBFA 2ZB2A 1TVMA 4I8IA 1J0DA 5KC8A 1SKUA 4HK4A 4CIXA 1UMBA 2HA7A 4LDAA 4L78A 3MJHA 2GSDA 3DMTA 1FFAA 1U2GA 1U7TA 2QVLA 3QIVA 2PZ8A 4P4SB 4JJAA 2Z57A 1ZNXA 1EAYA 1PFKA 3ROPA 2C82A 5JS6A 5EMLA 1GSAA 1YAHA 3EGWA 2UYGA 1R3UA 2GETA 3V4FA 1ZMOA 5EXXA 2EVWX 5JS7A 2EKZA 4DLSA 3UJCA 3QOYA 3JAMA 1LCIA 2VDJA 1RIIA 1BXKA 3MCVA 4PG4A 5BUQA 1NDHA 2B92A 4IIGA 4CKBB 1GLGA 2FEOA 1L3IA 2SECE 2QRQA 4ZYZA 5EXTA 5AO9A 2RGRA 3HV2A 1JLLB 1T8TA 2JFQA 2F67A 4ZT6A 2H1IA 3WXBA 2Q3LA 3C97A 4ZZ3A 5JBQA 1IBSA 3S2FA 1CLUA 5BMOA 5HCUA 2R44A 2CXXA 1EGMB 5DYWA 2BJVA 2P62A 2CLKB 3X2EA 3QE4A 1UZNA 1U2GC 1P9RA 4XD2A 3CUKA 3LRPA 3ROXA 1KVUA 4ALIA 2YR0A 3FSJX 2J9FB 5CPBA 3C1AA 5SICE 3FOEC 4G86A 2V7WA 2C4HA 2DECA 3I52A 1M7GA 4ME6A 4BJHB 3NEPX 3GEGA 3QK7A 3EVTA 1ZGAA 1NE7A 4LYFA 4ZQFA 3NYQA 2GEUA 2XUIA 3DLBA 4JBLA 3RK0A 2O0LA 3OC6A 4BWVA 1L4EA 4E33A 1UJ2A 4XDZA 3P2MA 4COKA 2A35A 1P5RA 3D0RA 4L8GA 1LDGA 4B3XA 2QVCA 3RK1A 3THXA 2HUNA 3I6IA 3P4XA 3HC7A 1TVKA 1T25A 1NQ5A 2O2YA 2C9CA 3FY4A 4XB6B 3BJIC 1IJEA 4QEKA 1E9SA 2DHRA 4RPKA 2VXBA 4XLTA 2Q2NA 2ZJ2A 3BXEA 2VLBA 4X71A 4GQBA 2FMHA 2PXCA 5EUQB 2QMYA 3ZGYA 5E2IA 4DSZA 4ZYLA 2BKUA 3J80A 5DBEX 1P6UA 3MMSA 4GBMA 2DR2A 1GCOA 2A0XA 2DY0A 1E3DA 2VH2A 4WZBE 1RXCA 2JJ2D 1ORWA 2ISCA 1WVGA 1AOXA 2R6FA 4GE3A 3C6YA 1PYGA 3KVYA 4UBJA 5B3LA 3A4TA 3NOVA 1II9A 4JJEA 4UTXA 1ZXLA 5F1YA 3K71B 1AQLA 3GU3A 1NOJA 2PZAA 4N41A 5BQ5A 3T3OA 3QXJA 4QDTA 2G17A 3RPEA 3Q9NA 4DLAA 3KNZA 1LB1B 5E8RA 1JTFA 3T7DA 3TLEA 4LE0A 4L73A 2MJLA 3GLGE 2A0FA 4FHFA 3BFPA 1ZX1A 4AY4A 2OAEA 3LF2A 2FMUA 2PBZA 2Y92A 3LFTA 1UT8A 4N47A 1U8UA 3G0IA 3RRXA 1IXRC 1GKKA 1RYHA 1ZR4A 3WGTA 3TH5A 1TGYA 2QGNA 2NXEA 4ZJPA 4QRHA 4O4IB 2WJIA 1PR0A 1Q83A 1X1AA 1UDWA 2FFQA 1R5NA 3OPQA 1W2GA 5HIIA 3VMMA 3INNA 4CIVA 1EVKA 4NBVA 5JATA 1CHNA 2PKQO 4CQMD 1FFWA 1WEHA 1QYRA 1BCRB 1C3JA 3BPSA 1VMDA 2DXIA 5CXSA 1G59A 5D5HA 3R20A 3U3KA 3HP7A 4HN9A 1Z5UA 3S0JA 2RBGA 2YYYA 4OGGA 2EZ8A 3FW1A 4DY4A 3IQGX 5C5EA 2Q6TA 4QOEA 1T1SA 1EX7A 3OAAA 3ZJVA 1TAHA 4ND1A 5C7YA 2XF8A 5FA8A 4J0KA 1FPQA 2IPAB 3FTNA 1JEQA 4LHSA 3I6BA 1J97A 2XUZA 3E1KA 1XO1A 2OZLA 2YS7A 3UIEA 3BMOB 4EIWA 3IILA 3OZEA 1C9MA 1SZPA 1N5IA 2NACA 4GSKA 3PEFA 3F9RA 3IP6A 1BD3A 4KYIB 4MUEA 1OFTA 2FFRA 4JENA 1AUPA 4OGKA 1ZINA 1JFLA 2DBYA 3OTGA 2FN9A 3KAKA 4IMRA 4RJJA 4KIUA 2GSWA 5AJWA 4D98A 1D2AA 2H3HA 1A8UA 1CEXA 2RI6A 3A37A 4NULA 5EA2A 4MGZR 3ZIUA 5AM2A 2BPOA 4DJTA 3VKUA 3HKCA 3L8FA 2J3LA 3GCZA 3PJGA 2ZCVA 3RTAA 2WV7A 4G25A 3SFZA 1FDRA 1A76A 1T0BA 3I45A 5KTNA 1AH2A 2JC3A 4HLUA 2CLFB 1TO6A 5CVEA 4HQNA 1B6TA 3UPUA 4INOA 1G3QA 3UZUA 2HCJB 2K2QB 2PGNA 1W85A 3KKOA 1H85A 2H57A 4BQSA 1TQ2A 5EP4A 4EX6A 1EXVA 1JHMA 4AZVA 4RH1A 5CX1B 1LBEA 2P2SA 4G56A 4N0MA 1VI5A 4WX2B 2LZ0A 3IC5A 1XQ9A 3EVEA 1J8VA 1L4FA 1K88A 2D00A 2DUWA 4MUBA 3I04A 3Q10A 2QTNA 1R0KA 2ZBPA 3FPAA 5EGNA 2VBFA 3DKPA 4WOPA 2OD2A 1QFJA 2BKEA 4LRSB 3DDUA 2ZUVA 1L1QA 1PLJA 2CC2A 1G6OA 3I5MA 5EKXA 3ZTYA 2X1VA 4H3KB 4US0R 1OROA 5C37A 2OORC 1HFJA 4OI0A 3QBTA 4HXEB 4BRZA 3NM4A 2A3NA 5T67A 2R66A 3OLVA 1KK1A 1V1RA 2Q49A 2IPOA 3GEDA 3K2IA 1CUXA 1PV2A 3NPAA 4OHCA 5BSVA 5IK2D 3OEED 2PVCA 5EG5A 1TF7A 2VEDA 4GUAA 3GDHA 1ZJ4A 1Z35A 3OPNA 3OOYA 5AUQA 3Q12A 3V7NA 4F3YA 1E3SA 3LC0A 2CNDA 2O8EB 3NT2A 5DM2A 1Y1TA 4FSXA 4AF8A 3NWEA 4CGZA 1II8B 1G0NA 1KKUA 1L1RA 4RK0A 3UAYA 1URPA 4A0HA 3ZY5A 5AVOA 2GKOA 1SVSA 5IYZB 1K68A 5L95A 1VL0A 4I5IA 2I33A 5REQA 3A4NA 4IZIA 2HF7A 1BX3A 1QH8A 2IJGX 3UCXA 3W05A 1DRJA 2W42A 1QBKC 2RAFA 3HHEA 1D6JA 1PLLA 3DE0X 5JAHA 3LWZA 2ZB8A 1Z7YA 1W88B 3WWEA 2PL5A 1R6DA 3V4PB 2AOTA 5LDHA 4I9GA 4OFBA 2YXNA 5KAMA 4DAOA 5DRYA 2H59A 2C3YA 2MDTA 4OPMA 4AURA 2QPLA 4LCBA 2GF9A 3AUKA 1IMOA 1ND6A 3KJHA 4CTKA 1Y5IA 1HX7A 2ZRLA 4U6NA 4BLUA 3BE8A 1SIOA 4NOLA 1G8PA 1W4CA 5EQJB 1OREA 3L1VA 4BVFA 3F6PA 3B53X 3QVJA 5IAAA 1MENA 3BK1A 4N40A 4MS3A 1WNFA 2CHFA 2EFEB 4ZFNA 1CUBA 1M34B 2VJMB 3IESA 1R6UA 2GJ4A 4H31A 1MR3F 5AOBA 5BRJA 3D7NA 3ZIDA 3I3OA 1HMPA 1UKCA 3TW8B 1UXGA 4ZAXA 3U44A 4B3FX 1R0RE 3ESCA 4II2A 2YV2A 3EW9A 5DGCA 1YI1A 3OZRA 3L7OA 3O2QB 4NPCA 2ZT5A 5IUNC 4B5KA 2WU0A 2KI5A 2RH5A 3JYNA 2J0UB 4MKFA 5D3KA 5JCJA 3EZ2A 3ROTA 1IHDA 2A6PA 3UHFA 4CDGA 1OU0A 1XL0A 1REQB 2WIFA 1BDIA 1Z15A 1UZLA 4NMHA 2ZUCA 4KWTA 3V2UA 3VNRA 4A0GA 1H42A 1NU8A 1TM3E 4QJIA 2NZ2A 4QHTA 5IAKA 3E81A 3LU1A 5HXAA 3WAKA 3QM1A 4F4HA 4D74A 2N46A 1CS0A 5TVKA 1COZA 3QOXA 1JEOA 1K3FA 1LSUA 3SVLA 2JI9A 1X1DA 2WD9A 2W6ID 3EA4A 4BY9E 1S3FA 4UNSA 5EKSA 4BMSA 2DTXA 1DSSG 2PZFA 3FSGA 5KSZA 1W94A 1LVGA 4MWBA 1D07A 4MA5A 3Q0IA 3ZHXA 5J43A 3FPFA 4RTMA 4NENA 5EWJB 3IKTA 2LGJA 3DMNA 4PNEA 5CX1A 3T8YA 1P61B 3OZGA 1VSUA 2F3PA 4QTXA 1PJLA 4PWYA 4PZCA 3EVAA 3D5TA 7AT1A 5I7OA 4QOSA 5C8DA 1E3MA 3NTXA 2P5UA 2KWIA 1V16B 2NQ8A 2WVJA 3UV3A 4I5FA 1H4SA 1HE4A 2F59A 1NFQA 2F90A 2QHXA 4E5NA 3U5ZB 1Q74A 5FH9A 2O3JA 3NG1A 3T5AA 1SVNA 2W2VA 2L18A 1FFDA 4Q3NA 2HMVA 1RI5A 4WNYA 1VRWA 2V03A 4L6IA 3ZLBA 1GTSA 1U2EA 4R68A 3N6VA 4UW9A 2PX3A 1OZHA 1TJ3A 2A59A 3ESBA 4TYNA 5KJCA 4KYUA 4UNIA 3O8LA 1BDHA 3FCSB 4LHVA 3I09A 4FDAA 3A58B 4Y6LA 3I2GA 3S29A 4UVHA 4E5KA 2ECKA 3B60A 1KL7A 4U1RA 4Z1OA 5IH7A 1HZZA 2G4VA 1P5HA 3WKEA 4OLBA 5KNCD 1W30A 4EW2A 1FNMA 4Q7QA 1P8AA 3KTAB 1Z6QA 1EFTA 1M8FA 3IEKA 1MVLA 1X94A 1CU1A 3HCDA 2HHLA 3CNHA 1C14A 5J58A 2PRIA 2IYXA 2RHRA 1ZVQA 1C7FA 2WF9A 5JTUA 5BW4A 1UDXA 4MIYA 4CLOB 2ID4A 3AR6A 3FYSA 3OIVA 4BX8A 4MITA 5NLLA 2FZVA 1RACA 4YGYA 4DR2B 1WKBA 1RAAA 1Y3AA 1B15A 4CQJA 2FX5A 4HEQA 4Z0HO 3AR4A 5BY2A 2YV4A 5ICFA 3ZY4A 2H7VA 5FYDA 3G49A 2IOHA 1G4HA 4FQ8A 3SJUA 1SQ5A 2X6RA 4G6ZA 5CH5A 2B1IA 2NSYA 4EFNA 4BQNA 3DHNA 4YP7A 1YUNA 1WY7A 4NU5A 4BJ6A 5JYDA 3ZJTA 1GL6A 2X2EA 3GNQA 2AUMA 4HAYA 4O2AF 4H4DA 3GLQA 3ZTTA 2ZJBA 4CW7A 2BYTA 4F45A 4PFSA 4D79A 1MJHA 4TYPA 4KNVA 3X1YA 3V8BA 3ZYZA 3SF0A 1R4NB 5AI5A 2VJYA 1TQ6A 4A2QA 1A9XB 3FE2A 5ADWA 4UVGA 1TTPB 1IQRA 4KKXB 4RPIA 1CDEA 4KW7A 4EM6A 1R5JA 3CRZA 4U7TB 5ALRA 4PE5B 3ZDRA 2EGUA 1Q2XA 3G85A 3L5KA 4LDJA 4DMRA 2O54A 1E2QA 1RWPA 1UOPA 3JYQA 2ZITA 3E0XA 4JWTA 1XTUA 1JHPA 4DLXA 3CN7A 4XIGS 3WBKA 3ZVLA 3OCCA 4QEDA 4BQEA 3W8FA 4POOA 1VHWA 2ZIFA 3RJTA 2ZR8A 2G07A 4OFXA 1NN5A 3FI9A 3QKUA 1BZYA 2O5RA 6AT1A 3ER6A 2ZUEA 3UHPA 2EGGA 3CE9A 3SDZA 1G9XA 4FQ5A 4BJ3A 5U4QA 1I2AA 3ID6C 3KTOA 1P4AA 4Q3OA 4RS4A 2ZVDA 4HFRA 1K7CA 3DKKA 1M1NB 4ROSA 1KQNA 5LQRA 2H1SA 1H0HA 2C5GA 3GEMA 4LJ8A 4HQKA 1N9KA 1SKAA 1VJ1A 4Z0TA 1SCNE 4C4PA 2AOUB 4HGOA 4RIGA 3AP3A 1ENOA 2DFTA 1WSAA 3ZU4A 4DLNA 1C0IA 2NP7A 2FG5A 4MB0A 1GG5A 1GITA 5I9NA 5FPQA 1P80A 2XH8A 2XB8A 4WKNA 4FVTA 4NBUA 1O57A 3GO4A 2D2VA 2DQSA 3ANNA 1KF0A 3E3OA 1D4FA 3FHCB 4RFLA 4RKYA 1ZKMA 2ZYHA 2Q5QA 1TE2A 1Z4JA 1MJFA 4JP5A 4L4XA 1DV2A 4NE7A 5ITSA 1AB5A 3D4NA 4NATA 4YJDA 4Q02A 1GKUB 1OX4B 3NBQA 3NV9A 3FCUB 3JWEA 3O0DA 3C3CA 1KAGA 2VN8A 1CP3A 1JVBA 2NUTB 3GD7A 3OQIA 4QVGA 3KQQA 1A2BA 4PAQA 5JEEA 3NYIA 1VLQA 4K46A 3QPVA 1NQOA 5LMUB 3BGIA 3FNEA 3JQPA 4GP6A 1QPBA 4RABA 1SMKA 2AXPA 4X41A 1ZCZA 1UXIA 1UFOA 3OO1A 5CAEA 1A9ZA 3SZRA 3DFZA 3WGZA 5KVQA 4Z4FA 5JCZA 1GQFA 1U6JA 1C3OA 1TIPA 1IH8A 5H80A 5EEGA 1JQJC 1GAWA 1OE0A 4HB2A 4Q6BA 2BUBA 3EWIA 1ETHA 3F3MA 3H11B 2GF0A 4R1PA 3IIEA 5L3RA 1L6RA 2Q2QA 2B8NA 3RYFA 5HZKA 5JBNA 3IMEA 5KOJA 3K5HA 3RAFC 1QTRA 4J1NA 3UGTA 2NYRA 1HTTA 4K81B 4ZZIA 4EJ6A 1FY2A 3MCUA 3QEBZ 3ITNA 3BB4A 5REQB 4D9KA 1RJGA 5HF9A 1E4EB 1UR5A 3WYEA 3F6BX 2X22A 4QHYA 5TQVA 3MMNA 2IPLA 2B37A 2WT4A 3MM4A 4X7BA 3DAPA 4B6JA 4OQDA 4OB6A 2IP1A 3C5HA 1U63A 3V5NA 3TMAA 1W19A 2RGWA 3BERA 4D0GA 4IVRA 2IHNA 2WE7A 4QULA 1SM4A 2G9ZA 1ZN2A 2L42A 5AQEA 2DJIA 1MG0A 2YBDA 1B16A 2PMDA 4C6TB 2PMBA 1NWCA 4O0MA 2V7BA 4IBOA 1UBKS 5A1JA 4LJKA 1XXHA 2EFHB 3HLYA 4GECA 5FHQA 4BFVA 1P2BA 3PNLA 1IJBA 3U13A 1DEOA 2Q8QA 1KEWA 4ZCTA 1JHRA 1TO2E 2Z5GA 3AUYA 1Z6GA 4GZLA 5DTQA 4XVQA 1W4LA 3HDJA 1ESEA 1OZAA 4HZUA 1IDOA 2ZUSA 3UKJA 2AYXA 4GUDA 1S8NA 2ZETA 1TT5A 3DYVA 1LZLA 2JHCA 3MLEA 4R6XA 5FLEX 3WL5A 5C2JB 3U4QB 2LBPA 1DWUA 4GBGA 1NF3A 3PWSA 2B7CA 4QXQA 4IOJA 2WY2D 3Q7QA 3OEHA 1CD5A 3PA8A 1QE5A 3S40A 3K9BA 2BELA 4P7FA 1DBWA 3EW7A 1ECJA 3CX8A 3OQHA 2NO6A 1YAJA 4C29A 2ZIGA 2B4QA 3UW1A 3BFJA 2ZS8A 4DA0A 4TWIA 2QROA 1UKVY 3ZWBA 4FEAA 1DAEA 4IIVA 4AKEA 3O9ZA 3CX4A 3EOZA 1WJGA 3EXHB 2QZZA 3GN1A 1PJCA 4DCCA 3K05A 2ZU0C 1U3WA 3E3NA 4LEIA 4MX8A 1J6UA 1YA8A 4JQYA 1RYYA 3IQZA 3ZZMA 1TEXA 5KWJA 5I9MA 3SE7A 1YRAA 4Q01A 5C8XA 3T1OA 1Q15A 4Q47A 1LA2A 3UEOA 3A9WA 4EVRA 2G3YA 4B87A 1I4DD 4WNAA 4ZI2A 3PIDA 2BUAA 3KKPA 2GPNA 5IM4A 1V39A 1YVPA 4BKOA 4CM3A 5IVKA 4HKTA 1PDOA 4CM7A 4U02A 1QIMA 5MN6A 1Z0ZA 1FFHA 1MC5A 1T2UA 4XB1A 3L7IA 3PZRA 1BX0A 5D3QA 1MXFA 1NJ8A 1XP5A 2X14A 4I6EA 2DUUA 1CUUA 5UKDA 3GJYA 4RA9B 3CNNA 1UM9A 3TQIA 5BQFA 4QQKA 1QV6A 1INLA 1JIXA 4V0KA 3GEEA 4CJXA 3EXG1 4TKUB 3WLAA 3CF4G 3AOEA 3ZHSA 3QYFA 1E58A 3PNMA 2QMOA 4PPNA 3MB8A 5FTMA 2OVFA 4NMMA 2IDKA 2JJ1D 5CG2A 1QLJA 1EP9A 2JI6A 4N7MA 4DQXA 3C3MA 2HAEA 3RIXA 3D0OA 3KXPA 3ZWXA 3KM0A 3OJLA 1NPTO 2QTZA 4XLZA 5FWXA 4I1RA 3UG7A 1WM1A 3CW9A 1QGOA 4YALA 1TLTA 1XU4A 1WDMA 1CVRA 4M7RA 1GSHA 1LJ8A 1X7XB 1ZC3A 5AKZA 3U6BA 3V8NA 2BWJA 3HO6A 4CG1A 2DT5A 3WBJA 1NYLA 2GN1A 3QXXA 4X1OA 3MTJA 2QT0A 5D00A 3U56A 1X7HA 1USIA 3LP6A 2YASA 4D5GA 4Q39A 3ABSB 4PSCA 4H0FA 4YEDA 4P4GA 4BNVA 2XHZA 2MMGA 5BYKA 2H2IA 1U8TA 2GOYA 1TCUA 3LDFA 2FF7A 4C21A 4EKNB 5L3SA 3MMPA 1R16A 4GL2A 3DVAA 4WCFB 4N3GA 2ZUFA 4EI9A 2GPYA 2H0QA 3ZHOA 4WRRA 3L8EA 3SJAA 5ED4A 4EKGA 4W5OA 3F47A 3UJ3X 1T6YA 1NW7A 3FX2A 4FHGA 4IIEA 2R5WA 5CLGA 2FRVA 1QK5A 1LK0A 1VGRA 5CDTA 2WUGA 4KOEC 3DE4X 5D5PA 5AM4A 4DNXA 1Y8RB 1BW9A 4C0HA 4GL4A 1VSTA 3OEYA 4F5YA 2YFYA 3C6BA 3ONEA 2GAOA 3AJDA 4CF5A 5H4GA 2H2HA 2OHJA 1SBYA 3FD8A 3JVVA 1U0FA 4XDYA 4DLLA 2GS9A 1H8EA 3QP9A 4JXXA 3C7KA 2QGFA 3HR4A 1FJ2A 1XA3A 1DAGA 2G06A 3MB5A 2R8OA 2WM2A 2WTMA 3JZMA 3PXAA 3QLJA 1VE7A 1Y82A 3L79A 4JGGA 4DG8A 3RRYA 5HVNA 1AKUA 1XXHE 1PJRA 4KIWA 3HQ4O 1THGA 3GUYA 4EWLA 4YMVA 3E8SA 2R4QA 1XZDA 4LZWA 1TYBE 4QXOA 4Q3DA 3LHDA 2A78A 2JEZA 1LH0A 1R88A 3B3JA 3DAOA 3RVQA 3UHJA 2UYOA 1G3IA 1JQ3A 4MHOA 1ODJA 4YECA 1A5BB 3H3FA 5G1PA 3CKYA 1DELA 4JLDA 3SPXA 2O2GA 2CKMA 4REMA 2ZFUA 4V3CA 4NX2A 4BNYA 5LFAA 1K1EA 1NDQA 1OWMA 4JY7A 4TTJA 2C8VA 2PZKA 1ZK4A 2UVQA 3K1ZA 4Y1EA 3ST7A 1GQOA 1TAUA 2Y0EA 3A0UA 4J4TA 4GKJB 3H16A 1LTHR 3OQPA 1EM8B 1N2XA 4WKGA 1O0BA 4PO9A 5MF6A 1QHIA 1DRKA 3VU1A 3KD3A 4BB0A 2EJBA 1KVQA 4XX0A 2ZBUA 3DEZA 4GZ3A 4G2TA 3N8NA 4JU9A 3W1EA 1XD9A 5EMMA 5FNVA 2HDNB 1HE2A 1K27A 1P4RA 2GPBA 2VPIA 2WSSD 3LBYA 4HMPA 8MHTA 2W00A 4FDLA 1J9ZA 3VR4H 4HPJB 3GGDA 5LSAA 2IE0A 1JHXA 2R8RA 3IKMB 3RYTC 3RS5A 3TZCA 1PWEA 2JVJA 3U4HA 1QP4A 5K4AA 1Y9JA 1ZUIA 3SC2B 4TYWA 2QRPA 3UTDA 1J0CA 4KLAA 3WB2A 3D9QX 5F76A 3RU2A 3N2GB 2AOUA 4QJBA 1L5MA 2GBLC 3D6UA 3PBKA 4JFRA 4JT4A 5GWXA 3LAWA 2CXQA 1H3NA 4PC1A 3RKRA 1Z9BA 3G9ZA 4XUEA 2HNKA 3HDTA 3LHSA 6LDHA 5LMCA 2IH5A 4U7JA 1DC6A 4Y2PA 3TIFA 1NBEA 2QRMA 4C3ZA 4BU0A 3RKUA 2V8BA 4CMBA 5ITWA 1LTKA 2C3MA 3H1FA 4RU1A 5L45A 4QDJA 4XTCS 3NM5A 3RT7A 3TLBA 1ZOSA 1BFUA 5DBHX 4RIHA 4F8EA 1WS6A 5LZ8A 4EUFA 5JO0A 3RHTA 3HL0A 2FPLA 4TLAA 5CD9A 1U3DA 2ZDGA 3L4KA 5DISB 4MICA 3WJ1A 5HDQA 1HNXB 2O1SA 1YL7A 2IW1A 2W11A 4TWZA 5C3UA 3PX7A 2O6LA 4IINA 4NBWA 1P91A 1WETA 1QNLA 3D02A 3H5VA 3W79A 5JU6A 3WTBA 4DYHA 4DMMA 1G38A 1DADA 2C9YA 1SOAA 2G72A 3MILA 2FHPA 1TU0A 3DNPA 4G65A 3DZBA 4IJUA 3ZN2A 4Y2UA 5B12A 5B1SA 1KRHA 1XAJA 4BVJA 5AFSA 1VB5A 4MMXB 3CR8A 5T4FA 3G2OA 4KPUB 3KXKA 3ZC3A 4FTWA 3CZ5A 1QIJA 2UYYA 3ZLJA 1Y3HA 1UXHA 1ZUNA 1I4TD 3RVRA 1EJ2A 1NBWB 2JGDB 4XIFA 4DT1B 3UB4A 2ZW9A 1AV7A 2G8LA 4CR8A 3PQEA 3F71A 2SCUA 3CXUA 1TZMA 3DV9A 1CF9A 1UC8A 3O4IA 4LVNA 4WLVA 5DHPA 5DLQC 1VCMA 4C0SA 1VCOA 3AIIA 3EF0A 3G9QA 3ZWPA 5AW8A 2XRYA 5FD8A 1ZK2A 4FOLA 1VXOA 1X8LA 4IDBA 1MNAA 2P5YA 3KEQA 3EIHA 4YV7A 4FZRA 3KYDA 5EIOA 3L7KA 2XCRB 1CJSA 2ZJ8A 2RJOA 3RAGA 4UTZA 3BORA 1FNBA 1LV7A 4M1TA 4N49A 2A5FA 1GFSA 4KO3S 4U2GA 2ZTLA 1QX4A 3FKQA 1ULZA 3EVGA 4HH1A 5CT5A 3AM5A 4QBGB 4CQMA 5B3JA 1U04A 1VJRA 3GEPA 5EC8A 5IPFA 3IUBA 4C88A 4B3DA 1CNMA 2XBUA 1NLUA 4HDKA 2OECA 1JSXA 3NDJA 4F4DA 4PX2A 4RKRA 2GWHA 1WCWA 3V4OA 2VDVE 3I0ZA 2UVPA 1PEDA 5KYUB 3GGSA 1YGPA 4G0VA 1AURA 2AMLA 1PL7A 5AR1A 3EQ6A 2G7ZA 4UE3S 5ADVA 2NO1A 5CEFA 3K9CA 1V95A 1H9AA 5DLYA 3UK2A 5JQGB 5KO2A 3K30A 4M8NE 5CFRA 1K8QA 1U0NA 2J07A 3E4CA 2QU7A 4CIYA 4HPWA 2ZEJA 1YB5A 4N5NA 1BA2A 2A33A 3GJ7A 2JZNA 1V45E 3BZWA 5LLSA 1WB9A 1D03A 1JL3A 2ACWA 1TM5E 3IHLA 3OETA 3RUAA 3Q11A 2BE9A 2EBWA 2JIPA 4ZQCB 3GNTA 3QVVA 2PIDA 4WVFA 2XA9A 2RGAA 3NM6B 3WSWA 2FDXA 1C9DB 3P9IA 3QZUA 1L5WA 2QN6A 3HB9A 3AFGA 3RS7A 5J4VA 5FO1A 4S12A 5CVDA 1VPVA 2QN7A 4R5MA 1CJUC 1A71A 2H07A 4XPIA 1CY8A 2I1LA 3JWJA 2ZT8A 1GNPA 2XX3A 3BM5A 5DULA 4YDRA 3GCXA 5JASA 3KYCB 4X66B 5P8WA 3MPUA 7MHTA 1C9NA 1PVVA 1HKUA 2VSYA 5KNCA 2APJA 1RQLA 1WXHA 2QX8A 4HNGA 1O94C 1HQDA 1AK2A 4CLRB 1XK6A 2MMCA 1SWWA 3HB1A 3MNFA 3NNDA 3ZVNA 2AFVA 2OSVA 3M1LA 4ASUA 2D0IA 5AW7A 1R12A 3F5DA 4UHKA 2WG1A 2NVUB 5CCXA 2M6LA 3N74A 1WXDA 4O02B 1YCGA 1JSZA 3PNOA 1LXCA 2H5IA 2OZEA 4JOCA 3DM5A 4D6YA 4RZXA 1YHNA 4Z3KA 3D7RA 5JNVA 1Z08A 1LNQA 4AN0A 1IJKA 3K2QA 3L9WA 3BRCA 4CWAA 3NIWA 3THOA 5EJ5A 2V5VA 1COWA 1PFUA 2IX3A 3B5JA 5AM1A 1D8AA 1RC1A 3DZJA 2UDPA 4ZDKA 6REQA 4PLGA 4DL9A 2WC1A 1ZONA 3JTEA 4EITA 4RDXA 4Q1AA 2B4KA 2I6FA 2QBYB 3CBGA 1BX1A 1F7VA 2OC9A 4C7JA 2UVPB 2NO0A 4XUGB 2I66A 1UMBB 1Z6PA 1WO8A 2WK1A 5ECWA 2VH5R 4UDNA 1Z36A 2HQBA 1HEIA 5F2KA 3TJZA 3QEAZ 3AHGA 2BZGA 3JQ8B 5AI4A 1Q11A 3EIWA 2QY6A 1E1NA 3LA8A 5DGDA 3KZCA 4UHFA 1ST3A 4A03A 3NOQA 4F84A 5EXEA 5COAA 4X62B 1U7DA 2WTAA 2VAWA 3AGPA 1DIBA 1USKA 3BSFA 2RKOA 4Q1DA 4OQ4A 4YRSA 1IIBA 4BNZA 4QUBA 3DOHA 2BUCA 2CXNA 2FB9A 2EFYA 3G2MA 3R5SA 1YU9A 1SIUA 2GRAA 2Q28A 3IAEA 3O4VA 1SQGA 1E8MA 5DM1A 3SC2A 1YI8A 1V6CA 3BDAA 3NYRA 1BXRB 1W9MA 3G88A 4JASB 1LBHA 1HOXA 1XZ8A 3EF3A 1PWXA 5GJVC 2PGLA 3S5JA 1ST2A 2V3VA 2HW8A 2XBLA 4G01B 4EBFA 5EJEA 4OSPA 1EWVA 2HHJA 4D9HA 2WJWA 3CPJB 1CQWA 3Q98A 1NRJB 1TO1E 4BLSA 5BWOA 2HSEA 4QOFA 5KX5F 3NHWA 3KSBC 2GO7A 3TS1A 2BBSA 3DVQX 2NTYC 1SXQA 2ID7A 3SZGA 4CTNA 3G0BA 3MJ4A 4O4LA 4CM4A 1CY7A 2VYCA 3M5CA 1Q1AA 4KXMA 2VP0A 4AYWA 4QXRA 4PTYA 2HU8A 1W0CA 4D5EA 1XMVA 5JHGB 2FPSA 4JOSA 1P2UA 4PRKA 1LLDA 3NRJA 3HKDA 4P33A 1P17A 2JFHA 2X19A 4YDSA 2OZPA 1PR3A 1RAGA 3HVUA 4IDAA 4D02A 4Q7JB 3WGKA 1OBHA 2HY7A 1KK3A 4Q3LA 1RXWA 2HBQA 3CO5A 3I9MA 3Q0TA 5HIAA 1J2RA 1FBTA 3KAQA 5LBTA 5K99A 1CETA 2VHWA 4F5DA 3PI7A 4IDDA 2EF0A 4JLKA 4OX9B 1EK5A 4MVJI 3IALA 4B6PA 3WE7A 4YCLA 4NJEB 3O4FA 4DIUA 1XE3A 5CNKA 3JQGA 1UIMA 4I50A 5ULLA 3ELBA 4O6VA 1FU8A 1KSFX 2W2KB 3DBLB 1G8HA 2JI8A 3MGGA 1PI3A 1DQRA 2RH4A 3I2HA 3LT4A 2JJ8A 2IY7A 4IJWA 4KO8A 4AD8A 5BV1A 1X74A 3EVFA 4OBEA 1OI4A 1N36B 4G63A 4G3XA 3CEAA 1I4OA 3KU4A 3TSCA 4EI2A 1T0UA 1NKSA 1P1IA 4RHTA 5CX4A 1DTEA 1JXMA 2Y1FA 1TA9A 1OBCA 3ICEA 1XNJA 3JD4A 3Q2KA 5GAJA 3V2IA 3NC4A 3M4YA 4QGGA 7GPBA 4LCEA 3JAKA 4G0UA 2YRFA 3PX3A 4DC9A 1QKJA 1DEXA 4DC0A 3SSOA 4GP7A 4ZC1A 3L82B 2I80A 1TKAA 1RBQA 1DT3A 2XD4A 3JW8A 2WV9A 4B85A 2XA1A 2WWIA 1M1YA 3B78A 1V6SA 3NBMA 4PZYA 5BYJA 4OXXA 1ZA2A 2V9ZA 2AF3C 5E3IA 1EG2A 2PSDA 3I73A 2FW1A 3FDZB 1RJEA 3DHWC 1E3WB 3DO8A 2K4MA 5HKKD 4ZYWA 2GILA 2BKAA 4WE3A 5IK2A 4M1EA 1WXFA 2JH8A 3E5NA 1ZUHA 5AOCA 1IPEA 2G9QA 4DC1A 4EGSA 5L4SA 1C3OB 2UU9B 1NW9B 1XKLA 4AMGA 4KXFB 3RFCA 2XRZA 1LPBB 3CIOA 3EDYA 3GA0A 3L1JA 4WD3A 3COPA 9GPBA 5AKXA 3RTBA 5HQ3A 2CL6X 3AZOA 1QVZA 2CVFA 2DWUA 2MSKA 2BISA 2YS6A 1IIRA 3E3LA 3JVEA 1Z39A 2XHEA 3S7ZA 2EATA 3OHSX 1SZCA 1L6IA 3AUUA 2GBGA 2V0CA 2XUHA 1E20A 1M8PA 1Y3CE 3WIBA 5BN1A 4JL5A 1E92A 3HI6A 4KO2S 4KQHA 2ISSD 2IZ0A 3K15A 4DA9A 2AN1A 2IOFA 2WD7B 3PQ8A 3VZRA 2RHLA 2QRHA 1FTQA 2QR2A 3KZOA 3U3RA 3EG5A 4XYEA 2PLRA 2Z1MA