4QWNB

Histone demethylase kdm2a-h3k36me1-alpha-kg complex structure
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
b'QVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELASSDPKLALTGVPIVQWP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 2A
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/structural protein
total genus 19
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4qwnB00
4QXCB 4QWNB 4TN7B 4QX7B 4QXHB 4QXBB 4QX8B
chains in the Genus database with same CATH superfamily
4L9IA 5JRCA 4EIWA 3Q9DA 4I55E 3QB5A 2WMNA 3AEBA 4HWDA 4YHHT 4QXHB 3N9OA 3E0ZA 2CE7A 1Z0PA 3AEDA 3LK42 1FMWA 1VOMA 1UURA 4HFHA 3L39A 4DR1T 4MALA 4HGAA 4QXBB 2YOEA 3P8CD 2ZM0A 3KV6A 1KK7A 2FJDA 4HFIA 3I9YA 1HR0T 4NUUA 1GQEA 4AQFA 3JC6C 2SPCA 4NXMT 4DR2T 1IJ5A 4JI5T 1J5WA 4UXNB 2ZM2A 4ILAA 3N9NA 3SFEA 3AE2A 2W62A 2H7VC 3F31A 3RIUA 2IW5B 5L3CB 2XHEB 2XQ4A 5HXCA 2NW8A 3PV0F 2IIUA 5IUXA 2A2FX 2VKDA 3UFGA 5FXWA 4IT4A 2Y48B 4K0KT 1N34T 3ONLC 4OX9T 4HTEA 4Z90A 3DTOA 3PUVF 2X68A 5ABFA 3AAIA 2WBLA 4MLKA 3FZLB 4A97A 2DL1A 3PE0A 3Q5XA 3AECA 1FIOA 3O1IA 2IC9A 2PG8A 2M67A 5JR9A 4EGWA 1XNRT 3L3PA 3HKCE 2XQ7A 4H63H 4ZZCA 2VQET 3UUBA 5L3EB 4IREA 2LLYA 5KDMC 5FXXA 4QX7B 3LBXB 4HWCA 3C98B 4U3CA 3ZEFB 3ZC1A 4U2YA 3ANWA 3MKDA 5LMNT 3RIFA 3T8OA 3AXJB 2HHHT 2E9XD 2E9XA 5IYZE 4DMWA 3X1DA 3RPUA 4OFZA 4GOUA 4TNWA 2NP9A 1HNWT 2UUBT 5BR8T 2X51A 3N5LA 2Q9QC 2QGSA 2XTLA 2X0YA 5JH7E 2WWUA 2BS2A 4LMKA 4EZHA 2FJBA 2HN1A 2J1DG 4X20E 3PUWF 5ABHA 2V5DA 2XAQB 2BBJA 2LKGA 3UUNA 4ZI2C 5AQFB 2C5JA 5FMNA 3NZPA 3RC8A 2X67A 3UU5A 4WBNE 2BVLA 1XNQT 1M7KA 1ZEEA 1CHUA 1UX5A 5AQKB 4DV2T 2F4VT 3NKZA 5LOVE 4C90A 1D0ZA 2WY2A 2BG9B 4HKAA 5LHHB 2CWYA 3CVRA 2HPJA 3ABVA 2NR4A 2MYSA 3AEEA 5L47A 4HWIB 3EABA 2WM9A 5LBMA 5LP6E 2YEVC 3NZQA 5LG4A 2ACXA 4NIQA 4YSZA 3ZSTA 4DR6T 3R84B 3PUZF 1I6ZA 4ERRA 2DWKA 3VU7H 4KP3C 1MMDA 5DQWA 4HE8A 4MFRA 4QH5A 4I50E 5KX5E 2I6HA 2NTYA 3PUSA 3UTKA 3EDUA 3UFEA 5LG3A 3SWHA 3JCFA 5HYAA 2NW9A 1BR4A 4GIWA 3HKEE 4E7SA 1YD8G 2V7IA 3RC3A 3OYXA 5LCYA 3H3MA 4UF0A 4EEDA 4E7ZA 5J2UE 2XY8B 4X1YE 4U72A 3BQKA 3ZT7A 3E22E 3V5SA 4LF6T 4U33A 4YJ2E 4QWNB 1DU2A 5HWXA 4HFBA 3WAJA 3RX6A 3MA9A 5HEUA 3LDQB 4BAYB 3EVYA 1WYCA 2ODVA 4QH1A 4O2AE 4NUVA 2YN6A 2CCQA 3V5UA 1W09A 4DR5T 3RIAA 4AQYT 3ONJA 2LOSA 5FY0A 4JBWF 1OXZA 2CWOA 3HI2A 4YLHA 1T8BA 3M65A 2LSJA 2EHOC 5AQJB 3AAAB 3P4QA 3A5XA 3QB5K 3QK6A 1OEDA 4KHZF 1H7CA 4LF8T 4DR7T 1SA0E 4YHJA 3O1HA 4KX6A 4K0UA 2JIWA 4PK4A 3AE5A 5JDGA 2CMRA 4JI0T 3OYZA 4HFDA 3JAFA 5IWAT 5EK4A 1MIYA 2PFVA 5CJ5A 4EYYR 3PJAJ 2BG9E 3N9PA 5LB7B 4GK0E 3FHNA 5AFUL 2Q9QB 5L3FB 4DV4T 3EDVA 4TWFA 2CXFA 1U5PA 1X9BA 3GA8A 5LGUB 4CXWA 4EYUA 4PJMA 2E8IA 1UCUA 3T1YT 3B57A 4UELA 4H9SE 5JDNA 3TLWA 2WZHA 4L5GA 2MTQA 2CA5A 5AQHB 3ZN0B 2YK0A 3ZYKA 1NENA 4U7YA 3K3QC 3B13A 5EK3A 5ABEA 2K48A 2XAJB 2WWVA 3LBXA 2WP9A 3PUGA 4OYKA 4KI0F 2VVSA 5KXJA 1KF6A 2V6YB 4A98A 1XDPA 1WRDA 4U7IA 1FMVA 2YU2A 2LSYA 3P4PA 2IDOB 3FZFB 4JI2T 3C50A 3OPCA 4P0BA 4H9OC 4ZI3D 4H9PC 3ZMZB 3ZT5A 4JV5T 4DUYT 3CPZA 4IDQA 5LNKA 4DO0A 1XMOT 2W63A 5AQMB 2C5KT 5A1LA 2BKNA 4WW0A 3A8YC 3EI0A 4ZEYA 4QH4A 2ZLYA 5FY7A 3M3ZB 3IHRA 4OHFA 4P09A 1NWMX 2BG9A 3KBUA 4IDPA 1VRBA 1HNZT 2XPKA 4IE4A 2OLTA 2X9XA 5AQRB 3EAMA 3VR8A 4H9QC 2H89A 4IE5A 4HWHA 2PBIA 5LBQB 1Z8UA 3AEGA 2WAUA 2JMKA 2K3WA 5J1GA 1W9RA 2DHRA 3AEFA 4FI5A 3Q2MA 2E5VA 4PAGA 3AVRA 1WR0A 3FBLA 4QX8B 1FJGT 2M6BA 4AQFC 2VB6A 1IBLT 3P4WA 2ES0A 2VL0A 3AE7A 2XASB 3BQIA 4MHCA 1E2AA 4C91A 2FUPA 4IGUA 5ADXL 3CK6A 3L8RA 4H9RC 3I0QA 3K8PC 1LKXA 5EK2A 2OV9A 3RIUC 3WI3A 4PK6A 4GYRA 2LJLA 2BDEA 4LMLA 2X9HA 3CX8B 3GWHA 2ZMAA 2EHOB 3ZSSA 3AE3A 2CBJA 4DIDB 2KWIB 5FXVA 3UU3A 2UXXB 2XQYA 4F8HA 2NWBA 5CA1E 1L0VA 4HEAA 5LA6E 5JDMA 4LF7T 2PJQA 4LMJA 1UK5A 2QA7A 4UVAB 3AA0B 3E08A 5LHGB 2KSRA 2MPKA 2V8SV 4EXTA 2XAFB 5JR9C 4EZ4A 2X9YA 5F5WA 2XUEA 5TAOA 3DJBA 3C4WA 4HFEA 3EUHA 4Q25A 2JRKA 2V7MA 4A56A 3DP7A 3RQWA 1XWMA 2C5IT 1HG5A 3OTOT 5AQLB 3Q5WA 2LSGA 5F8PA 5LGNB 4I0UA 4M1PA 4DR3T 3HL6A 1UGOA 4AKRB 2E9XC 2CXLA 3VHLA 2JQQA 4L0RA 4U31A 3JAEA 1LVKA 2N1GA 3CQGB 2QRXA 4ISTA 5C8YE 1D0YA 2YINA 4JYAT 2K9AA 4MBQA 2L3LA 2FBWA 1UUSA 4IDZA 3FBZA 1IJ6A 3QNUA 1WCRA 2CBIA 5J2TE 4CZZB 2IHR1 1KEYA 2V1DB 2UXBT 3OJAA 4X1IE 1E1HB 5ABGA 2LRLA 1XMQT 2XQ5A 3TKLB 3FXDB 4TV9E 2W66A 5HCMA 1LRZA 1T7SA 3CQCB 4PJJA 5FXZA 2D9DA 4TWDA 3CMLA 4NPPA 3CX6B 2B76A 1XZYA 3KDSE 4YTNA 4DV3T 4TNVA 1FEWA 2HN2A 1G8XA 3JADA 2NOXA 4AISA 2ACZA 2JQKA 4LF5T 5ETWA 3QC9A 3ZPOA 4CN4A 1D0XA 2MAWA 3RH3A 1S35A 3LK2B 4DNDA 2XAGB 5DQVA 2BS3A 4B3RT 5J0ZA 2UXCT 1YW0A 3N9QA 4PJNA 4IE7A 4IHJE 1D1AA 1WFDA 3N2GE 4YY3T 1XDOA 2XSAA 4IDNA 3LG7A 4U2ZA 4KUMB 1WLXA 4YSXA 1AJ3A 2N2NA 5AQUB 4OYJA 2UUAT 3UT5E 3KV5A 1J1JA 4O4IE 3AEAA 2JMHA 1IBMT 4I4TE 4HWFA 5L3BB 1SE7A 3IBPA 2MOZA 4CI1B 1MNDA 4KBMB 2G0UA 2CPTA 4G63A 4JEUB 2LOPA 4IDOA 3P50A 4GKJT 2CEAA 5L3GB 1HTJF 2WU5A 3VKGA 2XM2A 1I94T 4P1NA 4PFOA 2WCAA 1T72A 2L9QA 1V9DA 3PJAA 4JI7T 3MJXA 4IE6A 2BKPA 1HS7A 2V26A 2IUBA 4H63V 1QLBA 3CKDA 3P7IA 2FJAA 4O4HE 1KNZA 5H6QB 3MACA 5DABA 2E2AA 3C4XA 5JR9B 3ZMUB 1SHZC 2ZM6T 3O9XA 5L4EA 1OEDC 2XZEA 2RPAA 2VWAA 4TUYE 4UV8B 1HX1B 1X79A 4WNKA 2A9UA 1IZNB 3ANWB 2H7OA 3SS1A 3ESLA 1HNXT 3SFDA 1D1BA 3P4SA 4X5TA 2E9XB 4H9NC 3GN5B 1ZV4X 1KNRA 3C4ZA 4TV8E 4DV1T 4JI6T 4ILUA 4X66T 2X0HA 3PUAA 4WZXA 2V5CA 4ZS3A 3MK7C 3C51A 3AA6B 5CFBA 5FVLA 3F57A 3IA3A 5HCJA 3RYCE 1YKEB 2XQ8A 1Y01A 4WYVA 4LF9T 3ZKRA 4ILCA 5DJQC 1YQ4A 3ZMTB 5LJMA 2KLQA 2YKSA 3VRBA 2PTFA 4YT0A 2D2SA 3N2OA 4KMCA 2P9BA 2KNDA 1EZ3A 3AE1A 1ZOYA 1US7B 3RGLA 4UV9B 2D0TA 2XM1A 2I0MA 4IIJE 4EOZB 5FYMA 2XQ9A 3AE9A 5C2TA 1QUUA 2V7LA 4PJLA 3I9WA 2DNXA 1M62A 3UUXB 3AXJA 4B3ST 3HA4A 3KVBA 5CB4E 4CI3B 3F2EA 5KMGP 3OBVE 4XBFB 4ZI3C 2V7KA 5FVKA 3W15B 2W00A 2DCFA 2UXDT 3TLTA 1N33T 4ZS2A 4O4LE 3QOFA 5CA0E 4CXXA 4DBQA 3TLUA 3UUMA 1SUMB 2LRKA 3UU6A 3KV9A 4UR9A 4HFVA 1ZHCA 5E0OA 3G06A 3NVOA 2ODUA 4DV0T 3ZLIA 4JI1T 3K3NA 5AQIB 4AI6A 4EV6A 3RKGA 2J47A 2BG9C 5FKYA 3VKHA 1B7TA 5LGTB 3NBXX 1ZP0A 4O8SA 4LF4T 4UF0B 3FZMB 4UVBB 3KINB 2NTXA 4DR4T 3PU3A 5LJNA 1MIVA 5HXHA 4BA9A 2CXDA 4BJNA 5F3JA 4LFBT 2KT9A 4OK0A 3N9MA 2X66A 1CUNA 1OWAA 4UEMA 4JUYA 3T1HT 3PUYF 4FJOA 3K1SA 2JPFA 5AQNB 5JDHA 3KV4A 2CLYC 2J4GA 3EHZA 5HEOA 3I0OA 2CRBA 2BZBA 1N32T 3AE6A 5FL0A 1MNEA 5HXEA 2W0GA 5HAXA 3AE4A 4N78D 2I59A 2M6IA 2V7JA 1G73A 2LKHA 2A3DA 3RYHE 2OA5A 3U78A 1BR2A 4X65T 3RQUA 2XSBA 3UU8A 2RA1A 4IL4A 2LEHA 1S94A 3B5MA 1OEDB 3AAEB 5AQOB 4PK5A 3D0TA 3BQLA 3JC6D 1BR1A 2W2UA 3U3IA 5C3JA 3K3OA 3UULA 4QKNA 4I43B 3ZJ2A 3UQ7A 2WQYA 2NW7A 3KVAA 2W67A 4PNIA 4ZOLE 1NEKA 3RRCA 2YDSA 4DMVA 2VVNA 4COFA 4DUZT 3GMIA 4KHPT 2WDVA 3ZT6A 2LSKA 5FL1A 4JI3T 5HEHA 4CQIA 2BS4A 3OKQA 3ZN1B 5L2LA 1IAPA 2J62A 2UXNB 4EEBA 4GK5E 4B6XA 2DI4A 4AXPA 2YDQA 5GONE 3S4UA 3ZCIA 3NRXA 4GYSA 5JDQA 1HG2A 4ZZBA 4DBRA 2UU9T 2B1EA 3UU4A 4UIGA 3ZYLA 2HPLA 2UUCT 2KZ7B 3BK9A 3O1JA 4UVCB 1Y64B 4CN1A 2XQAA 3AB3B 2K5BB 3GN5A 2C0SA 2VURA 3PUXF 1BR0A 2WSSV 5AQTB 4U74A 3Q5EA 3MXZA 5L4HA 4YXDA 2KMFA 1HX8A 2Q9QD 1WYBA 3H37A 2Q9QA 3LJCA 3FZKB 2WB5A 2YU1A 4P0AA 4IL9A 2A72A 3Q5DA 5JREA 4AKHA 3TLSA 4ZI7E 2LHNA 4LFCT 4BJMA 4ZI2D 3H3AA 4JLEA 3TLVA 3RLFF 2FJEA 5JRCB 3ONXA 3CIRA 2XJ7A 2BBHA 5AQGB 1MMGA 1E7PA 3VRAA 2KINB 3CX7B 5HEJA 2CHNA 4ZHQE 3J9X1 2LM9A 2V6YA 4EB6E 1VCSA 1N36T 1YXRA 4ISSA 4AKLA 2X9WA 3ETVA 4LFAT 4TX5A 2X0LB 3ZCJA 1YKHB 2IAKA 4JEHB 5LMUT 1OEDE 3FXEB 2GK9A 4J2CA 5AQSB 1QSDA 3AE8A 1KFYA 5AQVB 5FY1A 3IEEA 2CLYB 4F6RC 3C64A 3UQ4A 1W0AA 5JVDE 3I1AA 4EAHA 3PURA 5IHYA 4IE0A 2D0UA 4XZCA 1JNZA 2LHRA 4YSYA 1HFAA 1JNRA 1NAFA 2VQFT 4DVDA 3AVSA 3O4XE 4YTMA 2VKOA 5HWYA 4DV7T 2Y6XA 5BMVE 3OVUA 2Y8DA 4ANJA 1MMNA 2AE9A 2AXDS 3MZKB 4QHOA 4ASKA 4YTPA 2V6XA 5FP3A 5AQPB 1T98A 1MIWA 5AQQB 1J5ET 3RYFE 4AKIA 5M4YA 4XAXB 3HKBE 3LFMA 3FZHB 2ZM8A 4HN9A 1VCTA 2LT3A 1U4QA 5ABFB 3A7MA 2JJ9A 3N2KE 1HF8A 4QXCB 2WZIA 2WU2A 2XQ6A 3ZJ1A 2CM0A 3WAKA 2WMOA 4X64T 2VKJA 1O3XA 4WBOA 3PU8A 3SRZA 2Z6EA 4ILBA 3FB2A 3HR0A 4A5XA 3N9LA 3VR9A 4DV6T 2W4XA 4Z8XA 2RP4A 5HEGA 2VK9A 3RI5A 2LM2A 1W0BA 5HXSA 3IF8B 5JTGA 4AIUA 2R6GF 2EHOD 4YJ3E 2EHOA 4ZXLA 3L09A 2H88A 2LE8A 4TZ4C 4CN6A 3NRYA 3PDYA 5L3DB 4O4JE 5CGMA 4TWHA 3RHWA 1HCIA 2DWGA 2LSIA 1MMAA 4V1Av 3LK3B 3J7Yq 1KNPA 2JQHA 3RF1A 2QVAA 4YFSA 5JQGE 3RKOA 3NWIA 4GKKT 2KXPB 5HXRA 2K24A 4PW8A 3AA1B 3ZC0A 2YDRA 2H3RA 4JI4T 2IMLA 2BVMA 5LHIB 2XQ3A 2VKHA 4CXYA 5H6RB 3RRWA 5LXTE 3CWZB 4B3TT 5JDLA 2WDQA 2KWHA 1LVFA 3KBTA 4PFPA 4Z91A 4HFCA 5JDFA 3PTRB 4O2BE 4X62T 1WR6A 1ZKEA 2QYWA 1IBKT 1UX4A 3R6NA 4AKGA 2HH7A 2D5UA 3P4RA 3HKDE 1YQ3A 5EZYE 3AA7B 4DV5T 4TN7B 3ZMVB 3ETUA 5LYJE 1R8IA 2E5LT 3ZMSB 3SOLA 2VASA 3QUJA 4JI8T 2IC6A 2VL8A 4G2AA 1D1CA 2CHOA 4CI2B 2WDRA 5FNVE 3PUQA 2XAHB 4X1KE 2WS3A 2DLRA 2L8KA 3LSVA 3ZYMA 2W61A 2N9DA 3RYIE 2BKOA 4NXNT 2JQ9A 4AQGA 4B3MT 3CQXC 3KFWX 2MBGA 4ADZA
chains in the Genus database with same CATH topology
4L9IA 4B6XA 5EK4A 2DI4A 4AXPA 1MIYA 3LG7A 5GONE 4KUMB 2PFVA 3S4UA 1WLXA 5JRCA 4EYYR 1AJ3A 3ZCIA 2N2NA 3N9PA 3NRXA 4GYSA 4OYJA 4EIWA 3Q9DA 4I55E 5JDQA 1HG2A 2WMNA 3UT5E 4DBRA 4GK0E 3KV5A 2B1EA 3FHNA 5AFUL 2Q9QB 5L3FB 3EDVA 4O4IE 2JMHA 4QXHB 3N9OA 4UIGA 3E0ZA 3ZYLA 2CE7A 1U5PA 2CXFA 3GA8A 1Z0PA 4I4TE 4CXWA 4EYUA 3LK42 5LGUB 1FMWA 5L3BB 3IBPA 2MOZA 2HPLA 4PJMA 1VOMA 4CI1B 2KZ7B 3BK9A 1MNDA 2E8IA 1UCUA 3O1JA 4KBMB 3B57A 2G0UA 4UVCB 1Y64B 3AB3B 2K5BB 4UELA 4MALA 4G63A 4HGAA 3GN5A 2C0SA 4H9SE 5JDNA 4QXBB 4JEUB 2LOPA 3P8CD 2ZM0A 3KV6A 1KK7A 1BR0A 2WSSV 4U74A 4L5GA 2MTQA 2CA5A 2CEAA 5L3GB 3MXZA 3ZN0B 2YK0A 1HTJF 3I9YA 3ZYKA 2KMFA 3VKGA 1HX8A 4NUUA 3K3QC 3B13A 2Q9QD 1WYBA 5EK3A 3H37A 4AQFA 2K48A 2XAJB 3JC6C 2Q9QA 2SPCA 1IJ5A 3LBXA 3PUGA 4OYKA 4PFOA 2L9QA 1V9DA 3LJCA 3MJXA 2YU1A 4P0AA 4IE6A 4UXNB 1WRDA 2A72A 1FMVA 5JREA 1HS7A 2V26A 4AKHA 2ZM2A 2YU2A 2LSYA 4H63V 3N9NA 3CKDA 4ZI7E 2LHNA 3P7IA 3C50A 2W62A 4BJMA 4O4HE 4ZI2D 1KNZA 5H6QB 3H3AA 2H7VC 3MACA 3F31A 4JLEA 4P0BA 5DABA 4H9OC 3C4XA 2IW5B 5L3CB 5JR9B 2XHEB 3ZMUB 5HXCA 1SHZC 4ZI3D 5JRCB 2NW8A 3ONXA 3O9XA 4H9PC 3ZMZB 2A2FX 2VKDA 5FXWA 2Y48B 3CPZA 2VWAA 4TUYE 1MMGA 4UV8B 5LNKA 4DO0A 1X79A 4WNKA 2W63A 2KINB 1IZNB 3CX7B 3ANWB 4HTEA 2C5KT 4ZHQE 5A1LA 3J9X1 2H7OA 3SS1A 4WW0A 3ESLA 2LM9A 4EB6E 3DTOA 1D1BA 2X68A 4ISSA 4AKLA 3AAIA 2WBLA 2X9WA 3ETVA 4MLKA 4TX5A 2X0LB 2E9XB 4H9NC 3ZCJA 3GN5B 1YKHB 1ZV4X 2IAKA 2ZLYA 3PE0A 3Q5XA 3C4ZA 4JEHB 1FIOA 3O1IA 2IC9A 3FXEB 2GK9A 4J2CA 2PG8A 1QSDA 4OHFA 3IHRA 5FY7A 4TV8E 2M67A 4P09A 4ILUA 5JR9A 5FY1A 3IEEA 3L3PA 3HKCE 3PUAA 1NWMX 2CLYB 4H63H 4F6RC 4ZS3A 3MK7C 3C64A 5L3EB 3C51A 3KBUA 1VRBA 3AA6B 4IE4A 5KDMC 5FXXA 5JVDE 4QX7B 2X9XA 3I1AA 4EAHA 3PURA 5IHYA 3LBXB 3ZEFB 3C98B 3F57A 4H9QC 4IE5A 4IE0A 3ZC1A 2D0UA 2PBIA 4XZCA 5LBQB 3ANWA 3RYCE 2LHRA 2WAUA 1YKEB 3MKDA 1HFAA 1NAFA 2JMKA 4DVDA 5J1GA 3AVSA 3T8OA 5DJQC 3ZMTB 2DHRA 5LJMA 2KLQA 2E9XD 4FI5A 3O4XE 2D2SA 2E9XA 3N2OA 3Q2MA 5IYZE 4DMWA 2VKOA 4KMCA 2P9BA 5HWYA 3RPUA 2KNDA 1EZ3A 2Y6XA 4OFZA 5BMVE 4PAGA 4GOUA 2NP9A 2Y8DA 3AVRA 1US7B 3FBLA 4ANJA 4QX8B 1MMNA 2X51A 3N5LA 4UV9B 4AQFC 2Q9QC 2VB6A 2QGSA 2D0TA 2XTLA 5JH7E 3MZKB 2ES0A 3BQIA 4MHCA 2XASB 2WWUA 4QHOA 4ASKA 4IIJE 4EOZB 5FP3A 4EZHA 4C91A 5FYMA 1T98A 2J1DG 4IGUA 4X20E 1MIWA 5ADXL 4H9RC 3I0QA 3RYFE 4AKIA 1QUUA 5M4YA 2V7LA 4PJLA 4XAXB 3K8PC 2XAQB 3I9WA 1LKXA 3HKBE 3LFMA 2ZM8A 4HN9A 3UUNA 5EK2A 2DNXA 2LT3A 1U4QA 3UUXB 4ZI2C 3WI3A 3HA4A 4PK6A 4GYRA 3KVBA 2C5JA 5FMNA 5CB4E 3NZPA 4CI3B 3F2EA 3RC8A 2LJLA 2BDEA 2JJ9A 2X67A 3N2KE 5KMGP 4WBNE 2X9HA 2BVLA 3OBVE 4XBFB 1ZEEA 1HF8A 4ZI3C 2V7KA 3W15B 3CX8B 4QXCB 1UX5A 2W00A 2DCFA 3GWHA 2ZMAA 2EHOB 5LOVE 4C90A 1D0ZA 4ZS2A 4O4LE 3ZJ1A 4HKAA 2KWIB 5CA0E 2CM0A 4CXXA 5FXVA 3WAKA 2CWYA 5LHHB 4DBQA 3UUMA 2UXXB 3CVRA 2HPJA 2WMOA 2VKJA 2XQYA 1O3XA 2NWBA 5CA1E 4WBOA 3PU8A 3SRZA 2Z6EA 4HEAA 5LA6E 3KV9A 3FB2A 2MYSA 5JDMA 4HFVA 3HR0A 1ZHCA 5E0OA 2PJQA 3N9LA 2WM9A 2QA7A 4UVAB 3AA0B 3E08A 4Z8XA 5LBMA 2YEVC 3NZQA 5LG4A 5LP6E 5LHGB 2ODUA 4EXTA 2RP4A 2XAFB 2VK9A 3ZLIA 2ACXA 5JR9C 4EZ4A 2X9YA 5HXSA 3IF8B 3K3NA 4AI6A 2XUEA 5TAOA 3DJBA 3VKHA 1B7TA 2EHOD 3C4WA 5LGTB 3EUHA 3NBXX 4YJ3E 3R84B 2EHOA 4O8SA 2JRKA 2V7MA 3L09A 4ERRA 4UF0B 2DWKA 3VU7H 4KP3C 2LE8A 4TZ4C 4UVBB 4A56A 3DP7A 3NRYA 1MMDA 3PDYA 5DQWA 4HE8A 2C5IT 1HG5A 3KINB 2NTXA 3Q5WA 2LSGA 5F8PA 5LGNB 5L3DB 4MFRA 4O4JE 3PU3A 5LJNA 4I50E 4M1PA 5KX5E 2NTYA 3HL6A 1HCIA 1MIVA 4BA9A 2CXDA 4BJNA 5HXHA 5F3JA 2DWGA 3PUSA 4AKRB 2E9XC 2KT9A 4OK0A 2CXLA 3N9MA 3UTKA 3EDUA 2LSIA 2X66A 3VHLA 1CUNA 1MMAA 2JQQA 3LK3B 4V1Av 1OWAA 4UEMA 4L0RA 3SWHA 3UFEA 3J7Yq 4JUYA 5HYAA 1LVKA 4YFSA 2NW9A 5JQGE 1BR4A 2N1GA 4GIWA 3HKEE 3CQGB 4FJOA 3RKOA 2JPFA 4E7SA 1YD8G 5JDHA 3KV4A 2CLYC 2KXPB 2V7IA 3RC3A 3OYXA 4ISTA 3I0OA 2BZBA 5LCYA 5HXRA 2K24A 4PW8A 1MNEA 4UF0A 1D0YA 3AA1B 5C8YE 5HXEA 3ZC0A 4E7ZA 2YINA 5J2UE 2W0GA 5HAXA 4X1YE 2K9AA 4MBQA 2H3RA 4N78D 4U72A 3BQKA 2L3LA 2I59A 3E22E 4IDZA 3V5SA 4YJ2E 4QWNB 3FBZA 2V7JA 1G73A 2BVMA 2A3DA 5LHIB 1IJ6A 2VKHA 4CXYA 5H6RB 3RRWA 5LXTE 3CWZB 3RYHE 5HWXA 2OA5A 3U78A 4CZZB 5JDLA 3WAJA 3RX6A 5J2TE 3MA9A 1BR2A 2KWHA 1LVFA 2V1DB 3KBTA 2RA1A 3OJAA 4BAYB 4PFPA 2LEHA 3EVYA 4X1IE 1WYCA 1S94A 2ODVA 1E1HB 3AAEB 4PK5A 3D0TA 5JDFA 3PTRB 3BQLA 3JC6D 4O2AE 1BR1A 4O2BE 1WR6A 3U3IA 1ZKEA 4NUVA 3K3OA 2CCQA 3TKLB 3FXDB 1UX4A 3UULA 4QKNA 3V5UA 4TV9E 3R6NA 4AKGA 1LRZA 3CQCB 4PJJA 2HH7A 2D5UA 5FXZA 2LOSA 4I43B 5FY0A 3HKDE 3ZJ2A 3CMLA 2NW7A 3CX6B 3KDSE 3KVAA 5EZYE 1FEWA 1OXZA 3AA7B 1G8XA 2CWOA 3HI2A 4PNIA 4TN7B 4YLHA 3ZMVB 4ZOLE 2NOXA 3ETUA 3M65A 3RRCA 5LYJE 3ZMSB 4DMVA 5ETWA 2LSJA 3QC9A 3SOLA 3ZPOA 2EHOC 2VASA 3QUJA 3AAAB 2IC6A 1D0XA 2VL8A 4G2AA 1D1CA 3A5XA 3GMIA 4CI2B 3QK6A 5FNVE 2LSKA 3PUQA 2XAHB 3RH3A 4X1KE 1S35A 1H7CA 2DLRA 3LK2B 2L8KA 2XAGB 5DQVA 1SA0E 4DNDA 4YHJA 3ZYMA 3O1HA 4CQIA 2W61A 1YW0A 2N9DA 3N9QA 4PJNA 3RYIE 4IE7A 4K0UA 3OKQA 4PK4A 4AQGA 4IHJE 5JDGA 2CMRA 3ZN1B 5L2LA 1IAPA 3CQXC 1D1AA 2UXNB 3KFWX 3OYZA 2MBGA 4GK5E 4ADZA 3N2GE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QXC B;  4QWN B;  4TN7 B;  4QX7 B;  4QXH B;  4QXB B;  4QX8 B; 
#chains in the Genus database with same CATH topology
 4L9I A;  5JRC A;  4EIW A;  3Q9D A;  4I55 E;  3QB5 A;  2WMN A;  3AEB A;  4HWD A;  4YHH T;  4QXH B;  3N9O A;  3E0Z A;  2CE7 A;  1Z0P A;  3AED A;  3LK4 2;  1FMW A;  1VOM A;  1UUR A;  4HFH A;  3L39 A;  4DR1 T;  4MAL A;  4HGA A;  4QXB B;  2YOE A;  3P8C D;  2ZM0 A;  3KV6 A;  1KK7 A;  2FJD A;  4HFI A;  3I9Y A;  1HR0 T;  4NUU A;  1GQE A;  4AQF A;  3JC6 C;  2SPC A;  4NXM T;  4DR2 T;  1IJ5 A;  4JI5 T;  1J5W A;  4UXN B;  2ZM2 A;  4ILA A;  3N9N A;  3SFE A;  3AE2 A;  2W62 A;  2H7V C;  3F31 A;  3RIU A;  2IW5 B;  5L3C B;  2XHE B;  2XQ4 A;  5HXC A;  2NW8 A;  3PV0 F;  2IIU A;  5IUX A;  2A2F X;  2VKD A;  3UFG A;  5FXW A;  4IT4 A;  2Y48 B;  4K0K T;  1N34 T;  3ONL C;  4OX9 T;  4HTE A;  4Z90 A;  3DTO A;  3PUV F;  2X68 A;  5ABF A;  3AAI A;  2WBL A;  4MLK A;  3FZL B;  4A97 A;  2DL1 A;  3PE0 A;  3Q5X A;  3AEC A;  1FIO A;  3O1I A;  2IC9 A;  2PG8 A;  2M67 A;  5JR9 A;  4EGW A;  1XNR T;  3L3P A;  3HKC E;  2XQ7 A;  4H63 H;  4ZZC A;  2VQE T;  3UUB A;  5L3E B;  4IRE A;  2LLY A;  5KDM C;  5FXX A;  4QX7 B;  3LBX B;  4HWC A;  3C98 B;  4U3C A;  3ZEF B;  3ZC1 A;  4U2Y A;  3ANW A;  3MKD A;  5LMN T;  3RIF A;  3T8O A;  3AXJ B;  2HHH T;  2E9X D;  2E9X A;  5IYZ E;  4DMW A;  3X1D A;  3RPU A;  4OFZ A;  4GOU A;  4TNW A;  2NP9 A;  1HNW T;  2UUB T;  5BR8 T;  2X51 A;  3N5L A;  2Q9Q C;  2QGS A;  2XTL A;  2X0Y A;  5JH7 E;  2WWU A;  2BS2 A;  4LMK A;  4EZH A;  2FJB A;  2HN1 A;  2J1D G;  4X20 E;  3PUW F;  5ABH A;  2V5D A;  2XAQ B;  2BBJ A;  2LKG A;  3UUN A;  4ZI2 C;  5AQF B;  2C5J A;  5FMN A;  3NZP A;  3RC8 A;  2X67 A;  3UU5 A;  4WBN E;  2BVL A;  1XNQ T;  1M7K A;  1ZEE A;  1CHU A;  1UX5 A;  5AQK B;  4DV2 T;  2F4V T;  3NKZ A;  5LOV E;  4C90 A;  1D0Z A;  2WY2 A;  2BG9 B;  4HKA A;  5LHH B;  2CWY A;  3CVR A;  2HPJ A;  3ABV A;  2NR4 A;  2MYS A;  3AEE A;  5L47 A;  4HWI B;  3EAB A;  2WM9 A;  5LBM A;  5LP6 E;  2YEV C;  3NZQ A;  5LG4 A;  2ACX A;  4NIQ A;  4YSZ A;  3ZST A;  4DR6 T;  3R84 B;  3PUZ F;  1I6Z A;  4ERR A;  2DWK A;  3VU7 H;  4KP3 C;  1MMD A;  5DQW A;  4HE8 A;  4MFR A;  4QH5 A;  4I50 E;  5KX5 E;  2I6H A;  2NTY A;  3PUS A;  3UTK A;  3EDU A;  3UFE A;  5LG3 A;  3SWH A;  3JCF A;  5HYA A;  2NW9 A;  1BR4 A;  4GIW A;  3HKE E;  4E7S A;  1YD8 G;  2V7I A;  3RC3 A;  3OYX A;  5LCY A;  3H3M A;  4UF0 A;  4EED A;  4E7Z A;  5J2U E;  2XY8 B;  4X1Y E;  4U72 A;  3BQK A;  3ZT7 A;  3E22 E;  3V5S A;  4LF6 T;  4U33 A;  4YJ2 E;  4QWN B;  1DU2 A;  5HWX A;  4HFB A;  3WAJ A;  3RX6 A;  3MA9 A;  5HEU A;  3LDQ B;  4BAY B;  3EVY A;  1WYC A;  2ODV A;  4QH1 A;  4O2A E;  4NUV A;  2YN6 A;  2CCQ A;  3V5U A;  1W09 A;  4DR5 T;  3RIA A;  4AQY T;  3ONJ A;  2LOS A;  5FY0 A;  4JBW F;  1OXZ A;  2CWO A;  3HI2 A;  4YLH A;  1T8B A;  3M65 A;  2LSJ A;  2EHO C;  5AQJ B;  3AAA B;  3P4Q A;  3A5X A;  3QB5 K;  3QK6 A;  1OED A;  4KHZ F;  1H7C A;  4LF8 T;  4DR7 T;  1SA0 E;  4YHJ A;  3O1H A;  4KX6 A;  4K0U A;  2JIW A;  4PK4 A;  3AE5 A;  5JDG A;  2CMR A;  4JI0 T;  3OYZ A;  4HFD A;  3JAF A;  5IWA T;  5EK4 A;  1MIY A;  2PFV A;  5CJ5 A;  4EYY R;  3PJA J;  2BG9 E;  3N9P A;  5LB7 B;  4GK0 E;  3FHN A;  5AFU L;  2Q9Q B;  5L3F B;  4DV4 T;  3EDV A;  4TWF A;  2CXF A;  1U5P A;  1X9B A;  3GA8 A;  5LGU B;  4CXW A;  4EYU A;  4PJM A;  2E8I A;  1UCU A;  3T1Y T;  3B57 A;  4UEL A;  4H9S E;  5JDN A;  3TLW A;  2WZH A;  4L5G A;  2MTQ A;  2CA5 A;  5AQH B;  3ZN0 B;  2YK0 A;  3ZYK A;  1NEN A;  4U7Y A;  3K3Q C;  3B13 A;  5EK3 A;  5ABE A;  2K48 A;  2XAJ B;  2WWV A;  3LBX A;  2WP9 A;  3PUG A;  4OYK A;  4KI0 F;  2VVS A;  5KXJ A;  1KF6 A;  2V6Y B;  4A98 A;  1XDP A;  1WRD A;  4U7I A;  1FMV A;  2YU2 A;  2LSY A;  3P4P A;  2IDO B;  3FZF B;  4JI2 T;  3C50 A;  3OPC A;  4P0B A;  4H9O C;  4ZI3 D;  4H9P C;  3ZMZ B;  3ZT5 A;  4JV5 T;  4DUY T;  3CPZ A;  4IDQ A;  5LNK A;  4DO0 A;  1XMO T;  2W63 A;  5AQM B;  2C5K T;  5A1L A;  2BKN A;  4WW0 A;  3A8Y C;  3EI0 A;  4ZEY A;  4QH4 A;  2ZLY A;  5FY7 A;  3M3Z B;  3IHR A;  4OHF A;  4P09 A;  1NWM X;  2BG9 A;  3KBU A;  4IDP A;  1VRB A;  1HNZ T;  2XPK A;  4IE4 A;  2OLT A;  2X9X A;  5AQR B;  3EAM A;  3VR8 A;  4H9Q C;  2H89 A;  4IE5 A;  4HWH A;  2PBI A;  5LBQ B;  1Z8U A;  3AEG A;  2WAU A;  2JMK A;  2K3W A;  5J1G A;  1W9R A;  2DHR A;  3AEF A;  4FI5 A;  3Q2M A;  2E5V A;  4PAG A;  3AVR A;  1WR0 A;  3FBL A;  4QX8 B;  1FJG T;  2M6B A;  4AQF C;  2VB6 A;  1IBL T;  3P4W A;  2ES0 A;  2VL0 A;  3AE7 A;  2XAS B;  3BQI A;  4MHC A;  1E2A A;  4C91 A;  2FUP A;  4IGU A;  5ADX L;  3CK6 A;  3L8R A;  4H9R C;  3I0Q A;  3K8P C;  1LKX A;  5EK2 A;  2OV9 A;  3RIU C;  3WI3 A;  4PK6 A;  4GYR A;  2LJL A;  2BDE A;  4LML A;  2X9H A;  3CX8 B;  3GWH A;  2ZMA A;  2EHO B;  3ZSS A;  3AE3 A;  2CBJ A;  4DID B;  2KWI B;  5FXV A;  3UU3 A;  2UXX B;  2XQY A;  4F8H A;  2NWB A;  5CA1 E;  1L0V A;  4HEA A;  5LA6 E;  5JDM A;  4LF7 T;  2PJQ A;  4LMJ A;  1UK5 A;  2QA7 A;  4UVA B;  3AA0 B;  3E08 A;  5LHG B;  2KSR A;  2MPK A;  2V8S V;  4EXT A;  2XAF B;  5JR9 C;  4EZ4 A;  2X9Y A;  5F5W A;  2XUE A;  5TAO A;  3DJB A;  3C4W A;  4HFE A;  3EUH A;  4Q25 A;  2JRK A;  2V7M A;  4A56 A;  3DP7 A;  3RQW A;  1XWM A;  2C5I T;  1HG5 A;  3OTO T;  5AQL B;  3Q5W A;  2LSG A;  5F8P A;  5LGN B;  4I0U A;  4M1P A;  4DR3 T;  3HL6 A;  1UGO A;  4AKR B;  2E9X C;  2CXL A;  3VHL A;  2JQQ A;  4L0R A;  4U31 A;  3JAE A;  1LVK A;  2N1G A;  3CQG B;  2QRX A;  4IST A;  5C8Y E;  1D0Y A;  2YIN A;  4JYA T;  2K9A A;  4MBQ A;  2L3L A;  2FBW A;  1UUS A;  4IDZ A;  3FBZ A;  1IJ6 A;  3QNU A;  1WCR A;  2CBI A;  5J2T E;  4CZZ B;  2IHR 1;  1KEY A;  2V1D B;  2UXB T;  3OJA A;  4X1I E;  1E1H B;  5ABG A;  2LRL A;  1XMQ T;  2XQ5 A;  3TKL B;  3FXD B;  4TV9 E;  2W66 A;  5HCM A;  1LRZ A;  1T7S A;  3CQC B;  4PJJ A;  5FXZ A;  2D9D A;  4TWD A;  3CML A;  4NPP A;  3CX6 B;  2B76 A;  1XZY A;  3KDS E;  4YTN A;  4DV3 T;  4TNV A;  1FEW A;  2HN2 A;  1G8X A;  3JAD A;  2NOX A;  4AIS A;  2ACZ A;  2JQK A;  4LF5 T;  5ETW A;  3QC9 A;  3ZPO A;  4CN4 A;  1D0X A;  2MAW A;  3RH3 A;  1S35 A;  3LK2 B;  4DND A;  2XAG B;  5DQV A;  2BS3 A;  4B3R T;  5J0Z A;  2UXC T;  1YW0 A;  3N9Q A;  4PJN A;  4IE7 A;  4IHJ E;  1D1A A;  1WFD A;  3N2G E;  4YY3 T;  1XDO A;  2XSA A;  4IDN A;  3LG7 A;  4U2Z A;  4KUM B;  1WLX A;  4YSX A;  1AJ3 A;  2N2N A;  5AQU B;  4OYJ A;  2UUA T;  3UT5 E;  3KV5 A;  1J1J A;  4O4I E;  3AEA A;  2JMH A;  1IBM T;  4I4T E;  4HWF A;  5L3B B;  1SE7 A;  3IBP A;  2MOZ A;  4CI1 B;  1MND A;  4KBM B;  2G0U A;  2CPT A;  4G63 A;  4JEU B;  2LOP A;  4IDO A;  3P50 A;  4GKJ T;  2CEA A;  5L3G B;  1HTJ F;  2WU5 A;  3VKG A;  2XM2 A;  1I94 T;  4P1N A;  4PFO A;  2WCA A;  1T72 A;  2L9Q A;  1V9D A;  3PJA A;  4JI7 T;  3MJX A;  4IE6 A;  2BKP A;  1HS7 A;  2V26 A;  2IUB A;  4H63 V;  1QLB A;  3CKD A;  3P7I A;  2FJA A;  4O4H E;  1KNZ A;  5H6Q B;  3MAC A;  5DAB A;  2E2A A;  3C4X A;  5JR9 B;  3ZMU B;  1SHZ C;  2ZM6 T;  3O9X A;  5L4E A;  1OED C;  2XZE A;  2RPA A;  2VWA A;  4TUY E;  4UV8 B;  1HX1 B;  1X79 A;  4WNK A;  2A9U A;  1IZN B;  3ANW B;  2H7O A;  3SS1 A;  3ESL A;  1HNX T;  3SFD A;  1D1B A;  3P4S A;  4X5T A;  2E9X B;  4H9N C;  3GN5 B;  1ZV4 X;  1KNR A;  3C4Z A;  4TV8 E;  4DV1 T;  4JI6 T;  4ILU A;  4X66 T;  2X0H A;  3PUA A;  4WZX A;  2V5C A;  4ZS3 A;  3MK7 C;  3C51 A;  3AA6 B;  5CFB A;  5FVL A;  3F57 A;  3IA3 A;  5HCJ A;  3RYC E;  1YKE B;  2XQ8 A;  1Y01 A;  4WYV A;  4LF9 T;  3ZKR A;  4ILC A;  5DJQ C;  1YQ4 A;  3ZMT B;  5LJM A;  2KLQ A;  2YKS A;  3VRB A;  2PTF A;  4YT0 A;  2D2S A;  3N2O A;  4KMC A;  2P9B A;  2KND A;  1EZ3 A;  3AE1 A;  1ZOY A;  1US7 B;  3RGL A;  4UV9 B;  2D0T A;  2XM1 A;  2I0M A;  4IIJ E;  4EOZ B;  5FYM A;  2XQ9 A;  3AE9 A;  5C2T A;  1QUU A;  2V7L A;  4PJL A;  3I9W A;  2DNX A;  1M62 A;  3UUX B;  3AXJ A;  4B3S T;  3HA4 A;  3KVB A;  5CB4 E;  4CI3 B;  3F2E A;  5KMG P;  3OBV E;  4XBF B;  4ZI3 C;  2V7K A;  5FVK A;  3W15 B;  2W00 A;  2DCF A;  2UXD T;  3TLT A;  1N33 T;  4ZS2 A;  4O4L E;  3QOF A;  5CA0 E;  4CXX A;  4DBQ A;  3TLU A;  3UUM A;  1SUM B;  2LRK A;  3UU6 A;  3KV9 A;  4UR9 A;  4HFV A;  1ZHC A;  5E0O A;  3G06 A;  3NVO A;  2ODU A;  4DV0 T;  3ZLI A;  4JI1 T;  3K3N A;  5AQI B;  4AI6 A;  4EV6 A;  3RKG A;  2J47 A;  2BG9 C;  5FKY A;  3VKH A;  1B7T A;  5LGT B;  3NBX X;  1ZP0 A;  4O8S A;  4LF4 T;  4UF0 B;  3FZM B;  4UVB B;  3KIN B;  2NTX A;  4DR4 T;  3PU3 A;  5LJN A;  1MIV A;  5HXH A;  4BA9 A;  2CXD A;  4BJN A;  5F3J A;  4LFB T;  2KT9 A;  4OK0 A;  3N9M A;  2X66 A;  1CUN A;  1OWA A;  4UEM A;  4JUY A;  3T1H T;  3PUY F;  4FJO A;  3K1S A;  2JPF A;  5AQN B;  5JDH A;  3KV4 A;  2CLY C;  2J4G A;  3EHZ A;  5HEO A;  3I0O A;  2CRB A;  2BZB A;  1N32 T;  3AE6 A;  5FL0 A;  1MNE A;  5HXE A;  2W0G A;  5HAX A;  3AE4 A;  4N78 D;  2I59 A;  2M6I A;  2V7J A;  1G73 A;  2LKH A;  2A3D A;  3RYH E;  2OA5 A;  3U78 A;  1BR2 A;  4X65 T;  3RQU A;  2XSB A;  3UU8 A;  2RA1 A;  4IL4 A;  2LEH A;  1S94 A;  3B5M A;  1OED B;  3AAE B;  5AQO B;  4PK5 A;  3D0T A;  3BQL A;  3JC6 D;  1BR1 A;  2W2U A;  3U3I A;  5C3J A;  3K3O A;  3UUL A;  4QKN A;  4I43 B;  3ZJ2 A;  3UQ7 A;  2WQY A;  2NW7 A;  3KVA A;  2W67 A;  4PNI A;  4ZOL E;  1NEK A;  3RRC A;  2YDS A;  4DMV A;  2VVN A;  4COF A;  4DUZ T;  3GMI A;  4KHP T;  2WDV A;  3ZT6 A;  2LSK A;  5FL1 A;  4JI3 T;  5HEH A;  4CQI A;  2BS4 A;  3OKQ A;  3ZN1 B;  5L2L A;  1IAP A;  2J62 A;  2UXN B;  4EEB A;  4GK5 E;  4B6X A;  2DI4 A;  4AXP A;  2YDQ A;  5GON E;  3S4U A;  3ZCI A;  3NRX A;  4GYS A;  5JDQ A;  1HG2 A;  4ZZB A;  4DBR A;  2UU9 T;  2B1E A;  3UU4 A;  4UIG A;  3ZYL A;  2HPL A;  2UUC T;  2KZ7 B;  3BK9 A;  3O1J A;  4UVC B;  1Y64 B;  4CN1 A;  2XQA A;  3AB3 B;  2K5B B;  3GN5 A;  2C0S A;  2VUR A;  3PUX F;  1BR0 A;  2WSS V;  5AQT B;  4U74 A;  3Q5E A;  3MXZ A;  5L4H A;  4YXD A;  2KMF A;  1HX8 A;  2Q9Q D;  1WYB A;  3H37 A;  2Q9Q A;  3LJC A;  3FZK B;  2WB5 A;  2YU1 A;  4P0A A;  4IL9 A;  2A72 A;  3Q5D A;  5JRE A;  4AKH A;  3TLS A;  4ZI7 E;  2LHN A;  4LFC T;  4BJM A;  4ZI2 D;  3H3A A;  4JLE A;  3TLV A;  3RLF F;  2FJE A;  5JRC B;  3ONX A;  3CIR A;  2XJ7 A;  2BBH A;  5AQG B;  1MMG A;  1E7P A;  3VRA A;  2KIN B;  3CX7 B;  5HEJ A;  2CHN A;  4ZHQ E;  3J9X 1;  2LM9 A;  2V6Y A;  4EB6 E;  1VCS A;  1N36 T;  1YXR A;  4ISS A;  4AKL A;  2X9W A;  3ETV A;  4LFA T;  4TX5 A;  2X0L B;  3ZCJ A;  1YKH B;  2IAK A;  4JEH B;  5LMU T;  1OED E;  3FXE B;  2GK9 A;  4J2C A;  5AQS B;  1QSD A;  3AE8 A;  1KFY A;  5AQV B;  5FY1 A;  3IEE A;  2CLY B;  4F6R C;  3C64 A;  3UQ4 A;  1W0A A;  5JVD E;  3I1A A;  4EAH A;  3PUR A;  5IHY A;  4IE0 A;  2D0U A;  4XZC A;  1JNZ A;  2LHR A;  4YSY A;  1HFA A;  1JNR A;  1NAF A;  2VQF T;  4DVD A;  3AVS A;  3O4X E;  4YTM A;  2VKO A;  5HWY A;  4DV7 T;  2Y6X A;  5BMV E;  3OVU A;  2Y8D A;  4ANJ A;  1MMN A;  2AE9 A;  2AXD S;  3MZK B;  4QHO A;  4ASK A;  4YTP A;  2V6X A;  5FP3 A;  5AQP B;  1T98 A;  1MIW A;  5AQQ B;  1J5E T;  3RYF E;  4AKI A;  5M4Y A;  4XAX B;  3HKB E;  3LFM A;  3FZH B;  2ZM8 A;  4HN9 A;  1VCT A;  2LT3 A;  1U4Q A;  5ABF B;  3A7M A;  2JJ9 A;  3N2K E;  1HF8 A;  4QXC B;  2WZI A;  2WU2 A;  2XQ6 A;  3ZJ1 A;  2CM0 A;  3WAK A;  2WMO A;  4X64 T;  2VKJ A;  1O3X A;  4WBO A;  3PU8 A;  3SRZ A;  2Z6E A;  4ILB A;  3FB2 A;  3HR0 A;  4A5X A;  3N9L A;  3VR9 A;  4DV6 T;  2W4X A;  4Z8X A;  2RP4 A;  5HEG A;  2VK9 A;  3RI5 A;  2LM2 A;  1W0B A;  5HXS A;  3IF8 B;  5JTG A;  4AIU A;  2R6G F;  2EHO D;  4YJ3 E;  2EHO A;  4ZXL A;  3L09 A;  2H88 A;  2LE8 A;  4TZ4 C;  4CN6 A;  3NRY A;  3PDY A;  5L3D B;  4O4J E;  5CGM A;  4TWH A;  3RHW A;  1HCI A;  2DWG A;  2LSI A;  1MMA A;  4V1A v;  3LK3 B;  3J7Y q;  1KNP A;  2JQH A;  3RF1 A;  2QVA A;  4YFS A;  5JQG E;  3RKO A;  3NWI A;  4GKK T;  2KXP B;  5HXR A;  2K24 A;  4PW8 A;  3AA1 B;  3ZC0 A;  2YDR A;  2H3R A;  4JI4 T;  2IML A;  2BVM A;  5LHI B;  2XQ3 A;  2VKH A;  4CXY A;  5H6R B;  3RRW A;  5LXT E;  3CWZ B;  4B3T T;  5JDL A;  2WDQ A;  2KWH A;  1LVF A;  3KBT A;  4PFP A;  4Z91 A;  4HFC A;  5JDF A;  3PTR B;  4O2B E;  4X62 T;  1WR6 A;  1ZKE A;  2QYW A;  1IBK T;  1UX4 A;  3R6N A;  4AKG A;  2HH7 A;  2D5U A;  3P4R A;  3HKD E;  1YQ3 A;  5EZY E;  3AA7 B;  4DV5 T;  4TN7 B;  3ZMV B;  3ETU A;  5LYJ E;  1R8I A;  2E5L T;  3ZMS B;  3SOL A;  2VAS A;  3QUJ A;  4JI8 T;  2IC6 A;  2VL8 A;  4G2A A;  1D1C A;  2CHO A;  4CI2 B;  2WDR A;  5FNV E;  3PUQ A;  2XAH B;  4X1K E;  2WS3 A;  2DLR A;  2L8K A;  3LSV A;  3ZYM A;  2W61 A;  2N9D A;  3RYI E;  2BKO A;  4NXN T;  2JQ9 A;  4AQG A;  4B3M T;  3CQX C;  3KFW X;  2MBG A;  4ADZ A; 
#chains in the Genus database with same CATH homology
 4L9I A;  4B6X A;  5EK4 A;  2DI4 A;  4AXP A;  1MIY A;  3LG7 A;  5GON E;  4KUM B;  2PFV A;  3S4U A;  1WLX A;  5JRC A;  4EYY R;  1AJ3 A;  3ZCI A;  2N2N A;  3N9P A;  3NRX A;  4GYS A;  4OYJ A;  4EIW A;  3Q9D A;  4I55 E;  5JDQ A;  1HG2 A;  2WMN A;  3UT5 E;  4DBR A;  4GK0 E;  3KV5 A;  2B1E A;  3FHN A;  5AFU L;  2Q9Q B;  5L3F B;  3EDV A;  4O4I E;  2JMH A;  4QXH B;  3N9O A;  4UIG A;  3E0Z A;  3ZYL A;  2CE7 A;  1U5P A;  2CXF A;  3GA8 A;  1Z0P A;  4I4T E;  4CXW A;  4EYU A;  3LK4 2;  5LGU B;  1FMW A;  5L3B B;  3IBP A;  2MOZ A;  2HPL A;  4PJM A;  1VOM A;  4CI1 B;  2KZ7 B;  3BK9 A;  1MND A;  2E8I A;  1UCU A;  3O1J A;  4KBM B;  3B57 A;  2G0U A;  4UVC B;  1Y64 B;  3AB3 B;  2K5B B;  4UEL A;  4MAL A;  4G63 A;  4HGA A;  3GN5 A;  2C0S A;  4H9S E;  5JDN A;  4QXB B;  4JEU B;  2LOP A;  3P8C D;  2ZM0 A;  3KV6 A;  1KK7 A;  1BR0 A;  2WSS V;  4U74 A;  4L5G A;  2MTQ A;  2CA5 A;  2CEA A;  5L3G B;  3MXZ A;  3ZN0 B;  2YK0 A;  1HTJ F;  3I9Y A;  3ZYK A;  2KMF A;  3VKG A;  1HX8 A;  4NUU A;  3K3Q C;  3B13 A;  2Q9Q D;  1WYB A;  5EK3 A;  3H37 A;  4AQF A;  2K48 A;  2XAJ B;  3JC6 C;  2Q9Q A;  2SPC A;  1IJ5 A;  3LBX A;  3PUG A;  4OYK A;  4PFO A;  2L9Q A;  1V9D A;  3LJC A;  3MJX A;  2YU1 A;  4P0A A;  4IE6 A;  4UXN B;  1WRD A;  2A72 A;  1FMV A;  5JRE A;  1HS7 A;  2V26 A;  4AKH A;  2ZM2 A;  2YU2 A;  2LSY A;  4H63 V;  3N9N A;  3CKD A;  4ZI7 E;  2LHN A;  3P7I A;  3C50 A;  2W62 A;  4BJM A;  4O4H E;  4ZI2 D;  1KNZ A;  5H6Q B;  3H3A A;  2H7V C;  3MAC A;  3F31 A;  4JLE A;  4P0B A;  5DAB A;  4H9O C;  3C4X A;  2IW5 B;  5L3C B;  5JR9 B;  2XHE B;  3ZMU B;  5HXC A;  1SHZ C;  4ZI3 D;  5JRC B;  2NW8 A;  3ONX A;  3O9X A;  4H9P C;  3ZMZ B;  2A2F X;  2VKD A;  5FXW A;  2Y48 B;  3CPZ A;  2VWA A;  4TUY E;  1MMG A;  4UV8 B;  5LNK A;  4DO0 A;  1X79 A;  4WNK A;  2W63 A;  2KIN B;  1IZN B;  3CX7 B;  3ANW B;  4HTE A;  2C5K T;  4ZHQ E;  5A1L A;  3J9X 1;  2H7O A;  3SS1 A;  4WW0 A;  3ESL A;  2LM9 A;  4EB6 E;  3DTO A;  1D1B A;  2X68 A;  4ISS A;  4AKL A;  3AAI A;  2WBL A;  2X9W A;  3ETV A;  4MLK A;  4TX5 A;  2X0L B;  2E9X B;  4H9N C;  3ZCJ A;  3GN5 B;  1YKH B;  1ZV4 X;  2IAK A;  2ZLY A;  3PE0 A;  3Q5X A;  3C4Z A;  4JEH B;  1FIO A;  3O1I A;  2IC9 A;  3FXE B;  2GK9 A;  4J2C A;  2PG8 A;  1QSD A;  4OHF A;  3IHR A;  5FY7 A;  4TV8 E;  2M67 A;  4P09 A;  4ILU A;  5JR9 A;  5FY1 A;  3IEE A;  3L3P A;  3HKC E;  3PUA A;  1NWM X;  2CLY B;  4H63 H;  4F6R C;  4ZS3 A;  3MK7 C;  3C64 A;  5L3E B;  3C51 A;  3KBU A;  1VRB A;  3AA6 B;  4IE4 A;  5KDM C;  5FXX A;  5JVD E;  4QX7 B;  2X9X A;  3I1A A;  4EAH A;  3PUR A;  5IHY A;  3LBX B;  3ZEF B;  3C98 B;  3F57 A;  4H9Q C;  4IE5 A;  4IE0 A;  3ZC1 A;  2D0U A;  2PBI A;  4XZC A;  5LBQ B;  3ANW A;  3RYC E;  2LHR A;  2WAU A;  1YKE B;  3MKD A;  1HFA A;  1NAF A;  2JMK A;  4DVD A;  5J1G A;  3AVS A;  3T8O A;  5DJQ C;  3ZMT B;  2DHR A;  5LJM A;  2KLQ A;  2E9X D;  4FI5 A;  3O4X E;  2D2S A;  2E9X A;  3N2O A;  3Q2M A;  5IYZ E;  4DMW A;  2VKO A;  4KMC A;  2P9B A;  5HWY A;  3RPU A;  2KND A;  1EZ3 A;  2Y6X A;  4OFZ A;  5BMV E;  4PAG A;  4GOU A;  2NP9 A;  2Y8D A;  3AVR A;  1US7 B;  3FBL A;  4ANJ A;  4QX8 B;  1MMN A;  2X51 A;  3N5L A;  4UV9 B;  4AQF C;  2Q9Q C;  2VB6 A;  2QGS A;  2D0T A;  2XTL A;  5JH7 E;  3MZK B;  2ES0 A;  3BQI A;  4MHC A;  2XAS B;  2WWU A;  4QHO A;  4ASK A;  4IIJ E;  4EOZ B;  5FP3 A;  4EZH A;  4C91 A;  5FYM A;  1T98 A;  2J1D G;  4IGU A;  4X20 E;  1MIW A;  5ADX L;  4H9R C;  3I0Q A;  3RYF E;  4AKI A;  1QUU A;  5M4Y A;  2V7L A;  4PJL A;  4XAX B;  3K8P C;  2XAQ B;  3I9W A;  1LKX A;  3HKB E;  3LFM A;  2ZM8 A;  4HN9 A;  3UUN A;  5EK2 A;  2DNX A;  2LT3 A;  1U4Q A;  3UUX B;  4ZI2 C;  3WI3 A;  3HA4 A;  4PK6 A;  4GYR A;  3KVB A;  2C5J A;  5FMN A;  5CB4 E;  3NZP A;  4CI3 B;  3F2E A;  3RC8 A;  2LJL A;  2BDE A;  2JJ9 A;  2X67 A;  3N2K E;  5KMG P;  4WBN E;  2X9H A;  2BVL A;  3OBV E;  4XBF B;  1ZEE A;  1HF8 A;  4ZI3 C;  2V7K A;  3W15 B;  3CX8 B;  4QXC B;  1UX5 A;  2W00 A;  2DCF A;  3GWH A;  2ZMA A;  2EHO B;  5LOV E;  4C90 A;  1D0Z A;  4ZS2 A;  4O4L E;  3ZJ1 A;  4HKA A;  2KWI B;  5CA0 E;  2CM0 A;  4CXX A;  5FXV A;  3WAK A;  2CWY A;  5LHH B;  4DBQ A;  3UUM A;  2UXX B;  3CVR A;  2HPJ A;  2WMO A;  2VKJ A;  2XQY A;  1O3X A;  2NWB A;  5CA1 E;  4WBO A;  3PU8 A;  3SRZ A;  2Z6E A;  4HEA A;  5LA6 E;  3KV9 A;  3FB2 A;  2MYS A;  5JDM A;  4HFV A;  3HR0 A;  1ZHC A;  5E0O A;  2PJQ A;  3N9L A;  2WM9 A;  2QA7 A;  4UVA B;  3AA0 B;  3E08 A;  4Z8X A;  5LBM A;  2YEV C;  3NZQ A;  5LG4 A;  5LP6 E;  5LHG B;  2ODU A;  4EXT A;  2RP4 A;  2XAF B;  2VK9 A;  3ZLI A;  2ACX A;  5JR9 C;  4EZ4 A;  2X9Y A;  5HXS A;  3IF8 B;  3K3N A;  4AI6 A;  2XUE A;  5TAO A;  3DJB A;  3VKH A;  1B7T A;  2EHO D;  3C4W A;  5LGT B;  3EUH A;  3NBX X;  4YJ3 E;  3R84 B;  2EHO A;  4O8S A;  2JRK A;  2V7M A;  3L09 A;  4ERR A;  4UF0 B;  2DWK A;  3VU7 H;  4KP3 C;  2LE8 A;  4TZ4 C;  4UVB B;  4A56 A;  3DP7 A;  3NRY A;  1MMD A;  3PDY A;  5DQW A;  4HE8 A;  2C5I T;  1HG5 A;  3KIN B;  2NTX A;  3Q5W A;  2LSG A;  5F8P A;  5LGN B;  5L3D B;  4MFR A;  4O4J E;  3PU3 A;  5LJN A;  4I50 E;  4M1P A;  5KX5 E;  2NTY A;  3HL6 A;  1HCI A;  1MIV A;  4BA9 A;  2CXD A;  4BJN A;  5HXH A;  5F3J A;  2DWG A;  3PUS A;  4AKR B;  2E9X C;  2KT9 A;  4OK0 A;  2CXL A;  3N9M A;  3UTK A;  3EDU A;  2LSI A;  2X66 A;  3VHL A;  1CUN A;  1MMA A;  2JQQ A;  3LK3 B;  4V1A v;  1OWA A;  4UEM A;  4L0R A;  3SWH A;  3UFE A;  3J7Y q;  4JUY A;  5HYA A;  1LVK A;  4YFS A;  2NW9 A;  5JQG E;  1BR4 A;  2N1G A;  4GIW A;  3HKE E;  3CQG B;  4FJO A;  3RKO A;  2JPF A;  4E7S A;  1YD8 G;  5JDH A;  3KV4 A;  2CLY C;  2KXP B;  2V7I A;  3RC3 A;  3OYX A;  4IST A;  3I0O A;  2BZB A;  5LCY A;  5HXR A;  2K24 A;  4PW8 A;  1MNE A;  4UF0 A;  1D0Y A;  3AA1 B;  5C8Y E;  5HXE A;  3ZC0 A;  4E7Z A;  2YIN A;  5J2U E;  2W0G A;  5HAX A;  4X1Y E;  2K9A A;  4MBQ A;  2H3R A;  4N78 D;  4U72 A;  3BQK A;  2L3L A;  2I59 A;  3E22 E;  4IDZ A;  3V5S A;  4YJ2 E;  4QWN B;  3FBZ A;  2V7J A;  1G73 A;  2BVM A;  2A3D A;  5LHI B;  1IJ6 A;  2VKH A;  4CXY A;  5H6R B;  3RRW A;  5LXT E;  3CWZ B;  3RYH E;  5HWX A;  2OA5 A;  3U78 A;  4CZZ B;  5JDL A;  3WAJ A;  3RX6 A;  5J2T E;  3MA9 A;  1BR2 A;  2KWH A;  1LVF A;  2V1D B;  3KBT A;  2RA1 A;  3OJA A;  4BAY B;  4PFP A;  2LEH A;  3EVY A;  4X1I E;  1WYC A;  1S94 A;  2ODV A;  1E1H B;  3AAE B;  4PK5 A;  3D0T A;  5JDF A;  3PTR B;  3BQL A;  3JC6 D;  4O2A E;  1BR1 A;  4O2B E;  1WR6 A;  3U3I A;  1ZKE A;  4NUV A;  3K3O A;  2CCQ A;  3TKL B;  3FXD B;  1UX4 A;  3UUL A;  4QKN A;  3V5U A;  4TV9 E;  3R6N A;  4AKG A;  1LRZ A;  3CQC B;  4PJJ A;  2HH7 A;  2D5U A;  5FXZ A;  2LOS A;  4I43 B;  5FY0 A;  3HKD E;  3ZJ2 A;  3CML A;  2NW7 A;  3CX6 B;  3KDS E;  3KVA A;  5EZY E;  1FEW A;  1OXZ A;  3AA7 B;  1G8X A;  2CWO A;  3HI2 A;  4PNI A;  4TN7 B;  4YLH A;  3ZMV B;  4ZOL E;  2NOX A;  3ETU A;  3M65 A;  3RRC A;  5LYJ E;  3ZMS B;  4DMV A;  5ETW A;  2LSJ A;  3QC9 A;  3SOL A;  3ZPO A;  2EHO C;  2VAS A;  3QUJ A;  3AAA B;  2IC6 A;  1D0X A;  2VL8 A;  4G2A A;  1D1C A;  3A5X A;  3GMI A;  4CI2 B;  3QK6 A;  5FNV E;  2LSK A;  3PUQ A;  2XAH B;  3RH3 A;  4X1K E;  1S35 A;  1H7C A;  2DLR A;  3LK2 B;  2L8K A;  2XAG B;  5DQV A;  1SA0 E;  4DND A;  4YHJ A;  3ZYM A;  3O1H A;  4CQI A;  2W61 A;  1YW0 A;  2N9D A;  3N9Q A;  4PJN A;  3RYI E;  4IE7 A;  4K0U A;  3OKQ A;  4PK4 A;  4AQG A;  4IHJ E;  5JDG A;  2CMR A;  3ZN1 B;  5L2L A;  1IAP A;  3CQX C;  1D1A A;  2UXN B;  3KFW X;  3OYZ A;  2MBG A;  4GK5 E;  4ADZ A;  3N2G E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...