4QWNB

Histone demethylase kdm2a-h3k36me1-alpha-kg complex structure
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
b'QVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELASSDPKLALTGVPIVQWP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 2A
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/structural protein
total genus 19
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4qwnB00
4QXBB 4QWNB 4QX8B 4QXCB 4QXHB 4QX7B 4TN7B
chains in the Genus database with same CATH superfamily
2XY8B 2XQ3A 4I43B 4B3MT 4DR7T 3AVSA 2VURA 4X1YE 4YSXA 5E0OA 4Z91A 2YOEA 1OXZA 4XZCA 5FL1A 1MNEA 3WI3A 2XHEB 2WM9A 1UX5A 1IBMT 2K24A 2XM1A 5LBMA 1I94T 2WS3A 4NIQA 3I1AA 2WDVA 1D0YA 2VL0A 2UUAT 2XQAA 3C50A 5KXJA 1N33T 3ZC0A 3QNUA 5CB4E 2VKDA 3ANWA 3PTRB 5FY0A 3OTOT 3RQUA 1T8BA 2L8KA 2J47A 3UT5E 2J4GA 4LMKA 4QWNB 3ZYMA 2LRLA 2FUPA 4DV2T 5JRCA 3TLSA 2VWAA 2J62A 2XM2A 5J2TE 4B3TT 3GMIA 3N9OA 1I6ZA 3RC8A 2UXBT 2JMHA 5AQIB 2PJQA 2MBGA 2IMLA 3MZKB 4EB6E 4IIJE 5L3DB 2C5KT 2QA7A 4U72A 5JR9C 4NUUA 3B57A 3EAMA 5ABGA 2ZM2A 4NUVA 5CGMA 4LFCT 3PDYA 3K1SA 1FIOA 4OYKA 2X0LB 3VU7H 2NW8A 1SHZC 2MAWA 2LKHA 1U4QA 3V5SA 3K8PC 4EZ4A 2JQ9A 3FZKB 4IHJE 3E08A 1LKXA 3LK42 1UGOA 3ZJ1A 2BG9E 4JI5T 2OV9A 2X0HA 3D0TA 4JEUB 4WYVA 3P4QA 1J5ET 4J2CA 4X5TA 4IE0A 3J7Yq 4XBFB 1Y01A 3VR8A 1Z0PA 1O3XA 3FZHB 3MACA 5AQUB 1MMGA 2W66A 1V9DA 2L3LA 2K3WA 4BAYB 4X1KE 4LFBT 2G0UA 3VHLA 2V5CA 3ZC1A 4IE7A 4DV4T 3V5UA 2QYWA 3RGLA 4LF9T 2H89A 3SWHA 1HNZT 3RLFF 3AA6B 4O4HE 3RC3A 2WB5A 3ZYLA 5H6QB 3U3IA 3P4SA 4ANJA 4YSZA 3O9XA 4JI1T 2V8SV 2YDRA 3PUZF 4A56A 3AEFA 2X9YA 5L3FB 5LJMA 3GA8A 1UK5A 3ZKRA 2W62A 1LVFA 3B5MA 4ILUA 5AQTB 4BJMA 4B3ST 3KBTA 2DLRA 3A8YC 1IAPA 4YT0A 5ETWA 2WQYA 2BG9A 2A9UA 2C5IT 4IREA 4KI0F 2Q9QB 3FBLA 5IYZE 3WAKA 3TLWA 3C51A 3RHWA 2NTYA 1Y64B 2UXCT 2YN6A 3LK2B 4TN7B 5KMGP 4GYRA 2MYSA 3TKLB 4PJJA 2N2NA 3CQXC 3K3OA 1G8XA 1R8IA 4DV3T 3AAIA 5L3CB 5JVDE 2V6YB 2D5UA 4UV8B 4EOZB 3HKDE 4PNIA 4DV7T 4DBQA 2LRKA 4KP3C 1IJ6A 3M3ZB 2NOXA 3NRXA 2IHR1 3DJBA 4OFZA 3A7MA 2LHRA 4CXXA 3P8CD 2XAJB 4MHCA 4QXBB 3TLTA 3ESLA 4UXNB 3EHZA 3RF1A 4ERRA 2F4VT 1M7KA 2VQET 4GYSA 4JI4T 1MMNA 2CBJA 3ETUA 3M65A 3EVYA 4YTPA 5JQGE 4K0UA 2MPKA 4O4JE 2IAKA 4PK6A 2XPKA 3Q5EA 4X1IE 4CXYA 3CWZB 3UUNA 3Q5XA 1ZOYA 5LGTB 3JAEA 3B13A 3ONXA 3MJXA 4HFDA 4XAXB 4JBWF 2YDSA 3IBPA 2Q9QD 4CI3B 5DQWA 4WW0A 4U74A 3FBZA 4TV9E 2OA5A 3ZT6A 4JLEA 2D2SA 2Y6XA 4LF5T 1OEDB 2QGSA 3QB5A 5J1GA 4H9NC 4IDZA 3VKGA 3C4ZA 4TWDA 5CA1E 2H88A 4DV1T 3ZT5A 5HEOA 5L47A 3FB2A 2YK0A 2XQ9A 5HCJA 2Z6EA 1E7PA 1T98A 5LHHB 5GONE 3UFEA 1YXRA 3AXJB 3UU5A 5ABEA 2EHOB 4LF7T 3NZPA 1FEWA 4EAHA 5LMUT 3RQWA 2VB6A 2X68A 2BVLA 2LOSA 4WBNE 4ZZBA 3J9X1 2V26A 3HKEE 5HWYA 5LHGB 4AKRB 2CE7A 2KZ7B 5AQVB 2V5DA 1N32T 4DIDB 4YJ3E 3AE2A 3NKZA 1KNPA 3C98B 2KNDA 3U78A 3AE5A 2VASA 2IIUA 2KXPB 3PUQA 2UUBT 4UEMA 2V7IA 1KF6A 4OX9T 3KINB 4AIUA 3AB3B 2BS4A 2P9BA 1J5WA 3BQIA 3O1HA 2MOZA 4IL9A 1CHUA 2BBJA 3RRWA 3PU3A 3RKOA 3ZLIA 3BK9A 3RIUA 5J0ZA 4U31A 4P1NA 5LOVE 2CRBA 1OEDE 3L3PA 3N9QA 3NWIA 5AQPB 4U7IA 2XAGB 4CI1B 1QSDA 4ISTA 4QH1A 4U3CA 2CXDA 3N5LA 1XMQT 2V6YA 5F3JA 4ZOLE 5FP3A 2VQFT 3F2EA 4O2AE 3RRCA 5HCMA 1SE7A 1HTJF 2YKSA 3BQKA 4LMJA 4HE8A 4IDNA 3AAEB 3KDSE 4TWFA 3AAAB 3KBUA 2AE9A 3AEBA 4HKAA 4UVAB 3PURA 5LXTE 2HHHT 2VKHA 4ZS2A 1FMVA 2EHOD 1OWAA 2XAHB 3DP7A 4O2BE 2QVAA 4AQGA 2CCQA 3CQCB 4AQFA 3JADA 3I0QA 4UVCB 2X67A 1HNWT 4TUYE 2CLYB 2WWVA 4QKNA 2W2UA 2IC6A 1WFDA 2BKNA 2XQ7A 1XZYA 4HWIB 3UUMA 4YLHA 1KNRA 5HXSA 3CK6A 3R6NA 3K3NA 4G2AA 2JIWA 3KFWX 2NWBA 5C8YE 2XSAA 5FVKA 3OYZA 5HEHA 2K5BB 4E7ZA 2CWYA 5HEGA 3CKDA 4HFVA 1YKEB 2KINB 3AA1B 2BKPA 1OEDA 4B6XA 1EZ3A 3F31A 3LG7A 4PK5A 3AVRA 4V1Av 1YKHB 5JDQA 2BVMA 2W00A 1L0VA 5AQKB 1W09A 3AEEA 3JC6D 3LFMA 5AQFB 3ZMTB 1YQ4A 2IW5B 2JPFA 3ZN1B 4JI8T 4ZS3A 4WBOA 4ISSA 2W4XA 3AXJA 2EHOA 3C4XA 1MMAA 3ONJA 5JREA 1XDOA 4AKIA 3RIAA 2B1EA 2CPTA 2LLYA 4EV6A 1M62A 3KV9A 4AI6A 2GK9A 3F57A 2Q9QC 4HFEA 4ZZCA 2LT3A 3RIUC 2C0SA 2JQHA 2DL1A 2HPJA 3PE0A 4N78D 1HFAA 5FXWA 5EK4A 3EDUA 3CQGB 2H7VC 4HWCA 2NR4A 5BR8T 3TLUA 1MIVA 3ZMVB 1NENA 4IGUA 5A1LA 2XSBA 3AECA 2C5JA 4AQYT 3JAFA 1KNZA 3E0ZA 1X79A 4Z90A 3AE1A 4U2ZA 4CXWA 4O8SA 2CXLA 2KMFA 4Q25A 4ZI3D 2W63A 2A3DA 3AEGA 1WRDA 2JRKA 1HCIA 2XAFB 3LDQB 2KLQA 1HG5A 4AISA 3A5XA 4YHJA 3I9YA 4KHZF 4AQFC 2OLTA 2X66A 2FJBA 2E5LT 2E9XB 4M1PA 4B3RT 2KSRA 3FZLB 1XMOT 2MTQA 3SOLA 1KFYA 4HGAA 2LSYA 3VKHA 1WLXA 2WZIA 3OPCA 4JUYA 5FXVA 1N36T 4DR4T 4I50E 4F6RC 2I59A 4ILAA 2LSIA 4F8HA 5IHYA 5IWAT 4GK0E 2L9QA 4A98A 4AKHA 4CZZB 3PV0F 2WMOA 1BR0A 2WZHA 1OEDC 4DUZT 4X62T 4QX7B 2Y8DA 4YJ2E 1LVKA 4U33A 3LBXB 1WYCA 5F5WA 2XTLA 4LF6T 3L39A 4U2YA 2AXDS 4X65T 3ETVA 5EZYE 3T1YT 4TWHA 4NPPA 4H9QC 3FHNA 5FY7A 2WBLA 2LSGA 4DMVA 2ZMAA 3RIFA 3LJCA 1HS7A 4YHHT 5LJNA 2EHOC 5JDGA 3LSVA 3KVBA 4IDPA 3UU6A 4EYUA 4JEHB 2YEVC 2D9DA 5JDFA 3Q9DA 4HFHA 5AQGB 2FBWA 2VVNA 4OYJA 1SUMB 3HKCE 3RH3A 4HFCA 1UURA 4X66T 4KMCA 3R84B 4ZI2D 3AE7A 4DR3T 2UUCT 2LSJA 3L09A 3IA3A 4ILBA 2E9XD 3T8OA 3PUYF 4JI6T 2UXXB 2BBHA 2HPLA 4C90A 4PK4A 2LM2A 4P0BA 4AKLA 4TZ4C 3ZMUB 3UU3A 1B7TA 1HX8A 2YU2A 4FI5A 5AQLB 3E22E 5JH7E 1XDPA 3ZSSA 3RPUA 3PUXF 1Z8UA 4DBRA 1UCUA 4OHFA 2CEAA 5AQQB 2XQ5A 3PJAA 1JNRA 2D0UA 1US7B 5BMVE 4E7SA 1ZKEA 1T72A 2HH7A 2V1DB 2X51A 3JC6C 2XAQB 4EZHA 4IE5A 5FXZA 1DU2A 1E1HB 5C2TA 3UULA 4P0AA 1NAFA 2XUEA 3TLVA 4H63H 2LOPA 1FJGT 5LGUB 3T1HT 4H63V 2XQ8A 3O4XE 2KWIB 2CHNA 4FJOA 2ZM6T 4H9PC 2ACXA 5LHIB 4ADZA 4EEBA 1W9RA 4UIGA 2W67A 3RYCE 3RYFE 2XASB 3UUXB 3UFGA 5AQHB 3ZJ2A 2E9XA 3N2OA 2CLYC 3QOFA 3N9PA 4IDQA 3UUBA 3HL6A 5ADXL 1QUUA 3SFEA 2FJEA 1LRZA 5FKYA 4ASKA 1MIWA 1NWMX 5JDMA 5LNKA 1KEYA 1QLBA 3LK3B 1X9BA 2WP9A 5JDHA 5L4EA 4MALA 5ABFB 3P4PA 4JYAT 1SA0E 5LG3A 1ZEEA 5L3EB 4ZI3C 5HXRA 1HX1B 5L4HA 4ZI7E 4KHPT 1YQ3A 4X64T 2IUBA 2LE8A 1H7CA 2Q9QA 3LBXA 1NEKA 3ONLC 4WNKA 4Z8XA 3RYHE 3PUGA 1G73A 3AEAA 2H7OA 4IL4A 4QH4A 4TNVA 2KWHA 3CIRA 4C91A 5DQVA 4DO0A 3N9NA 3O1JA 4CI2B 3ZT7A 3EDVA 2NTXA 5HXCA 1W0BA 4NXNT 4HN9A 3BQLA 3ZN0B 2WMNA 1HNXT 1YD8G 3QC9A 4TV8E 4I0UA 2LKGA 3VRAA 1GQEA 2WWUA 3ZMZB 2WDQA 2JQKA 2PG8A 1VCSA 4HFIA 3C4WA 5FNVE 3KV5A 5DJQC 4EGWA 2CMRA 3PUSA 4LMLA 2UXDT 5LBQB 1XNQT 3PJAJ 3CMLA 2JMKA 3OVUA 2X0YA 3UU4A 2IDOB 1HF8A 5FYMA 4QHOA 4UVBB 2CXFA 4DR2T 2CM0A 2E5VA 1XNRT 2N1GA 5KDMC 4EXTA 5IUXA 4ZXLA 2YINA 4QH5A 4COFA 4LF8T 4IDOA 5AQRB 3FXEB 3UTKA 2BG9B 2YDQA 4YTMA 1FMWA 2DWKA 2PBIA 4ZI2C 2RP4A 3VRBA 2BS3A 1WYBA 3EUHA 4YFSA 2W0GA 2E9XC 1E2AA 5CFBA 1UUSA 5HAXA 1S35A 1U5PA 5EK2A 2BS2A 2N9DA 3I0OA 3GN5B 4QX8B 2UU9T 2ZLYA 3P7IA 3ZCJA 2X9XA 4K0KT 3PU8A 3H3AA 1IZNB 5L3GB 2V7KA 5AQSB 5LGNB 4TX5A 2DI4A 2V7MA 5HEJA 2DWGA 3ZEFB 2FJDA 4UR9A 4ZHQE 5LMNT 4UF0B 4HEAA 3MXZA 5AQNB 2A2FX 5F8PA 3AE6A 4UELA 3EI0A 1HG2A 3AE9A 5JDLA 3IEEA 4PFPA 3FZMB 1N34T 5H6RB 4WZXA 3RI5A 3H37A 5JTGA 1W0AA 5ABFA 4A97A 2ODVA 2PTFA 4JI3T 2NW7A 4CQIA 2VKJA 2SPCA 5J2UE 4EIWA 4YY3T 2K48A 4YXDA 3SRZA 4EYYR 4KBMB 2VKOA 3RYIE 2HN1A 4QXCB 4PJMA 3IHRA 5CJ5A 1MIYA 2NP9A 3FXDB 4GKJT 2Y48B 3K3QC 4AXPA 4YTNA 2R6GF 2XQYA 3ZSTA 5AQOB 4BA9A 2DHRA 3KVAA 3CX8B 2V7JA 4JV5T 4L9IA 1ZV4X 3G06A 4GIWA 2BZBA 2XQ4A 3KV4A 3QB5K 2WDRA 1T7SA 2JJ9A 2E8IA 5JDNA 2ODUA 3AA0B 4I55E 4H9OC 4H9RC 5FY1A 3CX7B 2QRXA 3HKBE 2WU5A 2D0TA 4DUYT 3H3MA 2LHNA 3AA7B 3JCFA 3NVOA 3ABVA 5AQJB 2PFVA 2KT9A 4IT4A 5EK3A 4UV9B 2NW9A 3ZMSB 3L8RA 3C64A 5M4YA 5JR9B 2LSKA 1IBLT 3N9MA 2HN2A 1VRBA 4HWHA 3AE8A 4LF4T 2A72A 3FZFB 1WR6A 3N2GE 2LM9A 2RA1A 1YW0A 4EEDA 2J1DG 3DTOA 3GWHA 1VOMA 5AQMB 5TAOA 4TNWA 2VVSA 2CBIA 4L0RA 3OKQA 4QXHB 4P09A 5HEUA 2XQ6A 3CX6B 5HXHA 4LFAT 4DR1T 2WSSV 5LP6E 5HYAA 3S4UA 3MK7C 1HR0T 3HI2A 3GN5A 3KV6A 5FXXA 1XWMA 2RPAA 1CUNA 3HR0A 2I6HA 3EABA 2LEHA 4NXMT 4JI7T 3OBVE 1WCRA 4AKGA 5FVLA 3W15B 2WY2A 4CN1A 2ACZA 3Q2MA 2X9WA 4KUMB 2V6XA 4MLKA 3SFDA 4UF0A 4I4TE 1KK7A 1UX4A 3X1DA 2X9HA 3SS1A 4ZEYA 3P4WA 1J1JA 2E2AA 4IE6A 3RKGA 1ZHCA 3HA4A 3OYXA 2W61A 3QK6A 4DV0T 3IF8B 5LCYA 4JI2T 3RX6A 2VL8A 5DABA 3UQ4A 4DVDA 4GK5E 2ES0A 2WCAA 1D0ZA 4A5XA 5C3JA 4GKKT 1ZP0A 3Q5DA 4KX6A 3AE3A 1D1BA 1D0XA 2FJAA 3ANWB 1D1AA 4H9SE 2M6IA 4DV6T 2M67A 5AFUL 2IC9A 3CVRA 4BJNA 2H3RA 1JNZA 3P4RA 5KX5E 3PUVF 3PUWF 2DCFA 5JRCB 2ZM8A 2XJ7A 2UXNB 2CA5A 3UU8A 2I0MA 5HXEA 5L2LA 1IBKT 2B76A 2CHOA 3AE4A 4DMWA 2K9AA 4O4IE 4GOUA 1IJ5A 4HTEA 3N9LA 5LYJE 4YSYA 1MNDA 1D1CA 1MMDA 3VR9A 3O1IA 4OK0A 5L3BB 5LG4A 3MKDA 1BR2A 4L5GA 4PAGA 4DNDA 4DV5T 3AEDA 4PW8A 2BG9C 1BR4A 5ABHA 2BDEA 2M6BA 5HWXA 2DNXA 3P50A 5JR9A 3ZPOA 3CPZA 3NZQA 5FMNA 3OJAA 5FL0A 1WR0A 5CA0E 2BKOA 4DR6T 1BR1A 2YU1A 3NBXX 2CWOA 4PJNA 4MBQA 4MFRA 4HFBA 1VCTA 2XZEA 4DR5T 4CN4A 2VK9A 1AJ3A 1S94A 4U7YA 3PUAA 3WAJA 2LJLA 4CN6A 4JI0T 4X20E 3ZCIA 4G63A 2ZM0A 4HWFA 2V7LA 4PJLA 3ZYKA 2JQQA 2WU2A 4ILCA 3QUJA 5LA6E 3NRYA 4IE4A 4PFOA 3MA9A 3Q5WA 3I9WA 4HWDA 3UQ7A 2WAUA 5LB7B 3N2KE 4O4LE
chains in the Genus database with same CATH topology
4PFPA 2D2SA 2Y6XA 4YJ2E 4I43B 1LVKA 2QGSA 5H6RB 3AVSA 3LBXB 5J1GA 4X1YE 4H9NC 1WYCA 2XTLA 3H37A 4IDZA 3VKGA 5E0OA 3C4ZA 2ODVA 5CA1E 2NW7A 4CQIA 2VKJA 1OXZA 4XZCA 2SPCA 5J2UE 3ETVA 5EZYE 4EIWA 4H9QC 3FHNA 5FY7A 2K48A 1MNEA 2LSGA 2WBLA 4DMVA 3SRZA 3FB2A 2YK0A 4EYYR 4KBMB 3WI3A 2ZMAA 3LJCA 2VKOA 2XHEB 1HS7A 2WM9A 2EHOC 2Z6EA 5JDGA 1T98A 1UX5A 3RYIE 4QXCB 3KVBA 4PJMA 5LHHB 5GONE 2K24A 3UFEA 3IHRA 4EYUA 1MIYA 2NP9A 3FXDB 4JEHB 2YEVC 5LBMA 2EHOB 3NZPA 1FEWA 3Q9DA 5JDFA 3I1AA 1D0YA 4OYJA 2Y48B 3HKCE 4EAHA 2VB6A 2X68A 3K3QC 3RH3A 2BVLA 2LOSA 4WBNE 4AXPA 3C50A 4KMCA 2XQYA 3J9X1 3R84B 4ZI2D 2V26A 3HKEE 5HWYA 3ZC0A 5CB4E 4AKRB 2VKDA 5LHGB 2CE7A 2KZ7B 3ANWA 3PTRB 5FY0A 2L8KA 4YJ3E 2LSJA 4BA9A 2DHRA 3C98B 3KVAA 3L09A 2E9XD 3UT5E 3CX8B 2KNDA 2V7JA 3U78A 2VASA 3T8OA 4QWNB 4L9IA 1ZV4X 4GIWA 2UXXB 2KXPB 2BZBA 3ZYMA 3KV4A 2HPLA 3PUQA 4C90A 4UEMA 2V7IA 5JRCA 4PK4A 2JJ9A 4P0BA 2E8IA 4AKLA 2VWAA 5JDNA 4TZ4C 2ODUA 5J2TE 3AA0B 3KINB 3ZMUB 3GMIA 4I55E 1B7TA 1HX8A 2YU2A 5LJNA 4H9OC 4FI5A 4H9RC 3AB3B 5FY1A 3CX7B 3E22E 3N9OA 5JH7E 2P9BA 3HKBE 3O1HA 3BQIA 2MOZA 3RC8A 3RPUA 2JMHA 2D0TA 2PJQA 2MBGA 4DBRA 1UCUA 3MZKB 3RRWA 4EB6E 3PU3A 3RKOA 4IIJE 2LHNA 3ZLIA 2C5KT 3BK9A 3AA7B 4OHFA 5L3DB 2QA7A 2CEAA 2PFVA 4U72A 2KT9A 5LOVE 5EK3A 3L3PA 4UV9B 2NW9A 3N9QA 3ZMSB 5JR9C 2D0UA 2XAGB 4NUUA 4CI1B 1US7B 5BMVE 4E7SA 3B57A 1QSDA 3C64A 5M4YA 2ZM2A 2LSKA 4ISTA 1ZKEA 4NUVA 5JR9B 2HH7A 2V1DB 3PDYA 2X51A 3N9MA 1VRBA 3JC6C 2A72A 1FIOA 2CXDA 2XAQB 4EZHA 4IE5A 2X0LB 4OYKA 3VU7H 5FXZA 2NW8A 3N5LA 1WR6A 1E1HB 4ZOLE 5F3JA 1SHZC 3N2GE 3UULA 5FP3A 4P0AA 1NAFA 3F2EA 2LM9A 2XUEA 4H63H 4O2AE 1U4QA 2LOPA 3RRCA 3V5SA 2RA1A 1YW0A 3K8PC 5LGUB 2J1DG 4H63V 1HTJF 3DTOA 3GWHA 1VOMA 3BQKA 3O4XE 5TAOA 4HE8A 2KWIB 4EZ4A 3AAEB 3KDSE 4IHJE 3E08A 3AAAB 3KBUA 1LKXA 3LK42 3OKQA 4FJOA 4L0RA 4QXHB 4HKAA 4P09A 4H9PC 4UVAB 2ACXA 3PURA 5LHIB 2VKHA 4ZS2A 5LXTE 4ADZA 1FMVA 3CX6B 2EHOD 1OWAA 4UIGA 5HXHA 3ZJ1A 2XAHB 3RYCE 3DP7A 4O2BE 4JLEA 3RYFE 2XASB 3UUXB 3D0TA 4AQGA 2WSSV 2CCQA 3ZJ2A 3CQCB 5LP6E 4JEUB 4AQFA 2E9XA 3I0QA 2CLYC 3N2OA 3N9PA 3HL6A 4UVCB 5HYAA 3S4UA 4J2CA 3MK7C 2X67A 4IE0A 5ADXL 3J7Yq 4TUYE 4XBFB 2CLYB 3HI2A 3GN5A 3KV6A 1QUUA 1O3XA 1Z0PA 5FXXA 4QKNA 1CUNA 1LRZA 3HR0A 4ASKA 3MACA 1MIWA 2LEHA 2IC6A 1MMGA 1NWMX 5JDMA 3OBVE 1V9DA 5LNKA 4AKGA 3UUMA 4YLHA 5HXSA 2L3LA 3W15B 3LK3B 4BAYB 5JDHA 3R6NA 3K3NA 4X1KE 4MALA 3Q2MA 2X9WA 4G2AA 1SA0E 4KUMB 2G0UA 3KFWX 4MLKA 3VHLA 4UF0A 4I4TE 1KK7A 1UX4A 2NWBA 3ZC1A 5C8YE 3OYZA 2X9HA 4IE7A 3SS1A 1ZEEA 2K5BB 5L3EB 4ZI3C 4E7ZA 5HXRA 3V5UA 2CWYA 4IE6A 1ZHCA 3HA4A 3OYXA 3CKDA 4ZI7E 4HFVA 1YKEB 2W61A 2KINB 2LE8A 3QK6A 3AA1B 1H7CA 3IF8B 2Q9QA 5LCYA 3SWHA 3LBXA 1EZ3A 3RX6A 4B6XA 3F31A 2VL8A 5DABA 3LG7A 4PK5A 4WNKA 3AA6B 4Z8XA 4O4HE 3AVRA 4V1Av 4DVDA 1YKHB 4GK5E 3RC3A 2ES0A 3RYHE 5JDQA 3ZYLA 3PUGA 5H6QB 1G73A 1D0ZA 2BVMA 2W00A 3U3IA 4ANJA 3O9XA 1D1BA 2H7OA 1D0XA 3JC6D 2KWHA 4A56A 3ANWB 1D1AA 4H9SE 3LFMA 2X9YA 5L3FB 2M67A 4C91A 3ZMTB 5AFUL 5DQVA 2IC9A 4DO0A 3N9NA 2IW5B 3O1JA 2JPFA 4CI2B 3ZN1B 5LJMA 3EDVA 3GA8A 2NTXA 5HXCA 4ZS3A 4WBOA 3CVRA 4BJNA 4ISSA 4HN9A 2W62A 3BQLA 2H3RA 3ZN0B 2EHOA 1LVFA 2WMNA 5KX5E 4ILUA 3C4XA 1YD8G 1MMAA 2DCFA 4BJMA 5JRCB 3QC9A 4TV8E 2ZM8A 5JREA 3KBTA 4AKIA 2DLRA 2WWUA 3ZMZB 2UXNB 2B1EA 2CA5A 2PG8A 5HXEA 1IAPA 5L2LA 5ETWA 3KV9A 4AI6A 2GK9A 3F57A 2Q9QC 3C4WA 5FNVE 4DMWA 3KV5A 2C5IT 2LT3A 5DJQC 2CMRA 2K9AA 2Q9QB 3FBLA 3PUSA 5IYZE 3WAKA 2C0SA 3C51A 2HPJA 3PE0A 4N78D 1HFAA 5FXWA 5EK4A 5LBQB 3EDUA 4O4IE 3CQGB 2H7VC 4GOUA 1IJ5A 2NTYA 4HTEA 1Y64B 3N9LA 5LYJE 1MIVA 1MNDA 1D1CA 3ZMVB 1MMDA 3CMLA 3LK2B 2JMKA 4TN7B 5KMGP 4IGUA 3O1IA 4GYRA 5A1LA 4OK0A 2MYSA 3TKLB 5L3BB 4PJJA 2N2NA 3CQXC 3K3OA 5LG4A 1G8XA 1HF8A 5FYMA 2C5JA 3MKDA 3AAIA 5L3CB 4QHOA 1KNZA 4UVBB 5JVDE 3E0ZA 2CXFA 2D5UA 2CM0A 1X79A 1BR2A 4UV8B 4L5GA 4PAGA 4DNDA 3HKDE 4EOZB 4CXWA 4PNIA 4DBQA 2N1GA 5KDMC 4EXTA 4O8SA 2CXLA 2YINA 4PW8A 4KP3C 1IJ6A 2KMFA 1BR4A 4ZI3D 3FXEB 2BDEA 2NOXA 2W63A 3NRXA 5HWXA 2DNXA 3UTKA 3DJBA 2A3DA 4OFZA 5JR9A 1FMWA 1WRDA 3ZPOA 2JRKA 3CPZA 2DWKA 1HCIA 2PBIA 2XAFB 4ZI2C 2LHRA 4CXXA 2RP4A 3NZQA 3P8CD 2XAJB 4MHCA 2KLQA 5FMNA 1HG5A 3OJAA 1WYBA 4QXBB 3EUHA 3A5XA 4YFSA 4YHJA 3ESLA 3I9YA 5CA0E 2W0GA 4AQFC 2E9XC 2X66A 4UXNB 5HAXA 1BR1A 1S35A 1U5PA 4ERRA 2YU1A 3NBXX 2CWOA 2E9XB 4PJNA 5EK2A 2N9DA 4M1PA 4GYSA 4MBQA 4MFRA 2MTQA 3SOLA 1MMNA 3I0OA 2VK9A 4HGAA 3ETUA 2LSYA 3GN5B 3M65A 4QX8B 1AJ3A 2ZLYA 3EVYA 3P7IA 3ZCJA 5JQGE 3VKHA 2X9XA 1S94A 1WLXA 4K0UA 3PUAA 3WAJA 3PU8A 4O4JE 2IAKA 1IZNB 3H3AA 5L3GB 2V7KA 2LJLA 4X20E 4JUYA 5FXVA 4I50E 4PK6A 3ZCIA 4G63A 2ZM0A 4F6RC 2I59A 4TX5A 2V7LA 2LSIA 4X1IE 3CWZB 4PJLA 5LGNB 4CXYA 2DI4A 2V7MA 5IHYA 3ZYKA 2DWGA 3UUNA 3ZEFB 2JQQA 3Q5XA 4GK0E 5LGTB 2L9QA 4ZHQE 4UF0B 3QUJA 3B13A 4HEAA 5LA6E 4AKHA 3ONXA 3MJXA 3MXZA 3NRYA 4CZZB 4IE4A 2A2FX 4PFOA 3MA9A 4XAXB 2WMOA 3Q5WA 5F8PA 4UELA 3I9WA 3IBPA 2Q9QD 1BR0A 4CI3B 1HG2A 2WAUA 5DQWA 4WW0A 4U74A 5JDLA 3IEEA 3FBZA 4TV9E 2OA5A 4QX7B 2Y8DA 3N2KE 4O4LE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QXB B;  4QWN B;  4QX8 B;  4QXC B;  4QXH B;  4QX7 B;  4TN7 B; 
#chains in the Genus database with same CATH topology
 2XY8 B;  2XQ3 A;  4I43 B;  4B3M T;  4DR7 T;  3AVS A;  2VUR A;  4X1Y E;  4YSX A;  5E0O A;  4Z91 A;  2YOE A;  1OXZ A;  4XZC A;  5FL1 A;  1MNE A;  3WI3 A;  2XHE B;  2WM9 A;  1UX5 A;  1IBM T;  2K24 A;  2XM1 A;  5LBM A;  1I94 T;  2WS3 A;  4NIQ A;  3I1A A;  2WDV A;  1D0Y A;  2VL0 A;  2UUA T;  2XQA A;  3C50 A;  5KXJ A;  1N33 T;  3ZC0 A;  3QNU A;  5CB4 E;  2VKD A;  3ANW A;  3PTR B;  5FY0 A;  3OTO T;  3RQU A;  1T8B A;  2L8K A;  2J47 A;  3UT5 E;  2J4G A;  4LMK A;  4QWN B;  3ZYM A;  2LRL A;  2FUP A;  4DV2 T;  5JRC A;  3TLS A;  2VWA A;  2J62 A;  2XM2 A;  5J2T E;  4B3T T;  3GMI A;  3N9O A;  1I6Z A;  3RC8 A;  2UXB T;  2JMH A;  5AQI B;  2PJQ A;  2MBG A;  2IML A;  3MZK B;  4EB6 E;  4IIJ E;  5L3D B;  2C5K T;  2QA7 A;  4U72 A;  5JR9 C;  4NUU A;  3B57 A;  3EAM A;  5ABG A;  2ZM2 A;  4NUV A;  5CGM A;  4LFC T;  3PDY A;  3K1S A;  1FIO A;  4OYK A;  2X0L B;  3VU7 H;  2NW8 A;  1SHZ C;  2MAW A;  2LKH A;  1U4Q A;  3V5S A;  3K8P C;  4EZ4 A;  2JQ9 A;  3FZK B;  4IHJ E;  3E08 A;  1LKX A;  3LK4 2;  1UGO A;  3ZJ1 A;  2BG9 E;  4JI5 T;  2OV9 A;  2X0H A;  3D0T A;  4JEU B;  4WYV A;  3P4Q A;  1J5E T;  4J2C A;  4X5T A;  4IE0 A;  3J7Y q;  4XBF B;  1Y01 A;  3VR8 A;  1Z0P A;  1O3X A;  3FZH B;  3MAC A;  5AQU B;  1MMG A;  2W66 A;  1V9D A;  2L3L A;  2K3W A;  4BAY B;  4X1K E;  4LFB T;  2G0U A;  3VHL A;  2V5C A;  3ZC1 A;  4IE7 A;  4DV4 T;  3V5U A;  2QYW A;  3RGL A;  4LF9 T;  2H89 A;  3SWH A;  1HNZ T;  3RLF F;  3AA6 B;  4O4H E;  3RC3 A;  2WB5 A;  3ZYL A;  5H6Q B;  3U3I A;  3P4S A;  4ANJ A;  4YSZ A;  3O9X A;  4JI1 T;  2V8S V;  2YDR A;  3PUZ F;  4A56 A;  3AEF A;  2X9Y A;  5L3F B;  5LJM A;  3GA8 A;  1UK5 A;  3ZKR A;  2W62 A;  1LVF A;  3B5M A;  4ILU A;  5AQT B;  4BJM A;  4B3S T;  3KBT A;  2DLR A;  3A8Y C;  1IAP A;  4YT0 A;  5ETW A;  2WQY A;  2BG9 A;  2A9U A;  2C5I T;  4IRE A;  4KI0 F;  2Q9Q B;  3FBL A;  5IYZ E;  3WAK A;  3TLW A;  3C51 A;  3RHW A;  2NTY A;  1Y64 B;  2UXC T;  2YN6 A;  3LK2 B;  4TN7 B;  5KMG P;  4GYR A;  2MYS A;  3TKL B;  4PJJ A;  2N2N A;  3CQX C;  3K3O A;  1G8X A;  1R8I A;  4DV3 T;  3AAI A;  5L3C B;  5JVD E;  2V6Y B;  2D5U A;  4UV8 B;  4EOZ B;  3HKD E;  4PNI A;  4DV7 T;  4DBQ A;  2LRK A;  4KP3 C;  1IJ6 A;  3M3Z B;  2NOX A;  3NRX A;  2IHR 1;  3DJB A;  4OFZ A;  3A7M A;  2LHR A;  4CXX A;  3P8C D;  2XAJ B;  4MHC A;  4QXB B;  3TLT A;  3ESL A;  4UXN B;  3EHZ A;  3RF1 A;  4ERR A;  2F4V T;  1M7K A;  2VQE T;  4GYS A;  4JI4 T;  1MMN A;  2CBJ A;  3ETU A;  3M65 A;  3EVY A;  4YTP A;  5JQG E;  4K0U A;  2MPK A;  4O4J E;  2IAK A;  4PK6 A;  2XPK A;  3Q5E A;  4X1I E;  4CXY A;  3CWZ B;  3UUN A;  3Q5X A;  1ZOY A;  5LGT B;  3JAE A;  3B13 A;  3ONX A;  3MJX A;  4HFD A;  4XAX B;  4JBW F;  2YDS A;  3IBP A;  2Q9Q D;  4CI3 B;  5DQW A;  4WW0 A;  4U74 A;  3FBZ A;  4TV9 E;  2OA5 A;  3ZT6 A;  4JLE A;  2D2S A;  2Y6X A;  4LF5 T;  1OED B;  2QGS A;  3QB5 A;  5J1G A;  4H9N C;  4IDZ A;  3VKG A;  3C4Z A;  4TWD A;  5CA1 E;  2H88 A;  4DV1 T;  3ZT5 A;  5HEO A;  5L47 A;  3FB2 A;  2YK0 A;  2XQ9 A;  5HCJ A;  2Z6E A;  1E7P A;  1T98 A;  5LHH B;  5GON E;  3UFE A;  1YXR A;  3AXJ B;  3UU5 A;  5ABE A;  2EHO B;  4LF7 T;  3NZP A;  1FEW A;  4EAH A;  5LMU T;  3RQW A;  2VB6 A;  2X68 A;  2BVL A;  2LOS A;  4WBN E;  4ZZB A;  3J9X 1;  2V26 A;  3HKE E;  5HWY A;  5LHG B;  4AKR B;  2CE7 A;  2KZ7 B;  5AQV B;  2V5D A;  1N32 T;  4DID B;  4YJ3 E;  3AE2 A;  3NKZ A;  1KNP A;  3C98 B;  2KND A;  3U78 A;  3AE5 A;  2VAS A;  2IIU A;  2KXP B;  3PUQ A;  2UUB T;  4UEM A;  2V7I A;  1KF6 A;  4OX9 T;  3KIN B;  4AIU A;  3AB3 B;  2BS4 A;  2P9B A;  1J5W A;  3BQI A;  3O1H A;  2MOZ A;  4IL9 A;  1CHU A;  2BBJ A;  3RRW A;  3PU3 A;  3RKO A;  3ZLI A;  3BK9 A;  3RIU A;  5J0Z A;  4U31 A;  4P1N A;  5LOV E;  2CRB A;  1OED E;  3L3P A;  3N9Q A;  3NWI A;  5AQP B;  4U7I A;  2XAG B;  4CI1 B;  1QSD A;  4IST A;  4QH1 A;  4U3C A;  2CXD A;  3N5L A;  1XMQ T;  2V6Y A;  5F3J A;  4ZOL E;  5FP3 A;  2VQF T;  3F2E A;  4O2A E;  3RRC A;  5HCM A;  1SE7 A;  1HTJ F;  2YKS A;  3BQK A;  4LMJ A;  4HE8 A;  4IDN A;  3AAE B;  3KDS E;  4TWF A;  3AAA B;  3KBU A;  2AE9 A;  3AEB A;  4HKA A;  4UVA B;  3PUR A;  5LXT E;  2HHH T;  2VKH A;  4ZS2 A;  1FMV A;  2EHO D;  1OWA A;  2XAH B;  3DP7 A;  4O2B E;  2QVA A;  4AQG A;  2CCQ A;  3CQC B;  4AQF A;  3JAD A;  3I0Q A;  4UVC B;  2X67 A;  1HNW T;  4TUY E;  2CLY B;  2WWV A;  4QKN A;  2W2U A;  2IC6 A;  1WFD A;  2BKN A;  2XQ7 A;  1XZY A;  4HWI B;  3UUM A;  4YLH A;  1KNR A;  5HXS A;  3CK6 A;  3R6N A;  3K3N A;  4G2A A;  2JIW A;  3KFW X;  2NWB A;  5C8Y E;  2XSA A;  5FVK A;  3OYZ A;  5HEH A;  2K5B B;  4E7Z A;  2CWY A;  5HEG A;  3CKD A;  4HFV A;  1YKE B;  2KIN B;  3AA1 B;  2BKP A;  1OED A;  4B6X A;  1EZ3 A;  3F31 A;  3LG7 A;  4PK5 A;  3AVR A;  4V1A v;  1YKH B;  5JDQ A;  2BVM A;  2W00 A;  1L0V A;  5AQK B;  1W09 A;  3AEE A;  3JC6 D;  3LFM A;  5AQF B;  3ZMT B;  1YQ4 A;  2IW5 B;  2JPF A;  3ZN1 B;  4JI8 T;  4ZS3 A;  4WBO A;  4ISS A;  2W4X A;  3AXJ A;  2EHO A;  3C4X A;  1MMA A;  3ONJ A;  5JRE A;  1XDO A;  4AKI A;  3RIA A;  2B1E A;  2CPT A;  2LLY A;  4EV6 A;  1M62 A;  3KV9 A;  4AI6 A;  2GK9 A;  3F57 A;  2Q9Q C;  4HFE A;  4ZZC A;  2LT3 A;  3RIU C;  2C0S A;  2JQH A;  2DL1 A;  2HPJ A;  3PE0 A;  4N78 D;  1HFA A;  5FXW A;  5EK4 A;  3EDU A;  3CQG B;  2H7V C;  4HWC A;  2NR4 A;  5BR8 T;  3TLU A;  1MIV A;  3ZMV B;  1NEN A;  4IGU A;  5A1L A;  2XSB A;  3AEC A;  2C5J A;  4AQY T;  3JAF A;  1KNZ A;  3E0Z A;  1X79 A;  4Z90 A;  3AE1 A;  4U2Z A;  4CXW A;  4O8S A;  2CXL A;  2KMF A;  4Q25 A;  4ZI3 D;  2W63 A;  2A3D A;  3AEG A;  1WRD A;  2JRK A;  1HCI A;  2XAF B;  3LDQ B;  2KLQ A;  1HG5 A;  4AIS A;  3A5X A;  4YHJ A;  3I9Y A;  4KHZ F;  4AQF C;  2OLT A;  2X66 A;  2FJB A;  2E5L T;  2E9X B;  4M1P A;  4B3R T;  2KSR A;  3FZL B;  1XMO T;  2MTQ A;  3SOL A;  1KFY A;  4HGA A;  2LSY A;  3VKH A;  1WLX A;  2WZI A;  3OPC A;  4JUY A;  5FXV A;  1N36 T;  4DR4 T;  4I50 E;  4F6R C;  2I59 A;  4ILA A;  2LSI A;  4F8H A;  5IHY A;  5IWA T;  4GK0 E;  2L9Q A;  4A98 A;  4AKH A;  4CZZ B;  3PV0 F;  2WMO A;  1BR0 A;  2WZH A;  1OED C;  4DUZ T;  4X62 T;  4QX7 B;  2Y8D A;  4YJ2 E;  1LVK A;  4U33 A;  3LBX B;  1WYC A;  5F5W A;  2XTL A;  4LF6 T;  3L39 A;  4U2Y A;  2AXD S;  4X65 T;  3ETV A;  5EZY E;  3T1Y T;  4TWH A;  4NPP A;  4H9Q C;  3FHN A;  5FY7 A;  2WBL A;  2LSG A;  4DMV A;  2ZMA A;  3RIF A;  3LJC A;  1HS7 A;  4YHH T;  5LJN A;  2EHO C;  5JDG A;  3LSV A;  3KVB A;  4IDP A;  3UU6 A;  4EYU A;  4JEH B;  2YEV C;  2D9D A;  5JDF A;  3Q9D A;  4HFH A;  5AQG B;  2FBW A;  2VVN A;  4OYJ A;  1SUM B;  3HKC E;  3RH3 A;  4HFC A;  1UUR A;  4X66 T;  4KMC A;  3R84 B;  4ZI2 D;  3AE7 A;  4DR3 T;  2UUC T;  2LSJ A;  3L09 A;  3IA3 A;  4ILB A;  2E9X D;  3T8O A;  3PUY F;  4JI6 T;  2UXX B;  2BBH A;  2HPL A;  4C90 A;  4PK4 A;  2LM2 A;  4P0B A;  4AKL A;  4TZ4 C;  3ZMU B;  3UU3 A;  1B7T A;  1HX8 A;  2YU2 A;  4FI5 A;  5AQL B;  3E22 E;  5JH7 E;  1XDP A;  3ZSS A;  3RPU A;  3PUX F;  1Z8U A;  4DBR A;  1UCU A;  4OHF A;  2CEA A;  5AQQ B;  2XQ5 A;  3PJA A;  1JNR A;  2D0U A;  1US7 B;  5BMV E;  4E7S A;  1ZKE A;  1T72 A;  2HH7 A;  2V1D B;  2X51 A;  3JC6 C;  2XAQ B;  4EZH A;  4IE5 A;  5FXZ A;  1DU2 A;  1E1H B;  5C2T A;  3UUL A;  4P0A A;  1NAF A;  2XUE A;  3TLV A;  4H63 H;  2LOP A;  1FJG T;  5LGU B;  3T1H T;  4H63 V;  2XQ8 A;  3O4X E;  2KWI B;  2CHN A;  4FJO A;  2ZM6 T;  4H9P C;  2ACX A;  5LHI B;  4ADZ A;  4EEB A;  1W9R A;  4UIG A;  2W67 A;  3RYC E;  3RYF E;  2XAS B;  3UUX B;  3UFG A;  5AQH B;  3ZJ2 A;  2E9X A;  3N2O A;  2CLY C;  3QOF A;  3N9P A;  4IDQ A;  3UUB A;  3HL6 A;  5ADX L;  1QUU A;  3SFE A;  2FJE A;  1LRZ A;  5FKY A;  4ASK A;  1MIW A;  1NWM X;  5JDM A;  5LNK A;  1KEY A;  1QLB A;  3LK3 B;  1X9B A;  2WP9 A;  5JDH A;  5L4E A;  4MAL A;  5ABF B;  3P4P A;  4JYA T;  1SA0 E;  5LG3 A;  1ZEE A;  5L3E B;  4ZI3 C;  5HXR A;  1HX1 B;  5L4H A;  4ZI7 E;  4KHP T;  1YQ3 A;  4X64 T;  2IUB A;  2LE8 A;  1H7C A;  2Q9Q A;  3LBX A;  1NEK A;  3ONL C;  4WNK A;  4Z8X A;  3RYH E;  3PUG A;  1G73 A;  3AEA A;  2H7O A;  4IL4 A;  4QH4 A;  4TNV A;  2KWH A;  3CIR A;  4C91 A;  5DQV A;  4DO0 A;  3N9N A;  3O1J A;  4CI2 B;  3ZT7 A;  3EDV A;  2NTX A;  5HXC A;  1W0B A;  4NXN T;  4HN9 A;  3BQL A;  3ZN0 B;  2WMN A;  1HNX T;  1YD8 G;  3QC9 A;  4TV8 E;  4I0U A;  2LKG A;  3VRA A;  1GQE A;  2WWU A;  3ZMZ B;  2WDQ A;  2JQK A;  2PG8 A;  1VCS A;  4HFI A;  3C4W A;  5FNV E;  3KV5 A;  5DJQ C;  4EGW A;  2CMR A;  3PUS A;  4LML A;  2UXD T;  5LBQ B;  1XNQ T;  3PJA J;  3CML A;  2JMK A;  3OVU A;  2X0Y A;  3UU4 A;  2IDO B;  1HF8 A;  5FYM A;  4QHO A;  4UVB B;  2CXF A;  4DR2 T;  2CM0 A;  2E5V A;  1XNR T;  2N1G A;  5KDM C;  4EXT A;  5IUX A;  4ZXL A;  2YIN A;  4QH5 A;  4COF A;  4LF8 T;  4IDO A;  5AQR B;  3FXE B;  3UTK A;  2BG9 B;  2YDQ A;  4YTM A;  1FMW A;  2DWK A;  2PBI A;  4ZI2 C;  2RP4 A;  3VRB A;  2BS3 A;  1WYB A;  3EUH A;  4YFS A;  2W0G A;  2E9X C;  1E2A A;  5CFB A;  1UUS A;  5HAX A;  1S35 A;  1U5P A;  5EK2 A;  2BS2 A;  2N9D A;  3I0O A;  3GN5 B;  4QX8 B;  2UU9 T;  2ZLY A;  3P7I A;  3ZCJ A;  2X9X A;  4K0K T;  3PU8 A;  3H3A A;  1IZN B;  5L3G B;  2V7K A;  5AQS B;  5LGN B;  4TX5 A;  2DI4 A;  2V7M A;  5HEJ A;  2DWG A;  3ZEF B;  2FJD A;  4UR9 A;  4ZHQ E;  5LMN T;  4UF0 B;  4HEA A;  3MXZ A;  5AQN B;  2A2F X;  5F8P A;  3AE6 A;  4UEL A;  3EI0 A;  1HG2 A;  3AE9 A;  5JDL A;  3IEE A;  4PFP A;  3FZM B;  1N34 T;  5H6R B;  4WZX A;  3RI5 A;  3H37 A;  5JTG A;  1W0A A;  5ABF A;  4A97 A;  2ODV A;  2PTF A;  4JI3 T;  2NW7 A;  4CQI A;  2VKJ A;  2SPC A;  5J2U E;  4EIW A;  4YY3 T;  2K48 A;  4YXD A;  3SRZ A;  4EYY R;  4KBM B;  2VKO A;  3RYI E;  2HN1 A;  4QXC B;  4PJM A;  3IHR A;  5CJ5 A;  1MIY A;  2NP9 A;  3FXD B;  4GKJ T;  2Y48 B;  3K3Q C;  4AXP A;  4YTN A;  2R6G F;  2XQY A;  3ZST A;  5AQO B;  4BA9 A;  2DHR A;  3KVA A;  3CX8 B;  2V7J A;  4JV5 T;  4L9I A;  1ZV4 X;  3G06 A;  4GIW A;  2BZB A;  2XQ4 A;  3KV4 A;  3QB5 K;  2WDR A;  1T7S A;  2JJ9 A;  2E8I A;  5JDN A;  2ODU A;  3AA0 B;  4I55 E;  4H9O C;  4H9R C;  5FY1 A;  3CX7 B;  2QRX A;  3HKB E;  2WU5 A;  2D0T A;  4DUY T;  3H3M A;  2LHN A;  3AA7 B;  3JCF A;  3NVO A;  3ABV A;  5AQJ B;  2PFV A;  2KT9 A;  4IT4 A;  5EK3 A;  4UV9 B;  2NW9 A;  3ZMS B;  3L8R A;  3C64 A;  5M4Y A;  5JR9 B;  2LSK A;  1IBL T;  3N9M A;  2HN2 A;  1VRB A;  4HWH A;  3AE8 A;  4LF4 T;  2A72 A;  3FZF B;  1WR6 A;  3N2G E;  2LM9 A;  2RA1 A;  1YW0 A;  4EED A;  2J1D G;  3DTO A;  3GWH A;  1VOM A;  5AQM B;  5TAO A;  4TNW A;  2VVS A;  2CBI A;  4L0R A;  3OKQ A;  4QXH B;  4P09 A;  5HEU A;  2XQ6 A;  3CX6 B;  5HXH A;  4LFA T;  4DR1 T;  2WSS V;  5LP6 E;  5HYA A;  3S4U A;  3MK7 C;  1HR0 T;  3HI2 A;  3GN5 A;  3KV6 A;  5FXX A;  1XWM A;  2RPA A;  1CUN A;  3HR0 A;  2I6H A;  3EAB A;  2LEH A;  4NXM T;  4JI7 T;  3OBV E;  1WCR A;  4AKG A;  5FVL A;  3W15 B;  2WY2 A;  4CN1 A;  2ACZ A;  3Q2M A;  2X9W A;  4KUM B;  2V6X A;  4MLK A;  3SFD A;  4UF0 A;  4I4T E;  1KK7 A;  1UX4 A;  3X1D A;  2X9H A;  3SS1 A;  4ZEY A;  3P4W A;  1J1J A;  2E2A A;  4IE6 A;  3RKG A;  1ZHC A;  3HA4 A;  3OYX A;  2W61 A;  3QK6 A;  4DV0 T;  3IF8 B;  5LCY A;  4JI2 T;  3RX6 A;  2VL8 A;  5DAB A;  3UQ4 A;  4DVD A;  4GK5 E;  2ES0 A;  2WCA A;  1D0Z A;  4A5X A;  5C3J A;  4GKK T;  1ZP0 A;  3Q5D A;  4KX6 A;  3AE3 A;  1D1B A;  1D0X A;  2FJA A;  3ANW B;  1D1A A;  4H9S E;  2M6I A;  4DV6 T;  2M67 A;  5AFU L;  2IC9 A;  3CVR A;  4BJN A;  2H3R A;  1JNZ A;  3P4R A;  5KX5 E;  3PUV F;  3PUW F;  2DCF A;  5JRC B;  2ZM8 A;  2XJ7 A;  2UXN B;  2CA5 A;  3UU8 A;  2I0M A;  5HXE A;  5L2L A;  1IBK T;  2B76 A;  2CHO A;  3AE4 A;  4DMW A;  2K9A A;  4O4I E;  4GOU A;  1IJ5 A;  4HTE A;  3N9L A;  5LYJ E;  4YSY A;  1MND A;  1D1C A;  1MMD A;  3VR9 A;  3O1I A;  4OK0 A;  5L3B B;  5LG4 A;  3MKD A;  1BR2 A;  4L5G A;  4PAG A;  4DND A;  4DV5 T;  3AED A;  4PW8 A;  2BG9 C;  1BR4 A;  5ABH A;  2BDE A;  2M6B A;  5HWX A;  2DNX A;  3P50 A;  5JR9 A;  3ZPO A;  3CPZ A;  3NZQ A;  5FMN A;  3OJA A;  5FL0 A;  1WR0 A;  5CA0 E;  2BKO A;  4DR6 T;  1BR1 A;  2YU1 A;  3NBX X;  2CWO A;  4PJN A;  4MBQ A;  4MFR A;  4HFB A;  1VCT A;  2XZE A;  4DR5 T;  4CN4 A;  2VK9 A;  1AJ3 A;  1S94 A;  4U7Y A;  3PUA A;  3WAJ A;  2LJL A;  4CN6 A;  4JI0 T;  4X20 E;  3ZCI A;  4G63 A;  2ZM0 A;  4HWF A;  2V7L A;  4PJL A;  3ZYK A;  2JQQ A;  2WU2 A;  4ILC A;  3QUJ A;  5LA6 E;  3NRY A;  4IE4 A;  4PFO A;  3MA9 A;  3Q5W A;  3I9W A;  4HWD A;  3UQ7 A;  2WAU A;  5LB7 B;  3N2K E;  4O4L E; 
#chains in the Genus database with same CATH homology
 4PFP A;  2D2S A;  2Y6X A;  4YJ2 E;  4I43 B;  1LVK A;  2QGS A;  5H6R B;  3AVS A;  3LBX B;  5J1G A;  4X1Y E;  4H9N C;  1WYC A;  2XTL A;  3H37 A;  4IDZ A;  3VKG A;  5E0O A;  3C4Z A;  2ODV A;  5CA1 E;  2NW7 A;  4CQI A;  2VKJ A;  1OXZ A;  4XZC A;  2SPC A;  5J2U E;  3ETV A;  5EZY E;  4EIW A;  4H9Q C;  3FHN A;  5FY7 A;  2K48 A;  1MNE A;  2LSG A;  2WBL A;  4DMV A;  3SRZ A;  3FB2 A;  2YK0 A;  4EYY R;  4KBM B;  3WI3 A;  2ZMA A;  3LJC A;  2VKO A;  2XHE B;  1HS7 A;  2WM9 A;  2EHO C;  2Z6E A;  5JDG A;  1T98 A;  1UX5 A;  3RYI E;  4QXC B;  3KVB A;  4PJM A;  5LHH B;  5GON E;  2K24 A;  3UFE A;  3IHR A;  4EYU A;  1MIY A;  2NP9 A;  3FXD B;  4JEH B;  2YEV C;  5LBM A;  2EHO B;  3NZP A;  1FEW A;  3Q9D A;  5JDF A;  3I1A A;  1D0Y A;  4OYJ A;  2Y48 B;  3HKC E;  4EAH A;  2VB6 A;  2X68 A;  3K3Q C;  3RH3 A;  2BVL A;  2LOS A;  4WBN E;  4AXP A;  3C50 A;  4KMC A;  2XQY A;  3J9X 1;  3R84 B;  4ZI2 D;  2V26 A;  3HKE E;  5HWY A;  3ZC0 A;  5CB4 E;  4AKR B;  2VKD A;  5LHG B;  2CE7 A;  2KZ7 B;  3ANW A;  3PTR B;  5FY0 A;  2L8K A;  4YJ3 E;  2LSJ A;  4BA9 A;  2DHR A;  3C98 B;  3KVA A;  3L09 A;  2E9X D;  3UT5 E;  3CX8 B;  2KND A;  2V7J A;  3U78 A;  2VAS A;  3T8O A;  4QWN B;  4L9I A;  1ZV4 X;  4GIW A;  2UXX B;  2KXP B;  2BZB A;  3ZYM A;  3KV4 A;  2HPL A;  3PUQ A;  4C90 A;  4UEM A;  2V7I A;  5JRC A;  4PK4 A;  2JJ9 A;  4P0B A;  2E8I A;  4AKL A;  2VWA A;  5JDN A;  4TZ4 C;  2ODU A;  5J2T E;  3AA0 B;  3KIN B;  3ZMU B;  3GMI A;  4I55 E;  1B7T A;  1HX8 A;  2YU2 A;  5LJN A;  4H9O C;  4FI5 A;  4H9R C;  3AB3 B;  5FY1 A;  3CX7 B;  3E22 E;  3N9O A;  5JH7 E;  2P9B A;  3HKB E;  3O1H A;  3BQI A;  2MOZ A;  3RC8 A;  3RPU A;  2JMH A;  2D0T A;  2PJQ A;  2MBG A;  4DBR A;  1UCU A;  3MZK B;  3RRW A;  4EB6 E;  3PU3 A;  3RKO A;  4IIJ E;  2LHN A;  3ZLI A;  2C5K T;  3BK9 A;  3AA7 B;  4OHF A;  5L3D B;  2QA7 A;  2CEA A;  2PFV A;  4U72 A;  2KT9 A;  5LOV E;  5EK3 A;  3L3P A;  4UV9 B;  2NW9 A;  3N9Q A;  3ZMS B;  5JR9 C;  2D0U A;  2XAG B;  4NUU A;  4CI1 B;  1US7 B;  5BMV E;  4E7S A;  3B57 A;  1QSD A;  3C64 A;  5M4Y A;  2ZM2 A;  2LSK A;  4IST A;  1ZKE A;  4NUV A;  5JR9 B;  2HH7 A;  2V1D B;  3PDY A;  2X51 A;  3N9M A;  1VRB A;  3JC6 C;  2A72 A;  1FIO A;  2CXD A;  2XAQ B;  4EZH A;  4IE5 A;  2X0L B;  4OYK A;  3VU7 H;  5FXZ A;  2NW8 A;  3N5L A;  1WR6 A;  1E1H B;  4ZOL E;  5F3J A;  1SHZ C;  3N2G E;  3UUL A;  5FP3 A;  4P0A A;  1NAF A;  3F2E A;  2LM9 A;  2XUE A;  4H63 H;  4O2A E;  1U4Q A;  2LOP A;  3RRC A;  3V5S A;  2RA1 A;  1YW0 A;  3K8P C;  5LGU B;  2J1D G;  4H63 V;  1HTJ F;  3DTO A;  3GWH A;  1VOM A;  3BQK A;  3O4X E;  5TAO A;  4HE8 A;  2KWI B;  4EZ4 A;  3AAE B;  3KDS E;  4IHJ E;  3E08 A;  3AAA B;  3KBU A;  1LKX A;  3LK4 2;  3OKQ A;  4FJO A;  4L0R A;  4QXH B;  4HKA A;  4P09 A;  4H9P C;  4UVA B;  2ACX A;  3PUR A;  5LHI B;  2VKH A;  4ZS2 A;  5LXT E;  4ADZ A;  1FMV A;  3CX6 B;  2EHO D;  1OWA A;  4UIG A;  5HXH A;  3ZJ1 A;  2XAH B;  3RYC E;  3DP7 A;  4O2B E;  4JLE A;  3RYF E;  2XAS B;  3UUX B;  3D0T A;  4AQG A;  2WSS V;  2CCQ A;  3ZJ2 A;  3CQC B;  5LP6 E;  4JEU B;  4AQF A;  2E9X A;  3I0Q A;  2CLY C;  3N2O A;  3N9P A;  3HL6 A;  4UVC B;  5HYA A;  3S4U A;  4J2C A;  3MK7 C;  2X67 A;  4IE0 A;  5ADX L;  3J7Y q;  4TUY E;  4XBF B;  2CLY B;  3HI2 A;  3GN5 A;  3KV6 A;  1QUU A;  1O3X A;  1Z0P A;  5FXX A;  4QKN A;  1CUN A;  1LRZ A;  3HR0 A;  4ASK A;  3MAC A;  1MIW A;  2LEH A;  2IC6 A;  1MMG A;  1NWM X;  5JDM A;  3OBV E;  1V9D A;  5LNK A;  4AKG A;  3UUM A;  4YLH A;  5HXS A;  2L3L A;  3W15 B;  3LK3 B;  4BAY B;  5JDH A;  3R6N A;  3K3N A;  4X1K E;  4MAL A;  3Q2M A;  2X9W A;  4G2A A;  1SA0 E;  4KUM B;  2G0U A;  3KFW X;  4MLK A;  3VHL A;  4UF0 A;  4I4T E;  1KK7 A;  1UX4 A;  2NWB A;  3ZC1 A;  5C8Y E;  3OYZ A;  2X9H A;  4IE7 A;  3SS1 A;  1ZEE A;  2K5B B;  5L3E B;  4ZI3 C;  4E7Z A;  5HXR A;  3V5U A;  2CWY A;  4IE6 A;  1ZHC A;  3HA4 A;  3OYX A;  3CKD A;  4ZI7 E;  4HFV A;  1YKE B;  2W61 A;  2KIN B;  2LE8 A;  3QK6 A;  3AA1 B;  1H7C A;  3IF8 B;  2Q9Q A;  5LCY A;  3SWH A;  3LBX A;  1EZ3 A;  3RX6 A;  4B6X A;  3F31 A;  2VL8 A;  5DAB A;  3LG7 A;  4PK5 A;  4WNK A;  3AA6 B;  4Z8X A;  4O4H E;  3AVR A;  4V1A v;  4DVD A;  1YKH B;  4GK5 E;  3RC3 A;  2ES0 A;  3RYH E;  5JDQ A;  3ZYL A;  3PUG A;  5H6Q B;  1G73 A;  1D0Z A;  2BVM A;  2W00 A;  3U3I A;  4ANJ A;  3O9X A;  1D1B A;  2H7O A;  1D0X A;  3JC6 D;  2KWH A;  4A56 A;  3ANW B;  1D1A A;  4H9S E;  3LFM A;  2X9Y A;  5L3F B;  2M67 A;  4C91 A;  3ZMT B;  5AFU L;  5DQV A;  2IC9 A;  4DO0 A;  3N9N A;  2IW5 B;  3O1J A;  2JPF A;  4CI2 B;  3ZN1 B;  5LJM A;  3EDV A;  3GA8 A;  2NTX A;  5HXC A;  4ZS3 A;  4WBO A;  3CVR A;  4BJN A;  4ISS A;  4HN9 A;  2W62 A;  3BQL A;  2H3R A;  3ZN0 B;  2EHO A;  1LVF A;  2WMN A;  5KX5 E;  4ILU A;  3C4X A;  1YD8 G;  1MMA A;  2DCF A;  4BJM A;  5JRC B;  3QC9 A;  4TV8 E;  2ZM8 A;  5JRE A;  3KBT A;  4AKI A;  2DLR A;  2WWU A;  3ZMZ B;  2UXN B;  2B1E A;  2CA5 A;  2PG8 A;  5HXE A;  1IAP A;  5L2L A;  5ETW A;  3KV9 A;  4AI6 A;  2GK9 A;  3F57 A;  2Q9Q C;  3C4W A;  5FNV E;  4DMW A;  3KV5 A;  2C5I T;  2LT3 A;  5DJQ C;  2CMR A;  2K9A A;  2Q9Q B;  3FBL A;  3PUS A;  5IYZ E;  3WAK A;  2C0S A;  3C51 A;  2HPJ A;  3PE0 A;  4N78 D;  1HFA A;  5FXW A;  5EK4 A;  5LBQ B;  3EDU A;  4O4I E;  3CQG B;  2H7V C;  4GOU A;  1IJ5 A;  2NTY A;  4HTE A;  1Y64 B;  3N9L A;  5LYJ E;  1MIV A;  1MND A;  1D1C A;  3ZMV B;  1MMD A;  3CML A;  3LK2 B;  2JMK A;  4TN7 B;  5KMG P;  4IGU A;  3O1I A;  4GYR A;  5A1L A;  4OK0 A;  2MYS A;  3TKL B;  5L3B B;  4PJJ A;  2N2N A;  3CQX C;  3K3O A;  5LG4 A;  1G8X A;  1HF8 A;  5FYM A;  2C5J A;  3MKD A;  3AAI A;  5L3C B;  4QHO A;  1KNZ A;  4UVB B;  5JVD E;  3E0Z A;  2CXF A;  2D5U A;  2CM0 A;  1X79 A;  1BR2 A;  4UV8 B;  4L5G A;  4PAG A;  4DND A;  3HKD E;  4EOZ B;  4CXW A;  4PNI A;  4DBQ A;  2N1G A;  5KDM C;  4EXT A;  4O8S A;  2CXL A;  2YIN A;  4PW8 A;  4KP3 C;  1IJ6 A;  2KMF A;  1BR4 A;  4ZI3 D;  3FXE B;  2BDE A;  2NOX A;  2W63 A;  3NRX A;  5HWX A;  2DNX A;  3UTK A;  3DJB A;  2A3D A;  4OFZ A;  5JR9 A;  1FMW A;  1WRD A;  3ZPO A;  2JRK A;  3CPZ A;  2DWK A;  1HCI A;  2PBI A;  2XAF B;  4ZI2 C;  2LHR A;  4CXX A;  2RP4 A;  3NZQ A;  3P8C D;  2XAJ B;  4MHC A;  2KLQ A;  5FMN A;  1HG5 A;  3OJA A;  1WYB A;  4QXB B;  3EUH A;  3A5X A;  4YFS A;  4YHJ A;  3ESL A;  3I9Y A;  5CA0 E;  2W0G A;  4AQF C;  2E9X C;  2X66 A;  4UXN B;  5HAX A;  1BR1 A;  1S35 A;  1U5P A;  4ERR A;  2YU1 A;  3NBX X;  2CWO A;  2E9X B;  4PJN A;  5EK2 A;  2N9D A;  4M1P A;  4GYS A;  4MBQ A;  4MFR A;  2MTQ A;  3SOL A;  1MMN A;  3I0O A;  2VK9 A;  4HGA A;  3ETU A;  2LSY A;  3GN5 B;  3M65 A;  4QX8 B;  1AJ3 A;  2ZLY A;  3EVY A;  3P7I A;  3ZCJ A;  5JQG E;  3VKH A;  2X9X A;  1S94 A;  1WLX A;  4K0U A;  3PUA A;  3WAJ A;  3PU8 A;  4O4J E;  2IAK A;  1IZN B;  3H3A A;  5L3G B;  2V7K A;  2LJL A;  4X20 E;  4JUY A;  5FXV A;  4I50 E;  4PK6 A;  3ZCI A;  4G63 A;  2ZM0 A;  4F6R C;  2I59 A;  4TX5 A;  2V7L A;  2LSI A;  4X1I E;  3CWZ B;  4PJL A;  5LGN B;  4CXY A;  2DI4 A;  2V7M A;  5IHY A;  3ZYK A;  2DWG A;  3UUN A;  3ZEF B;  2JQQ A;  3Q5X A;  4GK0 E;  5LGT B;  2L9Q A;  4ZHQ E;  4UF0 B;  3QUJ A;  3B13 A;  4HEA A;  5LA6 E;  4AKH A;  3ONX A;  3MJX A;  3MXZ A;  3NRY A;  4CZZ B;  4IE4 A;  2A2F X;  4PFO A;  3MA9 A;  4XAX B;  2WMO A;  3Q5W A;  5F8P A;  4UEL A;  3I9W A;  3IBP A;  2Q9Q D;  1BR0 A;  4CI3 B;  1HG2 A;  2WAU A;  5DQW A;  4WW0 A;  4U74 A;  5JDL A;  3IEE A;  3FBZ A;  4TV9 E;  2OA5 A;  4QX7 B;  2Y8D A;  3N2K E;  4O4L E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...