4QWNB

Histone demethylase kdm2a-h3k36me1-alpha-kg complex structure
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
QVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELASSDPKLALTGVPIVQWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 2A
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/structural protein
total genus 19
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4qwnB00
4QX7B 4TN7B 4QXBB 4QXCB 4QWNB 4QX8B 4QXHB
chains in the Genus database with same CATH superfamily
4H9RC 5LGTB 3EABA 2NW9A 4YFSA 2XM2A 4UF0B 4EAHA 4IE7A 3CIRA 4ZS3A 5HWYA 1D1AA 4YTPA 3B13A 3RIUC 3NZPA 3EDVA 3RYCE 5LGNB 2ZM0A 4KBMB 4O2AE 3ETUA 4F6RC 4YJ3E 2X9YA 1US7B 2JQKA 4NUVA 3U78A 2WAUA 4HGAA 3AA7B 2KXPB 3RQWA 3PUSA 4HWIB 2IC6A 4KHZF 1ZP0A 1MIWA 3B57A 4IDPA 3EHZA 4O4HE 1UUSA 4O8SA 3DJBA 4ILCA 4Z8XA 3VR8A 3SRZA 1EZ3A 2LHNA 3QK6A 2LJLA 1OEDE 3ZLIA 3OYZA 4KHPT 3LDQB 2VVNA 2LSJA 3E08A 4L0RA 3A8YC 4UR9A 2VQET 1MIYA 4X20E 1D1CA 5JR9A 1QUUA 4HFIA 3KBUA 1J1JA 3Q5XA 3FXEB 4H9SE 5KMGP 2LKHA 1T98A 2K48A 4G2AA 3P4RA 1YXRA 2N2NA 2CMRA 3O1HA 1JNZA 4CXWA 5LYJE 2VWAA 1G73A 3L39A 3UFEA 2MBGA 3RX6A 4TV9E 3AAIA 5ETWA 4X5TA 2X9WA 3HI2A 2MTQA 5DQWA 3J9X1 2C5IT 4ZI3C 2KWHA 4U7IA 3N9NA 1XDPA 2WZHA 5DJQC 4XAXB 5FXVA 3AE8A 2H7VC 1D0ZA 2XJ7A 1WFDA 5HAXA 4IE6A 3TLWA 4HWFA 5ABFA 3IEEA 4MFRA 1FEWA 5LMNT 3Q5WA 1KNZA 3K3QC 4PK4A 3O9XA 2X67A 3BQLA 1W09A 2YDSA 2WY2A 3CWZB 2KMFA 3UUXB 2M6IA 4TV8E 4DR3T 4M1PA 5CA0E 5LJMA 2XAHB 2YINA 4Z91A 2WWVA 5L4EA 3RRCA 4P1NA 1WCRA 2WDVA 2EHOD 4DV0T 1M7KA 2JQHA 3CPZA 3FHNA 3RF1A 3BK9A 3OBVE 2FUPA 4PAGA 2LM9A 1D1BA 5DABA 1XWMA 4NPPA 2ES0A 3UULA 3VRAA 4DUZT 3QOFA 4HFVA 4JI0T 4UF0A 2Q9QC 5HCMA 4IIJE 3QNUA 3IA3A 3PU8A 2UXXB 3IF8B 4PFPA 2I59A 4AIUA 1X9BA 2H7OA 4DR5T 5AQLB 4B3ST 4C90A 5LA6E 1E7PA 2XQYA 3UUBA 2XAGB 3DP7A 2OA5A 1NAFA 2MAWA 3VR9A 5FMNA 1OEDC 3Q2MA 2CWYA 4DV3T 2W66A 3A7MA 2BG9C 3JAEA 3N2GE 3ZC1A 3HR0A 3KV5A 2X0LB 2HHHT 1W0AA 4CN4A 5LBMA 1G8XA 5J2TE 4JBWF 1FMVA 5HEJA 2PBIA 3ANWA 4N78D 1MMNA 5DQVA 3ZSTA 2LM2A 3ZC0A 2A3DA 4H9QC 2XQ9A 4JEUB 3LK3B 2UU9T 3AA6B 3TLSA 2UXCT 3OJAA 2E5LT 2V7MA 3FBZA 2XQ5A 5L3GB 5AQKB 4DBRA 3UTKA 5JDNA 1NEKA 2J1DG 4LFAT 3JAFA 5JR9C 5L3BB 5JDFA 3KDSE 4DNDA 4O4IE 4IT4A 3K3NA 2CEAA 2DNXA 4ADZA 3M65A 1T8BA 3P4QA 4TN7B 4MLKA 3OKQA 4P09A 4QX7B 1SUMB 2PTFA 4OK0A 2NP9A 1UCUA 3N2OA 3BQIA 3PURA 3I0QA 2JJ9A 5HXCA 4GKKT 4H63V 3GN5B 3MA9A 4JI8T 2V6YB 3CVRA 3RQUA 5FL0A 2CBJA 4X64T 4AQYT 2JQQA 5FP3A 3ZN1B 4TZ4C 5ABHA 4WBOA 3ZN0B 3NVOA 2KLQA 1I6ZA 3NWIA 2WQYA 1IBKT 2V6XA 2R6GF 3PUWF 4LFCT 4GIWA 3MXZA 4Z90A 2XQ4A 4EOZB 3LSVA 1IJ6A 3AE4A 3N5LA 3FZMB 2BZBA 4IDNA 1WR0A 2ODUA 3JC6C 5C2TA 4U3CA 2P9BA 4CN1A 3PDYA 3CKDA 4ZZCA 3C51A 4CI2B 2PJQA 4LF8T 3T1HT 3K8PC 5A1LA 3LFMA 4XBFB 3ABVA 3A5XA 3AE9A 5H6RB 5L3EB 2ACZA 2EHOC 2MYSA 4EV6A 4DBQA 2C0SA 3ZKRA 3KV4A 4JI4T 2V1DB 1IAPA 4LMKA 1CHUA 3EVYA 4QKNA 2CE7A 3ZCIA 4HWCA 3GA8A 4Q25A 2FJDA 3LJCA 1YKEB 2XM1A 4P0AA 1H7CA 2V8SV 2N9DA 5FYMA 3MACA 3H37A 1BR4A 3FZHB 2HH7A 2PG8A 3PU3A 1KFYA 1AJ3A 2LKGA 5TAOA 4F8HA 2C5JA 2CLYB 3ZYMA 4HFEA 4YHHT 2RA1A 2XQ3A 2BKPA 4KX6A 3M3ZB 1T72A 2DLRA 2XTLA 3VKGA 3MK7C 2BS2A 3P7IA 4J2CA 5AQMB 5JDMA 5FL1A 2AXDS 2NTYA 2W0GA 1OEDA 2AE9A 1NWMX 3KV9A 2VL0A 1LVKA 3BQKA 5LHHB 2W63A 5EK3A 1E1HB 3AVSA 2BG9A 5JDGA 1N34T 3KBTA 3C4ZA 2XZEA 4O4JE 5L2LA 4YSXA 1HS7A 2CBIA 4EZ4A 3UUMA 1J5WA 2N1GA 3AE1A 2HPLA 4AQGA 2JIWA 3ZCJA 4H9PC 4PJLA 4UIGA 4DV4T 5ABEA 5F5WA 1XDOA 3KV6A 1ZHCA 5AFUL 4DV1T 4TNWA 5LBQB 3AEEA 4X65T 3ZMTB 4YXDA 4QWNB 3MJXA 3I9WA 2BG9E 4JI3T 4K0KT 3RHWA 2YK0A 1BR1A 3GN5A 4U2ZA 2V6YA 5FY7A 5HEOA 4DR2T 2MOZA 4HFCA 2RPAA 3Q5EA 4WYVA 1JNRA 3C64A 3EUHA 4WBNE 5F3JA 5FVKA 2CXLA 2L8KA 3ZT7A 1MNDA 2WZIA 4QH5A 1XMQT 2WP9A 1WLXA 4QXCB 3UFGA 4JV5T 5IWAT 2BVLA 4EIWA 3N9QA 1MNEA 3FZFB 3H3AA 4X1KE 5IUXA 4EEDA 5KXJA 2LSYA 5JRCA 2V7LA 2WMNA 4EEBA 4JI2T 4X1YE 2DI4A 3LBXA 5L47A 1HCIA 2HN2A 3AVRA 4AKGA 4AKHA 2CXDA 3W15B 2Z6EA 2WS3A 3KFWX 1HNZT 4AXPA 3KVBA 4AISA 3NZQA 3AXJA 4MALA 1M62A 4E7ZA 3K1SA 4OYKA 3I1AA 3FXDB 3RGLA 2VL8A 2V7IA 1YW0A 3N2KE 3WAJA 2D9DA 1T7SA 1HG2A 3AEDA 4HFDA 4NXMT 2W67A 3ZMSB 4CN6A 3T1YT 4FJOA 5AQSB 2NWBA 3TLVA 4JI6T 3PJAA 2NTXA 4DV6T 2WB5A 2BS3A 1HR0T 2E2AA 2KNDA 4HKAA 3OVUA 3ZMZB 2EHOA 2E5VA 2ZLYA 4LMJA 2ACXA 3PUYF 3ZT6A 1FMWA 1OXZA 4HFBA 2IC9A 2UXNB 3S4UA 4WW0A 4UV9B 3RI5A 3E0ZA 3HKDE 4YY3T 2BDEA 5ABGA 2YOEA 4MBQA 2J4GA 2E9XB 1SA0E 2LSGA 4IDOA 3N9PA 5EZYE 2H88A 4OFZA 1L0VA 2ZMAA 2X0HA 4NXNT 5FKYA 1HTJF 4UVCB 5CGMA 1D0YA 5HYAA 2JQ9A 4YTNA 1U5PA 3B5MA 1YD8G 5HXEA 4HE8A 2CPTA 2PFVA 4HWDA 3AE5A 2E8IA 1Z0PA 1X79A 5LOVE 5JQGE 2A72A 4YSZA 2VASA 3GMIA 3K3OA 5L4HA 3UU5A 4CXYA 3MKDA 3SOLA 2JRKA 3AECA 1FIOA 3IBPA 4L5GA 2NW8A 3DTOA 2UXDT 4EXTA 5CA1E 2LOSA 5EK2A 3ESLA 4IDQA 3OYXA 2CM0A 4EYYR 5LHIB 2IMLA 4JLEA 2X0YA 4ZXLA 2V7KA 5AQGB 2OLTA 1Y01A 3HA4A 1XMOT 2XPKA 3CX8B 3PUXF 3H3MA 4K0UA 4AKLA 4U74A 3QB5K 3I0OA 2LRLA 3UU8A 2VKDA 1S94A 3VU7H 2D5UA 3AB3B 3CMLA 4NIQA 2FBWA 1XNQT 5FNVE 3ZYKA 5CJ5A 4PFOA 3G06A 2CXFA 2LEHA 3AE6A 2B76A 3N9MA 3RRWA 4KI0F 4CQIA 2QYWA 1MMGA 3ONJA 4AQFC 3O4XE 5GONE 3TLTA 2QA7A 3F57A 3PUVF 5JH7E 4ERRA 2YEVC 4QXBB 1V9DA 3RYHE 2LE8A 4I0UA 4C91A 5JDLA 2I6HA 1IJ5A 2HN1A 2Y8DA 1VRBA 5AQNB 5LMUT 2I0MA 2XUEA 3KINB 1UURA 4IE4A 2V5CA 3CQCB 3Q5DA 4COFA 2GK9A 1YQ4A 4L9IA 4ILUA 3C4WA 2LT3A 4LF7T 2H3RA 3NRYA 2UXBT 4BJMA 1QLBA 4DIDB 1E2AA 1HNXT 5IYZE 1UK5A 2LSKA 2VURA 3ONXA 5E0OA 3RC8A 3ZMUB 5HXSA 4JI5T 4P0BA 2CCQA 4JI1T 2M6BA 3KVAA 5LP6E 2E9XD 5HEHA 4TWDA 3FZKB 5J2UE 4O2BE 2YU1A 2KSRA 3PUGA 3L3PA 2V7JA 4AI6A 4YSYA 5L3FB 3SFDA 1N33T 2CLYC 3OTOT 1N32T 4ASKA 2D2SA 2XQAA 3CX7B 5LB7B 5ABFB 4KMCA 2DL1A 3RKGA 3D0TA 4EGWA 4ZZBA 1HG5A 4G63A 3ZT5A 4GYSA 4IL4A 2UUBT 1LKXA 3ZPOA 1DU2A 4HFHA 2VKHA 2XAJB 2G0UA 4GK0E 4U33A 1UX5A 5HXRA 2B1EA 5FXZA 5J0ZA 4LF6T 2IHR1 2YU2A 2BKNA 5LGUB 4KUMB 2WCAA 2XHEB 1ZKEA 5M4YA 2Q9QD 4U2YA 4CZZB 4DV7T 3Q9DA 3FBLA 4WZXA 5HEGA 4NUUA 2JPFA 4JYAT 5HCJA 1KNRA 4QHOA 3P50A 4QH4A 2BVMA 1W9RA 5L3DB 1S35A 2VVSA 1HF8A 4JEHB 4QH1A 5HXHA 3I9YA 2X66A 3LK42 4DR4T 3RYIE 3AE7A 5HWXA 3E22E 3AEBA 2VK9A 1Y64B 1BR0A 4WNKA 3UUNA 4ZI2D 4ZS2A 4ILAA 5AQTB 2LRKA 2X68A 2YN6A 2Y6XA 3WAKA 1Z8UA 3V5SA 3UU3A 4E7SA 1WRDA 3P8CD 2FJEA 4IE5A 2QGSA 3WI3A 4I4TE 5JDHA 1LVFA 5LCYA 3AEFA 5AQHB 1I94T 4IREA 4X62T 2HPJA 4GKJT 3RKOA 2KT9A 1IBLT 3P4PA 2CRBA 1YKHB 4AQFA 3ANWB 2W4XA 4QX8B 3AE3A 5IHYA 4DV5T 3UT5E 4PJNA 3EDUA 2IAKA 3N9OA 2IUBA 4EYUA 4CI1B 3AE2A 1XNRT 2WDQA 5ADXL 2QRXA 2VKJA 3ZJ1A 2D0UA 3PTRB 1WYBA 1SHZC 2DWGA 4U7YA 2WDRA 3MZKB 3ONLC 3PJAJ 3SWHA 3QUJA 3AEAA 3O1IA 4LFBT 2BBHA 4YTMA 2JMHA 1HNWT 4HN9A 5C8YE 4HTEA 3P4WA 4A5XA 3RIAA 3PUZF 3RLFF 4EB6E 3C4XA 2RP4A 2ODVA 2H89A 5EK4A 1KNPA 3JADA 4EZHA 4TWFA 4BJNA 2XQ7A 2JMKA 1LRZA 2E9XC 2IIUA 3FZLB 4YHJA 4I43B 2XSAA 1UX4A 3JC6D 3UU4A 5FY0A 5FY1A 3AAEB 3ZSSA 2WU5A 4ILBA 3RYFE 2BBJA 2MPKA 3EAMA 2VKOA 1BR2A 3LK2B 4PNIA 1HFAA 2VB6A 2IDOB 4CXXA 2SPCA 2IW5B 1R8IA 2BKOA 4XZCA 3CQXC 3ZEFB 3PUAA 1MMDA 2KWIB 3UU6A 3ZJ2A 4H9NC 3RH3A 3J7Yq 4CI3B 2X9XA 3VKHA 2C5KT 2M67A 3VHLA 2K5BB 2FJBA 2X51A 5LNKA 2W61A 3N9LA 3L8RA 2XY8B 3UQ7A 3GWHA 4IGUA 2QVAA 2W62A 5J1GA 2WU2A 3RC3A 3CQGB 2NR4A 4A98A 1IBMT 2YDQA 3QC9A 4DMVA 4I50E 2ZM2A 5AQIB 1GQEA 3EI0A 3O1JA 2Y48B 4B3RT 3PE0A 4ZOLE 5JVDE 4YT0A 5LXTE 4UVBB 2LOPA 2CHNA 4ISSA 1HX1B 3NRXA 2LSIA 3OPCA 4V1Av 1B7TA 1ZEEA 4TX5A 4YLHA 4IDZA 3VRBA 3T8OA 2XAFB 4QXHB 4OX9T 2YDRA 3PUQA 1ZV4X 4PJJA 4BA9A 2J62A 5AQOB 3L09A 2Q9QB 2X9HA 2LHRA 4X1IE 3HKEE 4ZI2C 3RIUA 3U3IA 5L3CB 3AA1B 4B6XA 5JTGA 3PV0F 1WYCA 5AQUB 1J5ET 4JI7T 4OYJA 4UELA 4MHCA 1FJGT 4KP3C 5AQFB 2V5DA 5F8PA 1OEDB 5JREA 2A9UA 3UQ4A 4DVDA 4UVAB 5KX5E 4HWHA 1KK7A 5AQPB 2V26A 5FVLA 3CK6A 2BG9B 3V5UA 5CFBA 3TLUA 2OV9A 2ZM8A 3SFEA 5AQJB 1VCTA 2K24A 4YJ2E 4GK5E 2FJAA 1SE7A 1QSDA 3RIFA 3HL6A 4IHJE 4PJMA 4DMWA 4DR7T 5AQQB 1W0BA 2WBLA 4ZHQE 4PW8A 3AA0B 2J47A 4LF9T 3R84B 5H6QB 4U31A 5C3JA 4TWHA 1KEYA 3HKBE 2WSSV 3C98B 2XAQB 2DHRA 5FXXA 1IZNB 3P4SA 5AQRB 4ANJA 2XASB 2K3WA 3QB5A 2D0TA 2ZM6T 5JR9B 2CA5A 4UXNB 4ZI3D 1KF6A 3IHRA 4TNVA 4UEMA 4LF5T 4A56A 5KDMC 4X66T 2K9AA 2NOXA 2DWKA 4AKIA 2W2UA 4LMLA 2LLYA 4DV2T 3SS1A 2KINB 1MMAA 1N36T 1UGOA 3AEGA 1HX8A 1D0XA 5LHGB 2CWOA 2E9XA 5JRCB 3R6NA 2WWUA 3AAAB 3JCFA 2XQ8A 4U72A 4B3MT 2KZ7B 3LBXB 5BR8T 5AQVB 4AKRB 3CX6B 5CB4E 3TKLB 4UV8B 3HKCE 4ZEYA 4DR1T 5LG3A 4ISTA 1MIVA 3NBXX 1OWAA 4O4LE 4H63H 3ZMVB 4H9OC 4I55E 3AXJB 3F2EA 4IE0A 3F31A 4FI5A 3ZYLA 4ZI7E 2A2FX 3LG7A 4JUYA 4DO0A 1YQ3A 4OHFA 5JDQA 2UUAT 4GYRA 3RPUA 2WMOA 5HEUA 1VCSA 4PK6A 2NW7A 2YKSA 2VQFT 4LF4T 2BS4A 2XQ6A 1XZYA 1WR6A 1CUNA 4PK5A 2WM9A 2UUCT 4DR6T 2DCFA 5LG4A 1NENA 4IL9A 2L9QA 3NKZA 3C50A 1ZOYA 1U4QA 4DUYT 1VOMA 4TUYE 3ETVA 2Q9QA 4A97A 2EHOB 1O3XA 2L3LA 2CHOA 2XSBA 5LJNA 4BAYB 4GOUA 2F4VT 5BMVE 4B3TT 3X1DA 5FXWA 4HEAA 3FB2A 2W00A
chains in the Genus database with same CATH topology
2VASA 3GMIA 3K3OA 4H9RC 2KLQA 4HTEA 5LGTB 4CXYA 3MKDA 3SOLA 2JRKA 1FIOA 2NW9A 4YFSA 3IBPA 4UF0B 4EAHA 4L5GA 4IE7A 2NW8A 4GIWA 3DTOA 3MXZA 4ZS3A 4EB6E 3C4XA 4EOZB 1IJ6A 3N5LA 5HWYA 2RP4A 1D1AA 4EXTA 2ODVA 5CA1E 2LOSA 5EK2A 3B13A 3ESLA 5EK4A 2BZBA 3OYXA 2ODUA 3EDVA 2CM0A 3NZPA 4EZHA 3RYCE 5LGNB 3JC6C 2ZM0A 4KBMB 4O2AE 3ETUA 2P9BA 4BJNA 3PDYA 2JMKA 4F6RC 4EYYR 5LHIB 4YJ3E 1LRZA 4JLEA 2E9XC 2V7KA 2X9YA 4YHJA 1US7B 3CKDA 3HA4A 4I43B 4NUVA 3U78A 3C51A 4CI2B 2WAUA 1UX4A 3CX8B 3JC6D 4HGAA 2PJQA 3AA7B 4K0UA 2KXPB 4AKLA 4U74A 5FY0A 3I0OA 5FY1A 3PUSA 3K8PC 5A1LA 3LFMA 4XBFB 2IC6A 3AAEB 2VKDA 1S94A 3A5XA 3VU7H 3RYFE 2D5UA 3AB3B 1MIWA 3CMLA 5H6RB 5L3EB 3B57A 5FNVE 4O4HE 2EHOC 3ZYKA 2VKOA 4O8SA 2MYSA 4PFOA 3DJBA 1BR2A 4Z8XA 4DBQA 3SRZA 1EZ3A 3LK2B 4PNIA 2C0SA 1HFAA 2CXFA 2VB6A 2LHNA 3QK6A 2LEHA 2LJLA 3KV4A 4CXXA 3ZLIA 2SPCA 3OYZA 2V1DB 3N9MA 2IW5B 1IAPA 3RRWA 3EVYA 4QKNA 4XZCA 2CE7A 2LSJA 3CQXC 3E08A 1MMDA 3PUAA 4CQIA 2KWIB 3ZCIA 3ZEFB 4L0RA 3ZJ2A 4H9NC 1MMGA 3RH3A 3GA8A 3J7Yq 4AQFC 4CI3B 3O4XE 5GONE 2QA7A 3F57A 3LJCA 2X9XA 3VKHA 2C5KT 1MIYA 4X20E 1YKEB 2M67A 3VHLA 2K5BB 1D1CA 4P0AA 5JH7E 5JR9A 1H7CA 1QUUA 4ERRA 2X51A 5LNKA 2N9DA 5FYMA 2W61A 3KBUA 3N9LA 3MACA 2YEVC 3Q5XA 3FXEB 3H37A 4H9SE 4QXBB 1BR4A 1V9DA 5KMGP 3RYHE 3GWHA 4IGUA 2W62A 5J1GA 2HH7A 2LE8A 1T98A 2K48A 2PG8A 4G2AA 3RC3A 3PU3A 3CQGB 2N2NA 2CMRA 3O1HA 4C91A 5JDLA 4CXWA 5LYJE 1AJ3A 1IJ5A 2VWAA 3QC9A 5TAOA 4DMVA 2C5JA 1G73A 2CLYB 3ZYMA 2Y8DA 1VRBA 4I50E 2RA1A 3UFEA 2ZM2A 2MBGA 3RX6A 4TV9E 2DLRA 2XTLA 3VKGA 3AAIA 2XUEA 5ETWA 3O1JA 3MK7C 2Y48B 3KINB 2X9WA 3HI2A 3P7IA 4J2CA 3PE0A 2MTQA 4ZOLE 5DQWA 3J9X1 2C5IT 5JVDE 5JDMA 4IE4A 3CQCB 4ZI3C 2KWHA 2GK9A 5LXTE 2NTYA 4L9IA 4ILUA 3N9NA 2LOPA 2W0GA 2LT3A 3C4WA 4UVBB 4ISSA 5DJQC 1NWMX 4XAXB 2H3RA 5FXVA 3NRXA 2LSIA 3KV9A 3NRYA 4BJMA 4V1Av 1LVKA 2H7VC 3BQKA 5LHHB 1D0ZA 1B7TA 1ZEEA 2W63A 5EK3A 4TX5A 1E1HB 4IE6A 5HAXA 3AVSA 5IYZE 2LSKA 4YLHA 4IDZA 3ONXA 5JDGA 3IEEA 3T8OA 5E0OA 2XAFB 4MFRA 4QXHB 1FEWA 3KBTA 3PUQA 3RC8A 3Q5WA 1ZV4X 3C4ZA 1KNZA 3ZMUB 4PJJA 3K3QC 4BA9A 5HXSA 4O4JE 4PK4A 3O9XA 3L09A 5L2LA 4P0BA 2X67A 2Q9QB 2X9HA 1HS7A 3BQLA 2CCQA 2LHRA 4X1IE 3HKEE 4ZI2C 4EZ4A 3KVAA 3U3IA 5LP6E 5L3CB 2E9XD 3CWZB 3AA1B 3UUMA 2KMFA 3UUXB 4B6XA 5J2UE 4O2BE 2YU1A 1WYCA 3PUGA 3L3PA 4TV8E 2N1GA 2V7JA 4OYJA 4AI6A 2HPLA 4M1PA 4UELA 5L3FB 4AQGA 3ZCJA 5CA0E 4MHCA 4H9PC 4PJLA 4UIGA 4KP3C 5LJMA 2XAHB 2CLYC 5F8PA 3KV6A 1ZHCA 5JREA 2YINA 5AFUL 4ASKA 5LBQB 3RRCA 4DVDA 2D2SA 2EHOD 4UVAB 3ZMTB 5KX5E 1KK7A 3CX7B 2V26A 4QWNB 3CPZA 3FHNA 3MJXA 3I9WA 3BK9A 3OBVE 4PAGA 3V5UA 4KMCA 2YK0A 3D0TA 1BR1A 1HG5A 3GN5A 5FY7A 2LM9A 1D1BA 2ZM8A 4G63A 2MOZA 5DABA 3C64A 4GYSA 2K24A 4YJ2E 3EUHA 4GK5E 4WBNE 1QSDA 5F3JA 1LKXA 3ZPOA 3HL6A 2CXLA 2L8KA 4IHJE 2VKHA 4PJMA 1MNDA 4DMWA 2ES0A 2XAJB 3UULA 2G0UA 2WBLA 4GK0E 4HFVA 1UX5A 5HXRA 1WLXA 4ZHQE 2B1EA 5FXZA 4PW8A 4UF0A 4QXCB 3AA0B 3R84B 2BVLA 2Q9QC 2YU2A 5H6QB 4EIWA 5LGUB 3N9QA 4IIJE 1MNEA 3H3AA 4X1KE 4KUMB 3PU8A 2UXXB 3IF8B 4PFPA 2XHEB 1ZKEA 2I59A 3HKBE 2WSSV 5M4YA 2LSYA 2Q9QD 3C98B 2H7OA 5JRCA 2XAQB 2V7LA 2WMNA 4C90A 5LA6E 4CZZB 2DHRA 4X1YE 5FXXA 1IZNB 2XQYA 2DI4A 4ANJA 2XAGB 2XASB 3DP7A 3Q9DA 2OA5A 3LBXA 3FBLA 3ZN0B 1HCIA 1NAFA 3AVRA 4NUUA 5FMNA 2D0TA 3Q2MA 4AKGA 5JR9B 2CA5A 2JPFA 4UXNB 4AKHA 2CWYA 2CXDA 4ZI3D 3W15B 2Z6EA 3KFWX 4AXPA 3KVBA 4QHOA 3IHRA 4UEMA 3NZQA 4MALA 2BVMA 3N2GE 4E7ZA 4A56A 3ZC1A 3HR0A 5KDMC 4OYKA 3KV5A 3I1AA 5L3DB 2X0LB 3FXDB 1S35A 2K9AA 2NOXA 2VL8A 1HF8A 2DWKA 4AKIA 5LBMA 2V7IA 4JEHB 1YW0A 1G8XA 5HXHA 5J2TE 3I9YA 2X66A 3LK42 3N2KE 3WAJA 3RYIE 3SS1A 5HWXA 2KINB 3E22E 1FMVA 1HG2A 2VK9A 2PBIA 3ANWA 1MMAA 4N78D 1MMNA 1Y64B 5DQVA 1HX8A 1D0XA 5LHGB 3ZC0A 2CWOA 2E9XA 5JRCB 1BR0A 4WNKA 3R6NA 3UUNA 4ZI2D 4ZS2A 2WWUA 3AAAB 3ZMSB 2A3DA 4H9QC 4JEUB 2X68A 3LK3B 4FJOA 2NWBA 4U72A 2KZ7B 3LBXB 4AKRB 2Y6XA 3WAKA 3AA6B 3OJAA 3CX6B 2NTXA 3V5SA 5CB4E 3TKLB 2V7MA 4E7SA 4UV8B 3FBZA 1WRDA 2KNDA 3HKCE 3P8CD 4HKAA 4ISTA 5L3GB 1MIVA 3ZMZB 3NBXX 4IE5A 1OWAA 4O4LE 2EHOA 4H63H 3UTKA 2ZLYA 3ZMVB 4DBRA 2ACXA 2QGSA 4H9OC 4I55E 3WI3A 1FMWA 3F2EA 4IE0A 3F31A 1OXZA 4I4TE 5C8YE 4FI5A 5JDHA 3ZYLA 5JDNA 2IC9A 2UXNB 1LVFA 2J1DG 5LCYA 3S4UA 4ZI7E 2A2FX 3LG7A 4WW0A 4JUYA 4UV9B 4DO0A 2HPJA 5JR9C 5L3BB 4OHFA 3E0ZA 5JDQA 5JDFA 2KT9A 3RKOA 3KDSE 3HKDE 4GYRA 3RPUA 4DNDA 2WMOA 4O4IE 2BDEA 1YKHB 4AQFA 4PK6A 2NW7A 4MBQA 3ANWB 3K3NA 2CEAA 2DNXA 2E9XB 4QX8B 4ADZA 3M65A 1SA0E 1CUNA 1WR6A 4TN7B 4PK5A 2LSGA 4MLKA 3OKQA 2WM9A 4P09A 3N9PA 5EZYE 4QX7B 5IHYA 2DCFA 4OFZA 5LG4A 3UT5E 2ZMAA 4PJNA 3EDUA 2IAKA 3N9OA 2L9QA 4EYUA 4CI1B 3C50A 1HTJF 2NP9A 4OK0A 1UCUA 4UVCB 3N2OA 3BQIA 3PURA 1U4QA 5ADXL 1VOMA 2VKJA 3I0QA 1D0YA 3ZJ1A 4TUYE 3ETVA 2D0UA 2JJ9A 2Q9QA 5HYAA 5HXCA 3PTRB 1WYBA 1SHZC 1O3XA 2DWGA 2EHOB 1U5PA 2L3LA 1YD8G 5HXEA 5LJNA 3MZKB 4HE8A 4BAYB 3SWHA 4GOUA 3QUJA 4H63V 3O1IA 5BMVE 3GN5B 3MA9A 3CVRA 5FXWA 2JMHA 2PFVA 4HEAA 5LOVE 2E8IA 1Z0PA 1X79A 5JQGE 2JQQA 2A72A 5FP3A 3FB2A 4HN9A 3ZN1B 4TZ4C 4WBOA 2W00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QX7 B;  4TN7 B;  4QXB B;  4QXC B;  4QWN B;  4QX8 B;  4QXH B; 
#chains in the Genus database with same CATH topology
 4H9R C;  5LGT B;  3EAB A;  2NW9 A;  4YFS A;  2XM2 A;  4UF0 B;  4EAH A;  4IE7 A;  3CIR A;  4ZS3 A;  5HWY A;  1D1A A;  4YTP A;  3B13 A;  3RIU C;  3NZP A;  3EDV A;  3RYC E;  5LGN B;  2ZM0 A;  4KBM B;  4O2A E;  3ETU A;  4F6R C;  4YJ3 E;  2X9Y A;  1US7 B;  2JQK A;  4NUV A;  3U78 A;  2WAU A;  4HGA A;  3AA7 B;  2KXP B;  3RQW A;  3PUS A;  4HWI B;  2IC6 A;  4KHZ F;  1ZP0 A;  1MIW A;  3B57 A;  4IDP A;  3EHZ A;  4O4H E;  1UUS A;  4O8S A;  3DJB A;  4ILC A;  4Z8X A;  3VR8 A;  3SRZ A;  1EZ3 A;  2LHN A;  3QK6 A;  2LJL A;  1OED E;  3ZLI A;  3OYZ A;  4KHP T;  3LDQ B;  2VVN A;  2LSJ A;  3E08 A;  4L0R A;  3A8Y C;  4UR9 A;  2VQE T;  1MIY A;  4X20 E;  1D1C A;  5JR9 A;  1QUU A;  4HFI A;  3KBU A;  1J1J A;  3Q5X A;  3FXE B;  4H9S E;  5KMG P;  2LKH A;  1T98 A;  2K48 A;  4G2A A;  3P4R A;  1YXR A;  2N2N A;  2CMR A;  3O1H A;  1JNZ A;  4CXW A;  5LYJ E;  2VWA A;  1G73 A;  3L39 A;  3UFE A;  2MBG A;  3RX6 A;  4TV9 E;  3AAI A;  5ETW A;  4X5T A;  2X9W A;  3HI2 A;  2MTQ A;  5DQW A;  3J9X 1;  2C5I T;  4ZI3 C;  2KWH A;  4U7I A;  3N9N A;  1XDP A;  2WZH A;  5DJQ C;  4XAX B;  5FXV A;  3AE8 A;  2H7V C;  1D0Z A;  2XJ7 A;  1WFD A;  5HAX A;  4IE6 A;  3TLW A;  4HWF A;  5ABF A;  3IEE A;  4MFR A;  1FEW A;  5LMN T;  3Q5W A;  1KNZ A;  3K3Q C;  4PK4 A;  3O9X A;  2X67 A;  3BQL A;  1W09 A;  2YDS A;  2WY2 A;  3CWZ B;  2KMF A;  3UUX B;  2M6I A;  4TV8 E;  4DR3 T;  4M1P A;  5CA0 E;  5LJM A;  2XAH B;  2YIN A;  4Z91 A;  2WWV A;  5L4E A;  3RRC A;  4P1N A;  1WCR A;  2WDV A;  2EHO D;  4DV0 T;  1M7K A;  2JQH A;  3CPZ A;  3FHN A;  3RF1 A;  3BK9 A;  3OBV E;  2FUP A;  4PAG A;  2LM9 A;  1D1B A;  5DAB A;  1XWM A;  4NPP A;  2ES0 A;  3UUL A;  3VRA A;  4DUZ T;  3QOF A;  4HFV A;  4JI0 T;  4UF0 A;  2Q9Q C;  5HCM A;  4IIJ E;  3QNU A;  3IA3 A;  3PU8 A;  2UXX B;  3IF8 B;  4PFP A;  2I59 A;  4AIU A;  1X9B A;  2H7O A;  4DR5 T;  5AQL B;  4B3S T;  4C90 A;  5LA6 E;  1E7P A;  2XQY A;  3UUB A;  2XAG B;  3DP7 A;  2OA5 A;  1NAF A;  2MAW A;  3VR9 A;  5FMN A;  1OED C;  3Q2M A;  2CWY A;  4DV3 T;  2W66 A;  3A7M A;  2BG9 C;  3JAE A;  3N2G E;  3ZC1 A;  3HR0 A;  3KV5 A;  2X0L B;  2HHH T;  1W0A A;  4CN4 A;  5LBM A;  1G8X A;  5J2T E;  4JBW F;  1FMV A;  5HEJ A;  2PBI A;  3ANW A;  4N78 D;  1MMN A;  5DQV A;  3ZST A;  2LM2 A;  3ZC0 A;  2A3D A;  4H9Q C;  2XQ9 A;  4JEU B;  3LK3 B;  2UU9 T;  3AA6 B;  3TLS A;  2UXC T;  3OJA A;  2E5L T;  2V7M A;  3FBZ A;  2XQ5 A;  5L3G B;  5AQK B;  4DBR A;  3UTK A;  5JDN A;  1NEK A;  2J1D G;  4LFA T;  3JAF A;  5JR9 C;  5L3B B;  5JDF A;  3KDS E;  4DND A;  4O4I E;  4IT4 A;  3K3N A;  2CEA A;  2DNX A;  4ADZ A;  3M65 A;  1T8B A;  3P4Q A;  4TN7 B;  4MLK A;  3OKQ A;  4P09 A;  4QX7 B;  1SUM B;  2PTF A;  4OK0 A;  2NP9 A;  1UCU A;  3N2O A;  3BQI A;  3PUR A;  3I0Q A;  2JJ9 A;  5HXC A;  4GKK T;  4H63 V;  3GN5 B;  3MA9 A;  4JI8 T;  2V6Y B;  3CVR A;  3RQU A;  5FL0 A;  2CBJ A;  4X64 T;  4AQY T;  2JQQ A;  5FP3 A;  3ZN1 B;  4TZ4 C;  5ABH A;  4WBO A;  3ZN0 B;  3NVO A;  2KLQ A;  1I6Z A;  3NWI A;  2WQY A;  1IBK T;  2V6X A;  2R6G F;  3PUW F;  4LFC T;  4GIW A;  3MXZ A;  4Z90 A;  2XQ4 A;  4EOZ B;  3LSV A;  1IJ6 A;  3AE4 A;  3N5L A;  3FZM B;  2BZB A;  4IDN A;  1WR0 A;  2ODU A;  3JC6 C;  5C2T A;  4U3C A;  2P9B A;  4CN1 A;  3PDY A;  3CKD A;  4ZZC A;  3C51 A;  4CI2 B;  2PJQ A;  4LF8 T;  3T1H T;  3K8P C;  5A1L A;  3LFM A;  4XBF B;  3ABV A;  3A5X A;  3AE9 A;  5H6R B;  5L3E B;  2ACZ A;  2EHO C;  2MYS A;  4EV6 A;  4DBQ A;  2C0S A;  3ZKR A;  3KV4 A;  4JI4 T;  2V1D B;  1IAP A;  4LMK A;  1CHU A;  3EVY A;  4QKN A;  2CE7 A;  3ZCI A;  4HWC A;  3GA8 A;  4Q25 A;  2FJD A;  3LJC A;  1YKE B;  2XM1 A;  4P0A A;  1H7C A;  2V8S V;  2N9D A;  5FYM A;  3MAC A;  3H37 A;  1BR4 A;  3FZH B;  2HH7 A;  2PG8 A;  3PU3 A;  1KFY A;  1AJ3 A;  2LKG A;  5TAO A;  4F8H A;  2C5J A;  2CLY B;  3ZYM A;  4HFE A;  4YHH T;  2RA1 A;  2XQ3 A;  2BKP A;  4KX6 A;  3M3Z B;  1T72 A;  2DLR A;  2XTL A;  3VKG A;  3MK7 C;  2BS2 A;  3P7I A;  4J2C A;  5AQM B;  5JDM A;  5FL1 A;  2AXD S;  2NTY A;  2W0G A;  1OED A;  2AE9 A;  1NWM X;  3KV9 A;  2VL0 A;  1LVK A;  3BQK A;  5LHH B;  2W63 A;  5EK3 A;  1E1H B;  3AVS A;  2BG9 A;  5JDG A;  1N34 T;  3KBT A;  3C4Z A;  2XZE A;  4O4J E;  5L2L A;  4YSX A;  1HS7 A;  2CBI A;  4EZ4 A;  3UUM A;  1J5W A;  2N1G A;  3AE1 A;  2HPL A;  4AQG A;  2JIW A;  3ZCJ A;  4H9P C;  4PJL A;  4UIG A;  4DV4 T;  5ABE A;  5F5W A;  1XDO A;  3KV6 A;  1ZHC A;  5AFU L;  4DV1 T;  4TNW A;  5LBQ B;  3AEE A;  4X65 T;  3ZMT B;  4YXD A;  4QWN B;  3MJX A;  3I9W A;  2BG9 E;  4JI3 T;  4K0K T;  3RHW A;  2YK0 A;  1BR1 A;  3GN5 A;  4U2Z A;  2V6Y A;  5FY7 A;  5HEO A;  4DR2 T;  2MOZ A;  4HFC A;  2RPA A;  3Q5E A;  4WYV A;  1JNR A;  3C64 A;  3EUH A;  4WBN E;  5F3J A;  5FVK A;  2CXL A;  2L8K A;  3ZT7 A;  1MND A;  2WZI A;  4QH5 A;  1XMQ T;  2WP9 A;  1WLX A;  4QXC B;  3UFG A;  4JV5 T;  5IWA T;  2BVL A;  4EIW A;  3N9Q A;  1MNE A;  3FZF B;  3H3A A;  4X1K E;  5IUX A;  4EED A;  5KXJ A;  2LSY A;  5JRC A;  2V7L A;  2WMN A;  4EEB A;  4JI2 T;  4X1Y E;  2DI4 A;  3LBX A;  5L47 A;  1HCI A;  2HN2 A;  3AVR A;  4AKG A;  4AKH A;  2CXD A;  3W15 B;  2Z6E A;  2WS3 A;  3KFW X;  1HNZ T;  4AXP A;  3KVB A;  4AIS A;  3NZQ A;  3AXJ A;  4MAL A;  1M62 A;  4E7Z A;  3K1S A;  4OYK A;  3I1A A;  3FXD B;  3RGL A;  2VL8 A;  2V7I A;  1YW0 A;  3N2K E;  3WAJ A;  2D9D A;  1T7S A;  1HG2 A;  3AED A;  4HFD A;  4NXM T;  2W67 A;  3ZMS B;  4CN6 A;  3T1Y T;  4FJO A;  5AQS B;  2NWB A;  3TLV A;  4JI6 T;  3PJA A;  2NTX A;  4DV6 T;  2WB5 A;  2BS3 A;  1HR0 T;  2E2A A;  2KND A;  4HKA A;  3OVU A;  3ZMZ B;  2EHO A;  2E5V A;  2ZLY A;  4LMJ A;  2ACX A;  3PUY F;  3ZT6 A;  1FMW A;  1OXZ A;  4HFB A;  2IC9 A;  2UXN B;  3S4U A;  4WW0 A;  4UV9 B;  3RI5 A;  3E0Z A;  3HKD E;  4YY3 T;  2BDE A;  5ABG A;  2YOE A;  4MBQ A;  2J4G A;  2E9X B;  1SA0 E;  2LSG A;  4IDO A;  3N9P A;  5EZY E;  2H88 A;  4OFZ A;  1L0V A;  2ZMA A;  2X0H A;  4NXN T;  5FKY A;  1HTJ F;  4UVC B;  5CGM A;  1D0Y A;  5HYA A;  2JQ9 A;  4YTN A;  1U5P A;  3B5M A;  1YD8 G;  5HXE A;  4HE8 A;  2CPT A;  2PFV A;  4HWD A;  3AE5 A;  2E8I A;  1Z0P A;  1X79 A;  5LOV E;  5JQG E;  2A72 A;  4YSZ A;  2VAS A;  3GMI A;  3K3O A;  5L4H A;  3UU5 A;  4CXY A;  3MKD A;  3SOL A;  2JRK A;  3AEC A;  1FIO A;  3IBP A;  4L5G A;  2NW8 A;  3DTO A;  2UXD T;  4EXT A;  5CA1 E;  2LOS A;  5EK2 A;  3ESL A;  4IDQ A;  3OYX A;  2CM0 A;  4EYY R;  5LHI B;  2IML A;  4JLE A;  2X0Y A;  4ZXL A;  2V7K A;  5AQG B;  2OLT A;  1Y01 A;  3HA4 A;  1XMO T;  2XPK A;  3CX8 B;  3PUX F;  3H3M A;  4K0U A;  4AKL A;  4U74 A;  3QB5 K;  3I0O A;  2LRL A;  3UU8 A;  2VKD A;  1S94 A;  3VU7 H;  2D5U A;  3AB3 B;  3CML A;  4NIQ A;  2FBW A;  1XNQ T;  5FNV E;  3ZYK A;  5CJ5 A;  4PFO A;  3G06 A;  2CXF A;  2LEH A;  3AE6 A;  2B76 A;  3N9M A;  3RRW A;  4KI0 F;  4CQI A;  2QYW A;  1MMG A;  3ONJ A;  4AQF C;  3O4X E;  5GON E;  3TLT A;  2QA7 A;  3F57 A;  3PUV F;  5JH7 E;  4ERR A;  2YEV C;  4QXB B;  1V9D A;  3RYH E;  2LE8 A;  4I0U A;  4C91 A;  5JDL A;  2I6H A;  1IJ5 A;  2HN1 A;  2Y8D A;  1VRB A;  5AQN B;  5LMU T;  2I0M A;  2XUE A;  3KIN B;  1UUR A;  4IE4 A;  2V5C A;  3CQC B;  3Q5D A;  4COF A;  2GK9 A;  1YQ4 A;  4L9I A;  4ILU A;  3C4W A;  2LT3 A;  4LF7 T;  2H3R A;  3NRY A;  2UXB T;  4BJM A;  1QLB A;  4DID B;  1E2A A;  1HNX T;  5IYZ E;  1UK5 A;  2LSK A;  2VUR A;  3ONX A;  5E0O A;  3RC8 A;  3ZMU B;  5HXS A;  4JI5 T;  4P0B A;  2CCQ A;  4JI1 T;  2M6B A;  3KVA A;  5LP6 E;  2E9X D;  5HEH A;  4TWD A;  3FZK B;  5J2U E;  4O2B E;  2YU1 A;  2KSR A;  3PUG A;  3L3P A;  2V7J A;  4AI6 A;  4YSY A;  5L3F B;  3SFD A;  1N33 T;  2CLY C;  3OTO T;  1N32 T;  4ASK A;  2D2S A;  2XQA A;  3CX7 B;  5LB7 B;  5ABF B;  4KMC A;  2DL1 A;  3RKG A;  3D0T A;  4EGW A;  4ZZB A;  1HG5 A;  4G63 A;  3ZT5 A;  4GYS A;  4IL4 A;  2UUB T;  1LKX A;  3ZPO A;  1DU2 A;  4HFH A;  2VKH A;  2XAJ B;  2G0U A;  4GK0 E;  4U33 A;  1UX5 A;  5HXR A;  2B1E A;  5FXZ A;  5J0Z A;  4LF6 T;  2IHR 1;  2YU2 A;  2BKN A;  5LGU B;  4KUM B;  2WCA A;  2XHE B;  1ZKE A;  5M4Y A;  2Q9Q D;  4U2Y A;  4CZZ B;  4DV7 T;  3Q9D A;  3FBL A;  4WZX A;  5HEG A;  4NUU A;  2JPF A;  4JYA T;  5HCJ A;  1KNR A;  4QHO A;  3P50 A;  4QH4 A;  2BVM A;  1W9R A;  5L3D B;  1S35 A;  2VVS A;  1HF8 A;  4JEH B;  4QH1 A;  5HXH A;  3I9Y A;  2X66 A;  3LK4 2;  4DR4 T;  3RYI E;  3AE7 A;  5HWX A;  3E22 E;  3AEB A;  2VK9 A;  1Y64 B;  1BR0 A;  4WNK A;  3UUN A;  4ZI2 D;  4ZS2 A;  4ILA A;  5AQT B;  2LRK A;  2X68 A;  2YN6 A;  2Y6X A;  3WAK A;  1Z8U A;  3V5S A;  3UU3 A;  4E7S A;  1WRD A;  3P8C D;  2FJE A;  4IE5 A;  2QGS A;  3WI3 A;  4I4T E;  5JDH A;  1LVF A;  5LCY A;  3AEF A;  5AQH B;  1I94 T;  4IRE A;  4X62 T;  2HPJ A;  4GKJ T;  3RKO A;  2KT9 A;  1IBL T;  3P4P A;  2CRB A;  1YKH B;  4AQF A;  3ANW B;  2W4X A;  4QX8 B;  3AE3 A;  5IHY A;  4DV5 T;  3UT5 E;  4PJN A;  3EDU A;  2IAK A;  3N9O A;  2IUB A;  4EYU A;  4CI1 B;  3AE2 A;  1XNR T;  2WDQ A;  5ADX L;  2QRX A;  2VKJ A;  3ZJ1 A;  2D0U A;  3PTR B;  1WYB A;  1SHZ C;  2DWG A;  4U7Y A;  2WDR A;  3MZK B;  3ONL C;  3PJA J;  3SWH A;  3QUJ A;  3AEA A;  3O1I A;  4LFB T;  2BBH A;  4YTM A;  2JMH A;  1HNW T;  4HN9 A;  5C8Y E;  4HTE A;  3P4W A;  4A5X A;  3RIA A;  3PUZ F;  3RLF F;  4EB6 E;  3C4X A;  2RP4 A;  2ODV A;  2H89 A;  5EK4 A;  1KNP A;  3JAD A;  4EZH A;  4TWF A;  4BJN A;  2XQ7 A;  2JMK A;  1LRZ A;  2E9X C;  2IIU A;  3FZL B;  4YHJ A;  4I43 B;  2XSA A;  1UX4 A;  3JC6 D;  3UU4 A;  5FY0 A;  5FY1 A;  3AAE B;  3ZSS A;  2WU5 A;  4ILB A;  3RYF E;  2BBJ A;  2MPK A;  3EAM A;  2VKO A;  1BR2 A;  3LK2 B;  4PNI A;  1HFA A;  2VB6 A;  2IDO B;  4CXX A;  2SPC A;  2IW5 B;  1R8I A;  2BKO A;  4XZC A;  3CQX C;  3ZEF B;  3PUA A;  1MMD A;  2KWI B;  3UU6 A;  3ZJ2 A;  4H9N C;  3RH3 A;  3J7Y q;  4CI3 B;  2X9X A;  3VKH A;  2C5K T;  2M67 A;  3VHL A;  2K5B B;  2FJB A;  2X51 A;  5LNK A;  2W61 A;  3N9L A;  3L8R A;  2XY8 B;  3UQ7 A;  3GWH A;  4IGU A;  2QVA A;  2W62 A;  5J1G A;  2WU2 A;  3RC3 A;  3CQG B;  2NR4 A;  4A98 A;  1IBM T;  2YDQ A;  3QC9 A;  4DMV A;  4I50 E;  2ZM2 A;  5AQI B;  1GQE A;  3EI0 A;  3O1J A;  2Y48 B;  4B3R T;  3PE0 A;  4ZOL E;  5JVD E;  4YT0 A;  5LXT E;  4UVB B;  2LOP A;  2CHN A;  4ISS A;  1HX1 B;  3NRX A;  2LSI A;  3OPC A;  4V1A v;  1B7T A;  1ZEE A;  4TX5 A;  4YLH A;  4IDZ A;  3VRB A;  3T8O A;  2XAF B;  4QXH B;  4OX9 T;  2YDR A;  3PUQ A;  1ZV4 X;  4PJJ A;  4BA9 A;  2J62 A;  5AQO B;  3L09 A;  2Q9Q B;  2X9H A;  2LHR A;  4X1I E;  3HKE E;  4ZI2 C;  3RIU A;  3U3I A;  5L3C B;  3AA1 B;  4B6X A;  5JTG A;  3PV0 F;  1WYC A;  5AQU B;  1J5E T;  4JI7 T;  4OYJ A;  4UEL A;  4MHC A;  1FJG T;  4KP3 C;  5AQF B;  2V5D A;  5F8P A;  1OED B;  5JRE A;  2A9U A;  3UQ4 A;  4DVD A;  4UVA B;  5KX5 E;  4HWH A;  1KK7 A;  5AQP B;  2V26 A;  5FVL A;  3CK6 A;  2BG9 B;  3V5U A;  5CFB A;  3TLU A;  2OV9 A;  2ZM8 A;  3SFE A;  5AQJ B;  1VCT A;  2K24 A;  4YJ2 E;  4GK5 E;  2FJA A;  1SE7 A;  1QSD A;  3RIF A;  3HL6 A;  4IHJ E;  4PJM A;  4DMW A;  4DR7 T;  5AQQ B;  1W0B A;  2WBL A;  4ZHQ E;  4PW8 A;  3AA0 B;  2J47 A;  4LF9 T;  3R84 B;  5H6Q B;  4U31 A;  5C3J A;  4TWH A;  1KEY A;  3HKB E;  2WSS V;  3C98 B;  2XAQ B;  2DHR A;  5FXX A;  1IZN B;  3P4S A;  5AQR B;  4ANJ A;  2XAS B;  2K3W A;  3QB5 A;  2D0T A;  2ZM6 T;  5JR9 B;  2CA5 A;  4UXN B;  4ZI3 D;  1KF6 A;  3IHR A;  4TNV A;  4UEM A;  4LF5 T;  4A56 A;  5KDM C;  4X66 T;  2K9A A;  2NOX A;  2DWK A;  4AKI A;  2W2U A;  4LML A;  2LLY A;  4DV2 T;  3SS1 A;  2KIN B;  1MMA A;  1N36 T;  1UGO A;  3AEG A;  1HX8 A;  1D0X A;  5LHG B;  2CWO A;  2E9X A;  5JRC B;  3R6N A;  2WWU A;  3AAA B;  3JCF A;  2XQ8 A;  4U72 A;  4B3M T;  2KZ7 B;  3LBX B;  5BR8 T;  5AQV B;  4AKR B;  3CX6 B;  5CB4 E;  3TKL B;  4UV8 B;  3HKC E;  4ZEY A;  4DR1 T;  5LG3 A;  4IST A;  1MIV A;  3NBX X;  1OWA A;  4O4L E;  4H63 H;  3ZMV B;  4H9O C;  4I55 E;  3AXJ B;  3F2E A;  4IE0 A;  3F31 A;  4FI5 A;  3ZYL A;  4ZI7 E;  2A2F X;  3LG7 A;  4JUY A;  4DO0 A;  1YQ3 A;  4OHF A;  5JDQ A;  2UUA T;  4GYR A;  3RPU A;  2WMO A;  5HEU A;  1VCS A;  4PK6 A;  2NW7 A;  2YKS A;  2VQF T;  4LF4 T;  2BS4 A;  2XQ6 A;  1XZY A;  1WR6 A;  1CUN A;  4PK5 A;  2WM9 A;  2UUC T;  4DR6 T;  2DCF A;  5LG4 A;  1NEN A;  4IL9 A;  2L9Q A;  3NKZ A;  3C50 A;  1ZOY A;  1U4Q A;  4DUY T;  1VOM A;  4TUY E;  3ETV A;  2Q9Q A;  4A97 A;  2EHO B;  1O3X A;  2L3L A;  2CHO A;  2XSB A;  5LJN A;  4BAY B;  4GOU A;  2F4V T;  5BMV E;  4B3T T;  3X1D A;  5FXW A;  4HEA A;  3FB2 A;  2W00 A; 
#chains in the Genus database with same CATH homology
 2VAS A;  3GMI A;  3K3O A;  4H9R C;  2KLQ A;  4HTE A;  5LGT B;  4CXY A;  3MKD A;  3SOL A;  2JRK A;  1FIO A;  2NW9 A;  4YFS A;  3IBP A;  4UF0 B;  4EAH A;  4L5G A;  4IE7 A;  2NW8 A;  4GIW A;  3DTO A;  3MXZ A;  4ZS3 A;  4EB6 E;  3C4X A;  4EOZ B;  1IJ6 A;  3N5L A;  5HWY A;  2RP4 A;  1D1A A;  4EXT A;  2ODV A;  5CA1 E;  2LOS A;  5EK2 A;  3B13 A;  3ESL A;  5EK4 A;  2BZB A;  3OYX A;  2ODU A;  3EDV A;  2CM0 A;  3NZP A;  4EZH A;  3RYC E;  5LGN B;  3JC6 C;  2ZM0 A;  4KBM B;  4O2A E;  3ETU A;  2P9B A;  4BJN A;  3PDY A;  2JMK A;  4F6R C;  4EYY R;  5LHI B;  4YJ3 E;  1LRZ A;  4JLE A;  2E9X C;  2V7K A;  2X9Y A;  4YHJ A;  1US7 B;  3CKD A;  3HA4 A;  4I43 B;  4NUV A;  3U78 A;  3C51 A;  4CI2 B;  2WAU A;  1UX4 A;  3CX8 B;  3JC6 D;  4HGA A;  2PJQ A;  3AA7 B;  4K0U A;  2KXP B;  4AKL A;  4U74 A;  5FY0 A;  3I0O A;  5FY1 A;  3PUS A;  3K8P C;  5A1L A;  3LFM A;  4XBF B;  2IC6 A;  3AAE B;  2VKD A;  1S94 A;  3A5X A;  3VU7 H;  3RYF E;  2D5U A;  3AB3 B;  1MIW A;  3CML A;  5H6R B;  5L3E B;  3B57 A;  5FNV E;  4O4H E;  2EHO C;  3ZYK A;  2VKO A;  4O8S A;  2MYS A;  4PFO A;  3DJB A;  1BR2 A;  4Z8X A;  4DBQ A;  3SRZ A;  1EZ3 A;  3LK2 B;  4PNI A;  2C0S A;  1HFA A;  2CXF A;  2VB6 A;  2LHN A;  3QK6 A;  2LEH A;  2LJL A;  3KV4 A;  4CXX A;  3ZLI A;  2SPC A;  3OYZ A;  2V1D B;  3N9M A;  2IW5 B;  1IAP A;  3RRW A;  3EVY A;  4QKN A;  4XZC A;  2CE7 A;  2LSJ A;  3CQX C;  3E08 A;  1MMD A;  3PUA A;  4CQI A;  2KWI B;  3ZCI A;  3ZEF B;  4L0R A;  3ZJ2 A;  4H9N C;  1MMG A;  3RH3 A;  3GA8 A;  3J7Y q;  4AQF C;  4CI3 B;  3O4X E;  5GON E;  2QA7 A;  3F57 A;  3LJC A;  2X9X A;  3VKH A;  2C5K T;  1MIY A;  4X20 E;  1YKE B;  2M67 A;  3VHL A;  2K5B B;  1D1C A;  4P0A A;  5JH7 E;  5JR9 A;  1H7C A;  1QUU A;  4ERR A;  2X51 A;  5LNK A;  2N9D A;  5FYM A;  2W61 A;  3KBU A;  3N9L A;  3MAC A;  2YEV C;  3Q5X A;  3FXE B;  3H37 A;  4H9S E;  4QXB B;  1BR4 A;  1V9D A;  5KMG P;  3RYH E;  3GWH A;  4IGU A;  2W62 A;  5J1G A;  2HH7 A;  2LE8 A;  1T98 A;  2K48 A;  2PG8 A;  4G2A A;  3RC3 A;  3PU3 A;  3CQG B;  2N2N A;  2CMR A;  3O1H A;  4C91 A;  5JDL A;  4CXW A;  5LYJ E;  1AJ3 A;  1IJ5 A;  2VWA A;  3QC9 A;  5TAO A;  4DMV A;  2C5J A;  1G73 A;  2CLY B;  3ZYM A;  2Y8D A;  1VRB A;  4I50 E;  2RA1 A;  3UFE A;  2ZM2 A;  2MBG A;  3RX6 A;  4TV9 E;  2DLR A;  2XTL A;  3VKG A;  3AAI A;  2XUE A;  5ETW A;  3O1J A;  3MK7 C;  2Y48 B;  3KIN B;  2X9W A;  3HI2 A;  3P7I A;  4J2C A;  3PE0 A;  2MTQ A;  4ZOL E;  5DQW A;  3J9X 1;  2C5I T;  5JVD E;  5JDM A;  4IE4 A;  3CQC B;  4ZI3 C;  2KWH A;  2GK9 A;  5LXT E;  2NTY A;  4L9I A;  4ILU A;  3N9N A;  2LOP A;  2W0G A;  2LT3 A;  3C4W A;  4UVB B;  4ISS A;  5DJQ C;  1NWM X;  4XAX B;  2H3R A;  5FXV A;  3NRX A;  2LSI A;  3KV9 A;  3NRY A;  4BJM A;  4V1A v;  1LVK A;  2H7V C;  3BQK A;  5LHH B;  1D0Z A;  1B7T A;  1ZEE A;  2W63 A;  5EK3 A;  4TX5 A;  1E1H B;  4IE6 A;  5HAX A;  3AVS A;  5IYZ E;  2LSK A;  4YLH A;  4IDZ A;  3ONX A;  5JDG A;  3IEE A;  3T8O A;  5E0O A;  2XAF B;  4MFR A;  4QXH B;  1FEW A;  3KBT A;  3PUQ A;  3RC8 A;  3Q5W A;  1ZV4 X;  3C4Z A;  1KNZ A;  3ZMU B;  4PJJ A;  3K3Q C;  4BA9 A;  5HXS A;  4O4J E;  4PK4 A;  3O9X A;  3L09 A;  5L2L A;  4P0B A;  2X67 A;  2Q9Q B;  2X9H A;  1HS7 A;  3BQL A;  2CCQ A;  2LHR A;  4X1I E;  3HKE E;  4ZI2 C;  4EZ4 A;  3KVA A;  3U3I A;  5LP6 E;  5L3C B;  2E9X D;  3CWZ B;  3AA1 B;  3UUM A;  2KMF A;  3UUX B;  4B6X A;  5J2U E;  4O2B E;  2YU1 A;  1WYC A;  3PUG A;  3L3P A;  4TV8 E;  2N1G A;  2V7J A;  4OYJ A;  4AI6 A;  2HPL A;  4M1P A;  4UEL A;  5L3F B;  4AQG A;  3ZCJ A;  5CA0 E;  4MHC A;  4H9P C;  4PJL A;  4UIG A;  4KP3 C;  5LJM A;  2XAH B;  2CLY C;  5F8P A;  3KV6 A;  1ZHC A;  5JRE A;  2YIN A;  5AFU L;  4ASK A;  5LBQ B;  3RRC A;  4DVD A;  2D2S A;  2EHO D;  4UVA B;  3ZMT B;  5KX5 E;  1KK7 A;  3CX7 B;  2V26 A;  4QWN B;  3CPZ A;  3FHN A;  3MJX A;  3I9W A;  3BK9 A;  3OBV E;  4PAG A;  3V5U A;  4KMC A;  2YK0 A;  3D0T A;  1BR1 A;  1HG5 A;  3GN5 A;  5FY7 A;  2LM9 A;  1D1B A;  2ZM8 A;  4G63 A;  2MOZ A;  5DAB A;  3C64 A;  4GYS A;  2K24 A;  4YJ2 E;  3EUH A;  4GK5 E;  4WBN E;  1QSD A;  5F3J A;  1LKX A;  3ZPO A;  3HL6 A;  2CXL A;  2L8K A;  4IHJ E;  2VKH A;  4PJM A;  1MND A;  4DMW A;  2ES0 A;  2XAJ B;  3UUL A;  2G0U A;  2WBL A;  4GK0 E;  4HFV A;  1UX5 A;  5HXR A;  1WLX A;  4ZHQ E;  2B1E A;  5FXZ A;  4PW8 A;  4UF0 A;  4QXC B;  3AA0 B;  3R84 B;  2BVL A;  2Q9Q C;  2YU2 A;  5H6Q B;  4EIW A;  5LGU B;  3N9Q A;  4IIJ E;  1MNE A;  3H3A A;  4X1K E;  4KUM B;  3PU8 A;  2UXX B;  3IF8 B;  4PFP A;  2XHE B;  1ZKE A;  2I59 A;  3HKB E;  2WSS V;  5M4Y A;  2LSY A;  2Q9Q D;  3C98 B;  2H7O A;  5JRC A;  2XAQ B;  2V7L A;  2WMN A;  4C90 A;  5LA6 E;  4CZZ B;  2DHR A;  4X1Y E;  5FXX A;  1IZN B;  2XQY A;  2DI4 A;  4ANJ A;  2XAG B;  2XAS B;  3DP7 A;  3Q9D A;  2OA5 A;  3LBX A;  3FBL A;  3ZN0 B;  1HCI A;  1NAF A;  3AVR A;  4NUU A;  5FMN A;  2D0T A;  3Q2M A;  4AKG A;  5JR9 B;  2CA5 A;  2JPF A;  4UXN B;  4AKH A;  2CWY A;  2CXD A;  4ZI3 D;  3W15 B;  2Z6E A;  3KFW X;  4AXP A;  3KVB A;  4QHO A;  3IHR A;  4UEM A;  3NZQ A;  4MAL A;  2BVM A;  3N2G E;  4E7Z A;  4A56 A;  3ZC1 A;  3HR0 A;  5KDM C;  4OYK A;  3KV5 A;  3I1A A;  5L3D B;  2X0L B;  3FXD B;  1S35 A;  2K9A A;  2NOX A;  2VL8 A;  1HF8 A;  2DWK A;  4AKI A;  5LBM A;  2V7I A;  4JEH B;  1YW0 A;  1G8X A;  5HXH A;  5J2T E;  3I9Y A;  2X66 A;  3LK4 2;  3N2K E;  3WAJ A;  3RYI E;  3SS1 A;  5HWX A;  2KIN B;  3E22 E;  1FMV A;  1HG2 A;  2VK9 A;  2PBI A;  3ANW A;  1MMA A;  4N78 D;  1MMN A;  1Y64 B;  5DQV A;  1HX8 A;  1D0X A;  5LHG B;  3ZC0 A;  2CWO A;  2E9X A;  5JRC B;  1BR0 A;  4WNK A;  3R6N A;  3UUN A;  4ZI2 D;  4ZS2 A;  2WWU A;  3AAA B;  3ZMS B;  2A3D A;  4H9Q C;  4JEU B;  2X68 A;  3LK3 B;  4FJO A;  2NWB A;  4U72 A;  2KZ7 B;  3LBX B;  4AKR B;  2Y6X A;  3WAK A;  3AA6 B;  3OJA A;  3CX6 B;  2NTX A;  3V5S A;  5CB4 E;  3TKL B;  2V7M A;  4E7S A;  4UV8 B;  3FBZ A;  1WRD A;  2KND A;  3HKC E;  3P8C D;  4HKA A;  4IST A;  5L3G B;  1MIV A;  3ZMZ B;  3NBX X;  4IE5 A;  1OWA A;  4O4L E;  2EHO A;  4H63 H;  3UTK A;  2ZLY A;  3ZMV B;  4DBR A;  2ACX A;  2QGS A;  4H9O C;  4I55 E;  3WI3 A;  1FMW A;  3F2E A;  4IE0 A;  3F31 A;  1OXZ A;  4I4T E;  5C8Y E;  4FI5 A;  5JDH A;  3ZYL A;  5JDN A;  2IC9 A;  2UXN B;  1LVF A;  2J1D G;  5LCY A;  3S4U A;  4ZI7 E;  2A2F X;  3LG7 A;  4WW0 A;  4JUY A;  4UV9 B;  4DO0 A;  2HPJ A;  5JR9 C;  5L3B B;  4OHF A;  3E0Z A;  5JDQ A;  5JDF A;  2KT9 A;  3RKO A;  3KDS E;  3HKD E;  4GYR A;  3RPU A;  4DND A;  2WMO A;  4O4I E;  2BDE A;  1YKH B;  4AQF A;  4PK6 A;  2NW7 A;  4MBQ A;  3ANW B;  3K3N A;  2CEA A;  2DNX A;  2E9X B;  4QX8 B;  4ADZ A;  3M65 A;  1SA0 E;  1CUN A;  1WR6 A;  4TN7 B;  4PK5 A;  2LSG A;  4MLK A;  3OKQ A;  2WM9 A;  4P09 A;  3N9P A;  5EZY E;  4QX7 B;  5IHY A;  2DCF A;  4OFZ A;  5LG4 A;  3UT5 E;  2ZMA A;  4PJN A;  3EDU A;  2IAK A;  3N9O A;  2L9Q A;  4EYU A;  4CI1 B;  3C50 A;  1HTJ F;  2NP9 A;  4OK0 A;  1UCU A;  4UVC B;  3N2O A;  3BQI A;  3PUR A;  1U4Q A;  5ADX L;  1VOM A;  2VKJ A;  3I0Q A;  1D0Y A;  3ZJ1 A;  4TUY E;  3ETV A;  2D0U A;  2JJ9 A;  2Q9Q A;  5HYA A;  5HXC A;  3PTR B;  1WYB A;  1SHZ C;  1O3X A;  2DWG A;  2EHO B;  1U5P A;  2L3L A;  1YD8 G;  5HXE A;  5LJN A;  3MZK B;  4HE8 A;  4BAY B;  3SWH A;  4GOU A;  3QUJ A;  4H63 V;  3O1I A;  5BMV E;  3GN5 B;  3MA9 A;  3CVR A;  5FXW A;  2JMH A;  2PFV A;  4HEA A;  5LOV E;  2E8I A;  1Z0P A;  1X79 A;  5JQG E;  2JQQ A;  2A72 A;  5FP3 A;  3FB2 A;  4HN9 A;  3ZN1 B;  4TZ4 C;  4WBO A;  2W00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...