4QWWC

Crystal structure of the fab410-bfache complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
212
Chain Sequence
QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMYWYHQKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSLSVSSVEAEDAATYYCQQYNSHPMTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Snake Venom Acetylcholinesterase in Complex with Inhibitory Antibody Fragment Fab410 Bound at the Peripheral Site: EVIDENCE FOR OPEN AND CLOSED STATES OF A BACK DOOR CHANNEL.
pubmed doi rcsb
molecule tags Hydrolase/immune system
molecule keywords Acetylcholinesterase
total genus 54
structure length 212
sequence length 212
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qwwC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qwwC01
5TE6L 1I7TA 3G6DH 3K7UA 4MB3A 1YZZA 3VD7A 2D31B 3BT2L 4G6KL 3VXSD 1ZVHA 2W9DH 3O6MH 3UTOA 5T1DL 3EO9L 1DN2A 4OB5L 4Y5YB 2EC9U 3MRCB 5GRWA 3B3IB 4OGAD 4DZBA 1CD9B 1KT2B 4PJXB 4XX1G 1CF8L 3MUY1 4ENEC 5ESQA 3WSQH 1CCZA 4LHUA 1CICB 1N26A 4YDLB 2DQJH 3WIHH 4NBZB 1BBJA 5I30L 1LD9B 1T89C 3O9WD 3HG1B 3F58H 3AC0A 4Y5XC 3MLZL 5CJ5A 4HWZB 15C8L 4L3EB 2IFGA 4D9RE 4OZFA 1KENL 3ARBA 3O0RL 2XG4A 3UJIL 3H7BB 5JHDE 4WI2A 5CGYC 1R3IH 5C71A 4E5XA 3MRLB 3CC5B 4D0DA 2ED8A 4DVRL 3MJ7A 4HGMA 1WZKA 4L9LB 4ZFOB 2BCKB 5FFLA 1N2RA 2O5XH 4FXKB 1V7NH 2R9HD 2VDLL 3I9GH 4R9HA 5F72S 2B5IC 2BDNH 1A3RL 5HI3C 4D9LL 1I9JH 3L95B 4KHXH 3VXNB 3HC3L 1A7RL 3QB7C 3HLAA 4RFEA 1L4IA 1IGTB 3GSOB 3TH4T 5GJTH 4RQQA 2XTJD 1IC4H 3V95A 3ARWA 2X4UB 1LEKB 4MNGB 3VXRB 2Q76A 2NR6C 3VRIA 1WZMA 5HYSG 4OZHB 1BJ1H 4N8PA 5T3XL 2CQVA 1MAJA 5DK3A 2Y36H 1PY4A 5DC0A 2BHZA 5I8OL 4KMTL 1BEYL 1JIBA 2P5WB 2CK0L 3RNQB 3L3JB 1UWEH 2XWJB 4ZD3H 2NY2D 4RGNE 4TNWF 4U1SA 3SO3C 1JZ4A 3KPOB 3UX9B 3PWVA 1ADQL 3HS0A 4YPGB 3U30C 3A6BL 2Q20A 4U7SA 1O0VA 4P5KB 4WFFD 4M48L 3LN4B 4KV5E 3T65B 5F9WB 1HNGA 2XRAH 2PO6A 2DWDA 3QH3A 4RDQF 3TBSB 4Q7DA 1FZJB 4BFGA 2UWEA 5C0JA 3GO1H 1NC2D 1GZQB 3O2WH 1S7RB 3GDBA 4NM8H 5I9QB 1CF8H 1QFPA 5HHQB 4OLUL 3IKCB 2CGRH 4M7ZB 4MSWB 3UXFA 4WHTB 1MAKA 4NZRH 1F6AA 1H8SA 2APBA 1S78D 2AQ2A 4AM0A 1EXUB 1B3JA 5CD5C 4PGBB 4LVHB 3BQUD 3QO0A 3DXAD 1AE6H 4OFIA 1LK2B 1NUDA 3B9DA 3D69A 1U8NA 4OCLC 1G6RB 3EOYG 1WC7B 2DQTH 4G6JL 1CGTA 3OKYA 2BSTB 5ESVB 2GCYB 3FT3B 4FQJH 4YGAB 5D96C 3C60C 4QTHB 1DSFH 2NXZD 1FH5L 1T22A 4G8GD 5CUSH 1IZKA 1HCFX 2W59A 4S2SB 1PKQB 5GS1C 1A6TB 2CIIB 2JJUA 5C09D 3K8KA 3X13A 4F7MA 4NRZA 4XNZC 1C7TA 1F4XL 5JZ7C 3B9AA 2R2CA 1GL4B 4PRID 4YGVB 2I60H 4Y2DB 3MRRB 3VCLA 5ACZA 1QPPA 3SDYH 3SJVA 3SGKA 1AGEA 5GGRA 4YBLB 3WNLA 5FO7A 1XGRB 4KDTC 3DRQA 3TO4C 3C09C 2WANA 4S11A 1NEUA 1WTGT 4OD3H 2WLYA 3QULA 1OB1B 3PJSB 2X4SA 1CE1H 2D31A 1YEGH 3GB7A 4D9RD 2PYFB 2QTEA 1ED3B 3MODH 3NGBC 2OL3H 4TOYH 3SDAB 3QRGL 4PRPE 4NKIH 1JZ2A 5K9OB 3AS2A 2R69H 5KVDL 1XCTB 5AZ2L 1HI6B 3DTXB 4FQHA 3MV7E 3ZE2E 2F19H 4NKOA 3QEGH 5E8OB 3K46A 3VXSB 4GUPA 1BOYA 1UQSA 4FQXB 2IC2A 1UG9A 5IVXB 3SBWC 5IHZA 3AXLB 1R3JA 1OAKL 4PJAA 1D6VH 2BK8A 4NGHH 4UNVA 5TH2B 2GT9A 3MV7A 2W9EL 2MKLC 3RFZC 4H25A 4WNQB 2X2YA 4P4KC 5EN2B 1D5IH 3IDYB 3I75B 5JW4Q 2HKHL 2UVEA 3QDGD 5IQ7L 2UWEF 4UU9B 2DS4A 4X98A 1FZOB 3KYMB 4PD4J 4M3JA 3S8WA 1RJZB 4PJDA 2F53B 3TVMD 5EU5B 1CLYL 2P8PA 3C2AL 3OXSA 1IGYA 5IK3B 1RFDL 3QUYA 1VFBA 2HJLA 2LE9A 2ZSVA 4YX2H 3O3UN 2AGJH 3NFSL 4CDGC 3QJFA 3KWWA 3O3AA 1SJXA 1R3LA 2ZUXA 3ARDB 3NIDF 3PWJB 1EVUA 5BMFL 5JDJA 4O58L 3BW9B 2DBLH 1NCCL 4PJCE 2A1WH 3EOBA 4KKAD 3SDCD 4LKXA 5ISZA 4F9LC 3CAFA 2CIKB 2R1YB 4EI5A 4CADB 4EI5C 3LZFL 5HDQH 1S7SA 2PCPA 5I19L 15C8H 1CICC 3N9GH 3OR6A 4NCC1 1R3HB 1HHHA 2OQJA 5FYLH 2CRIA 4LVHC 4G6ML 2NY2B 1HH9B 2X4NA 2ZUWA 5F7YC 5IROC 3K4AA 2ED9A 4ODTH 4LLAA 3ULUF 4EQ2A 4I8DA 3I3BA 3UBXI 3RVXC 5FKPB 2NW3A 3S36X 2EIZA 3QQ4B 4GFTB 4YDJB 1RUAL 2VSDA 2ZG1A 3RWFB 3NCYS 1ZEAL 3D1MC 4UV4H 2W0KA 3I6KB 1QLRA 3WIFA 4JKKA 3AAZA 1G6RA 4BKLB 2EDBA 1LDPL 1KT2A 4PJXA 1PG7H 5DJ2A 3O9WB 3PGFH 4KUZL 2WWKO 5I75C 2ZG2A 5DR5L 3P9MA 3S3SA 4HG4J 4U31A 1IGCL 1A4JB 5ICXA 3QDJB 1GGIL 2BMKA 3OZ9L 1W0YT 1Y6KR 3GFUA 1IFHL 3MRNA 3RDTD 3VFSB 3EO0B 3T77A 5IUSA 4HWZA 4Z6AT 1IAMA 2VDRH 2G9HB 2HRLA 3U7YH 5H2BA 3PIQA 4QO1A 5A2LH 1FSKB 1AI1H 1HOCA 2IPUK 3LKOB 4PV8B 4QWWD 1YEIL 4WFED 4BM7A 1AGFB 1ZSDA 4F33B 4YHNA 4Z7NE 4KHTH 4PJ8D 4G8GB 2AEIT 4LCIH 5GGTH 2CUIA 4XC3L 1EERB 1G6VK 5CFHA 3ZDXF 1S7WB 3MNZB 4PRIB 1LMKA 1JNLH 1ZANH 1ZWIB 2CKBA 5T5FL 4NM8L 2D4FA 3VI3F 1N5AA 4HEME 3INUL 4XMKL 1X5ZA 2HFFB 5D2LF 3T3MF 3DVGA 3BGMB 1J05A 1QBBA 2I24N 5EOTB 2KUTA 4YHIA 3UAJD 2EYTB 4JREB 2MCG1 3L5XH 4BZ1H 4L4JA 2ARJQ 5J3HD 2DQEH 2W1NA 2ICEA 2YA1A 3P0GB 4JFDB 4PREA 3GSNH 1RZJC 5CAYB 3MX0A 5L6YH 3EFDH 4Y16A 3GMQB 2AK4E 1B0RB 4XCFL 2E9BA 1MNUH 3BP6B 1KJVA 1OCWL 1D5BB 3TYFA 3MOQA 5H35B 5L8LB 1QHPA 5C08D 1AY1H 3SKJH 1KB9J 1XR9B 4EXPX 1CBVH 1I85A 1FZMA 3SJVB 4I4WA 4HULB 4YFEA 1YPZB 5DT1H 4LRNL 3MLXL 2DI9A 1NKOA 1N3NA 1X3DA 3FB6A 3QIWA 3W5MA 5E6ID 3VXMA 4N0FA 2ZPKH 5DK2B 2AI0H 3U1SH 3U9PH 4YIQA 1NCAH 3WL9B 3GHEH 1QD0A 4KVCL 2HMIC 2YPLA 3WS6A 4G80B 4PJFA 3KG5A 4I5BA 5MEOA 3QRFM 3UTPE 4HIIA 2D7MA 5HGBA 5FCSH 4PJDB 3K81A 1DQJA 3SE8H 2P5WA 1GGCH 4YHZH 2P4AB 4XWOC 3KPQA 5J13C 5E08L 5D93C 5C0EB 5IB3B 5I1GL 2BSRB 5HGDA 3BZEA 3QWQB 3VFWA 5ANMA 2MQCA 5LCVH 5FV2A 1QSFB 2R56H 3DX8B 2BY0A 1WBYB 4CVZA 2YN5A 2JJTC 1RVFL 1MUJA 4YWGL 3WLBB 4MA3A 3QNYB 2AV1A 3UC0L 4HK0B 4WI8A 4PJ7A 3X14B 5C6TL 1G7LA 3S98A 2VQ1A 5ANME 1BVKB 2CXGA 1KCLA 1ONQA 3QUML 2QADD 5TQ0H 4JAMA 1ACZA 1KPUA 3FO9A 3CSYA 4LNRB 4G8EB 1I8LA 4NNPL 1YMME 3P4NA 5C0AA 4Z78B 1TJGH 4LLQA 4KI1A 1NGYA 5EO0B 5BS0E 2EXWC 2ZSVB 3GI9H 4PJ8B 4ZYKA 4K07A 4L8BB 1R5VB 1MVUA 1FRGH 3ARGC 4QT5A 4HQQH 3BJLA 1JWSA 5KVFH 2L0DA 2VQUA 1EH9A 3V79C 2XV6B 3GEWB 4ZUSA 2LU4A 2VDOL 4Y1AA 2Y07L 2BRQA 3VFOA 2MFNA 1UH2A 3HI5H 1A9BA 4P4KD 2EYRB 2GITA 3B5TA 2BOCB 3EGSA 5C09E 4N0RA 4G43A 2YSSA 4JRXA 4O00A 4R90L 2PXYB 3UO1H 5I8EB 2Y72A 4M1GH 3EO0A 1DQML 3S96B 3DSNA 3SE3C 1TCRB 4PRHD 3VFNA 4XPAH 4MVBD 4MJ2A 1XCQA 4O51A 4AENB 4HGKC 5EO9A 3U9PL 3VI4F 1V8HA 4QRQB 1CZ8L 1KJMB 2F74A 5DJ8A 2X4NB 3MROA 1FPTH 3BGAA 1UYWH 2KZWA 1R3LB 3PWJA 1LWRA 3QG7L 4HKZA 3GJFA 3MBXL 4UOW0 3MGOA 3Q1SL 3O3DB 1JGEA 4R2GB 3L7FB 1DQQA 1UXSB 3WNKA 1ES0B 4KTDH 1J0JA 3UYOD 1T1WA 3V7AE 2AK1H 2FX9L 3HPLA 4R4FH 1ZVSA 3C5SB 1X5HA 3RTQB 3LDBB 4BSWA 5IEKA 2GEEA 1CDIA 2HJFB 2Q3ZA 5C07A 3FRUB 1Z0NA 1N7ML 3FQTA 4KROC 1SY6A 5IMKB 5AYUH 1UA6L 2XTJC 5SWSA 4K8RH 3GSNB 4KUCF 3ARDA 5D7KD 4N0CD 4K94C 3SCMB 1MCOL 3CUPA 3MLRH 3ZSTA 1MHHA 3VFUB 4Z7WA 5F6HI 5T3XH 1NGXA 4H26A 2OTUB 3GMQA 3UEZA 2YD7A 1NPUA 4XAKD 3VDCA 4MAUL 2C7UB 3NVQA 1CT8B 3QI9C 2FX8L 3CLFH 1JYWA 1RPQA 5FA4A 3S3JA 2YD9A 5DJZA 1FVCA 1P4BH 4MDJB 1F02I 4PG2C 4HHAB 3DRTA 4N8CL 2IPTL 4EEEA 5F9OH 1H15B 3B43A 4GBXD 4J23A 3TP4A 4CDHA 4GMTH 5JTWA 5TDPB 1CFQA 3O4LA 3NZ8A 2NPLX 5HHME 4N9GB 4UDTA 1JGLL 4IRSC 4HIXH 4UMGA 1YMMB 4HIJA 4ODSL 3GGWA 2R0ZL 3QQ4A 1T5XA 5I8KL 1UZ6F 1MLCB 4FMFA 3O4LE 5KSAB 2Q8BH 5JMRA 1HQ4A 4NQTA 4Y5YC 1KNOB 1SBSL 1GCFA 5FM5O 3TZVD 3ESUF 2IPKB 3NACH 3INUH 1GAFH 4LP4A 3IGAB 1RIUL 4M4PA 4KRNA 5DQJA 5GGUA 4P23B 1KJVB 1S7XB 1A7NH 1A9EB 4ONHB 4KROB 1BJ8A 4QHKJ 4UIKH 4KFZC 5CBAB 5ICXB 1BVZA 2VAAA 2AV1B 4PRNB 2EH7L 4U1IA 3IFOB 2JK5B 3PWUB 1KCRL 2C3HA 2DMCA 3IJYA 2LU7A 5FV1L 1ZGLA 5IHUH 3O2DL 2A6DA 3DVGB 1PG7X 4NKQB 3GSWB 4UAOC 3T0EC 5F1SA 7FABL 3R0NA 1FV1B 1U3HA 1U91A 2J1KA 2QL1A 4PUBL 1HYSD 5DFTA 5B39A 1AH1A 2DLIA 3NAAH 5IGXH 4JHWH 3MBED 4JFZH 3OZ9H 4U4BA 3DVFA 5DTFB 5L88H 4YXKL 1MCLA 4ETQB 5A40E 4XI5C 4PJ7F 1MLBA 3QXTA 4IRZL 2AK4B 3P9WB 4ZO8A 4XBEH 3VDBA 1MCIA 1A4KB 4QHNA 4AIXA 3QCUH 1H8OA 1P6AB 4RGND 4G9FA 4ELMA 1FLRH 2C1OA 2HFFA 2H26B 4K3EH 5GHWL 3HR5A 1YEIH 2KPNA 2O5ZH 1DR9A 4WHDA 3R0MA 2HAZA 3VRLF 2XQYK 3C6SA 2G9HA 3VFPB 1P7QB 3RI5F 2XIDA 3MZTA 4XTRC 2OTWB 5IB2B 3IVKA 3SGJA 3T0ED 4EZMA 2UV3A 3ZE0F 2PW1A 4KJYB 4F33A 3VI3E 2NLJB 5C0AB 4Z78A 3QO1B 3BZFB 2VDMH 4HKBB 3OB8A 4M5ZH 1NFDF 4TUOB 1CFSA 5E4EB 1HHIA 4IDJL 4XVTL 4I4WB 2VLME 1ZOXA 2HWZH 4Z18A 2Q7YA 1JV5B 3O6KL 3ULUE 1JMXA 4EI6A 5DS8B 3S4SA 5JOPD 3GSNL 3W9DA 3ARGB 1WBXB 3UTTB 1D5XB 5B8CC 3LS4H 1U2CA 3DHJA 1RULH 3BUYB 1UXSA 1RIUH 2V6HA 4JFOB 2ICEB 1HN1A 3ZLQC 3OKEB 1QACA 4LSTH 1INDL 2DBLL 1JGDA 1ORSB 5C0FB 1BBDL 3CXHK 5F3BA 1CVRA 3KR3L 4UQ2A 3TPKA 3FFCD 2QSCL 4NZUH 3GKWH 1YY8B 2RGSA 2EKJA 5DFVC 4PGCA 3CH1B 3ZDYF 2EDNA 4NKDB 2YN3A 3WHE0 5DRNB 1B0WA 5KJRH 2ITDA 3X17A 1OARL 5GS1B 3ARTA 1W8OA 4HKZB 3TV3H 3LOWA 3TNNA 4L5FH 4NQDA 1OWWA 4UINH 2VJXA 4U6VH 5D8JL 5D1XD 1HZHH 3AFLA 1FG2B 1PFCA 3BP5B 3LSOB 4ORZC 3BKYH 5DRWA 3UDWC 1HEZA 5J06A 3QUXC 3FQRB 2GAZB 1SVCP 4L8DA 2PXYA 3C5ZD 4FZ8L 1CLOL 3BKCH 2UUDH 5IMOB 3LEYH 4U7MA 1RZGB 1MHCA 3WDHA 4RAHA 4OJFL 1TJHH 4F9PC 1M71B 5C0DA 4POUB 4X80L 3GMOB 4H0HB 1MIMH 4N1HB 1NBVL 4RGNB 2NR6D 4ZFZB 4R0LA 3CFBB 1MCNA 4I18A 1SY6H 5IB5A 1JCKA 2E8ZA 2I9TA 3HS0B 4YPGA 4RIRA 3L7EB 4CU6A 4AEHL 5JO5A 4WW2C 2BXYA 2VZUA 1NCWL 4OF0A 1WGOA 3BUTA 3GNMH 3VFRB 4ODHH 4LLQB 3HAEB 4HWUA 2F5AH 3UP1A 1NFDA 1ZGLB 1U8PA 1DQLL 5IF0A 1QA9B 3QG6B 4BFIA 5FYJL 5E1AA 5LBSL 1KN2H 5DRZB 1P2CB 2XKUA 4P5MA 1CL7L 1NGPL 4TRPL 1NFDE 5C0CA 3QDGB 3RTQD 3UO1L 2W60A 4I2XA 4P48A 1UZ6E 2Z31D 3C8KB 4GKNA 3BN9C 4Q0XL 5JIKA 2IAMD 4R4NC 4MMZC 5ALBH 3UTTD 3JXAA 3G5VA 4HIEB 1KLUA 1J1OH 1BECA 5HYJD 1K4CB 3UTTE 1YJDH 5B22A 4X6FB 4G9FB 3HB3D 4YAQA 1OOAA 3QT2A 5EOCL 2JB5L 2R1XA 4P23C 5FK9A 5MEQA 4OGAC 3B9EA 4HD9A 1N64H 3GMLB 4UDUA 4JM2A 1LO5A 2VH5H 4OBSA 4F3FB 3N1PC 2X4QA 3GHBH 3DX7B 1AC0A 2NCMA 2EE9A 1H5BB 4FABH 5IV2A 4AY0A 1JPTH 5IIEB 3E2HC 2OXGA 3X3GL 2EO9A 4FFYH 3GJFB 3WFDH 3UPRA 5JLZB 1EAJA 5LXGH 3GRWH 3VJ6B 3BAEL 5A2IH 2XWTA 4D0BB 4G6JH 1ODAA 3HG1E 5B3JF 2X42A 4HFWB 3I2CH 2QADC 5F1KC 1Q9LA 4PGBA 1NC4D 1CG9A 4MHHI 4B5EA 3MV7B 3LN5A 5E5UB 1R3KA 3QDMD 3ESVF 4OIIL 2GSIB 1X4XA 4U1LB 1RUPH 4RGOH 5FYKU 3VGBA 4MSWA 5IHBA 4JB9H 4MD0B 4FXGA 3U46B 3NZ8B 3FO0H 4HIHB 1JRHH 4GKZA 1MRCL 2R1WA 4TULH 2XZQH 5IBLD 5DMJB 3NIFE 5KSAD 3UTQB 1F97A 4N8VA 1NGQL 1OGTB 1I3VA 1T1YB 3P30H 4PRPB 2RHEA 4HC1A 5FA3A 1WC7A 3LPGA 2V9RA 4Q9QH 4NO0D 2FATH 5IVZA 2ZNXA 3ALPA 4GQPH 1IT9H 1EO5A 3BEWB 1ZVYA 5KJRL 4NFCA 4EN3B 1K4DA 4OF7A 4M7ZC 1CGXA 5C6TH 1A7BA 4LLMB 1A6TA 2AJYH 4XNUH 4XZUB 3QDJA 1TJIL 2A9NH 3SDXE 1NDMA 3UBXA 4FNLH 5FYJH 3J8F7 1TXKA 1Q1JL 1KBGH 5E0QA 3WHXA 1H3GA 2FEDC 4APQA 3MNVB 4OM1H 3I75A 4KZDH 4QXGL 4QTIH 5HHOA 3SKMB 1AQDB 3EFFB 3VD9A 2WBJA 2YC1B 1MEXL 5E2JA 5IG7A 2C5DC 3QJHB 1I1CA 1M05A 1D5XA 4MWFA 4ZAKA 2CR6A 4XH2A 1R5WA 3V4UH 3Q0HA 3JWOH 5LKNA 2ZSWA 3QI9A 2BERA 1I1AA 1N8ZB 2ZOLA 1QFWI 5HHOE 5DF0A 2BVTA 4WGWB 4KKNA 3KGRA 4FFVD 4R6UA 2P48B 2BY3A 4AEIH 3D48R 3O4OB 4Q9RH 1VGKA 2PYEE 3GHBL 3MRHA 5AUMA 4KQ3L 3QIUB 1GC1C 4ZDHB 4KGLA 4WW2B 1QQDB 2AK4A 1IGML 2AJVH 1U8HB 2IQ9H 5L9DL 4DOHE 3PV6B 2HLFD 3PG2A 3HE6A 3G5YA 2DD8H 4ZUWA 4IRSA 4R90H 5IHZB 1B4JH 4YNYA 4JGJA 3IRZA 1WFUA 5DS8A 1UB6B 2XA3A 3JWDL 3ZE1E 4ZFFB 4K8RC 3GKZA 1KTRL 5CSGA 2UZIH 1A21A 4MXWL 2UY7A 1Q9OA 3SQOH 4EN3C 2QJDA 2A1WL 3SDDC 3PHSA 5GGSY 1S7UB 5JHDA 5HYJE 2Y5EA 5HVFB 1FZMB 4U6TA 3VE0A 1EHAA 3O3AB 3RAJH 4XVJH 3VGHA 3RWIB 5HHXH 5FYKH 5JQ6L 4I3GA 1LO4L 4OZGE 1YEHH 5F7UA 5EO1A 4L4VD 3W9DB 1SM3L 3LVEA 2CIKA 3H3PL 4W70A 4M62H 1Y6MR 4OTXH 1UGNA 12E8H 4KRPD 5MP6L 2ZCKH 4DKEL 2NY4C 3KPQB 2G5BB 5GS1A 2VL4A 4H1LH 2Q87A 5HYIA 1KLFA 4AG4H 1QR1A 2QKIB 5INDA 3O2DA 3FFCB 2IAMB 5IWLC 1A7QH 3LEXB 4BH8B 1F5WA 5SWZA 2QQLH 3MV8A 4EN3D 1TQCC 4Y4KA 3U4AA 5DMYA 4JANB 5DJ6B 4XAWH 3NFNB 1YEFH 3HNSL 5IB4B 4EUPA 5TPWL 2P47B 4CVWA 3H6JA 5TE6H 1JWUB 3OKMA 1MCWM 2R8SH 1EVTC 4MX7A 4AEHH 1MRDH 1TETH 5IMOA 4Y4FB 3E8UH 5F7KC 1DUYA 4OCXL 2AS5M 1E4XI 4FQ1L 4OIBA 1BP3B 5F7DA 1CGYA 1T2QH 2YD4A 3D39B 1H3TA 2VLKA 3HUJB 4FXGB 1K8IB 4LLVA 1LP9E 4P59H 2WBWB 4WWKA 3LY6A 3RWDA 3DV4B 3OJDB 5LWYH 4WI5A 3E6HA 3D3VB 2C3WA 4HFUL 4X6FA 2FEEI 4U6YB 3PHOB 3U82B 3BGMA 2ICWB 4Y7MA 2C1PB 3QIBA 4U1JA 4ZO6A 3OKLA 2Z93B 2CJUL 1U8IB 4N8VB 4U1GC 5GS0C 1SYVB 4I0PA 2HN7A 4OKVB 2VLMD 5EBMA 4ZNEA 3T77B 3RWGA 4X8JB 1KENH 3RGVA 1WZ1L 2QQKH 3LHPH 1JNLL 1ZANL 3QDAA 1QO3B 2ADFL 3RVVC 5DJCA 5IM7A 4LARL 4OZ4B 4ELME 2BVEA 1QSFA 4WVRA 5K9QG 3C60A 1G9EA 3I02A 1ZSDB 3PXHA 2PF6A 1JPTL 2R2HB 4X7SH 5FKAB 1VFMA 3W5NA 2B5IB 3FO2B 4K23H 2EKSA 1AR2A 1Q9KB 4YC2C 5LXGL 3FQRA 1FDLL 2BOBB 4Y5VB 1UACH 1OCWH 4NJ9H 2CLZB 1CFVH 4WUUA 5T5NF 5KS9E 4QRTB 4R2GD 4QGTA 1EHNA 1ZV5A 2GK2A 1XF2A 3QUZA 2YUZA 4P57B 2P7TB 3WIIH 3W39B 4JZNB 3VWJD 5L7XL 1HSBA 4FFVC 1NAKH 4QRPA 3LQAH 1PZUB 1MI5D 1ZGLM 1G9NH 4NC1E 2H9GA 4I9WD 5I71B 1T20A 4LASL 5GGRY 5C0GB 2FO4A 4FHBD 4LLUB 2JIXD 1Z3GL 3OF6D 1B88A 4HJJH 4H20L 2ZJSH 1T1YA 2E9WA 5DHYA 1SM3H 5CMAA 1Q1JH 2B2XH 5HDBF 1Q9OB 3JTSA 4I3SL 3MLSH 2IBZY 5JDSA 2ZOLB 3J7HA 4DUVA 4M1GL 3MOBL 5T5FH 3OXRA 3NIDE 5J13B 3TN0D 4B7LA 1WBYA 4CVZB 5DZLA 1OAQL 2PYED 4FN0A 3DURB 4LPXA 1YYML 3BZEB 3ILQD 1JPFA 3HUJE 4MA8L 3OSKA 3EDKA 5HD8C 1NBYB 2ZG3A 1RULL 3KYNA 1IAKA 1BZQK 3N0PB 2VABA 1X4YA 5I17A 1KPUB 3FO9B 1GH7A 5IJVA 1JI1A 4ZFFA 4I1NB 3NPSB 4JO4H 3CNKA 3SDAD 1RUPL 4RGOL 4HWEH 4K9EH 1M05B 1MJ8H 4XP1H 3SDDB 2NY6C 2R39A 2ESVE 4XPTH 5ADOH 3BSZL 3F65A 4ZXBA 3TWCL 3V5DB 4EBQH 5CWSB 5IBLC 3T0WA 4JO2H 4ODWA 4HUWB 4XPFH 5HD8D 3D39A 2FHBA 3CPLA 1T1WB 1FV1A 1U3HB 1U91B 1OM3H 3Q3GA 5B39B 1QKZL 2MHAB 4B7IA 3HZKB 2AJ3B 2C4FU 1P9MC 6FABL 3VFOB 5JA8B 4XWGH 3ARVA 3PL6A 4I48A 4PJ9C 3CVIH 3GBNL 2FL5B 4R7NB 1CDJA 1BF8A 2QQNL 3D3VA 5EO9B 3HHRB 4LU5H 3MV8B 3T0EE 3UBXB 4IRJB 4JO1H 4OGYH 4XXCC 2VXVH 43CAB 3OTTA 3EJJX 2H2PD 3O3DA 5AZEH 2M1KA 2FECL 4KI5F 4EOWL 1QRNA 3BYYA 1M7DB 1PZ5A 5TQ2L 3GM0A 2NY1C 5T3XE 1N2RB 3NFSH 3QO1A 4OT1L 5EC1B 2AJSH 3BHBB 2AXHA 1VFAA 3MACH 3K1DA 2ADGB 3OAZH 4KGJA 3VXQB 2N1KA 5T1DH 1OAQH 1DP0A 4W6YB 3D85B 1CL7H 1G7JB 5INDB 1EX0A 1PEZA 3H2WA 4WIQA 3KJ6L 1PY9A 3Q2CA 1YY9C 3HG1A 2ZCHH 3BPLC 1IILE 4TUKL 4WCYL 1J86A 2X1OA 1S7VA 4C83B 2F5BL 4LL9A 2FSEB 3VW3L 4JRYA 4RAUA 1AHWC 4QCIA 3W0WB 1VPOL 4ZS6C 4HFUH 4RAVB 1MAML 3BIAX 2GSGB 5F7EL 4ETQA 1NDGB 3KXFD 3UZVB 1DQMH 1QO3A 3U9UB 4K7PL 2C7UA 4G6KH 3IDJA 3EYFB 4PRDB 5SWQB 5HHPB 3QUMA 5L8JB 1GZPA 4OSUL 4ISVA 5EIIB 2DTMH 2F8VA 3WUWA 3QEUB 1VEPA 4PJXF 5I18H 3LEVL 3LRSA 1S3KL 3TNNB 1NEZG 2V2XA 1N5YH 3PQYE 3TJHC 3FL7A 4OIIH 4HBQA 4TSAH 4PJBB 5HHQA 4YO0A 1CXLA 3V6ZA 2J8UA 5FECB 1UA6H 3ROLB 4RMSA 5E8PA 1DEEA 1JPFB 4J4PA 4OI8A 4X6CF 3D2UA 4LPYA 1MHCB 1U8NB 1TVHB 5C9KA 1UEYA 2XA8H 3NMEA 2XZQL 1YQVL 1P4LA 1A6ZA 4ZSOB 1L7TH 2EDEA 3VA6A 3HC4H 3S88L 5DUPH 1BJMA 4U1KB 1CLCA 3IDYC 5D2NB 2CK0H 3DMMC 1NAKL 4Z0XA 2P5EB 4UU9A 1VKXA 1S8DB 1OSZB 4PR5B 1AQKL 1PG7W 4UOJA 1X6LA 4QTIL 3HR6A 4ZOCA 3A0OA 3C6LC 5EWIH 5ICZA 4XMKH 1ZHNA 2H6PB 4PJ9D 1XZ0B 5BV7C 2CD0A 2EC9T 3RVUC 1M6OA 1I3RA 5B38G 1BFOB 4V1DB 3IDGB 1WBXA 3GO1L 4LCUB 4U33A 4WUKL 5IB1A 2GJJA 4F9PA 2DQEL 1MJJA 3CFCH 5JORA 5MHSE 5DQDL 5IQ9A 1IM3A 5ID1B 5MENB 3ROOA 4JZJA 1UCBL 1R0AH 3RBGA 3PWNB 1GOHA 4IBLT 4H5SB 1XEDA 2FX9H 2X4RA 1I8IB 1DUZB 3C5ZC 4O5LH 3E1F1 4HKJB 5D7LE 5T1KD 5T1MB 3HMXL 4ELKB 3L5IA 4PG2A 1BJ1J 5SX5H 2OTWA 5E5MA 3HFMH 2X4QB 1IGMH 2AJVL 2OM5A 2IANA 4IJ3C 2HRPH 5A2FA 1W72B 1XGRA 4ZO9A 3GK8H 2X05A 3U4EA 1MCOH 3I50H 5D7LA 2DD8L 1JGUH 2RJMA 1HDMA 4Z77A 1WIUA 1G84A 4WFGE 1JHKL 4IOSD 3L5HA 3TT1L 5C3LD 4FG6D 5JLZA 5INCB 5IVXE 4LLUA 4Y4KC 1FYTE 4M93B 3A67L 4Y2DC 1F4XH 3FFDB 1GGCL 3BSZH 4JHAL 2LABA 4YLQT 1GC1H 3HI1A 5E9DD 5E8NB 4JFFA 4QOKA 4YHML 5BVPL 4XWOD 1IGYB 5DVLA 4A2LA 3E3QC 4Z7WE 4Z8FL 5HGGS 5ILTL 4JHZA 3JWOC 2FECI 2A0LC 5CJQL 1X5IA 3V7MA 1T80A 3OB0H 1QKZH 1Z3GH 2B0SH 1DQLH 3BW9A 2Z8WC 1JWMA 2XZCL 5JOEA 5LCVL 2NTSP 4TOYL 3UROR 4P46B 3DECA 2M8XA 1FC2D 1RI8A 4X5WB 2MMXA 1WSST 4Q9CA 3CXDH 4DCQB 1NCUA 4N90D 3V9FA 3EYFA 1QBAA 4NC2B 3FB5B 4Y2DD 2FLRT 4POZD 5GS0D 5K93A 8FABB 1CS6A 4NOBA 1I1RA 5DHYB 5F89B 1KB9K 2FWOA 1DCLA 1I3GL 6CGTA 4LHUG 5T3XD 2VR5A 3O8XA 4RNRA 4JKPL 4DK6A 3NA9H 1SYSB 4MXQD 3TYGL 5A16B 3VRJB 1JUFB 4XPBL 3BN3B 4GXUM 3TJEL 4K8RD 2J88L 1A6AB 3QFDA 5TFSL 5C08E 4RGNC 5AD0B 3SE9L 5C70A 4MCZA 1FNSL 4RMUA 1QSEA 1RZKC 3IKKA 3O2DH 4ZFZA 3U7WH 1EEQA 3LB6D 3S36L 1G9ML 3P4MB 4JRYB 4HH9B 3DYOA 2JELL 5C0DB 5M7QA 2LAAA 3DVNB 1EMTH 1OGAA 2FH6A 3SY0A 1UB5A 3FAWA 4GS7C 5H94B 1KJ3H 2MKWA 5C3TA 4YJZL 1TZGL 4J12A 5HHVH 3QCVH 4LSPL 3SEPA 1E6OL 3WJLA 2BMKB 2OI9B 3N50A 4PJ5D 4XPGL 4ZUWB 4IDLA 4IRJA 4WHYH 3T0BA 1CIDA 1MRFH 1N0XH 4K3EL 5TDNB 1J1OL 5E99L 1OSPH 5GRUL 1T3FA 4XBGB 4K94L 1K85A 4ZFOA 1INQB 3GRWL 5EOCH 2UY6A 3CSYB 4GAJH 2X7LA 4DVRH 4EKXA 3CD4A 3LZFH 4MA7H 5C0CB 1EEUA 2JB6A 1CK0H 3TPUA 2K3TA 2P5ED 1BFOA 3L1OH 4XNUL 2EDTA 3WXVL 2OZ4L 3G6JB 1HK6A 4DN4L 4GLRI 3SBWA 2JKXA 2W65A 1MFNA 4CW1B 2Z31C 3O6KH 2E27L 3AROA 1JZ7A 1LNUB 3E6FB 1J05B 1JWSB 1T04A 1UM5L 4L4VB 2BNUB 3KPMA 3RIAF 4Y5YA 1YMMD 5GGVH 5FXCH 1UVQA 3KJ4B 4OD2B 5E2TL 4HS8L 3VWKD 1A1MB 5E94B 3CFIC 3HE7C 1SMOA 1NCDL 4G43B 4UV4L 3F12B 5DK0B 3LMJH 1L7TL 5MEND 1RJCA 1MVFA 1IGFL 2IGFL 3WO3B 1QYGL 4GS7B 5DLMH 5C0BA 1KEML 4ALAH 1FGNL 4D0BA 4X6EB 4NO5B 3R06B 1E6JH 1LDPH 5EBWB 5JNYA 3MRBA 4APQB 1FG9C 5FECA 5F8QC 3BDBA 1C08A 3QUXA 4MNQE 2C3VA 2JCCF 3EOTL 3BPNB 3HI6H 1T1ZA 5FCUH 4LEOB 2YPVL 1MVUB 1GGIH 1KTDA 3SGDI 3A6CL 5CEZL 3UAJC 5IT2H 4N90E 2YPLB 3HC0A 3ULUL 5EZOH 2DICA 4U6VL 5GGTL 5B21A 3F58L 4FFZL 2W92A 2YPKA 2BNQB 3BE1L 1CICA 3T2NH 1IC1A 4B0MM 4MJIB 4F57H 5IB3A 1CQYA 1YEKL 2C9AA 2GJ6D 4J6RL 5DQDH 5J0BA 3MBEB 4YXLL 5FDWB 4LF3A 4S0TD 5HHPA 4PGEB 4YZFE 3SKJL 4YHLL 1GZPB 4D8PA 1J0KA 5GRUH 3KYOB 4OQTL 1WIOA 1DN0B 4XX1E 1QNZH 3SOBL 5IJKA 1OW0A 2RFXA 3WS3A 3MQIA 1FFPB 1Q38A 4JFQA 5CP7A 4WDIA 2AI0L 4QHLB 3NCMA 5BOPA 3MLTA 4PJEE 5MP6H 4NN6B 1OTSD 4YGVA 5HTSA 4I77L 1ZHKA 1FVCB 1CU4H 2QSQA 2ZUUA 3LKPB 3IETB 4K3GA 3T65A 4FQQB 1LEGB 4L29A 2APVA 4QOKB 2EZ0C 4PUBH 4XBEL 3JV6B 4HC1L 5HHXL 5FUOL 1U8MB 1CFQB 3O4LB 2H6PA 4L9DA 1LDSA 1FO0A 1KJ2A 4RMVA 1JUFA 4XHJD 1DUYB 1GC1L 4RX4A 1FO0L 2NNAB 3TNMB 1GOFA 1N6VA 3H3PH 1TQCB 1JWMB 3MLXH 2ILLA 5I1KL 2DYPD 1TFHA 1IE5A 2QR0B 2IMNA 4WHTA 3BH8A 2AJXL 4Q0XH 2F54E 4NFDA 1UENA 3OJDA 4G6FD 3MA9H 3TCXA 2RB8A 1QFUH 5KTEH 3MJ9A 2EICA 1DBAH 4UT7H 5DHVA 2IADB 1U8IA 5C2BH 3L95A 3B2VH 3X11A 3LS5H 4KC3B 4HK3J 3MRFA 1FNLA 2ERJB 2GI7A 1RMFH 3MCKB 2ADIB 2MWCA 1D6VL 1F4YH 1TZIA 2M26A 3O6LL 4R96B 5MHSD 2R29L 1RZFH 1AO7E 2AVGA 5BRZE 5KVFL 5TJWK 1ES0A 4JKPH 2NYYC 3CIQA 2XN9B 2JF1A 4XAWL 4NN5C 3OBAA 3HI1B 5DYOA 3ULSB 3VXME 2DWEB 5GRZA 2XPGA 1RQ5A 1I8IA 5DEZA 3ET9F 2NX5E 1NL0H 3V5HB 2YPLE 2DM3A 3MRKA 4HF5H 3MXWL 3G5XA 1G7PB 5H37G 5GRYA 2W65B 1JRHL 1CTOA 3ZDZF 2DMBA 1N59A 3P30L 4L3CA 3L3KB 4NZTL 4NQCA 5IJVB 5J12B 4H26B 3GIZH 3ZKMD 5KN5B 4QHUA 2VN7A 5HHVL 4OD2A 4KMQA 2XACC 3MJ9L 4J3OC 4YEFA 4WU7B 4X6EA 1MIEL 4XP4L 5ACZB 2Q8AH 2VDNL 3GBLA 4XRCB 4JFPB 2GTZB 4XGZB 5IMMA 2KQNA 1T03H 3AGVA 4W81A 4LCWB 1OHQA 4DEPC 3QEHB 4FFZH 1JP5A 1EFXD 2OL3L 5IEHB 1RUKL 2X1QA 2AXJA 3QQ9C 3RUGA 3W82A 3HB3C 2LQRA 2HA1A 5IOPB 3U36B 1JJUA 2PO6D 4FQXC 1IL1A 5I1DA 5KS9B 1PD6A 3NZHH 1FE8L 5BZWA 2HLAA 2H26A 4JVUA 2AJUL 1U3HC 3ZE1F 3VD5A 1HINH 3VG0L 1XF2B 4TPRH 4UTBL 4XHQA 3VG9C 2VXUH 1U41A 3F7QA 5KSUA 2NY3C 4FQCL 5IM7B 2GK0A 1MF2L 2CO7B 4PRHB 3V6BR 3EYUL 3CGTA 3RGVB 2FIKA 3QWOB 5KG9A 1KXVC 4RMRA 5CEZD 1W0VA 3DXAA 4KUZH 3EO1B 4JY4B 4Z95H 4N9OB 1HHIB 3ARSA 4UI2A 3VH8B 4XC1H 1AGEB 2JTDA 3AU1A 2BRRH 4HAFA 3SDXA 2JK5A 2R2EA 3GIVB 4XCCL 3MGTA 5CP7B 3VGDA 3FFCE 3P9LB 1OVZA 3SGEH 1FFOA 3A6OA 5EDXA 5I9QC 4UZGA 2W9DL 3O6ML 1CI5A 3D85A 4JZOA 5I6XB 3DETC 1HHJA 3C5JA 5F70A 1GAFL 1U8KB 3WSQL 1MCPH 4NZJA 3B8YA 3FHAA 4OD1H 5GPRA 1ZLSL 2KKQA 3IU3A 3D87B 1V7NL 1ZHLB 4MQXD 3OGCA 2HMID 2HTKD 4ZOEA 5KW9H 1S9WA 1NFKA 3MA7B 5GISH 3GSUA 3GSXA 4NUGH 3KLAB 1AKJD 1K3IA 3Q3GB 4HXAL 2DDQH 3LD8C 4F7PB 1WZ1H 2QQKL 3LHPL 3CDFA 1DANU 4HT1L 5TH2A 5KVMC 3O45A 2V7NA 4XVUD 1F2QA 2XXCB 4MJ5A 4R0LB 1H3WM 2ICWI 2EIDA 4R97B 5I16B 3IS0X 5ITFB 3DO3A 3O6LH 3DIFA 3NIFF 4HCRA 5FOJA 3ZTJG 3RY6C 2YA2A 1JNHB 2R29H 1MCBA 3KXFB 4S1RH 1ZHKB 3LQAC 3O81A 5IFHL 4BFBD 2PN5A 4HKBA 5C0BB 3ARDC 3BFOA 4M61B 3DNKA 3DJ9A 2IADA 5F7FA 5CEYA 2VLJD 4Z7NF 1G0DA 4PJCB 5DJDB 1INEH 1KB5B 4EBQL 3MGAA 4RISL 2AJZA 4PJFB 5GGQH 1KTDB 3CPLB 3GSQB 5F8RC 2XKSA 5IP4A 2VABB 2Q6WB 2XWBA 1I1AC 3ULVC 4OCXH 5K33A 3KPRB 1NGZA 2N56A 2EE2A 1VFAB 3BPCA 4KTEL 3LH2L 3VXQA 3IAGC 5JIPA 1P1ZB 1YNTA 3OKEA 1AGCA 1BIIA 4KROD 4Y19E 2X1PA 1V3JA 4TTDC 1J0ZA 1N5AB 1PSKL 2VZSA 1QUNA 3S6CA 4XPFL 2YPVH 1UJ3C 4HLZG 4OLUH 4PJDF 4JO1L 3JV6A 1TTFA 4YQXL 1X5GA 3PGCA 4LLDB 1F42A 3V0VA 1A6PA 4JFED 3U4BL 3W0WA 5BS0A 3SDCA 1SEQL 3GMMA 3TH3T 4CU7A 3RZCA 4JQVA 5LAXA 4FQIL 4JQXA 1VKXB 4XP6H 4E41D 3VW3H 1S8DA 3IDNB 5I1JL 4BQ8A 3D9AL 2A83A 4ZTOL 3QUMH 3B2VL 2X40A 4LSSH 4XNMA 3GI8L 4GG6A 2E6JA 3RWFA 2XN9A 1LO3L 5TFSH 2V5YA 3TIEA 5F9JA 5FUZL 2J5LC 2CDGB 3NA9L 1GOGA 2GJ6E 4CN1A 2Z8SA 2LTQC 5E1HB 4EOWH 1B6DA 2H2SD 3NIGF 4BQCA 1KCVL 4ZNCD 3AS1A 4YK4B 1OGTA 1YECH 4EUPH 5EUOF 2DQHL 4U3HA 5DMKA 3CLEL 2C4XA 4HPOL 4WI9A 4WI7A 4YHKL 1JE6A 1V3KA 5IB5B 2J3SA 4HBCL 5ITBL 1EBAA 4PJBE 1UWXK 2ADGA 3DX8A 4E42B 4JPVL 4ZS6D 2VITA 5T1KB 3PP4L 4N0CC 1INDH 5I8CB 4YHNB 4LCWA 4HK3N 3QRGH 3SDYL 5D6DC 3TO4A 1Y6NR 1SHMA 3LQMA 2E6PA 4FFWD 3QP3A 4LCCB 5AZ2H 2ERJC 1MCDA 2EH8L 4LPVA 3RDTA 1MQ8A 4GKZB 4FZ8H 3I6LD 4NWTL 5JMOC 1H5BC 5IBUG 5J3HC 3KYAA 3U36A 4XNYL 5J9PA 4Z7UA 2APWA 2DLFH 4NYLB 4J8RB 4TSAL 2YC1A 3K8LA 4R96A 3RWJA 5GISL 1C8PA 1WUNT 4X5LA 3GSVA 4TNVF 5CKAA 2J4WL 3G04B 2P8MA 2MPAL 1JPST 2B2XL 3DBXA 2Y5TA 1NBVH 3BEWA 3MLSL 5E8PB 2ZCKL 2MNUA 3WXWH 2VB5A 3O6FB 4JG0H 3C08L 3BD4A 1JFQL 1F4HA 4MAYA 1F4WL 1MQKL 5I1IL 1CBVL 2A9MH 3TIDA 5IFHH 4M7LT 1ETZA 2AABH 2NY5C 3EW3B 2J5LB 1BQUA 1OF2A 3O45B 3DX9A 1EGJH 2IPUG 3CMOL 4I0PC 4MYWB 5DUPL 5C8JB 5KVEL 1L0XA 2VZVA 1EJOL 3WEXA 5FO9B 4X4MA 2W07A 1OT1A 2Z91B 4FP8H 5J1SC 2I07B 2ADIA 2BZDA 1MCRA 4F2MA 1I9RH 5HHMB 3LRSB 1QSVA 2PXYC 2BCKA 5HY9B 3QWRD 1YEJL 3I3DA 3T0VA 5J1AA 3P4OA 4GKNB 5ETUA 1U3YA 3JUZA 2QEJA 2J8UB 3IB4A 4KJQD 1HWGB 3HMXH 2XI9A 5I76B 1FCCA 2OBGA 2J6EH 4PJCF 1J18A 4P59L 2N7BA 1ZK9A 3QFDB 3FZUD 1T7ZA 1JPGB 2ARJB 2OCFD 2VTFA 5MEQB 1A6ZB 4ZSOA 1KB5L 5E2WH 3G08B 5ANMB 4IIQB 1I7ZB 4X4ZA 2CKBL 3B9KD 5CJBA 3RVUD 1YNTB 1HQ4B 4F57L 4FZEH 3IFPA 1S7TB 4ODSH 3R8BB 4KI5C 3P77B 4XB7A 2O5YL 2IBBA 4ZPTA 5I73C 3RPIB 1LILA 4OCMC 2OK0L 3ECBB 1S7XA 5EU3A 1NC4B 5BVPH 4M9PA 3WJJA 3TBVA 4CJ1A 4WEUD 3SKOB 1MHEA 4PJ8C 3VXUD 4H8WL 2H32H 1F2XK 3ZT5A 2XXMB 1CXFA 3KDMA 5DFVD 1U58A 1YJDL 4YDLC 4GW1B 5MERA 1ZHBA 4JKLA 4Z77B 3IJYB 4YDIH 2N4IA 1YY9D 1G0YR 5KVGH 4NO0B 2J4WH 3VXRA 2VO5A 1D7FA 3FB5A 4JG1L 4R0LC 1I3RB 4XVSH 2CIIA 4LBEB 4JFEB 1Z0MA 4IMKC 5I71C 4MWFB 4ZAKB 3HN3A 2OSLA 4HMCA 4OI7A 1QZ1A 4U1MB 4L4TB 4U1HA 3OMZA 1YN6A 5DJ0B 2E7BA 5T1LA 3ALXA 1U8QB 4GXVL 4IMLB 3MCG1 3FO1A 5CD3A 3PWNA 1CR9H 4KXZH 3CLFL 2A9NL 4EXKA 3OX8A 2GIYA 2A6KA 4OZIB 1MLCA 3TJEH 3S96A 5DJ6A 3DXAB 1RK0B 4KK6C 4FG6C 4MD4B 1YUHA 2PYEB 4OV5B 1KIQB 5HYQB 1KC5L 2YD3A 1PSKH 4DZ8B 1IGCH 3FFDA 2O5ZL 4V2BA 3GIVA 1UB5B 4WENB 4PJHE 1I85C 5EBGA 3LS5L 5FOBB 5IFAH 2JELH 2CPCA 1IAOA 1IEAB 3QHZH 2VLRE 5F6IB 1UKTA 3BKJL 4QY8A 2F53D 3BO8A 4JCMA 1AIFA 1SQ2N 1X5AA 2NXYD 3F7YA 1ZLUK 4DTGH 4J1UB 2BVQB 1WQVT 2OI9C 3W11D 5IKCA 4DVBA 4KI5D 3PV6A 4Y5VC 2BVOB 2X70B 4LRIC 1JK8A 2JJTA 1CFNA 5L0QB 1WF5A 3HNVH 1XGPB 3PABB 3RUGE 5DT1L 1NMCB 5DJXA 1MH5B 4E5XB 4FP8L 1KCUL 2P8MB 2V5RA 1L7IL 1OTUD 3WCYA 1YNKL 2B4CL 1FHGA 2H1PH 4FQJL 4FQPA 1HXYB 1BD2A 3P11H 4XB8A 1MNUL 2NY0C 2R9HC 1HYRC 4UQ2B 5C8JA 3S5LG 4JVWA 1DLFH 3V4VH 2EDFA 4FQXA 1UQSB 2VISA 3LEXA 4HKXA 3HRPA 1AHWA 3FN0L 5FKAA 1RIVH 3KPMB 5T3ZD 2VDKH 1D9KC 4RFOH 1U8OA 4Z0BH 7CGTA 2Q1EA 5EN2A 3ILQC 1T20B 5C0GA 3ZKNC 1J0YA 2PKDA 1YEHL 3GIZL 5GS2H 4O2CB 2H8PA 1KPVA 3GSQA 4UOW1 1S7SB 1XF1A 1X44A 3VXSE 4MA1C 5AD0A 4OZFG 3RWJB 2VXSH 3C09B 3UTSA 3UJIH 1CN4A 2JB6B 4I0KA 3TPUB 1YEGL 1UADC 4Z76B 3OXSB 5H94A 1DBJL 4BFEA 2JJSC 4OZHE 5SX4H 3EHBD 1JV5A 4JZNA 3SQOL 3H3BC 3QUXB 4GBXA 2CLRA 3ARFB 3ULVF 4DAGL 4OAWB 1N6QL 4OLXL 1G7QB 5EOQH 3MRMA 5DEGA 5DQ9A 3N1GC 2R69L 5KVDH 1EGJA 1CWVA 4ONGH 2CLVA 2IH1B 5T33H 1WITA 3QHFL 1J5OL 1K5NA 1AJ7L 4YR6A 4K7PX 3KNBB 3NH7H 1LO4H 4YFLI 5DMIL 2YRLA 2VL5A 4X8JA 4CADA 2R56L 1B2WH 2HWZL 7FABH 3O3EB 3L3IB 4D9QD 2LU3A 3WO4C 1HKFA 2ZNWA 3ARBD 4GXUN 1L0QA 5IW3A 4NWUL 5FIEA 1J12A 4UQ3A 5HYFA 2A6DB 3OKDB 1U3JA 1KEMH 3HAEA 1CFSB 1TJGL 4OZGA 1FVDA 1CGSL 3ISWA 2Z0BA 3FT4A 5D7IF 1I9RL 4U1NB 2OX5A 3H9HA 2WUBH 4XP5H 3FQNA 4DUXA 3C2AH 3VXUB 5J56B 5CUSL 5DRZA 3DUSB 2YBRA 1JTOA 3GB7B 3TIDB 43C9B 4FQ1H 5AWNL 3OKLB 4PBXA 3F7VB 4NQXA 5D1QB 1MAMH 3MRQA 3M8OL 1YNKH 1KELL 1AGFA 4ZG1A 4RMWA 3ZT7A 4LVNB 1R5IA 2E7CA 2NY3B 5D72H 1NAML 3LB6C 5CILH 3RJDA 2F9BT 3U30B 3BD5A 4OZ4A 3W9EA 4MVBC 4BJLA 5L8KB 3RHWF 3TBTB 3KYOA 1WCBA 5E2VL 3QNZB 1DN0A 4NQVB 2C3VB 1ZA6A 2VE6B 4M5YH 4TVPL 5FGBC 3D18B 1J11A 5EBWA 3HZMB 1KXQE 2FYYA 2P1YA 5HPOA 3QG7H 1AP2A 3M07A 3MUZ1 1A2YB 2XWTB 3H9SA 5DA0B 4HUMB 3MV9E 4IIQA 1UWGH 4JLRB 4PRBA 3EDFA 1CZ8H 2YPKB 4OM0L 4O9HL 3IDXL 4OQTH 2MHAA 1NMCC 3HAEH 2XQYG 3U48A 4PP2B 4DFIA 4U1LA 3PE9A 4W68A 4Y5XA 3AREA 3RWEB 2DKUA 3BIKA 1C1EL 3WYRA 5L7XH 3B6SB 3B2UC 4GUPB 3QHFH 4LF3B 5DGRA 3QIWC 2OJEB 2FL5A 4R7NA 3DARA 3WBDA 4MJIA 1E4WL 3STLB 2Z9TA 2VLKE 5IJKC 3HKFA 2H9GB 1RIVL 3EO9H 3GNML 1OARH 1Z2KA 1OL0A 4JFHD 4NO3A 3CH1A 43CAA 4ODHL 3T2PA 4NKDA 2ICES 5LGKA 5CZVH 2RFXB 4UTAH 4H1LA 2VISB 5JXEA 1CFVL 5EC2B 3DV6A 5F44A 4QXWA 5KS9F 3WFHB 2BHYA 4FQQA 5HI5D 1SJVA 4G8GA 2OJZH 1A6VL 2PTUA 4RBPK 3P4OB 3NBNA 1OY3B 3VFVB 1AQKH 5C09A 1N0LA 3PQYB 4N0YH 5GS0L 3EOAA 3FQUA 3BZ4B 4YHYB 1S7QB 3REVA 3ARFC 3ELAT 5J7CC 5IIEA 2VUOA 4P2CG 3QZWB 1B6UA 5DURD 3SJVD 1MFEH 2BX5A 4NHUB 5JQHC 2DAVA 2EECA 1JF1B 4YDJA 5I1AB 1G9NL 4HUWA 3PWPE 4S10A 5FB8B 2WIIB 5KSBE 1J1PL 4MGXA 5F9DC 1OD9A 2DM7A 1F8TL 4JFYB 3FQXB 1ULVA 5E5RB 1SJHA 1SBSH 1KPRB 1MIEH 1RMFL 2R4RH 3HRZB 5DQ9B 3AAZB 5I6XC 4UUJB 4ZDHA 1F00I 4GAYA 5IHUL 1L9NA 5F7WC 5FYJU 1XR8A 3X3GH 4DGVL 4F80A 4OCYL 1A7NL 3V4PL 2XKNB 5KS9A 4RIRB 4LSRH 4GBXC 4HKXB 2PXYD 3CVHH 4DKDC 2MQ3A 4FQLH 2P5EE 3X14A 3RRQA 5HVWA 4NDMB 2DRUA 3WN5C 4N0FB 5DUBB 2EIZB 1S9KC 2BNRE 4G5ZL 4PJDE 1YYMH 4CBPA 5IF0B 3WMSA 4HLZH 1JHKH 3TT1H 2BJMH 2OR9L 4HS6B 4LPCA 1WICA 3TA3D 3V5KA 2DWEA 4PJ5E 2Z35A 4G9FE 1W0VB 1YNLL 2NW2B 2DTSA 3QDGA 1IAIL 1T6WA 1QP1A 1RUMH 1JVKA 1T21B 2Y7QA 4DN3H 3WFEH 3ZO0A 4ZXBC 4K9EL 5L88L 4MD5A 4QRRA 1KTLB 1HXYA 1XZ0A 2HFTA 3TWCH 3O41A 2AAVA 4WV1A 2LFGA 4UIMB 4X7DC 2QQNH 4NWTH 4HZLB 1A8JH 1L6XA 1LO0H 3BKML 3GZKA 5FA3B 3H0TB 3AS0A 3K2UH 5EOTA 1G7PA 2RAMA 3S4SG 3NFPA 1T83A 4NQXB 1BZ7A 3MRQB 4KJPD 2CGRL 3T4YB 3WFDL 1BM3H 5A43C 2MPAH 4GRLB 4XNXH 5ISZD 3SDDD 2ESVA 1ZT4B 2IAMA 4Y16B 3QNZA 3ZYOA 1ZEAH 3LV3A 4LPTA 4HKJA 3KPSE 3ZKQD 4Z7WF 3G9AB 5CHNB 1IMHC 1V7ML 3BHBA 1FVEB 2AJSL 4I3RH 1S9WB 1QBLL 4P4RB 4E9LA 1A7OL 3QFJE 4JFPA 1FZJA 1FQ9C 3AU1B 2CR3A 1BWMA 1JWUA 3OKMB 2YK1H 3PP3H 5DA4A 3QEQA 4GBXB 4JM2D 2EC8A 2O93L 3GMMB 4LIQH 4QXUL 2GY7B 4KXZI 2EIEA 1MSPA 2BFVH 4QT5B 5D6CA 2X89D 5KOVC 2AEPL 1FAIL 1IKFH 2R1WB 1A3LH 2B4CH 2H1PL 2J6EL 3LS4L 4JM2F 4LLYB 5HSFA 2HVKA 4NSKB 2VRAA 4DGIL 2NZ9D 2WUBL 3VXOA 2DKSA 4O02H 1D3CA 1G7IB 5D2LB 32C2B 4K3JH 4MDIB 3S7GA 3MLYL 3ARFA 4UQ3B 4WFGD 2UZIL 3SO5A 4JY4A 4BH7B 3RKDC 4MJ6A 3BP7A 5LWYL 4HIJB 2DTML 2J8OA 2VLRD 4JCLA 1FH5H 3OL2A 1W72A 3SCMC 2J7LA 2DDQL 5D7SL 1WWWX 3QUKA 4YBQC 2KH2B 2V7NB 4U1NA 4XPGH 5CP3H 3BDYH 3L3JA 4MCYB 3PWPD 1S3KH 2D4DA 2LV4A 1TVDA 3SKUD 5INCA 1OAZL 5CEXB 4UB0L 2GTWA 1QEWA 3SKMA 5HHOB 1GIGH 3CCHB 2NY4B 5I0ZA 3VCLB 4DKFH 4MDJA 5ERWB 1GPOL 2VZ1A 2IAMC 1IARB 5C07B 3W81A 1I7RB 1AJ7H 2MQ0A 4PJ8A 3HZYA 4X9BA 3BMWA 2R0KL 3PHQB 4XPHL 3BDXA 3RKDD 5J9PB 5DGQA 4P9MH 4JRYE 5F1OB 4OLVH 4KKBD 4NKIL 1CFTA 4TQEL 5AG9A 4QRPE 4P4KB 3HRZA 5ALCL 1ZHLA 1IM3B 1NMAH 3DBXB 1FL5A 3M1BA 4WY7L 4Z7QE 4MNHA 5B3NA 5EZLA 3BKCL 4XXDB 3AY4A 4G42B 3FQXA 4U6XB 3DIFB 2JJVA 3H7BA 5FA4B 5EU6D 4H1LB 1RZIA 5HI4D 3FQWA 1AO7D 5BRZD 3VA2C 1JRHI 3RIFF 5BV7B 3MXWH 3FT3A 2YD6A 1WAAE 4Y16D 4D0CA 3HC4L 3T08A 5I1GH 3PQYA 3MRPB 3VE0B 2QQQA 3BZ4A 4GJTB 3T4AA 5DWUH 1T83C 4G8IB 3ZDZE 3PWUA 4G6AD 2I5YH 1A6VH 1J8HE 2Q6WA 5DC4B 2DQCL 5JORB 1FN4A 5I1AA 2PW2B 4NRXA 1TITA 3QFJB 5GJSH 4LHQB 1TPXB 4HPYH 1XMWA 2D7OA 3HUJA 4LAQH 1JPSH 2DQJL 5GGTA 1R0AL 4Q6IB 4NQDE 5LBSH 1S9YA 4JPKH 1P6FA 4MXQC 3WNNA 2WK2A 3SY0B 1BLNB 3RNQA 1ZLSH 4MMXC 5KW9L 1LP9B 3LKRA 3EOBB 1UYWL 3DMMA 4P46C 3RBSA 4HG4K 2OJEA 3BDYL 5DHVH 2AV7A 1U8LB 3MBXH 4OLYH 1MREL 4P5TA 1Y0LB 1A6UH 4QRTA 3LN4A 3GI9L 4Y4KB 3RWGB 4L8SC 2VR9A 3C87A 5IESL 4ZPTB 3THMH 1BIHA 4NO2B 4NKOB 5E8OA 5E56A 1DQQB 4BZYA 3P0YH 3D0VB 2VDKL 2YRZA 4H1LG 4IJ3B 4KVNH 1MF2H 4F37K 3PWPB 2ENSA 1HH9A 2IMMA 3LCYA 1JGVH 1BX2B 5HGHA 4KK5D 1OT2A 1FVEA 4KHXL 4PLNC 4AH2A 5I75B 3AREB 3RWEA 5ID0B 4LLVB 3F6LA 3DGGA 1CQKA 2PYFA 3UBXG 3MREB 4UDTB 2JLLA 2FCBA 4P46D 5IGXL 1IBGL 3QPQC 2V9QA 5EULV 2D9QB 1OB1A 4JQIH 4KMTH 4H8WC 2CXKA 4P3CL 5ABDE 4S1SH 2JJWA 2DOCA 4NBYB 4U1JB 1UEMA 5D2LA 1HI6A 1U9KA 4A6YA 1AGBA 5T1LB 3RI5K 1TZHB 4HH9A 5I8OH 1MFCH 1DBAL 4G9DB 1M7XA 1NGQH 3JTTA 4WO4D 1JPGA 1OAYL 2ARJA 3GRWA 3DO7A 2P8LB 5I2IB 3AXLA 4XNYH 2DIJA 4C4KT 4G6AC 1D9KA 4Y4HB 4MQSB 2NW2A 2KQMA 1DDHB 3I85A 3BP7B 1HHGA 4QXTA 4XNXL 5GS3A 1M71A 4NUGL 5A16A 5CZXD 4FQIH 1S9VA 4PY7B 1QRNB 2Z4QA 4OLEA 4GW5B 3BIBX 4WDIB 3BRFA 2DQDH 4NUJB 2VQTA 1YEEH 3NCJH 1LK3L 4OFDA 4K7FA 2AABL 1ZS8B 1CD1A 2AEQL 2W0FB 2QLVB 4LLYA 5JO5B 3JWOL 4ERSH 3BD3A 4X83A 3MCLL 4PRIA 4GRLA 1LEGA 4QXUH 1JYVA 5DXWA 5IW1B 2QSVA 4ZXBB 3C6LD 4X7CC 3NTCH 3RY4A 4QYOA 3EYVB 2E8YA 1U8PB 4PG9B 3U1SL 4M1CD 2FBOJ 5DJAB 3ZDXE 3GHEL 1EFXB 2RQ8A 1NL0L 2EYTA 5D7JD 2FB4H 2X70A 4HWEL 2FEDD 4C56A 4JFFE 4EVNB 1S78C 5CD5D 1LQSR 1M4KA 1U92A 3QISA 2XICA 4YE4H 5CJOH 4XNQA 4K2UH 5CGYD 1UM6L 5CGTA 5E99H 5BCAA 1B9ZA 1B0RA 5JOFB 1TPXC 2EEAA 4K7PY 3ECBA 1DBKH 1XGQB 5CEZE 3WFEL 4LFHG 4C56E 3QQ9D 5CILL 3VXTA 5ICYA 4G8FB 3GSWA 5KSBF 2AKRB 1F45A 3CDGB 4HS6A 4X4YB 5BO1L 4M1DL 1YC8A 1RZJL 4JFDD 1HSAB 1IC7L 4WEBL 5C9JA 3TCLA 1PLGH 3L3DB 2CDFB 2FJFA 1AO7B 4L3AA 4OSUH 5BRZB 4NQEA 1UC6A 3V2AR 4A6YH 1Z9MA 3HZYB 3MV7D 4P2YA 3V6OA 1XF4B 2ZUVA 1P2CA 4XBPA 4KY1L 3M17B 3D9AH 3SJVE 1N5YL 1ZT1B 2HTKC 3L3HA 1DVFA 2XZZA 2V17L 4M5ZL 4WHYG 1HYSC 3LKRB 4DK3A 5ESAA 1BQLH 3BRGC 1MI5B 4HCRH 2Z31B 4N0UE 5L2KA 4NGHL 1NCDH 3K0WA 4OZIE 4TUJA 2BVQA 3V52H 4B41A 2VLRB 4HIHA 5CHNA 1BFVH 1UM4H 5KSBA 1QOKA 5DLML 1RK0A 4DJMA 5SX4I 3JV4A 4HDIB 3P0VH 4GLRH 2Q7YB 4PREB 4AG4L 1CDBA 4EI6B 1YQVH 3HI5L 2V2WB 5IVZB 3EOTH 4HH8A 5E2TH 3IJSB 1CR9L 2HT4D 4N0YL 5GS0H 2OLDA 3B8SA 2CRMA 3O6FD 4YX2L 1DQDL 2BNRD 4XPAL 2OJZL 3S34L 1VFUA 4KJPC 3BN9D 4NKMA 3RVWC 5EUOE 3A6BH 1FL3A 4P3WA 4PY8I 3HE7A 3BQUC 1LE5A 5KZCD 1X6NA 1RZIB 4PRAB 3BEVA 5DD6B 1I7RA 1IKNA 2A2QT 4J6RH 1FGNH 3OQ3B 4WW1B 2VDML 1AQDA 3C9NA 3EFFA 3O4OC 2R2BB 3CFKB 3MR9A 1G9MC 4Y1AB 4ZXBD 4DKAA 1CTNA 2JE8A 1J10A 1N4XL 5C0RH 5DSCB 3N9GL 4OCYH 5FYLL 3IF1B 1BGXL 4RWHA 5TDOB 5IT2L 4MQ7B 5CBEA 3RQ3A 3W9EB 4WWKC 3JTTB 1FNGA 4YDKL 3EYQC 4HFWA 3T3PE 4JN2B 2EYSB 4LQ1A 3NCFB 1U8HA 1HXMA 1N6QH 3HNVL 3STZB 1IAOB 4QHMA 4E41E 3TO2B 4WJ5B 1KCSL 1RU9H 3MRFB 3FRPG 3RPKA 3VH8A 3H8NA 1GYAA 1E4KC 3O3BA 3ZE2F 4JQVC 3OR7A 5K9KB 4N5ED 5HVGB 1ZWIA 1K6QL 3MRLA 3QFJD 4O2EB 5T3ZH 4NN5B 2VDQH 3F7YB 3OG6B 1OTUC 4G80A 3BQUA 2D7TL 1QRND 4OQ1A 4OI9A 1SEBA 1FVDB 3BH8B 1EZVX 1MY7A 3HLAB 5EZLB 4Z0BL 2DQIL 4HSQA 3VMOA 3HCVA 4M7JL 4ZS7H 1T66D 5KSVA 4I77H 4JFDE 3D0VA 3C5JB 4A2MA 2NY6D 4PJGE 1C5BL 5GZNC 4WFEE 4ZUUB 5DHVB 1Y18A 5I1HH 5ILTH 3UJTH 2VXSL 2OTUA 3KNBA 1NGPH 2AQ3A 1ZXQA 2B1AL 4QLRA 4OZFB 2AJYL 4IRSB 3T2OA 1QVOB 5I1JH 1E4JA 2NX5B 4CN6A 1E28B 4Y4HC 3MUGA 2XZCH 2H8PB 2X4RB 1DUZA 3MJGX 4FXLA 4DAGH 1DVFC 4KKLD 1T5WA 3CFEB 5SV3A 3EUUA 1WZLA 4Y4FD 3KXFA 4MA1B 4IEFB 3AREC 1V7MH 3TGXA 4NQDD 5DYOB 4D9QE 5D7IE 3STBA 4JANA 1A6UL 3UTSB 1I7UB 3KS0J 5D1XA 2HP4A 1QFOA 3FQNB 4P2RA 3BZDA 5ID0A 4QF1A 2H2SC 3DGGB 3DGCR 1D9KB 1KB5A 4KKCD 3JVGA 3MLZH 3PL6C 4K55A 1D5IL 4Q74A 1PGRB 5D2NE 2UZYB 1JN6B 4ZTPL 3MRMB 5DEGB 2R4SL 3BPLB 1KIRA 1MCHA 4L3EE 1VACB 4JFYA 3BOVA 4M7LH 3FRUA 3PNWA 1U8JA 3RP1A 4NCC2 1BQSA 3U7WL 4TRPH 2G5RA 2ZKHH 1S5HA 4BELD 4U49A 4CJ0A 2YSSB 2W0FA 5SWZB 3KAAA 4GG6F 3C2SA 3T8XB 3B9VA 3TZVB 4HZAA 5E6ZA 4HS3A 4M43L 5TF1H 4YXHH 4M61A 5J11B 1UZ8B 1ZAGA 1QHOA 2ID5A 5C0CE 5D72L 4OZGF 3K2MC 1Z9LA 5BS0B 4BQBA 2DLTA 4X6DF 4R2GC 2E6QA 3VRIB 4M1DH 1R3IL 2KL6A 3QUYD 1XF4A 4UNTA 1IM9A 1PX3A 1JZ8A 5LQBH 3MUHL 4P2QD 3VFTA 3IKCA 1J8HD 1T21A 2XWJA 1DE4A 1VENA 1F4AA 4FQ2H 2R2HA 1KBGL 2EYRA 2GITB 4M62L 2Z31A 3QIUA 1WJ3A 2CSPA 3MLUH 3I2CL 2R0KH 5C2UB 5KAQF 2Q76B 1ZA6B 1QSEB 2VE6A 4DW2L 4YUEL 1IGIL 1UWXH 5FGBA 5B3JE 2IANB 5DC9B 1FYTB 1P7QA 4OKVA 1A1MA 1IEBB 4UT9H 3OKOB 4FTVB 1NGXB 2BY1A 5I1LB 4MNQA 5J6HA 1W72H 2XYCA 4UILL 3DTXA 3P9LA 2ZUTA 1UWEL 4NP4H 3W39A 5K9JL 4AIZA 2A83B 1G0XA 2R8SL 4TUKH 4WCYH 4TUOA 4V1DD 5HI4C 1ZT1A 3VFVA 4OT1H 3L3HB 5T1KA 4DZBB 4PRNA 4HWBH 1FZKA 4RFNC 4AM0B 1FLTX 5ECJE 5EIQA 1ORQB 1F3DJ 5FHAH 3CX5J 1QRKA 1LE5B 4UTAL 4ZOBA 3QAZB 4JRWA 4Y5XB 5FGCE 1MFEL 4K71C 4NQEB 3ZTNH 5EFIA 4N9GA 2B39A 5KSBB 5CKGA 4XC3H 2PETA 4URTB 3NCYP 1NBZB 5C0AE 5DD5H 2A77H 4X5XB 2NYYD 2CKBH 3DVNA 1RZJH 1KPRA 5KSAA 1DVFB 3MJ7B 3ULUH 1G7HA 1Z6JT 3TESA 1F6AB 4NZRL 1ZGLP 3Q5YA 1NANI 2BVUA 3QZWG 4JY5H 3OKNA 5I1CH 3AMKA 2DLHA 5DQJB 5GGUB 1PQZB 3T3ME 4ZUUA 3DRQB 5IVOA 3TYGH 2DJ4A 2BSTA 4DWHA 3ALWA 3ARDD 3LPWA 1RJYA 3BESR 5CEYB 2FGWH 4RNRB 5T33L 3QDJD 1NFIB 3K2UL 4QHLA 3LEVH 1F6LL 4DKEH 3MLTB 4RA0C 3CCHA 3RZCB 3SOBH 4BUGA 5E7BA 1EDQA 4LKCA 1G6RL 3GGWB 3ULVD 3ARQA 3X3FL 2XWBB 3WS6C 1IC5H 4MCZB 4ZO7A 3MPCA 5E8DH 3LSOA 3B9KC 3WE6B 2RR3A 4P2RB 5T3ZE 5KZCB 4Q6IC 3EJZC 4AIOA 2FHFA 2V2TA 4L1DA 1KJ3L 3EDDA 4LSUH 5A3IC 3VXSA 3OPZL 3JSSA 3P4LA 3RNKB 2ATKA 1PKOA 5CJXA 1F6FB 3DURA 3QIBB 1H3VA 2FJGA 2EYSA 4WW1A 2ZPKL 4MS8D 1A4KA 4QHNB 1NC2B 4W4OC 4UILH 1CDYA 1IAIH 4X9IA 5FO9A 3WEXB 1NH6A 2ZUYA 2AEPH 4JREC 5B38B 2F54D 1PKQA 4UAOB 4WGVB 4X9GA 5LJYH 1ZT4A 1N6UA 3MLVL 4R3SA 3IF1A 3U0WL 4X8XA 3FMGL 1FZOA 4WO4C 5L0QC 5FDWA 5EU6B 3BMVA 5FDYA 1OGAD 5GRVK 3GSRB 4F7EA 3R06A 5J1AB 5JNYB 1PDKA 3KPLB 3I02B 3E0GA 4N8CH 4JN2A 1CLZL 3FTGA 1HXMB 3KPSD 4B50A 3BWUC 4FQ2L 4UIMA 4ZPVB 3RX8A 4BSVA 3EJZD 4QF1B 3KPRD 1A1OB 1FN4B 2ZOKA 1ERNA 2P5WD 4O2EA 3UCRA 1T7YA 2G60L 1SYVA 3IDIA 2X4PA 1UJ3A 1RHFA 1KIUA 2DM4A 1MPAL 1EV2E 4JM4H 4NNPH 3UZEA 3QUZB 1U3HD 4BKLA 3ARBC 1DE4B 4TVPE 5B4MC 2MSPA 3CVHL 1FBIH 1A02N 4JPVH 3VFMB 3QXUA 1DBMH 1FYTA 1N59B 2YUXA 1G7MB 3VFSA 5EPMA 1YECL 2P45B 5LGHL 1Q8MA 2K1MA 4G9FD 4MNHB 3IXAA 3CLEH 1BZ9B 1C08B 3O11B 2X10A 5TE4L 1AD0B 5DMGD 5CINH 1JYNA 4OV6F 1MJ7L 1V3LA 4KKCC 4A6YL 3IFLH 4LEXH 3CFJA 3QXDA 3AB0C 3T04D 1D5ZB 2DJSA 2HTLD 3DVIA 2ENYA 5DD1L 4ACPA 5FUCE 1XT5A 3WFBH 2NW3B 5FKPA 5C0FA 1ACYH 1K8DB 1NQBA 3K3QA 4M3KB 4CL7A 1KJ2L 4P4KA 6FABH 1QLEL 2EZ0D 2HVJA 4W6WB 4MLSA 2Y23A 4X0KA 3U0WH 4M48H 3I6KA 4TSCL 3SGDH 5HYQA 4PJBA 3QIBD 3L5WA 3TVMB 1F8TH 4G3YH 1GVIA 3FB8A 4X4XA 4XZUA 3MOBH 2W9LA 2VXTL 1CLZH 1PG7L 4IDJH 3KHQA 2P8PB 5HGAB 1LEIA 3JV5A 5CLWA 1IEAA 3CH8A 4LSQH 4NCDA 4XP5L 4NWUH 3WDJA 4WV1C 3C08H 3VFGH 1QSFD 4PRIE 1HH6A 1XF3A 5AWNH 1JNNH 1BVKA 1U8MA 2M2DA 2BNQD 4KRMB 3V4UL 3CMOH 1WFNA 3LQAL 2X41A 1I1AB 1N8ZA 2RIKA 3IT8D 4Y8DC 1CD1B 5SWSE 5I73B 3ILPB 1A6WH 2DQTL 3CDCA 3MRGB 1J88A 1KLGA 4N5EC 4KHTL 5EU7C 3P73A 2WIMA 2OMBA 5SWSD 3ZE0E 3S34H 1I1FB 5IMLA 1IQDA 3IXTA 1MH5A 1FBIL 3F7RA 4YAQB 4WI3A 1XIWA 4WUUD 3MRKB 4WW2A 1U8QA 3G5XB 5E70A 1KLUB 2XTLA 2YWYA 2NZ9C 1QFWL 4U7KA 3RNKA 4PRPA 3T2QA 1I8KB 2G2RB 5T5NG 5EIIA 1T2XA 5IB1B 3QXWA 1B4JL 2ATPB 4JE4B 5B38A 1H5BA 2J8HA 4LAQL 1KYOK 5JPNB 1G7LB 4G7VH 4FTVD 1ZMYA 4MD4A 3MV01 3WIHA 1ZLVH 1F3RB 1NCAL 2O5YH 2DYPA 4QRSA 1ADQA 4Y19D 2V2XB 3PDGA 4HXAH 3MCKA 4PV8A 1OWRM 1OAUL 4L4TD 2BSED 1EJ6A 4PP1C 4QRRE 3NACL 4GAJL 3O4LD 4Z5RB 5EOCJ 5FO8A 3SKNA 3FAXA 4ZOAA 4EJ1C 3VRLE 1S9YB 1DQJB 2A6IA 4LHUD 4PB0L 2FZ3A 1SVZA 1OQOA 2V2TB 3WXVH 3F6IA 4OGYL 1X5YA 2NZIA 4M7KH 1BMGA 3MRDA 1GGBH 4G7YL 2BVPA 2YUVA 3HZVB 4OFYD 4YWGH 3OKKB 4FQCH 1C5DA 1T1XB 3LKNA 4NBXB 4LIQL 4AJ0A 4AZ8A 4OKDA 3CU1A 1H8NA 2FJGB 4YHIB 4M7JH 4ZS7L 2I27N 3MYZA 2P46B 3FB7A 1JL8A 1H0DA 3PWLA 4A6YB 2YMXH 3PIQB 1UCTA 1NFIA 5KSAC 2QV2A 2EIBA 1G1CA 5F1IA 5D6DA 3RTQA 5HI5C 4PS4H 2VL5B 1U95B 4L8CB 4BH8A 3BP6A 5CZVL 2A6JB 4ERSL 5GSRA 1C5CH 5T1MA 4JO3H 2ZUQC 4EI5D 3PDDA 5IQ7H 3G5ZA 5GZND 2Z92A 1JNNL 1MUJB 5B4MD 4JGMA 3SCMA 1RVFH 5D5MB 2GYSA 2NMSA 4XGZA 4JN1L 4Z7VB 1EEZB 4KKAC 3SDCC 3QIWB 3BE1H 1U8OB 5JW4N 4P2OB 2X09A 1NLDH 4QHKI 3VG9B 4XXCA 5IKCB 4YQXH 2H2PC 5GJSL 1FGVL 3QI9B 5IOPA 1MCPL 3NN8B 3CFJB 3ZYZA 5B39G 3BVNA 4KJQC 2Y6SC 4CAGA 2DLEA 2MCPL 3D39D 3P40A 1N64L 4LP5A 4X7EC 1HWHB 4LCYB 4PGDA 3I6LE 1DEEB 1DQTA 1EZVY 1EFXA 5SWSB 3SO3B 4F15B 3N85L 3QDMA 1CFBA 1FAKT 3JV0A 4D3CH 5E6IB 4FABL 2WMPA 1U6AH 3L9RB 1NDMB 1AE6L 4ZTPH 5DD0H 1G6RH 3IJHA 4DGYH 4Y4HA 2ZKHL 4DQOH 1OP5H 4DTGL 3G5YB 3T0XA 3QDME 1JF6A 2YOCA 1CD0A 3Q1SH 1OTTC 4U1SB 2NY0B 2O61A 5FF6B 1KPVB 2VWEE 3HTLX 3CK0L 5TF1L 2HG5A 2V7HB 2SEBA 1TLKA 3WDIA 5ENWB 2F5BH 1JGVL 4J7RA 1HHKB 5I8CA 1RZ8A 2FB4L 4IHOA 3ULUD 1OSZA 4PR5A 1UJ3B 5F89A 3T09A 2DQFA 3EBAA 4OCSH 4U0RC 4GRLC 3QH3B 1XCQB 2DLGA 4O51B 5I74B 3CU7A 3FRPA 3JV4B 4PPTA 5EORH 2X4UA 1DBJH 4YXHL 4HC1H 4K7PH 2HFGH 1CE1L 2XY1A 2WUCL 1R5VA 2HFEA 3F62A 5C0BE 5C0IA 2FATL 4MA3B 5SV4A 4KJWD 4HLJA 3JUYA 1NCBL 1U92B 5DEFB 1BM3L 4N8VG 3L7FA 3FZUC 3NCCB 3EKCA 3WD5L 1J5OH 2X7LB 3VU2A 2NXYC 4UINL 4WEBH 3WO4B 4HUNB 3MLUL 4JDVB 1BZ9A 2P44B 5CIPA 1I1AD 4NFBA 4OUUA 4K3HA 3U7YL 3Q48A 4R3SB 4D0DB 1K2DA 5BVJA 1IGIH 5EC2A 4JRYD 3KYKL 1HILA 3IDMB 4AQOA 3R1GL 5TDPA 4ONFH 2E7MA 4RFEB 1AR1C 3KPTA 4GW4B 1T04B 1T0MB 1JHLH 4HJJL 2PTTB 5GZOD 4LRIA 4KU1A 1UCBH 3DPBA 4KK6D 1MFAH 4F2MB 1GGBL 1AKJA 3CVHA 1LGVA 4PJ5B 4X99A 3HZMA 4APQC 4BZ1L 4KK9C 1EJOH 4LSVH 4LSQL 1T5XB 2DMKA 3SN6N 3QIWD 2X9WA 3EHBC 3VXMD 4NP4L 4O02L 3OV6A 4Z7VE 4F7TA 1EAPB 1O7VA 3MCLH 4OF5A 3VXPA 1I7TB 3VGAC 2CDGA 4M6OH 3K74B 3MRJB 4D3CL 2UZXB 2A6IB 1X5LA 4PJHF 2DQHH 1VB9A 3ZKXB 5JR1L 3OJVC 4TUJB 4HW6A 1RZFL 2C1PA 3MJ9H 1E4XH 3GSNA 4MAYC 3WKMH 4QNPE 2VLJE 1I75A 1MFBL 1CD8A 1I8MB 3E6HB 5BXFB 1KIRB 4JQXC 4PV9A 3M8OH 4J4PD 3DETD 3GSVB 4S2SA 5BOZG 5E2WL 4P5TC 5BZDA 4DCQA 1MCEA 3FOLA 1PVHA 3RPIA 3ARBB 3SE4C 3MNWB 2H45A 5EBMB 2NTFB 4ZQKA 1U95A 1GZQA 1TCMA 1UWGL 4XPTL 4HAGA 4G6MH 5FO7B 4KVCH 4NQSA 1XF5B 2NY0D 1II4E 1Q0XH 2ICCA 4GW1A 4OB5H 1EHLH 5IMLB 2BDNL 3F5WB 1KN4H 4D9LH 5SWZD 4M5YL 1G1YA 2MCPH 2XTJB 4NNXB 2V5MA 3MUGB 3IFNL 1MELA 1ED3A 3RWDB 2ADJA 3O41B 2CLZA 1ZTXH 4GT7A 5D1QD 3HFML 4RQQB 4GRMA 3ZL4L 2B1AH 4PJFF 3D3VE 4K3DH 4DN4H 3JTSB 4X5WA 2NY3D 1NSNH 5EUKA 4HPOH 4NRYB 3U0TB 4KQ4H 3L5JA 4FQHB 5DD3H 1I3GH 3CSPA 4D94A 5TF0A 3CZFB 3ZT6A 1FNGB 3H9ZA 3F12A 5DK0A 3MOAH 5GGVY 2Y4SA 2GAZA 1VADA 1OTTD 3SQBA 1RURH 3PWVB 2CO6B 4IIQC 2AXGB 2EDDA 4PS4L 3LAFA 1XGYL 1S7QA 3REVB 4JRXE 3T3PF 5JW4R 4HUUB 1HH6B 1XF3B 3WNPA 2IAND 4PLJC 1Q0YH 3KJ4C 4I0PD 4WJ5A 5FOBA 1DQDH 2YZ8A 2FJHB 2VDOH 3HMXA 5E95B 2FO4B 2GTWB 1VFOA 5FF6A 4Z95L 1DBKL 5E9DE 4JPKL 2MTPA 3FMGH 1KB5H 5DUML 3WUZA 2JCCE 4YHYC 1XH3A 4P23D 1E6OH 2EDRA 2HFEB 1T7XA 4WFFE 2WWMD 1KACB 5E9DA 2BY2A 1HSBB 5F3BB 1XR8B 5D5MF 4BFIB 3WFCL 5HBBA 1OSPL 3S37L 4QOKD 2UYLA 1FPTL 4PLKC 1N4XH 1ZLWH 1DANT 1QLRB 3H0TA 3WIFB 1J1PH 4OF3A 4ONFL 3NABH 3HZKA 1ZLUH 3P3YA 3QPXH 3LRHA 2IQAB 3TV3L 4ZAKC 5EH1A 5LQBL 3CSGA 4EI5B 4PLJD 1NCTA 1FC1A 4TYUA 4AMKL 4X7SL 1GGTA 3EIFA 4APQD 5FK9B 4Z5RA 1BOGA 4EDXA 1ZHBB 3AM8A 2EEBA 5I18L 4P2OD 2I60L 3WFZA 1TENA 1BREA 1B90A 2DIBA 3CZJA 3QA3B 1DFBL 4G5ZH 4M8QB 3KWWB 5IV2B 3PHQA 3QI9D 3C8DA 3ARGA 4LBEA 5EZJB 1IJ9A 1NUGA 2JIXA 2IJ0C 5D8JH 1T4KA 3OF6A 4PJ7E 2PW2A 4NRXB 1V3MA 2B4CC 3O2VH 5C6WH 1FG2A 4FTVE 4PJBF 4KTEH 5F7LB 3IFPB 2CKNA 3O9WA 4JDVA 5C08A 5K9OA 2PR4L 2WINB 1M7IB 3UZQA 3ARXA 3HE6D 4GH7B 4U2YA 1BLNA 1QSEE 2YWZA 3TZVA 4LGSB 4PTUA 2YXMA 1GGYA 4WUUE 1YY8A 3S9DB 2PYEA 4PGJA 2HKFL 3G6DL 4U1KA 1R3JB 1KN4L 5KTEL 4NJAL 3DX7A 1OAKH 3K8MA 3IJHB 2IFFL 4RAVA 3MRIB 2GJZA 5EUOA 5C0NC 1SEQH 4I3SH 4PJ5A 4RGMC 3FOMB 4WTZG 4NQSB 3VJ6A 5HXMA 1QEWB 4RDQG 1NUFA 2F15A 5I66A 2CRZA 2K7QA 2VIRA 2VZTA 5J1TC 1FORL 1PQZA 5I15H 4KUCD 3WFCH 2VLLB 4O4YH 5DRWB 5I1CL 1VFBB 2HJLB 4JDZA 5BVJB 3VXUA 4UIKL 4M1CC 4YHKH 2NX5D 3MBEA 4LGPB 2VUYA 3MV9D 5DZNA 3ZTNL 3SGKC 5E1AB 4O2CA 4UDUB 2AV7B 3RZCC 2VC2H 1OPGL 3QDGE 1UJTA 1WWAX 2IALA 2VDLH 3I9GL 4GW4A 4WTWA 4JZJC 3AS3A 3R4DA 4OCSL 4LCWE 5C0EA 5EUKB 5F6IC 3B3IA 1D5BA 2L7JA 5C0AD 4RFOL 3LQZA 4U6HB 5GJTL 5E5MB 1NGWB 4M93C 4JFZL 1EAPA 2B0SL 3V6FA 2CLVB 2IH1A 4WFHD 4JM2B 1EPFA 1K5NB 5D1XC 1NC2A 4K3JL 5I1EL 2FGWL 4HEPG 5AEAA 3RA7L 5CJ8A 2Q86B 1PLGL 1YPZA 5JHLH 4LNRA 3UYPA 3K1KC 5DDHB 1RZGA 3AVEA 1IL1B 2NNAA 3TNMA 5C0IB 1NBZA 2VLJB 4F37F 5F93C 3FJTA 4IRZH 1EA9C 4PRHE 3FT2B 2J2ZA 3E2HB 5FGRA 2ITCB 1FFOB 4KKBC 4RZCB 4K23L 4XXDA 3ZYJA 4OM0H 3H3KA 3D2UB 2EDWA 1U93A 2HYMA 2Z8RA 3MRHB 5AUMB 4ZNEE 4GMSH 5HDLA 4KWUA 4P9ML 1A7PH 1EO8L 1CDCA 1NSNL 1MRCH 1QFWM 3D39E 4L1HA 1CICD 5IQ9B 1Q72L 4G8GE 4BQ9A 2AXGA 5D71L 5FM8A 2GJ6A 5KVEH 3D25A 3MRNB 3HG1D 4MLIA 5FYKE 1URLA 1AGDB 5IR1A 2E7LA 4XNQB 1F4WH 1MQKH 5I1IH 2WBJB 1V5JA 1EUTA 4KRPB 3OHXB 3TBWB 4XC1L 2R23A 3BX7C 5C07D 1BEYH 4NRYA 2FX7H 3U0TA 4X4YA 1TJIH 5EU4A 1MFBH 4HIEA 1BOGB 4YO0B 3LDBC