4QWWC

Crystal structure of the fab410-bfache complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
212
Chain Sequence
b'QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMYWYHQKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSLSVSSVEAEDAATYYCQQYNSHPMTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholinesterase
publication title Crystal Structure of Snake Venom Acetylcholinesterase in Complex with Inhibitory Antibody Fragment Fab410 Bound at the Peripheral Site: EVIDENCE FOR OPEN AND CLOSED STATES OF A BACK DOOR CHANNEL.
pubmed doi rcsb
molecule tags Hydrolase/immune system
total genus 54
structure length 212
sequence length 212
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qwwC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qwwC01
1PGRB 5KSUB 4HK3J 5KAQF 4NOFA 4L4VA 3O3DA 1WZ1H 1F42A 1WIUA 4PJDB 3X12B 1J8HE 3IXTA 1C5BH 4KPHL 1D5BB 3GEWB 4PJ5A 3GSWA 3O3UN 4GLRI 2OBGA 3UTOA 2GUOA 2C7UB 3V2AR 3PGCA 2IANE 5E6ID 3BP7B 1QLFB 4JE4B 2AKRA 1EAJA 2XY1A 4ODVH 2L7UA 2K7PA 5SWQA 1A7NL 4IOIB 4KKNA 5AZEH 1NCDL 3I6LD 1RUML 2AXGB 4CVZA 3CMOL 3M8OH 5L2JB 3HCVB 2Z93A 5GISH 2CDFB 1RJYA 4O02L 3GSVA 2A6IA 4RAVA 3DVNA 2A9NL 3P9MA 3NIGE 4GFTB 3TO2A 1EO5A 2YRLA 2P8PB 4H20L 4K23L 3R06A 1NMAH 4S1RL 5K9QG 3BRGC 4JDVA 2YBRB 2VLLB 4BM7A 4X6EB 1H0DA 4HC1L 5GZOC 4MNQD 1D5ZA 4LP5A 3OWEA 5EB9A 1ZGLA 3MRLB 4XXCC 3L3IA 1UZ6E 3WN5A 2ZJSH 4YXHH 4JZJA 1NDGA 4OLXL 3C8HA 4O4YH 3PL6A 3RU8H 4XWOC 3DNKA 4DK6A 5JORB 1G6VK 4JKMA 1OAYH 1RIHL 1SJVA 4GKNA 5CEYA 3EOAA 1JP5A 4HIJB 3QG7H 1CLYH 4QY8B 2R2CA 2UUDK 4HGKC 2ICWJ 3RZCA 4I48A 3WV0A 4RIRA 3RWFB 4E0RB 2DI7A 1RZGB 3FB5A 4V1DB 1YNKH 4JFEA 3RX5A 1IEHA 4X4XB 1DBJH 3HI6H 4R7NB 4XPBH 3EYOA 4XNMB 4IRZH 3GMOA 4PJ8A 2ZPKL 1UG9A 3LRGA 1MCFA 5F9JB 2JIXD 3DMMC 1RJLA 5E56A 3S98A 3MFFA 2FX7H 2DWEB 3QT2A 4LIQH 2J12B 3P4MB 2HVKB 3LD8C 1DBMH 1UVQB 3OAZK 1KTLA 3NH7L 3VD4A 4JFDE 1OTSD 2Z31B 2X6MA 4LLDA 3RPIA 3GSRA 3HZVA 3PNWA 5TFSH 1OGTA 4X7SL 3VD5A 3PWNB 4NBZB 2IBZX 1F97A 4W4OC 1LMKA 1T6VN 5ENWA 3KPOB 1S9VA 3GMPB 3S36H 3K3QA 1BX2B 3OAUL 4N0UB 3WFBL 3NZ8B 4OZGA 3VD7A 2A2QT 4GRLD 3QIUD 2BVYA 4HHAA 4ZAKA 5CJ8A 3LIZH 1T3FA 4JJ5A 2E7CA 2IG2H 2FJHA 2H2SD 5E00B 1DLFL 3ULVE 1RULL 4CGTA 2XPGA 2DTML 4OCRH 1CR9H 3HZMA 3FOLA 1FCCA 4J6RH 1E6OH 1L4IA 1A6TB 1Z5LB 1AQDB 3EDEA 5KN5B 5IR1A 5IMOA 2GI7A 3MLUL 4KJQD 1G7JB 4O2CB 2VLJE 3W5NA 3SKNA 3RBSA 1JNHB 2F53D 4ODXA 3DMMB 4Z76A 3OJ2C 4QRPE 3K4AA 4JM4H 1ERNA 5JLZB 1DJSA 3LD8B 3GBNL 3FHQA 5D1ZA 4ZS7L 4OLVL 4CVUA 3IFLL 3ULUE 5JW4Q 4KU1A 3ARGD 1RUQH 5B4MC 1CGXA 3HNSL 2OL3H 3P77B 3PWVA 3O41B 1QBLH 1L6XA 3L5IA 4ZPTA 1J1PH 2V9RA 1I7TA 4JVUA 5F44A 4YIQA 1S78D 4FTVD 4OBRA 5I16A 1DQDH 4U3XA 3SGDH 4BFIB 3M1BB 1UB5A 4FNLH 3PP3H 5E8OA 5IJVB 3S37X 3HFML 1FQ9C 1KFAH 1I9IL 3EJZC 4ZUWA 1T2QH 1G9ML 1JTPA 3N1QC 4GBXD 3CFDA 3SOBL 4PJBB 1ZLUK 3MLVH 4UOW1 2VDPH 3GBML 4HKBA 3IFNL 4EUPB 2H9GA 1KV3A 2HKHH 2ITDB 4OGAD 5F7DB 1P53A 3SGKC 5B38G 5KS9B 2M26A 2YMXL 2XZCH 5DK0A 5E2VH 4P99A 1A4KB 2FLRT 2WWKO 3C6LA 3SKOA 3WUWB 3HPJA 1G7QA 2BVQB 4GQPH 3CSYA 3ZTNH 1T20B 3EDJA 1GC1H 2R0ZL 3ZT5A 5L2KD 3IFPB 1KYOK 4PYHA 2R29L 4M9OA 1ETZA 1S8DB 3SJVE 2NZ9C 3QCVH 3OJMB 3UO1L 5J13B 3HI1B 3NCFB 4JJHA 1OPGL 3CFBB 3NIGF 5A3IC 4FQ2H 1EVTC 4PRBA 5JHLH 4PRAA 2YD6A 3DI2B 5D7SH 4F8QA 1W72A 5CEZH 5EPMA 4EOWL 3S34H 3ARXA 1U8QB 4MJID 1VPOH 1X7QA 4YBLC 5GGRY 3U7WL 1TJGL 2IGFH 3O3BB 2VLJB 4YHLH 1N0LA 3RQ3A 1Q94B 4ZUTB 1UZ6F 4R4ND 5JW3L 4Z0XA 3B6SA 1NGQH 1BZ9A 4NJ9H 4G7VL 4ODSL 4K7PH 4ODTL 3QRGL 5FK9A 3MRRA 3SE3C 4F7TA 1I1YA 3OPZH 3N50A 1WISA 1QRNA 2FYYA 2VAJA 4HS6A 1M7DB 5DMKA 3GBLA 4H1LH 4PB9L 3MXWH 3SDDC 1LHZA 2X4SB 5BV7C 4PGBB 1YEFH 2P24B 2Z4QA 1HK6A 2WWMD 4MNGA 4UU9B 3HMXH 1OSZA 3WD5H 3CLEH 4HFWA 4Y4KC 4F9LA 3HAEH 2ADJA 1P7QA 3L3OB 1PY4A 4JAMB 4N68A 1RIUL 1R0AL 5SV3A 2FL5B 5EZLA 4X4ME 4F7EA 35C8L 4XZUB 2PYFA 3R8BB 2HJLB 3EDDA 4XVSL 4LCCC 4DZBB 3P11L 5BMFL 3ROLB 1A6ZB 2IMNA 4U1LB 2GTZB 3PWLA 3AXLA 3GNMH 1KTRL 3JV6A 4ISVA 4G3YL 4GXVL 5INCA 4M62L 5BZDA 5C0FB 1S7VA 1T7VA 3LHPL 4Z7WB 4YBLB 5I8OH 4R96B 1DFBL 3DRQA 3QQ3A 3ZYIA 4RFOH 2CDEB 3AU1A 4JFFB 2FWOA 3E6FB 3BXNA 2EO9A 4JPIA 4YH6A 2Z92A 4MJ6B 1JNJA 1BM3L 1LEKB 1ZHNA 4Y4FA 1IM9D 2ICEB 4HG4K 1IGCH 1KPVB 4N0YL 2Q1EA 1FIGH 3N85L 1H8OA 1QO3A 5E2WL 2EH8L 1BQUA 3GM8A 3PGDB 3QPXH 2D31B 4G8GD 4MNHA 3ULVF 2HT3D 3MMEB 3SKMA 1KXTB 1HH6A 1IAIL 4G80A 3VXSD 4JFQA 3SDDB 1AXTL 4K9EH 5BV7B 4P59L 1PG7H 3K81A 4X6CB 1AKJB 4ELMA 4DK3A 1L0QA 5FYLE 3O6FA 4Y4KB 4PS4L 3DTXB 5F7NC 4G43B 4NZJA 4F3FB 3VXRB 1BECA 2H8PB 4KGJA 2MNUA 4AH2A 1MCQA 1HIMH 4F7MB 5D7LB 4ORGA 1XGUA 2DQGL 3OR6B 3G5VA 3EJJX 4RGMB 2DS4A 3BW9A 3GK8L 5EU6D 5C0JA 1R24B 3GMRB 2G2RB 2Z35B 1FH5L 4AG4H 3I9GH 3SDAB 2VL5A 4KDVA 3E3QC 4MAYC 1FV1A 1JK8B 1I4FB 2YD1A 1G7HA 3HZKA 5CMAA 1RUAH 2JCCB 3QFDA 4U6YB 5HPOA 4Y16D 1J18A 3NFPA 3IDMB 3ZDZF 1B6UA 1A1OB 4PGDA 1OARL 3SBWC 1MCPH 2LFGA 1NL0H 2EH7H 1EAPA 1X6LA 5DQ9A 3BPNB 4Z95H 5KOVC 3T4AA 1UJTA 4L4TD 2FB4L 2VC2H 2IALB 1GC1C 4G9FE 3BJLA 1DUZA 4JY4A 4NQED 3QDME 2DM7A 1IC4H 3EDFA 3B9KD 2C26A 1FAIL 5FYJE 3CFCH 1HYSC 3W0WA 2CDGB 1EEQA 4JO4L 1BBDL 1CGYA 2XACC 3UYRH 3QEQA 1OCWL 2YS4A 4X4YA 5FF6B 4UMGA 4G6KH 4LEOA 4M4PA 2XA8H 3V52L 1T83A 2EDWA 1OW0A 3TN0B 3WEXB 3KDMA 4BK4A 2CJUL 3IVKA 1JHTA 3O0RL 3PQYD 5CUSL 3U46A 2YRZA 1UADC 5FO7B 5FAAA 3CSGA 1UKSA 4MLSA 1AXSA 2AERT 4L8DB 1SYVA 4LCIH 4LU5H 2Z91B 5BS0E 1EIBA 2BHZA 4K3DH 3MNWB 3CXHJ 5JHDB 2ADGB 1AIFB 2GJ6B 4MAYB 1UCBL 4G5ZH 3NAAH 3JVGC 2BCKA 1RUKL 3ZKXC 4DVBA 1X5FA 3OB0K 4MMXC 4G6JL 1YMME 4F9PA 4CVXB 1BLNA 2BVTA 1Z9OA 1NDMB 1H9VA 1GGYA 3TA3D 3WDJA 3BP5A 4XVJH 1N5AA 1ROWA 4YHPB 4PJHB 5FUZH 3IDXH 3SCMD 1TVBB 2C4XA 4Z5RA 5E8DH 4XMLH 2X4TB 4PR5A 4LGPB 2J6EA 4E41D 1XEDA 3LS5L 1JGUH 1FZJB 3FO1A 2OMNA 3QXAB 1KIRB 3RWIB 2V2TB 2L4OA 1NCUA 3VD9A 2VTFA 4XB8A 3GUTA 1P1ZB 3MCLL 5I19L 1RK0B 3WL9A 1S7TB 1A7RH 1EHLL 1U93B 5DD3H 2Z8VC 1YN6B 3CZJA 5DHVH 3HRPA 3RDTD 2PW2A 1WC7B 3LEVL 4JM2F 1Z9LA 1LWRA 1QZ1A 4BSVA 1L9NA 5DEGA 4FXGA 2P8MA 4BJLA 4LDEB 3LDBB 2D7PA 3UJTL 4NC1C 3QWOA 3VMNA 4G9FB 5E5MB 4PYGA 2WQRA 3LMJH 4NIKB 4BKLB 3T04D 4K9EC 3HNVH 2VZVA 4Q7DA 5E2UL 4K2UH 5CGYC 2EO1A 1KNOA 4OV5A 4M8QB 1NLBL 3UX9B 1IEBB 4PTUA 1IEAA 1BJMA 1G6RB 4UT6L 1M71A 1YZZA 4Y5YA 1XIWC 2FR4A 4X5WB 5DHYA 3VG9C 2EKSA 1T7YA 1RJZB 5CP3H 2YA1A 3NTCH 1A7OL 4HAFA 2X4QA 4JZOA 1XT5A 4QOKE 1J7VR 5GGSB 2MFNA 3DI3B 4M7JL 3UTPE 3KPPA 2VZ3A 3FTGB 3MRFA 3IU3B 3ZZ1A 5I15H 1CL7I 2P8LB 5FB8B 3TZVD 1MJJA 3QHTC 1LNUA 5D7KE 5DI8A 3T1FA 4LSTH 1M6OA 4X0KA 4CU8A 2ZKHL 4HLZH 1A21A 5D70L 3BP6A 2Y6SC 3GO1L 6FABH 5F7LB 4P3CL 3DOSA 2VZOA 3DVGB 3F7VA 3U9PH 4PJHF 4QHMA 2A74A 2YPLE 1W8OA 1XF2B 4R0LC 1WZLA 1YMMB 1GHFH 3L3JB 3CH1B 1QFWH 1YQVH 2VYRE 4HD9A 3ZHLA 4ZOEA 2ZOLA 4MQ7A 4M7KL 2I60L 4NBYB 1HSAB 2BVEA 5D7IE 2P7TA 4FFVC 4EDWH 4MA1B 5C7XL 5DEFB 3ZHDA 1FYTA 4NKMB 1QHPA 2B4CH 2PXYC 1IGJA 4P49A 5C0BD 5IT2H 1E4KC 4JRYD 3U9UA 1XIWB 3K8KA 1GGBL 3VG9B 1HOCA 1JMXA 2P43B 3AGVA 5KAQG 5GJSL 3BEWB 2PETA 2R2BA 4HCRL 1MH5A 1ZHBA 4J8RA 1T89C 5KANG 1A0QH 12E8H 1XGTB 1QP1A 1OSPH 4WNQA 4X80H 5E8NB 3DX9A 2ARJB 3WXWL 5C6TL 4XPFL 3TP4A 2VXVH 3UEZA 3D3VE 3QIBC 1YA5A 4QF1B 5F1NA 3DXAE 3WNLA 2F8XC 1CDIA 2X4NB 3KR3H 4WI7A 3R8QA 4K55A 2P47B 3GM0A 2OTPA 2YZ1A 4NO3B 4RAUA 4P46B 2Z8SA 5A16A 2VXUH 4LPTA 3G5XB 1MY5A 1SEBB 5KOMC 3TVMD 3ISWA 3H9ZA 4R0LB 1NGXB 3QB7C 3PDOA 5T3XE 1MHPL 2DJ4A 2FATH 1RUPH 1XR9A 4DEPC 3VGEA 2GW5A 3GJFB 3MJ9L 3T4YB 1H3GA 4HZLA 5BXFA 3FKUS 4RZCB 2HN7B 1AY1H 5KBNC 4P3DB 3T0EA 3TBTA 3VXNB 1EUUA 1ADQH 4GW4A 4Z9KB 5T1LB 4HBQA 5SV4A 3V0VA 3RVWD 3D0LB 4M6OL 2G60H 3FQTA 5F21B 1KCRH 4QOKB 2VUOA 4I77L 3CVIL 2R9HD 4M6NH 2EDLA 4JREC 4KK6C 1DQJB 1HQ4B 5EZIL 2EZ0C 3JZ7A 2QSCH 3WS3B 3VWJC 2NY1B 4N1CA 4MXVF 2HFFB 1AD9A 1ZTXH 3S37H 1YEJH 1NCAH 1P4LB 1KENH 4PP2B 2OSLB 4G9DA 4PRHB 3KPNB 1A5FH 3VFUA 4MA8L 2DOCA 5I1KH 1IM9A 1WBYB 4YPGA 5FHBL 3REVB 5IBLC 4Y1AA 2P4AB 2VLKA 2E7LC 5D6DC 5DMGC 4BH8A 4Y2OA 4YAQA 3C2SA 4LARL 3LS4L 1Q9OB 1G0XA 1KJ3L 4U0RB 4FS0A 2X1PA 4RMSA 4ELKB 4QRRA 2PYEA 3H9HB 5DQDL 1YJDC 5D7IB 4X99A 3DX7A 3EO9H 4OZHA 1Q9WA 4M61A 3BEVA 1DBAH 2XG4A 4WW1B 3REWA 5CBAA 4CUCA 2IFFH 3L3GA 5GRVL 5EOCL 4TSCL 4Y4HA 1YUHB 2FX8H 5F7HA 1JYNA 2EYTB 2AI0L 5JUEH 3O81A 3W9DB 2WNGA 1UWGH 1ZT4B 4DN3H 5K9KB 5EU5A 3FONB 1MJUL 1JRHH 4JREB 4WO4B 3D3VB 4I2XB 4IEFB 4P9HH 4UQ2A 2XFXA 3PWPB 4DTGH 5J9PB 3VWJB 3JWOH 2BXYA 4GRMB 1FVCA 5D1QB 5DHVB 2QR0A 1BREA 1KG0A 3GMNA 4NQVA 2DI8A 2FCBA 1NGWA 3MV01 3UTQA 2NXYD 3E6HB 1T03H 4I3RL 3HS0B 3H0TA 1LEIB 1H15B 4OLYL 1S7UA 4OLZL 1FL3B 4HLJA 1T7WA 1JMZA 3QJHA 2XN9A 5I1EL 3RFZC 2LU3A 4HWBH 4R90H 3ULVL 2BFVH 4RGOH 1SVZA 2BNRB 2B4CC 3GI9L 4PBVC 1JZ3A 4TYUA 3PABB 3QUMH 3AROA 3MBEC 1ZVHA 5HY9A 4XNYH 4EN3C 3MLWL 4I8DA 2GT9A 3MXVH 4KZDH 3D18B 2RFXA 2APWA 5F7MC 1NAMA 3E0GA 5I1LB 3RWCB 1I7RA 3B2UC 3C60B 4OCYH 4NO5B 4AL8L 1UFUA 3CDYA 1HN1A 2RCSL 3OKMA 3FFCA 3ILQD 2G75B 5HGGS 2GJZB 3T0DA 5D7IF 1U2HA 1NGYB 5TQ0H 1ZWIB 4ZTOL 4EEEA 3BWAA 1LEGA 3AY4C 3ELAT 3IDJA 5EA0L 3ULUL 4R26H 3UYOD 3VU2A 1MREL 4XP6H 2HWZH 2V9QA 5HSFA 5L9DH 5H94B 3V6OA 3IAQA 4XP5H 4P2YA 1QG3A 1G84A 3TO4A 4IDJH 4M5ZL 3MCG1 3C87A 4H0IA 3RNQA 2EEBA 2AEQL 3DSFH 1XGYL 3MC0A 5E08H 3T2NL 1OL0A 3GDBA 5LGJA 5D7JA 1U8KA 3WIFA 2KDGA 2N7BA 1MCSA 4PB0L 4OLWL 5IHUH 4N0FB 5HYEA 1Q0YL 1CGWA 4XAKE 4WHDA 2Y06H 4KI5E 4P5KA 5L0QC 3V4UL 1Q9LA 5T3ZH 1ZLVH 2VZ1A 4EN3B 5GS1B 2BK8A 4YE4L 3UPRA 4J23A 4OZFA 4L5FL 1CZ8H 2WANA 5GGVH 4OJFH 4KKBD 2FX9H 2CO7B 4O2EB 4EBQL 2Y7QA 4X6BB 4FP8L 1KB5H 4KQ4L 5ACZB 3JV4B 3DYPA 4LVOB 5E2TH 4P23A 5C8JA 1EEUA 1ZT1B 4NNXA 1ZVYA 3Q6GL 1BD2E 3MUHL 2I9LB 3TBVA 1B9ZA 3QDGB 2VABA 4XCFL 4YJZL 5I6XC 4TNVF 1S7XA 4HJ0D 2VDQL 1MI5D 2DIBA 4HK0A 3MLSL 2W65B 2UY7A 4P2RE 5HJ3A 5IIEA 3C08H 5EWIH 3D25A 1JI1A 1TIUA 4NQCB 3W11C 4MXWL 1MLBA 4RFEA 1UGNA 1YEHH 4IMLB 5HYJD 3FMGL 1X5GA 4PGJA 2IH3B 3BKJH 4NHUB 1JPTH 1ZA6B 3P0VH 1XH3A 3TZVA 1D9KC 4P9HC 3RP1A 1U8PA 3HI5L 4GKOA 1FJ1B 4QHNA 5L0QB 3JWOC 1IC5L 2DQDL 1MHHA 2OM5A 4Z78A 2AEWA 2FH8A 5D96C 5EUKB 3V8OA 4O58L 2OZ4L 1NSNL 4WENB 5J11B 3VWKA 2R0KH 3CSPA 3X14B 3TH3T 1K2DA 3QULA 5IF0A 1IQWH 3GSXA 1EJ6A 5KSAD 1FAKT 4YDKH 2UUDH 5I6XB 5J7CC 3TBSA 4E42B 5C2BL 3QUYC 3WUWG 4UTBH 1X5LA 2J8OA 4MQTB 4TTDD 1VACA 4ZFGL 3NN8B 5D93C 4YHZH 1SQ2N 2B2XL 4NNPL 5E6IC 3ETBF 1QBMH 4NQDD 5I0ZA 1JN6B 1YY8A 1T1ZA 4TOYL 3W9EA 5ICYB 3KYOA 3VFPA 4CADB 3QRFM 1S5HB 2C4FU 4PLKD 5MENB 3MUGB 4LCUB 3IAGC 3WJJA 3OAZH 1FL6B 4PTTB 3LKSA 3TCLB 3HR5A 4PFEA 2ADIA 3MA9H 2HTKC 1P7KB 1U8JB 1MCKA 1MWAH 3T08A 4XVTL 1A1MA 2FIKA 2W9EH 3KPLA 5HHNB 5F9AC 3RWGB 1A8JH 4KUZL 2XXCB 2YHGA 3VRLE 1FFNB 4ONGH 5B3NA 1MLCB 5D96B 4JO2H 3LKQA 1EHNA 3TVMA 4JR9H 1AI1H 4WV1C 2H26B 4XBEH 2NXZD 5I8KL 1ND0A 2BY3A 4LKXA 3EHBD 4KC3B 4MA7L 1HHIB 3OKDA 1DQQB 5FYLL 4JHZA 2VXSL 3QNYB 1TNNA 1IQDB 3Q3GA 3QUYB 4HBCL 4CAGA 3CK0H 1XGPA 1U3JA 3PWUB 4XCEA 1WICA 5F72S 4CU6A 4GAJL 4GW5A 1UM6H 4UV7L 5FA3B 3OKEA 4N5ED 5KSUA 2DLIA 4CBPA 5J4MA 3DUUA 5MHSD 3DO7A 1U8HA 4PJ7E 3STLB 2NY4C 4TUKL 4N90E 5E95B 1W0WB 3MJ7B 5GZNC 3TPKA 2UWEA 4EI5D 1AQKH 1BVLA 1MCEA 4MZ2A 3DECA 2AJVH 4OFYD 3GHEH 4LSPL 5F97E 1L7TH 2ZOKA 3ARDD 5FYJL 3MOBH 4KDWA 3AB0B 3VFGH 4U1NB 3HCVA 1RVFL 5F3BA 3QUZC 3QFJD 3KVQA 4FZ8L 4KI5F 1P2CA 5IGXH 2Z9TA 1G6RL 3Q5OA 2Q8AL 4FFZH 3TPUB 4LVHC 4OFKA 1G7IB 1CL7L 1C08B 2VO5A 3PJSB 2P8PA 3UTSE 4YO0B 1FG2B 5GGRB 5HI4C 3VI4E 5AWNH 4RGNC 4FXLA 3A67L 1ZLUH 1KF9B 4XMKL 1T0MB 2JJTA 4P2CG 1U92A 5BZWA 4OQ1A 1BFVH 3R1GH 2Q6WB 5SWSB 4K3JL 2VXQH 2NY4B 1FORL 3MV9E 2ICES 5C0CD 3RIFK 4HIEB 1KB5B 4LSRL 1QRKA 4WFHE 4UILH 3EKCA 5ITFA 5C0RL 4JO3L 4E0RA 3K2UH 4JPWH 2D03L 4JQIL 3UDWC 1JF1B 4TVPD 4K07A 1IGIL 2IMMA 3SE9H 1CD1B 4XNMA 1K8DA 2FGWH 1LD9A 1FNGB 1LO2L 4NGHL 5I74B 5CJXC 2CKBL 4HCRA 3WFEL 3QUZB 1SMAA 4YDJA 4NRYB 2E6JA 1QR4A 2AK4B 2DQUL 4CKVX 5HGBA 3S9DB 4LVHB 4MAUL 5HHPA 1N6UA 4UDTB 3MLXH 4LCWE 3CDGB 2Z31A 1HINL 4KK5D 4PJ7B 4NM8L 4PRPD 4RGNB 5AG9A 1J8HA 1CLCA 5FM8A 1LGVA 2IANA 1BX2A 4NDMB 4LHJB 1CFVL 1YDPB 2G9HA 2ILLA 3RUGA 1VERA 4HUVB 3MJ9A 3S8WA 3OKOB 3KPQB 4BZ2H 5ESVA 3ARFD 3HC0B 3P30H 1S7WA 3B9EA 2X70B 4S2SB 4WUUB 4GUPA 4IJ3C 2NY6D 2DMCA 1K85A 3B8SA 1FN4A 1K9TA 5K59E 1BOGA 1F3DJ 1ZGLM 2YK1L 3WIHL 5GS0H 2J4WH 2VR4A 5KN5A 1I9RH 2WUBL 2QHRL 4D9LH 1TNMA 5ISZD 5ABDE 1LK3L 2P5WD 4PGCB 3UTSB 4C55A 1HKFA 4FQLH 1WV7T 4OB5H 2J5LC 1OD7A 4X8JB 1FBIH 5A2IH 3HG1E 4ZFOB 2QSVA 2PO6C 3W2DH 3L5WB 5DUBA 3CCHA 4FMKA 3QSKB 4NHCL 4HIIB 5JLZA 2ZCHH 3VRLF 2V9TA 5LGHH 5HI3D 5CJQL 3P73B 3D85A 3L7FB 2FEDC 2AW2A 4EI6B 1K4CA 1ZT7A 4LVEA 1S3KL 3QDMD 3U0PA 5DUPH 4HX1B 1FLRH 2VDLL 1W2KT 5E1AA 4FQHA 2CK0L 3GSNB 4R4NC 3G5YB 2HT2D 4RQQB 1VHPA 2A0LD 3O9WC 2ENYA 4LVNC 5IFJA 3W39A 1MHEB 4RMTA 2JB5H 3FRUB 3VXUB 5HVWA 1R3IH 3C8KA 1WFUA 3TV3L 3IJHB 4IJ3B 1AD0B 2XXMB 4PJ7F 4ZDHB 3RBGA 2NR6D 1IKNA 1P4IH 3I2CH 2NNAA 3BI9X 3CLFL 5TE4L 4EUPA 1A7BA 3IJYB 2W91A 3KXFD 5IW6B 1FRGH 4JFDA 3HAEG 3DGGA 1AC6A 2EDQA 4YGAB 3TYGH 43C9A 4YDLB 3T09A 2PO6B 2H32H 1LK2B 3VXMB 1U2CA 4XVUD 1A7QL 1JYXA 5FHAH 4Z7VA 1MIML 1OT1A 2CR3A 4FQIH 5J0BA 5EH1A 4OD1H 1FZMB 3I50L 1UZ8B 2X4PA 4K71C 4Z0BH 5T3XL 5I73C 4L3ED 1DN0A 5C07E 3KYKL 2OJEA 1XGQA 3V5HA 3O9WB 2WBJC 5I75C 5ICXB 3VI4F 4YX2L 5BRZB 4LVNB 1DQLH 1R5VB 3SDYL 4R4FL 1S9YB 1I7ZA 3D39B 3FCTA 1UACL 1WIPA 5AUMA 1MFBL 3QEGH 3O3BA 2VLJA 2GQHA 4UIMA 1OTUD 2GITB 4ZUTA 4KAQH 4WWKD 3LRSB 3HG1B 2V7HB 4Z7QE 4ZXBA 3BN9D 2FSEB 1HNFA 4QRPA 4EVNB 3PDGA 3V5DA 1C5DB 4AEIL 1KBGH 4HEME 2VAAA 4YR6A 1OT2A 1T7ZA 2NYYD 4HT1H 2JELL 3WS6A 2NZIA 4LEXH 3DURB 5HHME 5EO0B 4JVPA 3OB0H 4HWEH 3OJDA 4XPTL 3L3OA 4JAMA 2YD8A 3GMMB 4KWUA 3WXVH 2HJLA 1M05A 4H26B 2VQTA 1I1RA 2RHEA 1INDH 4DZBA 1Q9KB 5FCUH 4G8EB 4K71B 3UYPA 4BFEA 2CRIA 4JKPL 4POZC 2GTZA 1GGCH 5GS0C 4OCSH 1INQA 3CVHL 1JF5A 3QXWA 2WBJB 3BDBA 5I75B 1I8LA 1S9WB 4JFHD 5DO2D 4CN1A 5JPMA 3V6BR 3DX6A 4LMQE 5DVLA 1X5YA 5DT1L 1V5JA 2R2EB 4CN6A 5ANME 3VFMB 3IS0X 4MYWB 1EGJL 3TIDB 2CDEA 4HF5L 3PXJA 3QI9D 5DMJB 3I75B 5JZ7D 3QYCA 4JFXB 1LEKA 1WT5A 1J1XH 1QQDB 1T2JA 2APTA 4LNVA 1DBBL 2GAZB 4ODUA 1A4JA 4B53A 4NN7C 5EUOE 1KYOJ 2BOCA 2JK5A 1BF2A 3IYLW 3HC3H 1CFTA 3S3SA 5HGAB 3SJVA 5K59F 5E6YA 1RZFH 2WLYA 4PJCE 2G5BA 2VERN 3N06B 2DYPD 5LXGL 4YQXL 2QADB 3W81A 1I9JL 4Y88A 3MV7E 4QXGL 3MRJA 1RSFA 4KK8D 5K93A 4PJFB 3P0YL 4LSUL 2O26U 2ZNXA 2BXZA 3LKRA 1FC2D 1I1AC 4PD4K 1CLZH 2QQLH 4PRNA 4UUJA 1MJ7H 3HC4H 1QSEB 3SKJL 1PZ5B 1JK8A 3RGVA 4KJPC 2IADB 4KQ3H 4W68A 5IVZB 2DQEL 5DMYA 3F6LA 4Y2DC 5FUCE 4FQXA 3AREC 1KN2H 3CFKB 3BMVA 3IDMA 1A1OA 4R3SA 3O3EB 2KQMA 3NCYP 4G42B 2GKIA 1A14H 4MD4A 4MVBC 2XZQH 1OAKH 1AC0A 3RL1A 2OZ4A 2B8OT 8CGTA 4JDTL 4E9LA 5I8EB 4QO1A 1XF3A 4F33B 4LCYA 4LP4A 1R5IB 2VLRD 4IRJB 5SWZB 4JM2A 4MD0A 5AYUL 2Y07H 1BQHB 1IGMH 3D2UD 3QXTA 1MRDH 4JY5H 3TH4T 1GPOH 1R6VA 2K1MA 3ARYA 1F6AA 4HS3B 2BMKA 3NCJH 5FF6A 1B6DA 4X7CC 4C56B 1W0VB 1NFIB 3MODH 3BPCB 4GQ9H 4OCXL 1NKRA 2CLZB 3TN0A 1E4XI 1JHLL 1IFHH 1YMHB 4KV5E 4JANB 2HRPH 1FDLH 3OAYK 1UB6B 5FYKH 3T2QA 3L3HB 2SEBB 3VE0B 4MXQD 3OKLA 4UTAL 1I1AB 3F7RA 5ANMB 1I85A 4R97C 5BVJB 4LPVA 3D1MC 5I1HH 5JMRA 3RKDC 1F4HA 1AIFA 1DSFH 4RMVA 4HG4J 1HXMA 3OX8B 4LMQI 3EJYD 5LAXB 4YFDB 1X5KA 3B43A 3WFDH 4P2QE 1AE6H 4Y2DB 4K94L 4PRPA 5EUOB 3AREB 3CFJA 2B1AH 2CRZA 2HA1A 2Z8WC 4OI8A 3MRHB 1DEEB 2E3VA 2BHUA 1M4KA 2X7LB 1KN4H 1KXVC 1TCRA 4O2FA 2BDNL 4NWUH 3QIWD 4YHPA 4LPYA 4OLEA 4PJCB 5FEBA 4OM0H 2IF7A 3BOVA 2CMRH 2CPCA 1TJIL 3MV7B 4XTRC 3U1SH 2X4TA 5DRWA 1RFDL 4NPYA 1JPFB 4APQD 4Z7QF 4HLZG 4U4BA 1U9KA 4FQPA 5I76A 5CINL 1KIRA 2QQQA 3LOWA 3RWIA 2VUYA 1MFNA 4B0MM 1JNLL 4PRIE 5GRJH 1YEGL 3TT1L 1A2YB 5IOPB 3ZKMC 4BQ8A 1QR1B 4DAGH 1ZHLB 3HE6C 3QUXC 4OQTL 2BNUB 1B0GA 2GYSA 3F8UB 5ISZA 4KDTC 4YC2B 1F45A 4DGYH 1DVFB 3SDCC 5C0AD 4XPAL 5CZXC 3QXDA 5IFHH 4OKVB 3BPLC 3GSQB 1HSBB 4IDLA 4R97B 1CICA 2AABL 2L0DA 5DSCA 1T5XB 4G9FA 2VDKH 2W92A 4XHJC 3QDMA 1E4WH 4NP4H 4LAQH 4MA3B 5HD8C 2GK0A 3WBDA 5DJCB 1FO0B 4KVCL 4J4PA 3MGOB 4M8QA 3L95B 5EC2A 5TGBB 1IEBA 3BD3A 1EMTL 4U1HA 1AFVL 1MAML 3RL2A 4OSUH 2VITA 2O5YL 5J57B 1QD0A 1ACYH 3SHSA 5DXWA 2D9QB 5DDHB 4UIKH 3GRWL 3M17B 1N5YL 1WUNT 1NH6A 2F58H 3K0WA 3QHZL 3OGCB 3TJHD 3C2AL 4FQCL 5EUOF 5LWYH 4NKDB 4R2GC 1FFOA 4WRLA 3IB4A 5DC0A 4JN2A 4I0PD 5I1IL 5BS0A 5E8EA 3QUXB 3D69B 3JTTB 1QOKA 3AS0A 4L8SB 4HS8L 3VXTB 3KXFA 2FJFA 4JO1L 5F3HB 4PJCF 2X40A 4P2QB 1NC2A 3X13B 4IIQC 1B0WA 3MQIA 3BPLB 4PJ9B 3QQ4A 3L3JA 1RPQA 4X6FB 1ES0B 5I1GL 4OT1L 3BGMA 4WIQA 4YDIH 2DQHL 4PJXB 4LSSL 2C5DC 3MLTA 1T66C 2IAMA 4QWWC 4MSWB 1P9MA 5GRZA 3U7YH 1TTGA 3BYYA 5KVGH 4MDJA 1ACZA 4BQ9A 1YNTB 2CKBA 3MRMA 3MACH 3V5KB 5F89A 4S1SH 4U7KA 4U1IB 3BWUC 1PEZA 4KRPD 3KNBB 4DN4H 1FVEB 1VENA 1I9EA 4OI9A 5FOBB 1KPRB 2GJJA 2EYSA 1CD0A 5JPNA 1XGTA 1YECL 3WDHA 4ETYA 1GOGA 4NC2B 3KPSB 1YYML 4D0BB 4J3XA 5FO8B 1OGAD 1Z3GL 4DKFL 1BIIB 5IKCA 5CIPA 4R2GB 2WM0A 5KW9H 3J7HA 4M1CC 5JO5B 1RURL 2VKWA 5AG8A 1KIPA 4W4NA 1Y0LA 4KXZI 1T4KA 3T8XB 4AJ0A 5J1AA 1XR8A 1CXHA 1V3MA 5F70A 5KSBE 1CFQA 1MQKH 5EC1B 4NO0B 4C83A 1X3DA 5ACLA 1EHXA 4WJ5A 3WIHA 5D9SA 3DIFB 3PV6B 2KUTA 3VXNA 4RFNB 5JNYB 3B3IA 4KTYA 4KFZC 5DRXA 4ERSH 4O00A 1MCLA 3PP4H 4H5SB 1R5WB 1DQJA 1OTTD 4NQTA 2X1OA 4M3KB 5A2LH 2IPTH 3ORJA 5C09E 1Y18A 2FDBP 4MX7A 2WP3O 2HLAB 5D4QA 3EYFB 1QSZA 3CX2A 2O61A 4ZFOL 1NAKL 1MRCL 2AK1H 2OSLA 3ZKND 4D8PA 4BH7B 4PJXF 4IHOA 4IS6B 1F90L 1FNSH 2FBOJ 2YPLA 1EVUA 3BO8B 5T33H 3RX8A 4OUUA 3UTTD 2HMID 1AR1D 3ALPA 2NX5D 3C5ZC 4FFYH 4XBGA 2YPVH 4OFPA 5DYOB 3MV8D 1KCVL 5EOQH 4WEMB 2A83B 3UJIL 2YUWA 5E7FA 3GSNL 1N59A 1X5AA 3RX7A 4DUVA 5D7IA 4FQ1L 3LQAL 3ZE0E 5HHOB 1UYWL 2FZ3B 2CIKA 2FH6A 4R4BB 5C0DB 1SY6A 3O45B 4TUJA 3T3MF 3ILQC 5E6ZA 1XGRB 4F7CB 5F9WB 5C9KA 3WN5C 1NMCC 5E5UB 4ORZC 2F54D 3MRKA 3PL6C 3O3DB 2BSRA 1CT8B 3FRPG 5D2NE 4CDHA 2A77L 1D5XA 1RZJH 4P2OB 3FONA 4PJ5B 3GSWB 4HMEA 5DTFA 5HHQA 2GUOB 3IKCA 2R0LL 3AS1A 3D3VA 3PGCB 4X5XB 3DXAA 3RZCC 4ALAL 1RZIA 5ALBH 3ZO0A 2AKRB 4O9HH 1W72H 2VIRB 3SEPA 3UAJD 5D1QA 5CJOH 2FO1A 1KGCE 3INUH 5SWQB 5KSVA 5HVHC 4PJ8C 4CVZB 1CK0L 1MNUH 3JTSA 5T1DH 2Z93B 1VFAA 5CILL 1RJYB 1U6AH 2A6IB 5KSBB 3VXOA 3QHFL 3DVNB 4RAVB 5H2BA 5EO1B 3MGAA 4LHUG 5DMIL 4F8TA 4JB9L 4OM1L 3TO2B 1WWCA 1IZJA 3R06B 1BWWA 1X5JA 4JDVB 5DD0L 2X1WL 3H3PH 1I3UA 5IHZB 4FZEH 5AZ2H 1D5ZB 1OOAA 5FYKU 1ZGLB 1VFMA 3QCTL 4KROC 5C9JA 2XTJE 5TE7L 4J3OC 2FLBT 5I1AB 1I3GH 2XWJA 4EDXA 5IFAH 4I9WE 2VJXA 3UC0L 3WN5B 1B0RA 2BSTA 4NKIH 4JZJB 1NDGB 4F58H 4DGIL 5IMKA 4ZAKC 3PL6B 5DD1L 1ZLSH 3C60A 4NO5A 4GKNB 5CEYB 3EOAB 3GGWB 5CSGA 2OR8A 2YD2A 2CK2A 2H3NB 5CKAA 1NGYA 3VRJB 2WUCL 3ARQA 4I48B 5GGQL 1L6ZA 5GGTL 1ZWIA 2D3VA 3EDKA 1FFQA 5J6GA 4OTXH 3FB5B 3NABH 3BX7C 4KMQA 3CAFA 5JQ6L 4P4KA 5FIEA 4PUBL 5HVHB 3F12A 3GKWL 1NUFA 4PJ8B 2BVPA 4MCZA 5H94A 1I3RA 2C1OA 2I26N 4ZUVA 4G8FA 3MLRL 4J3VA 2PR4H 3MFFB 5CD5C 4BA8A 2ZNWA 3CVHA 4JQVA 4V1DD 4HUUA 1KTLB 3QQNA 4Q9QH 4JN1L 3BH8B 1LO4L 5BW7C 5DJDA 5INDA 3RPIB 3GSRB 3HZVB 1CGSH 2R1XA 2EEAA 1EGJA 5F8RC 3PNWB 4ODVL 4JQXA 4EQ3A 1OGTB 2JTDA 5EZJA 4UOJA 4J1UA 5ENWB 4KROB 1VCAA 5EORL 2AXFB 3DUHA 1AGDA 4HJJL 5GRVK 3Q6FB 2P5ED 2XRAH 4U31A 4OZGB 5KSBF 2HG5B 4HHAB 4H8WH 1T3FB 5GZOD 4JJ5B 4X6BA 2FJHB 1B4JL 3TESA 3MUZ1 3KHOA 2XPGB 4GAGL 1ZT1A 1CE6A 4WFHD 1D6EA 1NMAL 2O93L 3VFNB 1NBVH 1EHAA 3V0WL 4P5TB 5IR1B 4XXDA 1G9NH 4XWOD 4XAWH 3QXVA 3SKNB 2AVGA 1U3HC 2D9CA 4ODXB 4Z76B 3S35X 5CAYB 3C6LC 2OYPA 4BSWA 2RR3A 2BHYA 4GKZA 3MGTA 1NEZA 4WEBH 5FCSH 5D1ZB 2IH3A 1IMHC 1MCWW 4TULL 4Z7NE 3GMQA 2X1QA 3DMMD 4L1DA 1RHHA 4EXPX 5HYQB 3TJEL 1J86A 5ADOH 1X5IA 1FJ1A 3PWVB 4YBHA 4ZPTB 1S5IL 2YSSB 4YIQB 3ZE0F 1FNAA 5I16B 5EUKA 1S7QB 5BO1H 3I6GA 1UB5B 3HLAA 4GMSL 5E8OB 4Z77A 3QDAA 3EGSA 5TQ2H 5TF1L 1MFDH 3EIFA 4RMUA 1QUNA 2PNDA 3CFDB 3K8MA 1UQSA 1A3LH 1E4XL 4WI5A 4HKBB 4TQEL 2H9GB 3S36L 4LASH 5CP7A 2X09A 4OZGF 5DK0B 1DCLA 5EU3B 3A0OA 3C6LB 3OF6D 3SKOB 5EBMA 4AEFA 1CXEA 3DO3A 3HPJB 1G7QB 1A6VH 3CSYB 1F4XL 1PQZA 3VFTA 3ARDC 1ETZB 1BBJA 1HXYA 4XI5D 5E24E 3WO4B 4J6RL 1IKFL 3ZKQD 1HQRA 2J6EH 4NFDA 4N0CC 4HH8A 4PRBB 5DUML 4YXKH 4PRAB 2O5XL 1CGVA 2DL2A 1W72B 3EYSL 3RWGA 3LQMA 5EPMB 1U36A 1BD2A 3I6LE 2DQIL 3KPRD 3BQUB 2CXGA 5IW1B 1MY7A 1CDJA 1X7QB 1GCFA 4POUB 2MWCA 2E7BA 4NZUL 5BOPA 5DQJB 4P2RA 5DZNA 4NJAL 4KPHH 1GOHA 4Z0XB 3B6SB 4WHYH 4BUGA 1VGEL 1BZ9B 1IT9L 1QEWB 4GXUN 2ZUQB 5FK9B 3MRRB 3VGAC 4F7TB 4OQTA 4BQBA 5DVMA 5I1CL 2QQKL 4MNQE 1A9BA 1CCZA 3BFOA 5T5NG 4HS6B 2FYYB 2LTQB 5DJAB 1J1PL 1XZ0B 1A7NH 3EJZD 1NCDH 1RUMH 2XOTA 3CMOH 2H6PA 4HFWB 3FAWA 4O02H 3O6FC 3BJ91 4U49A 2ADJB 4A2LA 2A9NH 1NBZA 1Y6MR 3VDBA 4H8WC 3QA3A 3ZDYE 2PYFB 4DJMA 3ESUF 3VMOA 1AGBB 3ZHKA 4M6AA 4H20H 4S1RH 1H3XA 4XP1L 4HC1H 1FFRA 4U1SB 1OM3L 2V17L 3JV6B 5MERA 1I3VA 1G9NC 5INCB 2XZCL 4WWID 2NZ9D 4WHCA 1SYSB 5E2VL 1FO0L 3QEHA 3GRWA 5A3ID 3RNKA 3DRQB 1EV2E 3QQ3B 4HUXB 3AU1B 1II4E 1RIHH 2FWOB 1AGFA 4J2XA 1ZVSB 4JPIB 3H9SD 4M3JA 1WBXA 2YOCA 1ZHNB 4HPOL 4UV4L 4Y4FB 1FG2A 3H8NA 1QO3B 1CFNA 1JNNL 4MNHB 5IB1B 3BHBA 4D3CH 3SKMB 5CD3B 1RJCA 1HH6B 4G80B 1UWEL 4JFQB 3EYQD 4JFFD 2NY6C 2W9LA 4LLUA 2A73A 4UQ3A 1WFTA 3S5LA 4F37F 2ZPKH 1NC4D 3BD4A 2ZG2A 4WFGD 5SX5K 1EFXA 4NN5C 1T83C 5FGBA 2K3TA 3WJLA 5HVFB 4X6DA 3SDDD 3NH7H 4AH2B 1C7SA 1RI8A 1PW3A 1AKJD 4ORGB 1XGUB 3G5VB 3EAKA 5DD6A 3BW9B 5C0JB 1D6VL 2UZXB 2ED9A 4X7SH 4Y4KD 5DS8A 1BFOA 2ED8A 2VL5B 4Z7NF 1JPGA 1FV1B 3HZKB 1G7HB 5CMAB 3VXRD 5AD0A 3QFDB 1NCWL 5LBSL 2F53E 3HMXL 3WFBH 4NRYA 5D7LD 3NFPB 4MNQB 4PLJD 4F9PC 3F65A 1CGTA 5I1DA 4XNUL 4S1QL 1BQHG 2X5PA 2JJUA 1EAPB 4UDTA 2XG5A 5DQ9B 1DLFH 1HCFX 1QACA 2VH5L 3T4AB 5DWUL 1RULH 3OV6A 5E94A 2DTMH 3IGAA 2P42B 1DUZB 2N1KA 5J1SC 4JY4B 5GS2H 4PJ7A 5M7QA 1P6AB 3LH2L 1QKZL 3W0WB 1SJHA 2MPAL 3MLUH 3DARA 1JVKA 4QHKI 3QEQB 3CGTA 5DEZA 1YDPA 2Y23A 2NY2C 2XQBL 4PJGE 4U6HA 4FTVE 4X4YB 4WHTA 5DVKA 1YEIL 4LEOB 1MSPA 4JPKH 4JCLA 4PG9A 4WI3A 3U30B 3KDMB 1VB9A 4I18A 3IVKB 1JHTB 2X70A 5E8PB 3GBNH 4KKAC 4ZS7H 4OLVH 1AXSB 4QHKJ 3IFLH 4XVUC 1SYVB 2R0WL 4GSDL 5KVDL 3MRGB 1KJVA 2YPKB 4HIHB 4UAOC 5FFLA 1PG7L 3LCYA 3OTTA 1HCVA 2D7NA 4DVBB 4ZFOA 1HH9A 3WSQH 3L5WA 1QHOA 1IBGL 3GSUA 4NRXA 2ZSWB 2BNQD 4JFPA 5DGQA 5JHDD 5L2KE 2GJ6D 3BP5B 3HFMH 3E1F1 1I9IH 4MAYD 1N5AB 4Y5YC 1G9MH 3CX5K 2N4IA 4GRLB 4HX1A 5DR5L 4PGZA 3SOBH 4Z5RB 1XAUA 3MV9A 1OTUC 1OB1A 3GBMH 3IFNH 2BRQA 3G5YA 4JG0L 1JZ4A 4RQQA 1J12A 3FO1B 3CJJA 1BQSA 1BHGA 1H3VA 1BZQK 2NY2B 2YMXH 4MJIE 3GUTB 5CS7A 2MQ3A 1F4AA 1ZLWK 3WL9B 4M7ZB 1NL0L 3NFNA 5JXEA 1HYSD 3FO2A 3QG6A 4OCWH 2R0ZH 3AS2A 2R29H 2XWBA 3BP4A 1LE5A 3BD5A 1QLEL 2PW2B 3UO1H 5CEZD 1MRFL 4BSVB 3RRQA 5DEGB 4FXGB 3ZDYF 5F96L 4LCWA 3UYRL 1MOEA 1H8NA 3MROA 5I30L 3QWOB 3PHOA 2VQ1A 4EOWH 1U3ZA 3E2HC 3WKML 2EDEA 5GRUL 4N8CL 4QRUA 3ARBA 3ARGB 1LK2A 1JFQL 4HUNB 4KUCF 5GJTL 1YN7A 3U7WH 1TJGH 3ZDXE 3MRPB 4M03A 4OV5B 3TEUA 4PTUB 1IEAB 1WBZA 2FR4B 1M71B 5DHYB 2XTLA 2EKSB 1TTUA 2WWKT 2X1XR 4G7VH 4Z18A 4CRPA 4ODSH 4F80A 4YFLF 3QRGH 2X4QB 1UZ8A 3ARPA 4JZOB 1NGZA 3KPPB 3MRFB 5ICXA 4PB9H 1LO5A 3ARZA 2VRAA 1MJJB 1LNUB 3BISA 5DVOA 2CSPA 2XKNA 3T1FB 1FP5A 1M6OB 5ECJE 3BP6B 5C0EB 3CPLA 1QVOA 4OD2A 2YEZB 5HHVL 3RI5F 2GITA 2BOBA 3F7VB 1CXKA 1RIUH 1R0AH 4MQXC 3OAYH 4QHMB 3LRSA 1Q72L 35C8H 5IESL 3HG1A 2V7HA 3GJFK 3IDXL 2HRLA 3P11H 5BMFH 3OG6B 4G8GE 4XMLL 4KK8C 1V7ML 1FSKB 3VXSE 2ZOLB 4MQ7B 2P1YA 1G7MA 3T0EC 4G3YH 4GXVH 2P7TB 4M62H 3E2HB 3LEYH 4NUJA 1FYTB 3LHPH 2N56A 3UTZA 4TTGA 1DFBH 3GMMA 3U2SA 4L8CA 1UM5L 2Q7YA 3RVVC 2DL9A 5JIHA 3U9UB 1R3JA 3KPRA 1BM3H 2ARWA 1HOCB 2V2WA 2J8UA 4N0YH 2R2BB 1MH5B 2GFBB 1ZHBB 3N85H 5E2WH 2EH8H 4J8RB 4DWHA 5EU6E 3VG0H 5CGYD 4WNQB 1UT9A 2GSIA 1IAIH 4PRDA 4G6AC 1AXTH 5C86A 1XIWD 3LQZA 2R2EA 1F8TL 4RAUB 1JF6A 3VFMA 3TIDA 5IMLA 4L4JA 5A16B 4PS4H 2ZCKL 2D0FA 3FN0L 4PJGF 3D0VB 1LO3H 1QQDA 2BY0A 3T65A 4L4TE 4U1MA 5B8CA 3MRBA 3PDOB 3MV11 1J0YA 1BGXL 4NQEE 1XFPA 2DQGH 1XR9B 4HZAA 1G9MC 3HN3A 3PF2A 5L88L 2CKNA 2EIDA 3GK8H 2Y6SD 1UKQA 3QNXA 5BXFB 2K7QA 5L8JB 2KL6A 4Y4HC 4KHXL 3TBTB 4GW4B 1KJMA 5DK2A 2QBWA 3ECBA 3FQTB 3OZ9L 1VGKA 5C07A 3IDYC 1OARH 3AMLA 5DD5H 4W70A 3PQYE 4JKWA 3WFCL 2FB4H 5T1LD 4FFVD 4OZIA 2HT4C 1AHWA 2PXYD 4MJ5A 3HKFA 4NSKA 3VFUB 4JO4H 3WHE0 1BBDH 3CUPA 1EBAA 2IADA 1IM9B 2V2XA 1ZS8B 4URTB 1OCWH 4Y1AB 4IRSA 4YAQB 2VN4A 4PLOB 4BH8B 4NWTH 1M1SA 5E4IA 5CZVL 4QRRB 4TNVK 3C5SA 4PRHD 3V52H 2PYEB 3FOMA 3GIZL 2CJUH 1KLUB 1MJ8L 5HGHB 1INEL 1JGLL 2C9AA 1A3RL 3O0RH 3QIBD 5I8EA 4X99B 4Y5VA 3F62A 5CUSH 3DX7B 1KJ2L 4OZHB 5ILTL 1QLRA 3SE3A 1T6WA 4M61B 12E8L 2FECI 5CBAB 3REWB 5IROC 3CFIC 5D2LE 4E41E 4Y4HB 2ENSA 3UBXA 1UCBH 4HS3A 3U4EA 1L7IH 2NTFA 4ONOA 5J12C 1KIQA 1RUKH 3RZWA 4G6JH 1WCQA 1ULVA 3IDYB 1UB6A 4UQ2B 4LF3A 3VRIA 4DGVL 1V3JA 2ORBL 1T5WA 5FA4A 1SEQH 3NBNA 1FVCB 3RTQA 5ANMA 3ZDXF 2QR0B 2HFEA 4LKCA 1KG0B 2BVUA 3GMNB 4NQVB 4HH9A 3NIDF 1NGWB 4WO4D 4KK6D 3V6OC 2EZ0D 3LS5H 5HHXL 3H0TB 2XYCA 1KACB 3PWPD 3VWJD 4NQEB 5EUOA 4JG1L 3B9KB 3MCLH 4NYLA 1DEEA 4RWYH 4WFED 4ZO9A 2F74B 3RAJL 2XN9B 5D7JC 4JRWA 1EHLH 1P4BL 2VDMH 5F71A 2CUMA 4PJCA 2V5SA 3BPOC 5DMGD 4JKKA 3DETC 1NCAL 2OQJA 2R4RL 3LEVH 4N8VA 3UJJL 5HY9B 2X4RA 1BF8A 3EOBA 1J5OL 3UJTH 2GT9B 1U91A 1R3LB 2OL3A 2BNRD 2ZUXA 4PD4J 1NAMB 2DJSA 4MHHI 5DC9B 1I7RB 1QR1A 2ATKA 5EIQA 1ZHLA 4P23C 3FFCB 3OKMB 1J05A 4OZHF 1NLBH 4UT6H 3BWAB 2YR3A 1NCBL 3GSQA 3IDJB 3N1FC 3QWRD 1LILA 2DQJL 5IVOA 1A7OH 2IFFL 3EFFA 4KRPC 5A2KH 5H8DA 4M7JH 2FX8L 3I85A 4K3EL 4OIIL 5ADPL 1EXUB 3K74B 1PX4A 3TO4B 1OF2A 1CIUA 1UWGL 4K7PX 4YWGL 4QRSA 1ZHKA 2ZKHH 5D70H 1UEYA 3GO1H 1KT2A 3WIFB 3NACH 4P3CH 1CGUA 5C0BE 2NY5L 1KSRA 4JRYE 2A6DB 2YUXA 3ZE2E 4P5KB 2BX5A 3OG4B 3I6KA 1Q9LB 4M1GL 4OZFB 3OGCA 2DQFB 3AC0A 3DHJA 3N1PC 2XZAL 2I60H 1G1CA 3LKNA 4M7KH 2Y7QB 5E0QA 4RBPK 4CN4A 3QPQC 3VWKC 2WW8A 1NUNB 1X4ZA 1TVDA 3G9VA 5C7XH 4Q0XL 4POYA 5C8JB 1FVDB 1JTOA 3MBED 1ZKAA 4NNXB 4L8SA 3VXTA 4EN3D 2BFVL 3TBVB 5K9OB 1K6QL 3UPCA 4M48L 4RMQA 4P2QA 3HUJE 1IAKB 3X13A 3WNPA 1GGBH 4HK0B 4MQSB 2WQ8A 3E8UL 5AEAA 1MPAL 5GJSH 3B2UD 2CUHA 4HCRH 3PV7A 2GHWB 5HJ3B 3UPAA 1OTTC 5IIEB 4KZDL 3WXWH 5C6TH 2NY3C 4XPFH 3D25B 4U7SA 3QDGD 4M5YL 2D0HA 3DHMA 4H1LA 4OCYL 1MLBB 4TSAL 4MSWA 2NTSP 1E6JL 3ZKNC 2H45A 4WW2B 4XP9L 1SJEA 2ADFL 4LLVA 3HMXA 5CCKH 3KNBA 4YZFE 4PRIA 1XH3B 3TZVB 4Y8DC 3NPSC 4NQCD 1U8PB 2EDJA 2FEEL 3KPMA 1MHPH 3QWQB 1Y6NR 4XP6L 3FHAA 2ZG3A 1MHHB 4HQQL 4Z78B 3EYUL 1OQXA 4D0BA 3MJ9H 4XP5L 4X4ZA 3MA7A 2DIAA 3VGGA 2ZG1A 1I8IB 3VWKB 5JO5A 1HHGA 3BKYL 1QTYT 1K2DB 5D2LF 1PKOA 5IF0B 3ZTJG 4M6OH 3UCRA 4I77H 3GSXB 5HYSA 4UBDC 5K9JL 5EZIH 5IHUL 3TBSB 3RWDA 4YEFA 3I3DA 1VACB 3O2VH 3TYFA 5LKNA 4HUKB 1V3LA 3FZUD 5GS3A 1J9CT 5IUSA 2ZCLL 5C0BB 3RVXC 2NY3B 5TE6L 4EXKA 1YY8B 4MA8H 1T1ZB 5JNYA 5A2FA 1RU9L 5FHBH 3VFPB 1GIGL 3B5GA 3DRTA 4RISL 3PGFL 1P5VA 4LARH 3LS4H 1KJ3H 2ERJB 3OHXB 1EBPA 2MJWA 3LKSB 3HR5B 2ADIB 5DQDH 5I18L 3NPSB 1GOFA 3CNKA 3JWDL 3W11D 3EYFA 1A1MB 4Y19D 2FIKB 5MEND 1S9XA 5H37G 5D5ME 3VA2C 5DZOA 4OGYL 5EFIA 3RVUC 5C70A 1PKQE 2BP3A 5EOCH 3HUJB 3LKQB 5GRXG 3TVMB 1L0XA 2EC8A 4WW2F 4XPHL 1D9KD 2AI0H 4LKXB 3OKDB 1IGFH 2A83A 1MJUH 4ODBD 4EUPH 1NFDE 1XGPB 1N4XL 1WZMA 2IJ0C 4GW5B 4CW1A 4ZS6C 3IDIA 1TENA 2JJTC 1M7IB 2LVCA 1KELH 3DUUB 1FL5A 4I3RH 1U8HB 3DO7B 2E6QA 1CT8A 3QUYD 4OLYH 2YXMA 4XC1L 2R0KL 5E9DD 4OLZH 3SGEH 5IMMA 4P2OA 5F7EL 1MFCL 2PXYA 2C3WA 2UWEB 4X5XA 3WIIL 5I1EH 1C12A 1BVLB 4PY8J 3ULVH 1E4KA 2R15A 4X8XA 3GI9H 4NZTL 2VIRA 4PG2A 3RUGE 5I1JL 1ZANL 3B2VL 3S88L 2VZUA 2ZOKB 1JWMA 1T89A 2RGSA 3TF7C 3GI8H 3CFEB 4KTDL 3MLWH 5F3BB 4QTHA 3ZE2F 1P2CB 1J1OL 2OTUA 1KEGL 3UXFA 5KSBA 3MUJA 3HE7A 2HTKD 5EO1A 4HIXL 4YXLL 3KLAA 4AL8H 1PLGL 4J3UA 5DJ2A 2RCSH 2Z31C 2LE9A 3MJGX 2VKXA 4S0TD 5IHZA 3G5ZA 4ZTOH 1MWAL 4TNWF 1Q1JL 3ULUH 2CQVA 3O3AA 1MREH 5I1AA 3CSBA 1U92B 5BZWB 3QAZC 3HUJF 2DB8A 1F6LL 2D7QA 4JO2L 5C09A 4JR9L 2YD7A 3HNTH 2FBJL 3TWCL 2XNAA 3DX8A 2P48B 4M5ZH 4H0HB 1DE4A 2EXYD 1J11A 2AEQH 2YC1A 4LHUD 3GGWA 1XGYH 2H3NA 4OI7A 3VRJA 5ITFB 5FGRA 2R8SL 5CSBA 1FLTX 5T3ZD 3F5WA 4PB0H 4OLWH 1MI5E 2C1PB 5H35A 1CG9A 2NY4D 1Q0YH 1CN4A 1E27A 1U8LB 3HB3C 1K8DB 4YZFF 1LD9B 3UZQA 2R2HA 5FDYA 3V4UH 1OWRM 5GZND 5B39B 3O4LD 1A9EA 3MREA 4YE4H 4YDJB 1NFDB 3LZFL 3ZE1E 4L5FH 4DVRL 3SGJA 3GIVA 1S7RA 4GJTB 1ED3A 3RJQB 3VFOA 2NLJA 5HGBB 1PVHA 5IWLC 4FP8H 5HHPB 4KQ4H 2UWEF 3BUYA 1HHKA 5B21A 5HYJE 1I1FA 3A6BL 43CAA 3BH8A 2NY0C 1AQKL 4HJGB 3Q6GH 4NZRL 3QUZD 4XCFH 1P6FA 3GFUA 5EDXA 3NCEB 1J8HB 2VDQH 5D2NA 5BV7H 2AK4D 1YEEL 2YUZA 3MLSH 4Z7VE 1F13A 2AXFA 2IANB 4JHWL 3QAZB 3Q6FA 5CP3A 5FECA 1YC8A 1WWBX 2VZSA 2AJ3A 3QQ9C 3IFOA 2G9HB 2HG5A 3RUGB 5IGXL 5HI4D 4RGND 3QWRA 5ESVB 4MXWH 1TZHB 1S7WB 1CE1L 1VFBA 4GUPB 3FMGH 1T21A 1FN4B 3VFNA 1BOGB 1GVIA 1IKNC 4P5TA 4P9ML 5IK3A 3TM6A 1YPZA 3HI5H 1FGNH 2BJML 4Z7OE 4XI5C 2VXTL 1IC5H 2DQDH 4WUUD 3P3YA 3R1GL 4D9QD 4BELD 4LPUA 4NQDE 5EULV 5DUBB 1EA9C 1QYGL 3CCHB 3G6JE 5CLTA 3OMZA 4O58H 4GRWE 5L8KB 2OZ4H 1NSNH 5D5MF 5J3HC 4P5MB 1H5BB 4JGJA 3D85B 4FRWA 4UILL 5J13C 2NY0B 1K4CB 4D2NA 1ZT7B 1BP3B 4OLUL 3U0PB 3V7MA 2Y36L 1CU4L 5HYQA 5E1AB 5C2BH 4FQHB 2EDRA 5CGTA 3ULVC 4LOUC 4XCCL 1CXLA 5C08D 2VN7A 4ZFGH 3MBEA 2YSSA 1KJ2A 1NFDF 2APFA 4GMTL 3BSZH 5IFJB 2B2XH 4NNPH 3W39B 3O8XA 2FECL 4WHYG 1EZVX 1S7QA 4KTEL 1PEWA 2Q86B 3C8KB 4TOYH 1BPVA 1AO7D 5SX5H 1P69B 3ZL4L 3GMLA 1DLHA 1CBVL 3GHBL 4ZXBC 4W81A 3L5XH 5JOPD 2NNAB 3HZYA 3VXUD 3AY4A 3H42L 2VWEE 4XVTH 4AM0A 4JFDB 4KUZH 3DGGB 4GAYA 4HV8B 4LRIA 3RUGF 43C9B 1MCCA 3ULUC 4L29B 2IC2A 3P4LA 5EU3A 5MHSE 3NPZB 4BZ2L 3BZ4A 2X05A 2A6KB 5I8KH 2JJSA 4Z7VB 5EOCJ 1ADQA 4ZNEE 4MA7H 5FYLH 4JHAL 2VXSH 4OZ4A 4IM8A 4AQ1B 3R0MA 4LQFL 4XC3L 2PO6D 2WIIA 3VXMD 1T0NA 2X4PB 4HBCH 1DN0B 3SGEI 3SDXE 4NUGL 4BQ6A 4GAJH 4QTIL 2OJEB 1XGQB 3FQXB 3THML 3V5HB 2EDNA 3LKPB 1I8LC 4UV7H 1KULA 5KSAB 3BQUA 2LABA 2FEDD 1QBAA 3ARVA 5IW1A 1F3JB 1MCDA 3HR6A 1GL4B 1KC5H 3FCTB 1I7ZB 2F8VA 2KZWA 3QFJE 2D7MA 2R1YB 3NIFE 5AUMB 2XI9A 5DQJA 4UIMB 3EYQC 4TUKH 1A7PL 4XCYA 5LGHL 4YFEA 2AJUL 4XNQB 2CH8A 1K4DA 3O9WD 1WT5C 4FQJL 3R4DA 5BRZD 1QEWA 4NQDB 4ZXBB 4NZDA 1V05A 4QRPB 3D39D 4R7DA 4XMPL 5D1XA 3V5DB 4MJ2A 5IBTH 4F15C 1NAML 4YLQT 1RAMA 5DJAA 5T1KD 3JUYA 2VAAB 4YR6B 1XZ0A 1CFSA 2BC4A 4LSPH 3TNNB 5FYJH 4PJIE 2BSSA 5TDNA 1FE8L 4TN9A 1RVFH 4FZ8H 3OJDB 5F1IA 1G6RH 4U1KB 2Q8AH 5F9DC 5C0CE 2QTEA 1M05B 2X89D 1CL7H 3ZE1F 1AGBA 2DLFL 1Z2KA 3I2CL 4OCMC 4PLJC 1P84K 4RGMC 3V6ZA 4BYHA 2ZUUA 5D72L 4TVPE 1UXSA 4U1SA 5T1MA 3FT2A 3QCUL 3SDAC 1INQB 4XMKH 5IV2A 3RGVC 4TPRL 2DAVA 5JPMB 15C8L 1SYSA 1VFUA 2ARJQ 5KVMC 3DX6B 5EBLA 3DVFA 4FQXC 4KZEL 1ZLWH 4Z7VF 4HUXA 1TJHL 2B5IC 1FORH 1ZVSA 3BPNC 4NQSA 2WBJD 5EN2A 3VA6A 4LSRH 1FNEA 4ODUB 5C0RH 1A4JB 4JO3H 1JZ2A 5IB1A 4PRPE 2IQ9H 5CD3A 2BOCB 4JM2C 1WFOA 2JK5B 4F15B 1EPFA 2D03H 4JQIH 1CFTB 3MRQA 3PUCA 5F1SA 1IGIH 3SJVB 3RWHA 3G9AB 2DWDA 5E6IA 1LO2H 2AQ2A 2ESVD 4NGHH 1EH9A 2G5BB 2CKBH 2OJZL 3WFEH 3ZT7A 2JB6A 5F7KC 1TQCC 4Z7OF 3TN0C 3MRJB 4JPVL 2DQUH 4KAQL 5JDSA 4ZOCA 4MAUH 2JJVA 2CIIA 1VSCA 1IE5A 3LKRB 2FHBA 5CWSB 4DKEL 3G6JF 4GRWF 4MCYA 4RAHA 1Y6KR 1HINH 2WV3A 3QISA 4E5XA 2OP4H 4NM8H 1I85C 5EO9A 4PRNB 4UUJB 5DURB 3FRPA 5F7WC 5EZOL 5ISZE 4P3WA 1SHMA 3RGVB 2P5WE 3O6ML 3T77B 1CFVH 5EBWA 4FQXB 1D5IL 4MNQA 1P5UA 4WV1A 4R3SB 2W60A 5DJ6A 4MD4B 4POZD 2B5IB 1QSED 5J89A 5GS0D 4TSBL 3WXVL 4GT7A 3RL1B 2DRUA 5KVEL 4PJIB 4ZO8A 1WEJH 2AV1B 1XF3B 1T1XB 4XP4H 4LCYB 1DANT 3GJFH 1EJOL 2VDNL 2YK1H 1DBKL 4U3HA 3WIHH 4JM2B 4MD0B 3U83A 4AQOA 2W0FA 2WUBH 5EG6C 1X5XA 4R8WL 1LK3H 1F6AB 2BMKB 4KHTL 3T0AA 4RRPA 3C6SA 2UY6A 4IRJD 4CVWA 5SWZD 1TQCB 4NHCH 4PP1D 2JLLA 2HP4A 2AP2A 3EYVB 5E8PA 5K9QI 5HDQL 5CJQH 4QXWA 2WSKA 2YXFA 2JIXA 3OKLB 4X7DC 1IM3A 3RVTC 1S3KH 4FFWC 1EX0A 2HFTA 5KZCB 2VDLH 3MRGA 3LDBC 2YPKA 4HIHA 2IH1B 1HXMB 2Q76A 3KXFE 3NA4A 4AEEA 3U6RA 3DVIA 2C3VB 1ONQA 4PRPB 5HGDB 1I1AD 3CFJB 4HKZA 3SDXF 3RY6A 5DJYA 2UVFA 2ZSWA 4J4PC 1KPUA 3TV3H 4JRXD 3OBAA 1TCRB 4O2FB 2WINA 4KJPD 3F7PC 2V6HA 4GRLA 3QIUA 4RNRA 2HVJB 4Y2DD 2Y72A 3ARED 3ARFB 5DRWB 2JF1A 3UP1A 3CLFH 4L3EE 5TE4H 4NPYB 5D6CB 2FNBA 4OFDA 4MVBD 5I76B 2HFGL 1IGYA 1KIUA 5A40E 1IARB 2RBLA 2FD6L 4UT7L 1RY7B 3SQOL 2QLVB 1B0GB 4AK1A 1A7QH 5ISZB 3KWWA 2XZQL 4PJIF 3RPKA 1KB9K 3AS3A 1MIMH 2F53A 3QXDB 4FABL 5EU7E 1CICB 5DSCB 5FUOL 3I50H 1D3CA 2XQYK 5T3XH 2VB5A 3TNMA 3KYKH 2YA0A 3NCJL 1GH7A 4YX2H 1RIVL 3QDMB 3SDYH 2RB8A 2IAMC 4MA1C 4R4FH 3ARGA 1P9MC 1SMOA 1UACH 1YJDH 2GK0B 4QHLA 3MRPA 3LPWA 4KKCC 3RKDD 5C08A 4CMHB 4OGXL 3NMEA 4OZFG 1FC1A 5EC2B 2EC9T 4PJGA 4U1HB 3ROOA 4WY7H 4FTVA 3RL2B 4OD3L 2VITB 5FKPA 4LPCA 1TLKA 1AO7A 2X42A 3IT8D 3WUZA 4LBEB 3KYMA 4AEIH 4ZSOE 5DLML 5HDBE 4TRPL 1MWAA 4GBXA 4JFHE 2JELH 1FFOB 3V79C 2BY2A 1JGVL 4JN2B 5BQ7A 5BS0B 3MZTA 5E8EB 3SE4A 5MEQA 5C0EA 4P46C 4XTRD 4ZUUA 3QNZA 2YEZA 1WGOA 2FJFB 3KXFB 3M07A 4XPTH 5C0NC 4KGLA 4NWUL 3RWJA 1SVCP 1NC2B 3BKML 4XPGL 3NOIA 3QQ4B 3D5OF 3FQNA 5DC4B 3ZKMD 3VGBA 3HE6D 3QUXD 2UZYB 3BGMB 5L2KA 4JKPH 4LK4A 1A6WL 4YHIA 3CX5J 1MELA 3SO5A 1KCKA 1TFHA 3CVHH 3SDCD 4Q9RL 4RDQG 2AJYL 5CZXD 3MLTB 3EZ8A 2IAMB 4DAGL 1ZOXA 2VSCA 4MDJB 5DT1H 1QSFD 4L3EB 2W0KA 2CKBB 1ZV5A 3MRMB 5F89B 4HF5H 1RZ8A 4YBQD 4N5UA 2EIEA 5F1KC 4JLRA 4L3CB 4MJIA 2NY1C 2F8OA 3STBA 2IWGA 1U95A 4KRLB 4XHJD 4HMCA 2GFBA 4XRCA 2EYSB 5JPNB 5HD8D 1ZXQA 1HHHB 4WGVB 3DLQR 3L6FA 1T22A 4PJEE 2LQRA 5IKCB 5CIPB 4U1GC 1I8MA 1Z0NA 5JOFA 5FYJU 1LO0L 3O6LL 3NGBC 4U0RC 5LXGH 4YQXH 3QDJD 1FZOB 1I9JH 5T1KA 4QXGH 4U05A 3RIAF 3KPSD 3D0VA 1KIPB 3Q1SL 1Y0LB 3P0YH 1T4KB 2MHAA 1U0QA 5J1AB 1XR8B 4R2GD 5IB3B 2VLRE 1CFQB 4C83B 2Y4SA 5I9QB 1YEDA 1JHKL 4HDIA 1MQ8A 3SKJH 4WJ5B 2I07A 4GOSA 5D9SB 2OMBA 3FFDB 4LLYA 4U1JA 3B3IB 3K7UA 2DQEH 5AAWA 5I71C 4M93B 5DRXB 2HJKB 3LN5A 4WO4C 2JJWA 4UB0L 4WTZA 1Y18B 3LPGA 5LQBH 4JDTH 4MX7B 4KMLB 5D1QC 3U4BL 5T5FL 8FABB 1T66D 2O61B 4QWWD 3ZYZA 4D8PB 2DBJA 2OR9L 4NRZA 4C54A 4IHOB 3QI9B 3MRNB 1OAQL 4NN6B 5CHNA 3SE8L 1U8IA 2H2PC 2YPLB 4XX1G 4OUUB 1ZS8A 4U1GB 4QT5A 4UT9L 1BEYL 4G8GA 4Z8FL 4RBPH 4XBGB 5FYKD 3NGBB 4TUOA 2OX5A 3JBG7 3VXSA 1GXEA 4UDUA 3MACL 4OCXH 1JHLH 3P40A 4X98B 1VEPA 1KLUA 1N59B 3WLWC 5HGHA 5TH2A 4WDIA 2OI9B 2DYPB 2CIKB 4UTAH 4M1CD 3OL2A 4YEEA 4TUJB 5IQ7L 5I8CB 3U82B 3MRKB 4HKJA 1NBYA 2AXHA 2BSRB 5HHOD 2Q8BL 4L9DA 5I71B 3C60C 4MWFA 2IQAA 1T2XA 4K94H 5EU6A 1D5XB 3H3KA 5DTFB 3V8CA 5HHQB 2DQCL 3IETA 3IKCB 3V7AG 4WI2A 3DXAB 1TPXC 1RZIB 2EDBA 5C0AE 4Y16A 3X3GH 2BDNH 4L4VD 2R23A 2DQTL 2IFGA 3R0NA 4P4KC 5KSVB 4QGTA 1TJIH 3Q0HA 3JTSB 1RFDH 4OKDA 2R69L 1VFAB 4L4TA 3KJ4C 5CINH 5JW5A 2IBGA 4NQEA 3VXOB 1JNLH 1VFOA 5H2BB 3QZWA 4JQVC 1YEGH 3TT1H 3B9KA 4ZFFA 3EO0A 5HDBF 2F74A 4OQTH 32C2A 5ERWA 3ULSB 3D9AL 1RMFH 4JQXC 3LEXB 4XPAH 3G6DL 2EE9A 2FRGP 3C5ZD 4JKLA 5C9JB 4N0RA 4CU7A 2AABH 4UINL 2XWJB 5GS1C 4EDXB 4FQQA 3G08A 3PIQB 1B0RB 2BSTB 1R3LA 3PQYA 5T33L 4MD5A 2DBLL 4HWZA 5ITBL 5IMKB 2OXGA 2J2ZA 2R4SH 1HHJB 5K33A 4LVOC 1EERB 2HH0L 4KVCH 1TPXB 1D5MA 3KAAA 5J6GB 1EMTH 1AFVH 3PL6D 1MAMH 3B9AA 1YY9C 4I0CC 2O5YH 4PREB 3TT3L 4P4KB 2YD3A 3F12B 4QGYA 2BVPB 4MCZB 2EDTA 3GRWH 3TA3A 5JQHC 1I3RB 2C1OB 4ZUVB 4G8FB 2WMPA 1EXUA 3IS1X 4F7PA 3RZCD 3KJ4B 3QHZH 3C2AH 4FQCH 3SCMA 3CVHB 4JFED 3CIQA 2OK0L 2AEIT 4HUUB 3UROR 5I1IH 1GSMA 5D2LA 4E41A 4PJ8D 2H32A 2F9BT 1C5CL 4HS8H 1PDKA 5DJDB 5INDB 1W8NA 4JO1H 3MBXL 2R1XB 5IQ9A 2A6DA 1UH3A 3AM8C 5EZJB 1O5DT 4NCDA 7FABL 1ZK9A 4J1UB 5I1GH 3L7EA 4OT1H 3V9FA 1OAUL 1AGDB 2FHCA 4U0QB 4HXAL 2YD9A 5LG1A 2DQHH 1OGAE 2W59A 2DQFA 4LSSH 1MCJA 3QP3A 3RDTA 5J11C 2CXKA 2IPKA 3FZUC 4LQ1A 1FVDA 1JV5A 3KS0H 1CE6B 4KROD 4KK9C 1D6EB 1NUDA 5K9OA 5L6YL 1IAKA 2O5ZL 4ZAKD 1BWMA 4XXDB 1K3IA 1JGDB 1MCNA 4HXBL 1YECH 1YYMH 2Q20A 4NKIL 1CF8L 5KJRL 3BRDA 1Z3GH 4DKFH 4BSWB 3VH8A 4JFZH 3S4SA 4GKZB 4KI5C 3VJ6B 1F3DH 1NEZB 3MGTB 4WW2A 4BZ1L 3MRCA 1V3KA 3TFKC 3ALWA 4K94C 4M1DL 1RURH 5TDPA 5C6WH 3GMQB 4YHKL 4J3WA 1RHHB 1B2WL 1SBSL 5CD5D 2OTWA 2XWTA 3OB8A 3HTLX 4I0PB 4F37K 4BZYA 4M7LT 5JR1L 4LLQA 5FV2A 3L5HA 4NQXB 4PV9B 4GW1A 2F5BL 3UTTE 5F6HI 3I6GB 1I8IA 3HLAB 2NX5E 4EUPG 4Z77B 3EGSB 3FB8A 3EOTL 3H7BA 4FMFA 1U58A 5F1OB 4ZYKB 5JW4M 3HE6A 4HGWA 3MV8E 4Q2ZA 1A6AA 5JW4R 4AIXA 1UH2A 4KDTA 4ZNCD 4ESKA 1B90A 1RK1A 1JZ7A 2LAAA 1UQSB 1CTNA 1QNZL 5BVPL 1FG9C 1J87A 4LFHG 5F6HJ 1MRCH 1DQML 4TVPL 5CP7B 3F7YA 5C0BA 4JRYA 1F90H 4I3SL 2AQ1A 2F54E 4LHQB 5EBMB 4MDIA 1NMBL 1PQZB 3VFTB 4XNXL 3CXDH 5IB5B 3TLRA 1BBJB 3N1MC 3OHXA 5IB4A 1PBYA 1HXYB 1KCVH 3UJIH 1HQRB 1MEXL 1U3HD 4OF6A 3GSNH 4HKXB 3C6LD 4FQ1H 1DZBA 3MOAL 3LQAH 1UYWH 3L3KA 4A6YL 4M43L 1A64A 4PJDE 2CLRA 3AB0C 3T0WA 5J1TC 1BD2B 1HILA 4X6DE 3PE9A 1JZ5A 1JCKA 3LPFA 3HUJA 3IDNA 1XF4B 2H41A 1XF5A 2WP3T 3WNKA 5J6HA 3PWJB 3EFDL 4FXKA 4P2RB 3V4VL 3JUZA 2A77H 2DM2A 3QO1A 2MQ0A 1FCGA 2R0LH 1WLHA 4ALAH 5IP4A 1IILE 1A9BB 4I5BA 2EXYC 4IIQA 5MEOA 3KJ6L 3U79A 1Q8MA 1M7IA 2XY2A 3S3PA 5CLWA 1CK0H 4BK5A 4LNRA 2H6PB 4ETQA 3HPLA 3IJSA 5IM7A 4NOBA 5CILH 3DBXA 1CDBA 3MSPA 3VMPA 5FGBC 1CQYA 3QHFH 3STZA 1QRND 1NBZB 3WJLC 5DMIH 2VLMD 2A6JB 3QA3B 4PJAE 4JB9H 4OM1H 4FG6C 1MCOL 3CU1A 5DD0H 2NX5B 2ITCA 3WKNA 1P7QD 3L9RA 5MERB 1DEDA 3N9GL 3QCTH 5I74C 5TE7H 3CFEA 2DKUA 3UC0H 3QEHB 4N0CD 4DGIH 1A6VL 3RNKB 2CLVB 2VDOL 5DD1H 2NW2A 3G04A 4FHBD 4V1DE 1AGFB 2QHLA 1WBXB 3H3BC 3ULUF 1NFKA 4O5LL 5DFVC 1WTLA 2WUCH 4Q9CA 1CFNB 2F54B 5GGQH 5FV1L 5GGTH 3BHBB 4LGSB 4HFUL 3Q5TA 3WHE1 5JQ6H 4MJ4A 3FQUA 2A73B 4LLUB 4UQ3B 4ZODA 5FXCH 3S5LB 1F58L 4PUBH 3GKWH 2R39A 3LY6A 2P5EE 1BVKA 5J56B 2OXHA 3BE1L 3MLRH 3ALXA 1EFXB 5CSZB 1IL1A 1HEZA 4I18C 1MVFA 5D5MA 4X6DB 1PKQA 4JN1H 4U6XB 1LO4H 2XICA 4N0UE 3ILPB 1QFUL 5DD6B 3W5MA 2C1PA 4Q6IB 4YHNB 3O6FD 3T2PA 5DS8B 1BFOB 1U8LA 1JPGB 4OFVA 5AD0B 4ZD3L 5EORH 5B39A 3C5JA 2ID5A 4HJJH 2IBZY 1FPTL 1NFDA 3RI5K 2DJUA 5GQBA 4L9LB 5I1DB 1UM4L 3C5ZA 3S96A 2D7TL 5TPWH 1B4JH 5E94B 2ICWB 4DUWA 4GAGH 3IGAB 4HJGA 4NC0B 3BRFA 1NCTA 1JE6A 5EU4A 4B7IA 3JV0A 1CLOL 4WEUD 3V0WH 3KS0J 4ODHL 4GXUM 1SJHB 2ICWI 4RCAA 5KG9B 4PJAB 5TDOA 3LQAC 3WE6A 4U6HB 4WHTB 3VW3L 1R3HA 3M45A 4PG9B 2COQA 1TZHA 5JXEC 4I18B 2I5YL 3W0WD 3D48R 5M94B 4NQUA 4AEHL 3P2TA 3QEQD 1N0XL 3VXQA 1VDGA 4TULH 4D3CL 1GRWA 5F88A 2FIRT 3TJEH 1KJVB 4X9IA 4KUCD 5TF0A 1OAXL 1DL7L 1S5IH 3FB7B 4G6ML 1T7XA 4YDLC 1HH9B 3ARBC 5AYQA 1N2RA 4PJDF 4DW2L 4I1NB 4PJBE 3GSUB 3DROA 1HKLL 4NRXB 4CJ1A 1WWWX 4GMSH 4X6DF 2KBGA 4JFPB 4RMRA 4P5MA 1TDQA 1H5BA 1EZVY 4JHBA 5TF1H 1AP2A 5KS9E 2P5EB 2CO6B 3HMWL 3QR2A 3C9NA 4LSDA 3MV9B 1E4XH 3MNZA 1OB1B 2QQNL 4TQEH 1N6QL 2UZIL 4M7LL 4AMKL 5LCVL 3KPRE 4QCIB 1FNHA 4LSVH 2J8UE 5GHWL 3TBYA 3ZKSD 1MI5A 3IU4L 4G7YL 2Q86A 3K1KC 3NFNB 4QXUL 1YNLL 3FO2B 1F4XH 2PTUA 3QG6B 1CIDA 2W07A 1SY6L 3DYOA 5EIIA 2BRRL 2XWBB 4NKOA 3BP4B 1LE5B 2NY2D 3VXPA 1IKFH 1NLDL 5I66B 3ABZA 5DUMH 4PJAF 4I4WB 2O5XH 4LCWB 5HYJA 1C7TA 3MROB 3ET9F 3EYSH 3PHOB 2VQ1B 4KKAD 4HV8A 3QH3B 2DQIH 4L29A 4QRUB 4JPKL 3ARBB 1MHCA 4OCLC 1X6NA 1S7SB 3QUKB 1YN7B 2R1WB 4WCYL 2A6KA 1QBBA 4NZUH 4Q74A 3FN9A 5ETUA 4NJAH 1WBZB 4XWGL 2RIKA 3WNMA 4R6UA 4F57H 1VGEH 5BW7A 1IT9H 2F19L 4LRNL 1J0JA 1QPPA 5I1CH 2QQKH 5FKAA 3V4PL 1QFWM 1NGZB 4C57C 3FQXA 4G6FB 3FT3B 3LKPA 3ZDZE 3HRZA 1LO5B 5KSAA 1F3JA 3WSQL 3BZEA 2XKNB 3BDYL 4KKLC 1FNLA 2R1YA 2MCPL 4OZIE 3CPLB 1QVOB 1N64L 4OD2B 1FHGA 2BOBB 4XNQA 3H9SE 3OR7A 5F7FA 5B8CC 5GXBB 1YQ2A 4NQDA 2CD0A 4DQOL 2Z8RA 1H3PH 3G6JA 4XP1H 4WUKL 4Z7WE 5GGUA 2KH2B 2NW3A 4OF7A 5DHXB 2H1PL 4JFFE 3PHQA 1OM3H 3TNNA 4QLRA 2V17H 1G7MB 1F4YL 4LIQE 2DD8L 1U3HA 4YK4C 1FO0H 2IBBA 4NUJB 2QADC 4WFGE 3UTZB 3WLBA 4G8IA 4U1KA 3QEUB 3U2SB 4L8CB 2J3SA 4OCWL 1X5HA 5FGSA 2Y5TA 4RSVA 2Q7YB 2BZDA 1R3JB 3KPRB 5IB2B 5E7BA 4HPOH 2V2WB 4UV4H 2J8UB 4X6CE 1NCCL 4K3GA 1HWHB 4XH2A 3CC5A 2NY7L 1PAMA 1JNNH 1FYTD 3SN6N 1AHWC 4X9GA 4C4KT 2GSIB 3DUSA 1BAFL 1UWEH 4PRDB 1AJ7L 1IRAY 4JVWA 4Q9BA 3SO3C 3VXRE 1T0PB 4IRSC 3LQZB 1ORQA 4F2MA 5D7LE 1NJ9A 4OCNC 5IMLB 4D9RD 1JJUA 3EW3B 3O11A 3IF1B 4MB3A 4H0GA 3BZDA 3T65B 4U1MB 1JGEA 5B8CB 5BOZG 1TXKA 4Y5VC 3MRBB 5C0IB 2JCCE 1NKOA 4IRJC 1KXQE 3F58L 4PP1C 4NNYA 1D6VH 3QNXB 4ZNEA 2CGRL 4YUEL 3KLSA 1CDGA 1A02N 1KCUH 4MQXD 5GGVY 4EI5A 1KJMB 1NCWH 4YK4B 5DK2B 5LBSH 3ECBB 5HYFA 1A1NA 4EKXA 1VGKB 5C07B 3SDXA 1JYWA 4OFYA 2I9TA 4XNUH 5F9OL 4S1QH 5GS2D 3ARDA 2A9ML 1H3WM 2VH5H 5DWUH 1T80A 3T0ED 5CWSA 4PJBF 2QL1A 3QFJA 3BZFA 3RTQC 2YUVA 4OZIB 1MF2L 1EO8L 1TZGL 1G7PB 1MCRA 1AHWB 3LH2H 3NCCB 4MJ5B 1QKZH 3H9SB 5E99L 4NSKB 3T0XA 5KS9F 2MPAH 2GIYA 3CUPB 1K8IA 4KXZH 2V2XB 3SO3B 3RVVD 5JXAH 3NFSL 3T77A 4IRSB 4M02A 2OLDA 3LEYL 3QJFB 2XQBH 5L7XH 5DJ0B 3VGHA 1YEIH 4U6VH 3C5SB 2BNQE 3FOMB 5JHDE 4OF5A 2GJ6E 3WFHA 2J8UF 4PJIA 1JPST 3E3QE 4G6AD 2AV1A 1NC4B 1T1XA 4Y5VB 4Y1AD 2VLKD 5HHMB 1QLRB 2E8YA 4XCNA 2R0WH 3VG0L 3OKNA 4GSDH 5KVDH 4QRRD 5C0CA 5ESAB 2PYED 1SM3H 4PGEB 1QA9A 4KJWC 5EOTA 3UBXB 3U4EB 1P84J 5IEHA 2NTFB 1IJ9A 2F15A 1KIQB 2LU7A 4ZUSB 4PJHE 5DJ8A 5EIVA 1VKXB 1IBGH 1Q38A 5JMOC 2AJZB 2VQUA 2I27N 1VADA 3S35L 3UBXI 4YC2C 3EYVA 4GKSB 1DVFC 4LF3B 1LO3L 3VRIB 4ZFZB 1IC7H 4Y4HD 1T5WB 1EO7A 4WI6A 4LCCB 5FA4B 5FUCC 3RTQB 5KVFL 1DDHA 2YA2A 4N1HB 5CEZE 2HFEB 2PW1A 1AGCA 4HUWA 4LKCB 5DR5H 1B3JA 1OAZL 4HH9B 2FO4B 5I17A 5ALCL 2IH1A 1UXWA 2X44D 4FN0A 4JG0H 4DOHE 3KLHC 2QSTA 2MKWA 4ZQKA 4A6YA 5D71H 5C0GA 2C3VA 5HGDA 1YC7A 4D0DB 2AEPL 1NGPH 3IKKA 4NYLB 4XBPA 3U36A 1R3KA 1F11A 3DSNA 2HT4D 3DV6A 5DD5L 4P4RB 1PJ9A 1LE9A 3BT2L 1V7NL 1BJ1H 4OZIF 3S6CA 1KTKE 1QLEH 2OQJB 2HVJA 4N8VB 1U8OA 1MRFH 3A6CL