4QWWC

Crystal structure of the fab410-bfache complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
212
Chain Sequence
QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMYWYHQKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSLSVSSVEAEDAATYYCQQYNSHPMTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Acetylcholinesterase
publication title Crystal Structure of Snake Venom Acetylcholinesterase in Complex with Inhibitory Antibody Fragment Fab410 Bound at the Peripheral Site: EVIDENCE FOR OPEN AND CLOSED STATES OF A BACK DOOR CHANNEL.
pubmed doi rcsb
total genus 54
structure length 212
sequence length 212
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qwwC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qwwC01
1FFQA 1FV1A 5BJTB 1PQZA 1KSRA 2HJKA 5INCA 2AK1H 5LJYH 2EDHA 3BAEL 3ZZ1A 4P48A 3ALPA 5KOMC 4OF0A 4OFVA 1E4KA 1KCUH 1KJ2A 1W8NA 4UIMB 4JFOA 2R4RL 3CLEL 2RHEA 1QSFB 1N5AA 4Z0XB 4OFKA 1CU4L 4PV9B 3MV9A 1F8TH 2WWKT 4MVBD 2DQDL 3VRLE 1BGXL 2O61A 4RFOH 3SE8H 5KSUB 2UUDH 3I85A 5JXEC 3M1BB 3MRIB 4V1DE 4P2RE 1MPAH 4P4KC 4N9GA 1URLA 5GSRB 5D1ZC 3VD4A 3QZWB 4M1CD 3VXUA 1H5BC 4FNLH 2DLEA 4Y4HA 4N5UA 2NY6D 2CXKA 3U9PH 1X4YA 3UDWC 3MRDB 5J6GB 3WE6B 4OZGB 3RY6C 3T8XB 4Y8AA 4CMMA 1ZLUK 3FB6A 3O8XA 1HQRA 3STBA 9CGTA 2YBRA 5HHMB 4ODSL 1OW0A 3VA6A 2CD0A 2VZSA 4QHKI 2ARJQ 4X99A 3QZWG 1SY6H 3OR7A 2VLRE 2CGRH 2CH8A 1ADQA 1RIUH 3E6FB 1KJ3L 4IRSC 25C8H 4QCIB 1T04A 3FQUA 3UJIH 4L8SA 3ARGB 5GGUB 4KU1A 2EXYC 4NP4H 3BHBA 5I1KH 1OGAA 1XMWA 2H8PA 4P5MB 1M1SA 5TE4H 1WBZB 4NM4L 1KTDA 1IILE 2C7UA 1KPRA 4ETQA 2DKSA 3V0VA 4M48L 4GMSH 3WL9A 3H9SE 3LY6A 4GKOA 4QEGA 4ZPVA 3UAJD 5CEYB 1EUTA 3VRJB 1NAMA 5EO0A 2IGFL 3OJ2C 2FEDC 4P9ML 1IKFH 4Z7UA 2PXYD 3OAUH 3U4EB 5TF1L 4LVNB 1UACH 2EDLA 3MV8B 5C07B 5D4QA 1TJHH 5T33H 4LAQH 15C8L 1V7ML 1R3KB 3D69B 3V0WL 1HEZA 1NUNB 2Y36H 1FQ9C 2BNRA 3KPLB 1KGCE 5KVMC 3P77A 1JE6A 5ACLA 3EFFA 4QXUH 4Z7VF 5LAXA 2FYYB 2XWJB 1JNNH 1DANT 2BERA 1SQ2N 3GMQB 1F5WA 2H32B 1IFHH 4M7KH 1JZ2A 2WQ8A 2X9WA 1Y6KR 2HA1A 4XPHL 1FL6B 1JP5A 4OCXL 2RIKA 3C2AH 4OLXL 2AEWA 1R5WB 3EOBB 1OP5K 3PNWA 1TENA 1SHMA 3MJ7B 4J8RB 1MI5E 2WP3O 3UTOA 4OZIA 5AUMA 2VISB 4X6BA 3QEQD 1FL3A 1F45A 3OKYA 1RZIB 5BQ7B 3JV0A 5C08E 2G2RA 1PZ5B 3MNWB 3MR9A 3MJ9A 1OAYH 1JF1A 2AJUH 1QZ1A 3TVMB 2FNBA 4UOJA 3MRFA 1A47A 4YX2H 3FFDA 5EORH 3HB3D 4H20L 5T1MB 4HKJA 1Z9LA 2XQYG 2WZPD 4OQTH 1HSAA 1RUMH 2LTQC 3HAEA 5FUOH 3EYFB 5E9DB 5HDLA 2CR6A 1V3LA 4DUVA 3MLUL 4FMFA 4MDJA 2ADFH 3LCYA 4EUPG 2FX8L 1M7DA 5EZOL 2R39A 2DM7A 4PJFE 7FABL 4FQJL 5HVFB 4Y4FB 2H1PH 1XZ0A 4OUUA 1TJGH 4U1GB 3ZDXE 4X5LA 1YC7A 1LEGA 3WS6C 4C59B 4V1DA 4N90E 4P2RA 1BZ9B 1MLBB 1JZ4A 3OKOB 3DXAB 3QUMH 4KPHH 3TM6A 4H26A 3AY4C 3QFJE 3GHBL 3QDHA 4C83A 1NBZA 4WY7L 2AQ1A 1NUGA 3SDDD 1IGCH 4AENA 4K8RH 2NCMA 1KOAA 3ZMRA 3T3ME 1YQVH 1P1ZA 4WJ5A 1IL1B 4HPOH 2IQ9L 3SDXB 2JE8A 3MLSH 3CVHH 4KVCL 5MHSD 3ULVE 3OGCA 4KHXH 1F4YH 2MTPA 1DSFL 1YNLH 3GMMB 3L3HB 5HGAA 2OK0H 4LRNH 5T3ZD 1AGDA 4KZEL 4G7YL 1A7PH 2N1KA 3PQYA 4K94L 4PGBA 1C16A 3H0TB 5HYQA 3H9SA 3BFOA 4K23L 3MXVH 2AQ2A 2K1MA 4YC2B 1I85C 3P40A 1KEGH 3MLZH 2GJZB 4JB9L 1EHLL 4LLMB 4X7DC 1OD7A 4ERSL 5F70A 4S1DC 1FCGA 2ATKA 4LLYB 5D96B 4R96B 3ROLB 1LDPL 4Z7OE 3PWLB 1NC4B 4LGPB 3DUUB 1IQWH 4JDZB 5IGXL 2AJZA 3ZDYF 2KZWA 3ULUF 1YY8A 4GKNB 5IF0A 3S36X 1H3UA 2BVQA 4PR5B 3TVMC 2FJGB 2G75B 1U8PB 5EUKA 1MCNA 3QO1B 4LEOA 3PE9A 3QUZC 3GIZL 4HUNB 3RWGA 3P30L 2ZCHH 4F2MA 4YHOH 2Y5EA 4D9QE 1T6VN 1GGUA 4ZXBA 32C2B 3HG1A 2E6QA 5L0QB 3OR6B 2EXWD 1I9RH 3ULVH 1MI5A 4U1GC 3DMMA 4IHOA 3DX8A 4Y1AB 1J87A 2P48B 4I3SL 3CVHA 5J0BA 1JUFA 5C08A 3ARFC 3PGCB 5CJQL 1ZHNA 1GOGA 4KUZH 5MEOA 4NYLB 1FBIH 4MSWA 4FRWA 4P9HH 2L7UA 2CMRH 3C5ZA 3TT3H 5E4IA 3W39A 4DN3L 2B2XL 5IJKA 2X42A 4L5FH 4JPIA 4WV1A 1UH2A 4N0YL 5ISZB 4X9FA 5TE6L 4U7SA 4PUBH 3QIWD 5ITBL 5E2TL 2FO4B 5CLWA 4PJFA 3DETC 1UJ3C 1OT2A 1VFMA 4NQEE 4OD3L 3HMWL 4KI5E 3AS1A 4IDLA 2LE9A 3GB7B 2DQEL 2ZUUA 2P7TA 5D8JH 3FRPA 2DLHA 8CGTA 5D71H 2ZUVA 4AEIL 2VLRD 3QFJA 3DUSB 5D96C 5A2IH 3DVGB 4I4WB 4XNYL 3AREC 2AXJA 3P4OB 4HFUH 2PR4L 1CQKA 1O5DT 5DQ9B 2PW2A 4L9LC 2HTLC 4DUWA 2GJ6D 3QI9D 2SEBA 3TC9A 4U6HB 1ULVA 4JO3H 5T3XD 1MJ7H 3VGAB 2UYLA 4MD5A 2P24A 3ZE2F 4HH9A 2NXZB 4WU5B 3SGDH 3DX6B 1XR8A 1A7QL 3O81A 4GKZB 5HYSB 3QNXB 5L0QC 3VXME 4DN4L 2AI0H 4NNPL 4EDXA 3WFDL 2ESVB 3V8CA 4XI5C 3FTGB 2HP4A 5I1AB 2IANE 4LLQB 4MWFB 4JN1H 3PHQA 1S9VB 1T1WB 1GSMA 2Q1EA 1YPZE 1XR9A 3MRGA 5HHNB 2NY0B 2VDMH 3FQXA 2MCPH 4XNQB 4FABL 1QNZL 3QAZB 1NAKL 3TO4A 5FUCC 1RSFA 1TZGL 2A6IA 4JLRB 3MPCA 5FA4A 3EDDA 5T5FL 2GUOA 3TNMA 3FO9A 3MRCA 2MJWA 4UOW1 3I9GH 2RCSH 1PG7L 5DT1H 3LRGA 3V5HB 3VI3E 2HRLA 4ZS6C 1R3LB 5FUZH 3U4BL 2F9BT 4D0CA 1K3IA 1ODAA 2R0KH 4G8GB 1H8NA 4L4TB 4Y5YB 4O2FA 1AJ7L 1LO0L 1TJIH 2W91A 3B8YA 4XVTH 1MUJA 4UIKH 5C0AB 1JGUH 4G9FD 5E2VH 1P84K 4LLWB 1XF2B 4LSTH 5E6IC 3UTSE 1MFNA 5KG9A 5DEZA 4PJXF 5CD5C 1U8NB 3N85H 4KHTH 4K7PY 5F1IA 3OKEB 3QJHA 3KWWB 3QQ4A 3GMNB 5I1HL 2IH3B 5EU5A 3D85A 4UINH 1ZSDB 2Z31D 5IJVB 1G7IA 4LCYB 4I2XE 4F9LA 1I3GH 5MEPA 4RMVA 4J4PC 5GZNC 4KK8D 3QWOA 5DQJA 1TETL 2HG5A 4FQIL 4NBYB 1CFTA 5DHXB 4ZUTA 3C60A 2VLJE 4XBGA 1YEKL 2CUMA 1QFWH 5EOCL 4NQSB 3IFNH 5SWQB 3S97C 3EKCA 2CKBB 4U2YA 5I1GL 4NQEA 2DB8A 4Z7WF 5C0DB 5DO2C 3VFNA 1NGYA 2X09A 2VAAA 1AGBA 4YDLB 1ND0B 4TUKH 1MREH 5FYJD 4E41E 5GGQL 5EC2A 3SJVB 1FORL 3DLQR 4O51B 4X6DF 2D0HA 4HUKB 1A1NB 4ODHL 4YXLH 4OCWL 2NY5L 2DJSA 1UZ8A 4NGHH 2X05A 4NM8L 4OQ1A 4LSRL 2EH7H 4ZUSB 1YY9D 2D9QB 1JGLL 1L7TL 4MD4A 4KQ4H 1F3DH 2IC2A 1ACYL 5EFIA 5JNYB 2E27L 4BQ6A 2Z0BA 4U1KB 2X7LB 4EBQL 1BMGA 2HAZA 5ANME 3GMPB 4BQ9A 1ZK9A 3VXMA 5E99L 1EBAA 2P46B 2DTMH 4HW6A 1HXMB 3ILQC 1TNNA 4M43H 4YE4L 3GHEL 4HX1B 3VG9B 2IANA 3GKZA 2W92A 4PJ7E 1P7QB 5DEGB 1UQSA 3F7VB 5GGSA 4CAGA 4LSVL 5DUMH 1DN0A 1YPZA 5EOCJ 3FN0H 1W0WA 3KR3H 3N1QC 2FRGP 4NHUB 5JHDE 4LPTA 1GJIA 4XNZB 1J88A 3RRQA 3TH3T 4X80H 5B8CA 1U8LB 2PO6A 1U8IB 4W6WB 1T0NB 3HC3H 4L3EB 2ICEB 4G43A 2ATPB 4PGCA 4ODUB 3RQ3A 3QULB 5LCVL 3O6FD 5BMFH 3VFTA 1IKNA 4P3DB 5C0BB 1RZJL 5HI3D 4K7PX 1L4IA 1OCWH 4HFWB 4P0DA 4BZ1L 1KTRL 3VXRD 1HINH 2P44B 1BAFH 3JWDL 2CLRA 2HN7B 5F9OH 3TA3B 3LZFH 3ARVA 4OB5H 4OM0L 5HHOE 3QEGH 3UTSA 1A2YA 2AEIT 4KVNL 1A3QA 4RQQB 1WWBX 4XAWH 2IBZX 3BD3A 2P43B 3TJHC 5F96H 1Q0XL 3E3QE 2R2CA 1UB5B 1P2CA 4PYGA 1ZE3C 4Y2DC 4I2XA 3WV0A 3K0WA 4LNRB 1ORQA 1KEMH 1Q1JL 3ROOA 3O2DA 1L0QA 3IFLL 3KJ6H 1MOEA 4HJGB 1L7IL 1XGQA 2AXFB 3ECBB 4OSUH 2DI9A 4HS6A 2G9HB 5IG7A 3STLB 4LSUL 5GQBA 5IB2B 4HH8A 2VLJA 5C0ND 5I75C 3CGTA 4HIIB 3SDCD 4WVRA 4DKFL 1H3TA 2LU3A 4C55A 3WKML 4U4BA 2J5LB 3Q2CA 4XPGH 2D0GA 3I2CH 1NGXA 3E8UH 1YEEH 3WS3B 2VIRB 2XICA 1MWAA 1X5GA 1B4RA 3OG6B 3VG9C 2Z4QB 5EBGA 2H41A 4BFGA 2P5EB 3GO1H 4E41A 5I18L 4KV5F 3LS4L 4H8WC 1TVHB 2ZCKH 1KACB 4M1GL 1NGQH 3PDDA 1EMTH 2APTA 3LMJL 4XNZC 4GRWF 2BVEA 1Z0MA 4PTTA 3PL6A 3QDJE 3NCYS 3QEHA 3WN5C 3ULUC 4JQXA 4NQVB 5DMKB 1X5FA 1PVHA 1NGPL 4NQXB 2NX5B 1FFPA 3SGKC 4QHNB 5E0QA 1NEUA 1FNSH 1EDQA 5ID0B 3FO2A 4KAQH 2Y07H 2VWEE 5EULV 1WF5A 2VXSL 4LEXL 5I9QC 3EYSH 4I0PD 5I8OH 2V7NA 4TN9A 3L5WB 5ANMA 2EDDA 1MJUL 5K9KA 1I4FB 4XBPB 4JFHD 3P0YH 4G9DA 4AIZB 3TZVA 4Y4KC 3V6ZA 3ARPA 4F9PA 4PJ7A 5AZEH 1CIUA 1BQHA 5H35B 1LK3H 3VA2C 1FN4B 2AEQH 1YZZA 1RPQA 1QYGH 5DRNB 2I9LB 3EJJX 5JHDA 2H26B 3MNZA 4WW1A 3TN0A 3V7AG 4Z76A 1X5YA 2NY3D 2OR7A 3H9HA 3HC4L 2AJXL 5LVEA 1WIUA 5J13B 4YGVB 2WV3A 4G6AD 4PJGF 5KSAD 5GXBB 5GS0D 4PLKC 4UUJB 1QLRA 3WIFB 2X4QB 4KDWA 3GSNB 4K7PH 5IV2B 2W07A 4GUPB 4M7JH 2BOCB 4U49A 3VG0H 1CFNB 1CTOA 3U7WL 3LKRA 2ADGB 1GGCL 2DQTH 1E27B 1PD6A 1D5MB 5HHOA 5HJ3B 1AO7B 2BDNL 5GRVK 4RA3A 3D2UD 1IC1A 2BSSA 3QXTA 5JW5B 4WNQB 4IS6A 3UXFA 4F57L 3HE6C 4PJXB 4XC3L 4MAUH 2OJEB 4R4FL 3A67L 2CRYA 4NO0A 5DRWA 5EU3B 4TULH 4G6MH 1J0IA 5I19L 4YR6A 5CMAB 4YJZL 3WLWD 2HVJA 1OF2A 2YD3A 1RZ7L 4YK4B 5CP3A 3G5VB 4ONFH 4B5EA 1P9MA 3S37X 3WHXB 4PRID 2XI9A 4YFLI 1UH3A 2B4CC 2YD1A 1DP0A 2HFGL 4XPBH 3HE7A 1RZGA 1PKOA 3WJLC 5DEFB 2BVUA 3T0EB 4EIGB 4YHML 2Q7YA 1B3JA 3NIFE 3S35L 5IB1A 3UTQA 1B90A 3RWEA 4Z7WB 1TCRA 4G5ZL 4PP2A 1KXTB 1I9EA 4ETYA 3SOBH 3O3BA 1FPTL 2GT9A 4YPJA 4X6EA 3KPQA 2Q8AH 5JLZA 1W2KT 3HS0A 5KVEH 1I1AB 1ZGLA 4PJEE 4CN6A 1AIFB 1BZ7B 4X6DB 3EYUL 4TNWK 1R6VA 4LLVB 3RIFK 1FZMA 3KYKL 3QDJA 1GCFA 3ARSA 3IJSB 4AQOA 1FL5A 3TYFB 2EDXA 1CK0L 1FGNL 3LV3B 3VXSD 2X70B 3IAPA 1GGIL 4EIZC 4YIQA 5BVJB 4X98A 3LKNA 3SGDI 1FE8L 1XGUB 2X4TA 4RWYH 1G1CA 4P59L 1N64H 1W72L 3LSOA 2QQLH 4NUJB 1IC7H 3WJJC 5LWYL 2XY1A 5TDPB 1EAPA 1UKTA 1OB1B 3NCCB 4EN3B 2NYYD 1VPOH 1UB6A 4F7EA 4QT5B 3B9KD 2EDQA 4OZFG 1FHGA 2X9XA 2R2EA 4P5TB 1AE6H 5B4MD 4JRXD 4AH2A 1X4ZA 3RVXC 6FABL 1A0QH 3O4LB 4UQ2B 4UQ3A 4NQCE 1JFQL 4JZJC 3OX8B 1ZHBA 1YEJL 2XKNA 1HI6B 5FOBB 1KCVL 3X17A 2UUDK 4RMQA 3NFPB 3BKCH 4ZUVB 3GSQA 2C3XA 2AKRA 2DD8H 4NQDB 2BNQE 2BSED 3C6LB 1T1XA 4FQXA 3BZ4B 4LLUA 5F97E 3E6HB 3BEVB 4LU5L 5BO1L 2O5XH 4RSVA 2PUQT 3BPOB 5C92A 1XGRB 1G7MA 4FZEL 2VXUH 4W4OC 3GRWH 3WUWB 1JYVA 5D7SL 4IMLA 4LF3B 1CFBA 2R2HA 5D70L 1S9XA 3OJVC 4BSJA 4MQTB 2CIKB 3KYMB 1RJZA 1ZWIA 3PDOA 3G6DL 2GK2A 1F4AA 3V4VH 1JI1A 1AR1C 4EEEA 3QCVL 3OXSA 4HSQA 3B2VH 3QA3B 4YLQT 3WUWG 4OLZH 1DQML 3O6KH 5I1DA 2YMXH 4Y16C 4R4BB 4U3XA 1I1AC 1JK8B 3GSUA 5JPMB 3MRPB 2O5ZL 2BRRL 2XNAA 2GSGA 4AM0B 5IW6A 4OKVA 5TF0A 2LU7A 1C5BH 4XH2B 1FYTB 3BWAA 1RZKH 4YHKH 3DURA 3OKLB 5DTFA 3WNKA 4GRMA 2CLZB 2JB5L 2WBJB 4WDIA 4Y5VA 5IBUG 2HH0L 4HMCA 2HLAB 3MRJB 1MFAH 1CDJA 3PWJB 3EJYD 4JVWA 4ZD3L 4F58H 1Q9KB 5F8QC 4PJCF 3AM8A 5DJ2A 1PKQE 3L3KA 4HK0B 4HWEH 3QHTC 3HC0A 4PJAE 4P57A 2WWMC 2E5EA 1NMAL 3OAYK 3RL2A 1MHHB 5IBLC 3O6LL 3A6OA 3KVQA 1CFSB 1QRNE 1DDHB 3SQOH 4GRWB 4Q9CA 4P3WA 5J1SC 5ICZB 5CIPH 1LK2B 2QL1A 1J8HD 3GRWA 5EU4B 4FFVC 4LK4A 4W81A 3BKJH 3FQWB 1QQDB 5EBWB 3JWOH 5CFHA 4X7TB 1BJ1J 3D3VD 1IC5L 3CSGA 2R1WA 1NLBH 4P3CL 5C6TL 5BV7H 3P9LB 3PWVB 3C6LC 5F88B 3PV6B 2YZ1A 2VDNL 1JPSL 4KY1H 1VADA 2NLJB 1JPTH 3NAAH 3RIAF 3BPOC 1BBJA 5B39G 3HPLB 5DJXA 3TWCL 3ZE0E 4BFBD 4Q6IA 5A2LH 4MNHB 2R8SH 5F7EH 4F7TA 2GFBA 2JK5B 3RDTD 5FM8A 1A5FL 2F53D 4NKOB 3G5XA 4LMQE 1QG3A 3UTPE 4YBQD 5C0EA 5IM7A 1BD2B 1ACZA 2A6DA 4NQCA 3NCYP 2XOTA 4KH2A 4HV8B 2ARJA 4UV4L 3BP7B 2Z8RA 4ODXA 1KCSH 1NDMB 4APQA 2QSQA 4C4KT 5E8NB 3I3BA 1PLGH 1CZ8H 2GSIB 4PJGB 4JGMA 1WZKA 3O9WA 1ED3A 1FGVL 2BNQA 5FYKD 5J11C 1U3HD 3WFEH 1MFDH 5BW7C 3KPMA 5GS2H 2DLFL 1WAAF 5CSZA 1JHKH 2GW5A 2LV4A 2UVFA 2WLYA 4KTEL 2WBJC 2QQKH 4X5XB 4IIQB 2RAMA 4M7LH 1KJVA 2C5DC 5HBBA 1FFRA 3D39B 3DSNA 5E2WL 2R9HC 1AXSB 2F5BH 1KENL 1WT5A 3FOLA 5CIPA 3K3QA 5FECA 5D6CB 4YHLH 1QBBA 1LO4H 3PWUB 4D9RD 3LHPH 4PBXA 4R4NC 3RGVD 1Q0YL 2QQQA 2B1HL 2GHWB 3CFDA 4DCQB 4G8EB 4FFWC 4S0TD 5FCUH 3QUYA 4ZYKB 3BGFB 3L3OB 5IKCA 4Q6YA 3M45A 4EVNA 1EO8L 1T20B 5DD5H 1NCUA 2GCYB 1D6EA 3GMRA 2DMCA 4QWWC 5CBAA 2ZSWB 1JRHH 3HNVL 3O6ML 3Q6GH 1B4JH 1A6WL 2XWBB 3EUUA 4ZOEA 1F4WL 1WEJL 1NMCC 5D7LE 4RIRA 1U8KA 4JO4H 4KRMB 2XRAH 1OSZB 2XQYK 1J12A 1P4IL 1KXVC 3OPZH 4K2UL 3RUGF 4RA0C 4HC1H 4LVHB 5D6DC 2QADC 2HRPL 4X4XA 2QKIA 1PKQA 2Y7QA 3KYNA 1EEZA 4GSDH 4QHMA 4UOW0 5FHAH 4MJ5B 5EZLB 3LQZB 4GBXB 3IDMA 3JV4B 3TH4T 3ALXA 3ARRA 3QUKA 4G8IA 4KRNA 2CK0H 4XWOC 3GI9H 3NCFB 1U2HA 1QRNA 4MA8L 1WBXA 2I27N 4DGYL 5E95B 2ED8A 2DYPA 4X5WB 3INUL 4F3FB 4MXQC 3EGSA 4NO2A 4WFGE 1FNEA 1MCRA 3RWJA 4Z8FL 5DD6B 1EXUB 1ETZB 5TQ0L 3UYPA 3EAKA 4NFBA 2K7QA 3FAWA 4LBEA 3BRDA 2HMID 4P5KB 4DOHE 5L2JB 4WEUD 1SEBB 4PRBB 1QSEB 3FQRB 2QHRL 1A4KB 1HH6A 5CINH 2COQA 1I9JH 2CUHA 1YEGL 1CFVL 1AQDA 3U1SL 1KC5L 1DJSA 2HWZH 2DL9A 3ZTNL 5GGTH 2OTPA 4IIQC 2X4NA 5B3JE 5DVLA 5CZXC 4HXAL 3RTQC 4I77L 4R2GB 2ENYA 4HGKC 1KLGB 2I24N 1GZQA 3AS2A 4PY8I 5IMKB 5EU6D 2Q86B 3CZFB 4M5YH 1T66C 4J23A 4NZDA 1KCLA 5CBEA 1ZAGA 1N2RA 4Z7NE 1QSFE 4GW5B 3EHBD 1FDLH 4WO4C 2CDGB 5ESAB 5I30H 3BGFC 4MQXC 4ISVB 1M7IB 2ZOLB 2EZ0D 3P4MB 4JFEE 1NJ9A 3CSYA 4Z5RB 1ZVSA 3G5ZA 2ZJSL 5C9JA 1KB9K 3MRRA 2XZCL 1YNTA 2VKWA 3MGTB 4OKDA 3NPSB 4XRCB 1AXTL 2R4RH 3CLEH 2VTFA 5FYLD 1U9KA 4OZGE 1CU4H 2O93L 1R3HB 5CGYC 4LL9A 2DQDH 5HHME 2IALB 1BGXH 1BVKB 4K3JL 1BX2A 2FLRT 1KN4L 3UBXB 2HT3C 4YHPB 2D7TH 5L8LB 4JFPA 4XXDB 5A2KH 2W9DL 4TNVF 1T7YA 4F80A 4LSQL 5GISL 3RL1B 2J88L 3EDEA 1CBVL 3A6BH 3WMSA 3UBXG 5JXEA 3VD9A 3NFNB 2XQBL 4P4KA 4ODSH 5D1ZA 2YPVL 5J7CC 3QFDA 5F89B 1X6NA 1OD9A 1WTLA 3CPLB 5D7LA 1H5BA 4IOFC 1I3RB 2DLIA 3TP4A 1KJ3H 3HZKA 3UDWA 1DQLL 3X13B 3RY6A 3DYMA 5DZNA 5E5MB 4PJ9B 1BOYA 5CD3A 1ZHLB 4NM4H 1HN1A 4ONHB 5KTEL 1VACA 4PJCB 4M48H 4KMLB 4IRSA 2EEAA 3KNBA 3V7MA 4R2GC 4KJPC 5I0DA 2CLVA 3IVKA 2L7JA 3MRNA 3WFHB 4C57C 1FH5L 2IGFH 5FKAB 1F11B 4JQVC 4P4RB 1RAMA 4P9MH 3UYRL 5F9WB 1CCZA 1XIWD 2H2SD 1X9QA 4J1UA 2BHZA 4BQBA 4ZDHA 2OM5A 1JL8A 3IT8D 5AAMA 5C2UB 4CNIA 1V7MH 1RJYA 3V0WH 5F1OB 4U1SA 1Z2KA 2OI9C 3S96A 5KOVC 4K3GA 3OJDB 3FT3B 1UXWB 3FL7A 2VXQL 4NN5C 4O4YL 4DW2L 4KRPB 1OTSC 2DTSA 1CGTA 4XPHH 5BJTA 4OCXH 4OLXH 1DVFB 4UV7L 5JZ7C 3V52H 3NPZB 1ZT4B 5J57B 4U6VL 3PGDB 4HMDA 2AVGA 3PXJA 1OLZA 4HBCL 4Y88A 2Z8SA 4P2QD 2DQUL 3P0GB 1S3KL 5E9DE 2OL3H 4IMKC 5FAAA 5A2FA 1KG0B 5IUSA 3N50A 1G9ML 1SJEA 4JFEA 3RWIA 4BUHA 5KSUA 5SX5K 3RPKA 4GAFB 4X7EC 3M1BA 2XN9D 3MRIA 4OGXH 3NIDF 3T2OA 4POUB 5J3HC 4H20H 1S9WB 2H32H 4L1HA 1OTTC 4GO6B 3B5GA 3MRDA 3MLUH 4PJ8D 2Z91B 2FX8H 5EZOH 4XZUB 3W0WD 7FABH 4FQJH 3NBNA 1MCQA 5EPMB 3QXDB 3T3PF 4R0LB 4A2MA 3IGAB 4PJ9C 1A6PA 4XCNA 2YK1L 1G9NL 3SDXE 4QXGL 1UWXH 3QT2A 5MI0B 2FWOB 5JO5B 1P7KB 5DF0A 4ESKA 5TFSL 3MGOB 5GGUA 1A9EB 2A6KA 4M6OL 1JWUB 3IFOB 2BY0A 4P5MA 3DVFA 3GHBH 5C0JB 4WY7H 2EIZB 3TFKD 5JORB 5E70A 3U83A 1D5XB 2X2YA 1XF3B 5GRYA 1C5CH 5CEYA 4BK5A 1E4XL 4XMLL 2IQ9H 4KVCH 3WFCL 3AY4A 4G6KL 1IAII 1L0YA 1DSFH 3RUGB 1X6LA 4KZEH 2OL3A 2RFXA 4PJ5D 3MLPA 4G7YH 1LMKA 1XF1A 4R7NB 5I74C 1MCPL 3ZTJH 2JCCF 1R3KA 3JUZA 4M5ZL 1MFCL 3KPLA 4QRRD 2AABL 2OTUB 4N5ED 1LP9F 2FYYA 2XWJA 5C0GA 3GDBA 3GMQA 3LN9A 5DHVB 2H32A 1TFHA 4ZSOB 2BSRB 2R0LL 3ZKMC 4WENB 1FL6A 1I85A 5IGXH 4AQ1B 1NANH 1R5WA 5HGBA 3EOBA 5CJXA 2WIMA 1SYSB 2X1PA 2I07A 3MJ7A 3WNMA 4J8RA 1FO0B 4Y1AE 4FHBD 3TNNA 1BVLB 4K3HA 3AUVA 3KYAA 1RZIA 5BQ7A 3HPJB 1INDL 2YPLD 1G6RB 2APWA 1PZ5A 3GUTA 1IAKA 5FUCE 2VXTL 4JO1L 2Q76B 4MJ6B 2NY6B 4UNVA 3TVMA 1L6ZA 1QSFD 3BVNA 3QUZA 4DGVL 1I1FA 3QRGH 4R0LC 4BQ8A 5T1MA 4O02H 2AK4A 4I3SH 1FNGB 1UT9A 2BVOB 5F1KC 2DQHH 3EYFA 5E9DA 5ISZE 4LCWE 1N3NA 4IOIB 1NDGB 4XNMB 2I9TB 1HQ4B 3VDBA 5CJQH 2R1YB 5EIQA 4XNUL 3K1KC 3V8OA 1EIBA 5L7XL 1HCVA 3FT2B 3QG7L 1PDKA 3EOAB 2EYTB 2R15A 1JGEA 2NY1C 5GS1B 3ZL4L 4DN3H 2B2XH 1MLBA 3OKOA 5JXAL 3VD5A 3L6FB 4YWGH 3ARFA 3BSZH 4KWUA 4UU9B 3RVVC 1JYXA 4HHAB 4I0KA 5TE6H 2PYFB 4WI4A 4AIOA 1KIRB 3ARUA 5ITBH 2PXYB 4XP9L 1T4KB 5E2TH 4LKCA 1HNGA 4I18B 1IGFL 4NQTA 4JKKA 2OR9L 3ARGD 3QSKB 4R97B 5DK3A 3MXWL 5ETUB 5IB4B 3BRFA 2JJUA 3SDXA 4GG6E 4OD3H 2OYPA 1S78D 1GAFL 5DMGC 4P46D 3T77B 2EC9T 3CFEB 4C56D 3L3HA 3GMMA 2DQEH 3UC0L 2APBA 4XBEL 1UJ3A 4AEIH 3REVB 3RWHA 3I6GA 5CEZE 4ZO7A 5KVGL 4XNYH 4LMQI 3H0TA 1N6QL 1G7QB 4P99A 1HIML 5JQHC 3BT2L 3CDGB 4FG6D 2ESVE 2PR4H 3ZKXB 4MVBC 4X7FC 3MV8D 2GJZA 5C07D 5JQ6H 4XP5L 4LLMA 4K8RD 1JHTB 1AC0A 2YN3A 3SGEI 4LLYA 4FOMA 5F1NB 4R96A 5EO1B 1MF2L 3ROLA 5C86A 3AREA 3PWLA 4JN2A 1ZLSH 1LE9A 4EXKA 1NC4A 4MLIA 3MUZ1 4MJIE 3DUUA 4JDZA 4M1CC 5K9JH 1WIOA 4KGJA 5C7XL 4JHAH 1A7QH 4L9LA 1HHKB 3UTTD 5HHQB 2NY6C 3O3EB 3BRGC 4MCZB 2YHGA 4DN4H 1KNOB 2FJGA 4OT1H 2G75A 3WFDH 4OGAD 3QO1A 3BMWA 5LGJB 4M4PA 4KK9D 4X9IA 4ALAL 3LIZH 3S4SG 3U82B 4Z7VE 2R23B 1A6UL 4FQQB 3U30B 1OSPL 4G8GE 3WIHL 4FABH 3NZ8B 4L4TE 1QNZH 1NAKH 4N0FB 4JANB 1N0XH 2ZUWA 4M6ML 3FMGH 2BVTA 1I7ZB 5C0AE 5DUPL 5T5FH 5F9JA 1CDHA 4Y1AA 2FBJL 3SEPA 3CK0L 1PG7H 3IAGC 3L5XL 2Q7NA 1QHPA 2OXGA 1U41A 3L9RB 4H0IA 3UAJC 1IM3B 1KCRL 3PGCA 3G6AB 3SBWC 4E0RB 1EUUA 1KJ2L 1X5IA 1Q38A 5HD8D 1TDQA 4EOWH 3UZVB 1AJ7H 1LO0H 4BFEA 1UWGL 2PXYC 5F3HA 5C6WH 3SDDB 1GH7A 4MAYB 4DKEL 3TIEA 4R97C 4Y4FD 5ID1B 2JTDA 4NO3B 5HHVL 5ISZA 4LCWA 2FGZA 4PJIF 3BUYA 5I1HH 1KT2B 2APXA 2FO4A 1KBGL 3F5WB 3DXAD 5IFAH 1DQTA 5JW4M 3NA4A 1U93B 1CVRA 3MLTB 4U0QB 1CGSL 2OBGA 4I9WD 1QKZL 1VKXA 2Q6WB 3ZKXC 3E2HB 3GB7A 4JDVB 1TZIB 1TETH 3MBXL 2CO7B 1AD0B 1ADQL 3DUSA 3SJVE 2N56A 4Q74A 1A6TA 1YEKH 5DZLA 2EEBA 5EOCH 3P4OA 2CO6B 4J4PA 3O11A 5DQ9A 4GG6A 2XTJD 2MKWA 3FB7B 1MAML 4H25B 1E4KC 2D7NA 3IDYB 4U6HA 4XT1C 1K4DA 5EO9B 1CLYH 4U7KA 4S0SD 4NQUA 4U05A 2C4FU 5DS8A 3HB3C 4Y19D 4JRYD 1NAML 2CSPA 3DX6A 5TPWL 3U9UB 5DFTA 1FORH 5ITFB 4ODHH 5HYSA 3QNXA 4OCWH 4U6TA 5JW4R 2ESVA 4KROD 1LEKB 1MIMH 1RI8A 4C54A 3UPRB 4KK5D 4MWFA 4NM8H 4LSRH 1F8TL 1S9VA 3NA9L 5KSBF 4TRPL 2V2WB 4AEEA 1L7TH 4QHUB 4XC1H 3SE8L 1ACYH 3GJFB 4XNQA 5L8JB 5C0CD 3O8XC 4MJIA 2YWZA 3BOVA 2M8XA 3ZDYE 4FMKA 4L3EE 3ULUE 4FNLL 5E99H 2JCCB 4OIIL 1U8QB 5DMIH 3U9PL 3GHEH 1QOKA 2ZG3A 4WTXA 3V5HA 5C0BE 1R3LA 1LP9B 5EC1A 5K9OB 4LSVH 5IW1B 1DLFL 4Z7VA 5J89A 3H8NA 3O2WL 4G8GA 5J4MA 2Z93B 4L4TA 3D5OF 4RMUA 4OFIA 3FT4B 3MJ9L 3L3JA 5C0AA 2BOBB 5MENA 3PABB 5C70A 3IETB 1OVZA 4YO0B 2HLFD 1U8NA 1VFBB 5EDXA 5LCVH 3OKEA 2OTWB 4S1QL 3QCTL 2Y5TA 3GMNA 1RZJH 4KRLB 3E2HC 1ZSDA 4BZ1H 3RY4A 5IJVA 3KXFB 2NW3B 1OQXA 2F54B 3TLRA 3JWDH 2GI7A 1IKFL 4MB3A 4YDVB 5KVFL 3OAUL 3T4YB 4H8WH 4OM0H 5ESQA 4KVNH 2FIKB 4OAWB 2GJ6B 5T33L 4I3RL 3QI9B 3N1FC 2VDLH 2BK8A 4NFDA 2HKFH 4POZD 2R0ZL 4DGIL 1Q0XH 1T7WA 4NQSA 3U0TB 2CKBA 4QXUL 4X4MA 3MOAL 1Q1JH 1J1PH 5C0DA 3IFLH 1ORSB 3VGDA 2EXWC 1ND0A 1BOGB 4NZJA 5F7LB 4LDLB 2P5EE 1Q8MA 2GKIA 2JJWA 2YD4A 3BN3B 4Y2DA 3SJVA 2EIBA 3VCLB 4O51A 1FJ1B 4F8QA 5AWNL 3ZYZA 3LEXB 1FAKT 2NXZD 1SJXA 4ZUSA 1OAYL 1AH1A 3QUXB 1QFUH 5ERWB 2NX5E 3HFMH 4RBPK 3CXHK 5T1KB 4RWHA 3QR2A 4JJHA 3HLAB 5I18H 3LS4H 5I1CL 5D1QD 2V9TA 4M1GH 4Z0BL 3ZE2E 2X7LA 1UYWH 5E56A 3BQUD 2E8ZA 3GMPA 3LMJH 5FUOL 3QB7C 4W6XB 3QIWC 4HX1A 5DEGA 4G9FB 3F7VA 4PRHE 1D5BB 1XH3B 1NGPH 2A73B 4YXKH 5DLML 1NGZB 4NHUA 3TCLB 1G0YR 3U79A 2X4SB 3O45B 1I9IL 2VXSH 4LEXH 2FZ3B 3BPLC 3C2SA 1U8LA 1T5XA 2Z31B 1U8IA 4L3EA 4XB7A 1MJUH 4DVBB 2IPKB 2ATPA 4BFIB 3QULA 3SGKA 4D9LL 4P3DA 3MV7B 1T7XA 5C0BA 2VKXA 4WWKD 3P11L 1U95B 1OGTB 3HCVA 1QA9B 1XCTB 1YQVL 3ZT5A 4HFWA 3EO1B 4RMWA 3QI9C 2I60H 3KPNA 3CVHL 2HN7A 4OBRA 4MNGE 4Y4KA 1NANI 4M9OA 3ARDB 5T1LA 2OK0L 4LP5A 2B4CH 2AJXH 1N4XL 2XWTB 4JZNB 4P23D 5I0ZA 4PJXE 2GTZB 1QSVA 3ZKND 3MXVL 4BZ2L 4Z95H 2ZSVB 3DX7B 1UB5A 4LHUG 3MLZL 1FFNB 1H3VA 5IIEB 4F7PB 3HR5B 4LNRA 4M3KB 3O3UN 4AYFA 1GGCH 2MQCA 4YXHH 4HJGA 2AXFA 2FHCA 3ECBA 3CU7A 2G9HA 5GRZA 4HJ0D 4F57H 5IB2A 2EDWA 5CKAA 4ZXBC 4XNXL 4XC3H 5F3BB 4PJIB 4HF5H 4R4FH 1RQ5A 4HIIA 1HHIB 2PYEB 4UMGA 3OB0H 4QYOB 2YPKB 1KPVB 4ZTOH 2FJFB 1FLRL 4Q0XL 3DMMC 4OCNC 5I19H 2WANA 3HE6A 4LOUD 4Z7WE 1RZ7H 4JG1L 4XHQA 3L7EA 2Z4QA 2P5EA 5I1LB 2J2ZA 3V0AC 4EXPX 5EN2A 1TVDA 3MYJB 1ZVHA 2HFGH 3PJSB 3T1FB 2EE2A 2VZOA 4X6DE 1RURL 3GJEB 3U46B 2VXVL 5J9PB 4YHMH 1YEIL 4WI9A 4AIXA 4M61B 4NQVA 4G5ZH 4DEPC 4NQXA 2NX5A 2EC8A 4QHNA 3O6FB 3JV6B 4P2OD 2D03L 1QR4A 1FPTH 2VDOH 4KK8C 3WJLA 4FFYH 3PWPE 1P7QD 2ICWB 4L5FL 3L5WA 1I4FA 3WNPA 4XBPA 5GIRB 4X9GA 2AJ3A 3EYUH 2Y06H 5CKGA 2X40A 3GSVB 3VWJD 3KYKH 5FHBL 4N8CL 5H94B 5DHYB 1BJMA 4NDMB 3S7GA 4PRHA 5H35A 1FN4A 5KSBB 3VGGA 1CK0H 1FGNH 3HRPA 2I9LA 4B0MM 5DJYA 4HLZG 1MLCB 1YC8A 1GGIH 4JE4B 1NKRA 2H45A 5EZJB 3O4LE 5SWSD 4HJJL 3LEVL 2E6JA 4P59H 1W72H 4PBVC 4U1NA 5D71L 5LWYH 5FGCB 4OFYD 4UT6L 4JFDB 4YGVA 4OCLC 3ZDZF 4I5BB 3TA3D 2W0LA 2Z92B 4HFUL 3RVUD 4JKPL 3WIFA 1QPXA 2X4QA 3C8DA 4NQDE 3GSNA 1YY9C 5C09B 4GUPA 2BOCA 1CFNA 3WJJA 4MNGA 1NEZB 1JFQH 1WCBA 1XCQB 3L3DB 1E27A 3SDCB 3ZYJA 3ZSTA 1D5MA 5HJ3A 1KCVH 3DTXB 5JW5A 2PETA 5L2KE 5HPMA 4YHZL 1S5IH 3C6SB 4JRWA 4PJXA 3TBSA 2A6JB 1EEUA 2OJEA 4XWGL 3TO4C 4JZJA 3DGCR 3ILPA 3VI4E 5IVNA 5E24E 4LU5H 5BO1H 4JN1L 3VGFA 3MLVL 2NNAB 4FZEH 5D7SH 2VDML 3K4DA 4JHWH 5D70H 4RGND 3G5VA 3HHRB 5ALBH 1K85A 1S7TB 3E1F1 4GT7A 5J1AA 3G6DH 5I1EL 2IAMD 3QCVH 4W4OA 4OD2B 3WO3B 3S36L 3I9GL 3OF6A 5HI3C 5IQ9B 5DC4B 1UZ6F 1BJ1H 2J6EA 4NC2B 4K3DL 3S34H 1C8PA 4I0PB 4AEHL 2O5ZH 4XGZB 4WFHD 2OP4L 5D7JB 1F2QA 2R0KL 3BXNB 5J56B 1PJ9A 3B2UD 5IROC 4UAOB 4YNYA 4M7LT 4XVTL 4UIKL 1JGUL 5E2VL 1I1AA 4KV5E 4LSTL 2V17L 1BZ7A 4X6DA 4DAGL 4KHTL 2JB5H 4F9LC 3Q6FA 8FABA 2HH0H 4LLVA 1E4WL 2M1KA 3V4UH 1B6DA 4GRWE 5DJDB 3IJSA 2EYSB 4GFTB 3CH8A 2UZIL 4UINL 4JFXB 2WINB 3QPQD 4QRSA 3C60C 5FKPB 4BH7B 3LV3A 5KSAB 3LS5H 2FATL 5BVJA 1A6VL 1F97A 1EJ6A 2ZWLT 3PWPA 4QNPF 1MCKA 1XGUA 1CGUA 5TJWK 3CFIC 4WWID 5I71B 3BP4B 1NMAH 5JOPD 4NUJA 3O6LH 1DQJB 2JF1A 1OL0A 5C8JA 5TDPA 1RY7B 1OB1A 1YEFH 5ESVB 3D0LA 1WK0A 3AS3A 4CL7A 4CVZB 3K8KA 2MHAA 4QT5A 1MY7A 1N6UA 1ZT7B 3D2UB 3IFNL 4EI5D 2MQ3A 3N9GL 3O2VL 3RA7L 3O3AB 3UEZA 4KKCD 3EZ8A 1BD2E 4P3CH 5C6TH 3O4LA 4UQ2A 3BJLA 2QR0B 3OX8A 2VDNH 1JPSH 1HI6A 5FOBA 3TWCH 2YEZA 2FSEB 1LO5B 1JYNA 4ZUVA 4PJGE 2X1WL 2C3VB 4NQDA 1A5FH 3C6LA 1AO7D 4HWNA 1DN2A 1WWWX 4R6UA 3BZ4A 2NTFB 3E6HA 1R3JB 4I3GA 3RJDA 1IGYB 1XGRA 2EYRB 3BDBA 4OLYL 3FQTA 3LOWA 4H0GA 4LF3A 4UV4H 5I66A 4QRUB 4I0PC 1VENA 1ZEAL 3D39E 2NXYD 2IFGA 5L2KA 5SWZD 4DTGL 3KYMA 2OZ4H 1JZ3A 4M00A 3O2DL 3WO4C 1CDUA 3HNTL 2DQFB 1G6VK 3BP6A 1FGVH 4ODVL 1T2XA 4D0DA 4UAOC 4WEMB 1UGNA 5B21A 1JVKA 2DLFH 3HZMB 4R4BA 3F7QA 3P2TA 5JPMA 3MRPA 1V8HA 4PRDA 3HZVB 4AM0A 3RWCB 1P6FA 1T1YA 3OL2A 4FN0A 2EE3A 5E2WH 2WM0A 3T04D 3T0ED 1Q9OA 5BW7A 2NY3C 1KENH 1B2WL 1I3VA 3WXVH 3HC3L 4WUUD 1MWAL 4G6AC 5KSAC 4GLRH 2CLZA 3CXDL 3HNSL 5GS0C 5JR1L 5D1XD 3RIAK 2DOCA 2WBJA 3VXOB 1Q0YH 2I25N 2R56H 3Q3GB 4PGEB 3P4NB 4U33A 1ZGLP 1EVTC 1W0VB 5I71C 3MRJA 3I50L 1M7XA 1OCWL 3PWJA 1Q9KA 1EO8H 1HINL 5F9OL 1U8JB 4RMTA 2EECA 4PBWD 2HT2C 4Z18A 3F7YA 3BDXA 3O6MH 3B9KB 1A6WH 1WEJH 3LQAC 1MHHA 4JRXB 4ZAKB 1P4IH 1CFSA 4O9HL 1DDHA 1U91A 4K2UH 4F8TA 2DDQH 1LK2A 5HYIA 5EU4A 4ODTH 3FB8B 1BF2A 1FG2B 5F96L 4LCCC 3CCHA 1QQDA 3V95A 5EBWA 3WLWC 2NR6D 4X7TA 1V5JA 5J6HB 2OZ4A 5T1DL 3DYPA 1Q72H 3P9LA 1MHCB 1II4E 4EN3D 3KJ6L 1HH9B 1JGDB 5F88A 3PV6A 3OB8A 5F21B 2NLJA 2W0KA 5D6DA 4P5TD 4MA8H 2MKLC 1S7XA 4MNHA 3BKML 5KAQF 3O3DB 1Q94B 2JK5A 2VITB 5BS0D 4KTDL 1TCMA 1TNMA 4CU7A 4NKOA 4Z8FH 2P1YA 4OIAA 2N4IA 4JGJA 3KHQA 1BD2A 1I1CA 2YKLL 3I2CL 2VQUA 3MRHB 2OLDA 3ARBD 4HV8A 3PL6C 1F6AB 2QHRH 3BP7A 1MHEB 1NDMA 4UDUB 4FTVE 2YOCA 4NKDA 1CFVH 3U1SH 1KC5H 3ZTNH 3DV6A 4IDJH 4LPVA 5E8NA 4PJGA 1TTUA 1NGQL 4M8QB 1EMTL 2H3NB 4YHYB 3QNYB 1JYWA 4HKXB 4HXAH 3EYQD 4I77H 2KL6A 4CVXB 1E28A 4LPCA 3ZLQC 3DO7B 4HUVB 4PRPE 1KELL 4G3YL 4IIQA 4X5XA 5LG1A 4F9PC 4UNTA 3RTQA 1MFBL 4XMKL 1NFKA 4YHNB 1DQQB 2K7PA 5D6CA 3SDAD 5HHXL 1UM5H 3PWUA 3DVNA 2NYYC 1TMCB 4RMRA 3RWDB 1ONQB 2ZJSH 4G8EA 4WO4A 2XZCH 4ORGA 1XGTA 1FYTD 1LK3L 2X6MA 3IFPB 4L8CB 1N59A 1TVBB 1AXTH 3S3JA 2A9NL 2VJXA 5GS2D 1T20A 1J8HB 2ZSWA 1NFIB 4L29A 1I1YA 1HE7A 4K3JH 3VDAA 1UFUA 1C1EL 5E8EB 1KN4H 4QF1B 3D3VB 3BO8B 3BZDA 5ICXB 5J12C 4Z9KB 1N6VA 3SKOB 2FD6L 1GC1C 5CZKA 2XPGB 3MREB 2VN7A 5IHZB 4U1JB 4LSQH 5GISH 3NCBB 2R69H 2J88H 2BJML 1WWAX 1CBVH 1G0DA 2P8PB 4AL8H 3SCMD 2D2OA 4PJCE 4MJ5A 5EZLA 3LQZA 4GBXA 3JV4A 3PDGA 2XQBH 3RDTB 1EERB 2F53B 1S7QB 3VFMA 2XXCB 3GI8L 3ZHDA 2Q20A 4IJ3B 2VZUA 1DQLH 3MV11 4X5WA 3QIBB 4YAQB 4F3FA 1MCWW 3K74B 4TVPD 3VFUB 4X7SL 3V4PL 4TULL 1EXUA 1ETZA 4XP6L 4HDIA 5A3ID 3HE7C 1I75A 4P5KA 3KAAA 4BK4A 5L2JA 1SEBA 2HVKB 3ZO0A 4HGWA 1A4KA 1FH5H 3B43A 5JHLH 4M62L 3UYRH 2DN7A 1LEIB 3TBTB 5GHWL 3VFPA 4Z7UF 1P84J 1KLGA 1XF5B 3J7HA 4NRXA 3EJYC 5IMKA 4YGAB 2VC2L 2Q86A 4JZOB 4JQVA 1LE5A 4TNVK 3TCXA 3BIBX 3RGVB 3GSRB 1BBDL 4FTVA 1OAKL 2VXQH 3QO0B 1U6AL 2CDGA 3FFCD 5JPNB 4UI2A 5KVEL 4ISVA 2ZOLA 3L3IA 3MUGA 2YUVA 4Z5RA 2VWEC 2I5YL 3D39D 3EDJA 4L4VE 3QQNA 1R0AL 3MOBL 2ARWA 2IEPA 5FK9B 5CJ8A 4PRPA 1LO2L 4HBCH 2DQUH 1S3KH 2Z8WC 4LIQE 3B9VA 3TIDA 3ZHKA 2VLKD 4RWYL 4QGTA 5FIEA 4MD0B 1N64L 1UADC 1BVKA 2CJUL 2GITB 3UBXA 2PW1B 1NBYA 1OT1A 2BRQA 4EJ1C 2GAZA 3RDTC 4ZODA 4MQ7B 1AFVL 4NT6A 4YBQC 4IJ3C 3PIQB 4HS8H 4IOSD 1AE6L 3RL1A 3CDYA 3RX8A 1CS6A 1IGIL 1X5KA 3FRUA 3NFNA 4CU8A 3KDMA 3GNMH 5F89A 4TSCL 2YK1H 3VD7A 1G9NH 1VSCA 1RHFA 1CF8L 1A22B 3C09B 1I3RA 3QDGD 4QXGH 2WQRA 1K8IB 3T4AB 3IKKA 1U3HC 2X4UB 5TFSH 4P2YA 4X4YB 1DCLA 5M7QA 4M6OH 3RUGE 1H3XA 5E5MA 1U58B 4PJ9A 1ZHLA 2O5XL 1EAJA 4ONHA 4PJCA 1OP9A 5CS7A 4BSWB 2H2PC 3GMLB 3GRWL 1ZT1B 3VJ6B 3OAZH 3ZHLA 2P5WD 1E4XH 3WFHA 3S3SA 1F13A 4LIQH 5EU6B 3V9FA 3WLBA 2IJ0C 5FKAA 1F11A 4P4RA 3WFCH 3ESVF 4G6KH 1C7SA 2YUXA 3RGVC 1EBPA 4ZSOE 1QSED 4OLZL 2HJFB 5HHPB 1MCPH 4H88L 4JDTH 3L3GB 2FHFA 4M5ZH 1MFCH 2YUZA 3JSSA 1CFQB 2AABH 2ITDB 4QOKD 4HAFA 5TDNA 1BIIA 5I16A 2DKUA 3EYVB 3OJDA 5B3NA 2EE9A 1UXWA 3FT3A 4OI9A 4HCRL 4RAVB 4BSVA 1OLLA 3AM8C 1XF4A 3S37L 1ZLWK 3B5HA 2R0LH 4WI7A 4FQPA 1JTOA 4X0KA 3GIVA 1DVFA 3R8QA 5IHLB 1IAIL 1WBYA 1P6AB 2WIIB 1DANU 4X6FA 1F4XL 1ZT4A 3P73B 4WHCA 3PGDA 3M17B 4MGXA 3MLXH 5GSVB 1RK1B 2NY4C 3L1OL 1T3FA 1KJMB 1INDH 1FVCB 5KAQG 1T7VA 3TBYA 1FNFA 2P45B 2VXTH 4JO1H 1HHGB 4NBZB 5I8CA 2WLZA 4L4VA 1ES0A 5CEXB 3S3PA 2VDKH 3QEUA 3KLHD 4PREA 4ZNCD 3RZCD 3C09C 4JQIL 2JLLA 3JWOL 3QXAB 2VDPH 3RWFB 1J18A 3IXTB 3GBLA 3QIUD 5CGMA 2Z91A 1D3CA 5HYJD 4XZUA 5HGGS 4XNUH 5EPMA 3QXDA 4KY1L 4R0LA 5L7XH 3IGAA 3UROR 3NAAL 1DEEA 2FH6A 3D0VA 3QNZB 4RISH 1QFWM 2VABA 4H1LB 4KDVA 2FWOA 5JO5A 1P7KA 5D7IE 2DWDA 2MWCA 2VZTA 5JXAH 1FV1B 1YEHL 1A9EA 2BCKA 5FV2A 1JWUA 3IFOA 3W5MA 5C0JA 1XIWB 2EIZA 4XP9H 5JORA 1GGTA 4D0BB 2X89D 4H1LG 3EHBC 2OR9H 1XF3A 1N5AB 5DSCB 2JJSC 4PJFF 3MXWH 4HEPG 5HVHC 4JGUA 3K4AA 2WBKA 3PGFH 43CAB 1GAFH 1CR9L 1U3ZA 2O61B 3IJHB 3QEQE 1WFTA 3RUGA 5IMOB 3FB5B 4R7NA 4N9GB 4LDOB 5KVGH 4TUJA 43C9B 1HIMH 2BXYA 5FYJU 3BT2H 3RVTD 2OTUA 1BLNA 1F3RB 4NJAL 1DUYA 2YBRB 3QUZD 4TTGA 4K71B 4PV8B 4CMHC 2W0PA 1MF2H 4P2QB 3ULVF 1UCBL 4QRQB 1G7PB 2BSRA 3FO1B 1T04B 2YWYA 1B0WA 5C7XH 4Q7DA 1VESA 3VXTB 1QBML 4L8SB 3WKNA 1SYSA 4PJHF 3WXWH 1MJJB 1A7OL 1FO0A 1BVLA 3LRSA 4KRPD 2XN9B 1KTDB 2XT1B 4RNRB 1KPRB 3V0VB 3WUZA 5CCKH 3HPJA 4WHYG 4ALAH 1NC2D 3QXVA 5CZVH 4ZPVB 5DJZB 1Z3GL 5JOFB 3GSXB 1AKJD 1QBLH 4HEME 1A6UH 4LAJH 5I17B 2Q76A 4MJ6A 1OSPH 3WIHH 5EO0B 1SM3H 4PJ8B 3W9EA 4FP8L 3DUHA 1R5VB 2DBJA 3W0WB 4Z7UB 4EDWL 4YFLF 5DUPH 4XCFL 2FBJH 1FNGA 1LDSA 2BVOA 3CK0H 5MHSE 2Y72A 2WUBL 4JKMA 5HYEA 4IOIA 4XNMA 2FGWL 1HEZB 1KCRH 2R1YA 5AEAA 5F9AC 5T3ZE 3LD8B 1KJ2H 2XFXB 3FT2A 3SE3C 2CK0L 5LAXB 3DETD 3W2DL 4WTWA 3EOAA 2EYTA 2WP3T 4QXTB 2H2SC 1UWGH 1INQB 4PFEA 4G42B 4RDQF 3U0WL 1AQKL 4NHCL 3QISA 4DKEH 3NIDE 3L6FA 4UU9A 4Z6AT 4HHAA 3AU1B 3SBWA 3SE4C 3PNWB 3UTZB 1KIRA 1QVOA 2PXYA 1T4KA 4GXVL 1KBGH 3O4OB 2F19L 3SPVA 3VMNA 1FL3B 1GZPB 5ETUA 4MDIA 5CINL 2G2RB 1VGKA 3T3PE 4HULB 2R0WL 3QJFB 2HWZL 1JF1B 2HTLD 5DGQA 1CGSH 5D7IA 3CFEA 4HUUA 4K07A 1QKZH 5C71A 4QRRB 1X5ZA 3QQ9C 3DOSA 3MBXH 1GXEA 3MRFB 2KPNA 1U8HB 3U7YL 3REVA 2YD5A 4PP1D 3FFDB 1U92A 1ZLVH 4KTYA 3DARA 1RD6A 4M5YL 1G7QA 3TESA 1KB5L 3CDGA 3AVEA 1EPFA 4NWUL 1MAMH 3DRQA 5I30L 1JHTA 3U0PA 4PTUB 4U3CA 3BYTA 2ZCLH 1YEDB 1X5LA 2CK2A 3QEQA 5EO1A 4OV5B 1LEGB 1LWRA 2X4PB 3RBSA 3LKQB 4DKAA 3HAEG 3MFFB 2YPLB 4OJFH 2D31B 1NAMH 4GAGL 5TPWH 1PEZA 1TZHB 5HHQA 1I7UA 3O3EA 4MCZA 1PY4A 2JCCE 5DURD 2BHYA 5LGJA 3G9AB 1ZVYA 3NA9H 1LP9E 5F6HI 4TRPH 1P1ZB 2R23A 5DRZA 1NFDA 4FQQA 2IG2L 1CDYA 4XPFL 4XAKD 4YHIB 3NZ8A 2BSTB 1DFBL 2D7TL 2RGSA 1IQDA 4N0FA 3UBXI 1JZ7A 2W65B 4JCLA 1I7ZA 3UO1L 4OIIH 3HI1B 1AR2A 5E6ID 3TFKC 3PQYB 4JFZL 3A6BL 4LVOB 4PGBB 4F33B 3H42L 4JPKL 3L9RA 5E8DL 3IDIB 1IM3A 1DLFH 1CGVA 3G6AA 3G5YB 3O2WH 3LDBB 4E0RA 1ZS8B 2ZUYA 3I75A 3MCKB 4S1SH 1A6AB 1ZGLM 3SDDA 4U1IA 1K5NB 3MJ9H 4NOBA 4UNUA 2AJZB 2X4RB 3F7RA 4NO3A 5C2BL 2GJ6E 4NIKB 2C3WA 1YJDC 4S1QH 3PHSA 3QCTH 4P46B 5IF0B 4C56B 2BVQB 1KT2A 4N5EC 2GTWB 1RUPH 3F5WA 5T3XE 5EUKB 4WRLA 3QXUA 4FS0A 3HAEH 3ZE1E 4POYA 1FLTX 4F2MB 3S98A 4WTZA 3QUMB 3MLTA 5I15L 5E1AB 5KVFH 2E8YA 3HG1B 5DO2D 2Q6WA 4JDVA 1TZIA 4OF7A 3IDGB 1AD0A 3S88L 4I3RH 3DO3A 5F93C 2ICES 3BEWB 3BGMB 1QTYT 2R0ZH 4PG9A 5HDOA 4DGIH 5BXFB 5KANI 3CVHB 1OOAA 3B9DA 1BWMA 3LN4B 2E7LC 4Q9QH 3UTTB 1FNAA 3MOAH 3FB7A 4H25A 4LQ1A 3WSQL 5EO9A 4MSWB 1S9YB 3VWKD 4U7MA 1IGJB 3U9UA 4G6JL 4JPIB 3V52L 4MLSA 5AWNH 1PY9A 3ARTA 3OKMB 2FBOJ 2OL3L 4HKBB 1LEKA 4MB5A 3UPRA 4XCEA 1DBAL 4PJFB 1OAXL 4G9FE 5IFHL 1TTGA 2V2WA 3OXRB 4EUPB 3GJFA 3FN9A 5DK0B 4OGXL 5I1CH 5AYUH 4QHLB 4Z0BH 4RZCA 3LDBC 2C9AA 1EFQA 2P7TB 2HT4D 4M93B 2JCCA 3BJ91 3D18B 4B7IA 1U8QA 4V2BA 1E4XI 1S7SB 3QPXL 1RIVL 3ARGC 5GPRA 5KW9L 1LP9A 5K9OA 5GGSY 5IW1A 4ENEC 4ZUWA 5DLMH 1S78C 2AV7B 5AYQA 1H8SA 1X7QB 2IWGA 4P46C 3QDAA 1MCWM 3N1GC 2SEBB 3AROA 1I9IH 3QIWA 3C8HA 3FT4A 2BOBA 5BRZD 4MD5B 4RFNB 2P24B 1AGEB 4NCC2 4HH9B 4KJYA 4PJHB 4YO0A 1XR8B 1VFBA 2EDJA 1FZKA 4D9LH 4NZUL 2OTWA 1S7UB 3BIKA 1BJ8A 3P11H 3RKPA 3T65A 4LVNC 4EDXB 4MAYD 4DK6A 1C5CL 5FYJE 2NW3A 2Q8BL 2VLRA 3CMGA 1KULA 3PHQB 2DQIH 2QQNL 4XB8A 5FGRA 3NFSL 3WHE0 2BP3A 5DVOA 3T4YA 1EHNA 4F15B 1B0GA 1N4XH 2XTJB 4OAWA 2GJ6A 4GAYB 2VE6B 3QI9A 3BESR 2OJZH 5FA4B 2GUOB 5DA4A 3TNMB 3IU4L 3FO9B 4BZ2H 1QBAA 4PJIE 2MCG1 4KK9C 4KZDL 4Y19B 5CJXC 4JRYB 1IJ9A 3U0TA 3RVWD 1UXSB 3C5SB 3VXQB 1J11A 3LB6D 1ORSA 2YSSB 1TQBB 4O2FB 4KROB 3W9DA 2V7HB 1BOGA 1NL0L 1G0XA 1NMBH 5ADPL 1MUJB 4ELKB 4XNXH 3VCLA 3CUPB 1CGWA 3LH2L 1DL7L 1FJ1A 5TDOB 4WI6A 1QSZA 5C0CB 3RZWA 2IMNA 2A83B 3DWTA 4RDQG 3LEXA 4NNXA 1FLRH 1QRKA 2YA0A 4Q0XH 3D85B 3J8F7 3H9YA 1QLEL 4JG1H 4JM2D 5EOTA 5ERWA 2EDYA 2GJJA 1PW3A 3BDYL 3HLAA 4Y4FC 3Q5TA 3QRGL 1JJUA 4LLDB 4OCRL 3P9MB 4O02L 1TXKA 3VXRE 1CFTB 2DQHL 4ZUTB 4MJ2A 1RURH 1T21B 3QQ3B 2VXVH 4E42A 4XX1G 1CD0A 5H2BB 1C08B 1QFHA 1YEIH 1T1ZA 4G9FA 2GQHA 2BNUB 5TQ2L 4WI5A 2A73A 5FB8B 1F3JB 2FIRT 5KSBE 4NQEB 3KLAA 1I8IB 2JELH 3TCLA 5JIKA 2D03H 2X4SA 1NGYB 4LSPH 5FO9B 4F7CA 3OV6A 2VAAB 1E6JL 2Z31A 4YWGL 3BSZL 4DVBA 2IPKA 3T2PA 4BFIA 5FGCE 5EIIB 3T2NL 5FHBH 4N8CH 1ZHKB 1PG7W 3I3EA 2DMBA 1VGEL 1U95A 3TBVA 1UZ8B 1OGTA 2FR4A 2XTJC 1ZLUH 2W60B 5F7YC 4N68A 4PGZA 3UMTA 1CXEA 4YC2C 4HJJH 3LEVH 3WIIL 4MXWL 3W81A 3KXFD 3Q48A 2XWTA 4JZNA 2F54D 4UT6H 2D0FA 3SKNA 3BW9A 4ZUUB 3GMOB 1IBGL 2W59A 2GTZA 4ZO6A 5E2JA 4JKPH 2XG4A 4BUGA 3DX7A 4X8JB 4KK5C 1KB9J 3ETBF 4LFHG 1FFNA 1UQSB 3T08A 5IIEA 5JQ6L 3HR5A 2ZZUT 5AZ2H 5JDJA 5F72S 4D94A 2OXHA 3B83A 1ZLSL 1HSBB 3KPSD 1RHHA 1JPST 5K9JL 2BX5A 4JHAL 4YHZH 2PO6B 2BC4B 3S5LB 1YYLL 5F3BA 4G43B 4PGCB 1YMMD 4PJIA 4OT1L 4XWGH 1HHIA 2AXHA 4QYOA 4OFDA 3QDMD 5E03A 2YPKA 5D1QB 1KPVA 2FJFA 5FYKU 3LIZL 3MLVH 3BQUB 3R1GL 5D2NB 3MA7B 4YQXL 1V3JA 3F58L 4JFHE 3S5LG 5D2LF 4TUOB 2QBWA 1N0XL 3GBNL 4JREB 3FQNB 3FMGL 1HYRC 5I1EH 2HLFC 4JY4A 5E2UL 3MYJA 1A2YB 3QUXD 1OP5H 3PJSA 3T1FA 3S36H 1VFAA 2VSDA 3UX9B 3GJEA 4K3DH 5T1KD 1OY3B 5J9PA 3BP5B 5CEZL 4AEHH 4M61A 1LNUA 2OP4H 3K46A 4MHHI 4U6YA 4EOWL 3I84A 3R06B 3O6FA 1ORQB 3C9NB 3JV6A 2BY3A 3QWRD 5BZDB 4O2CB 4WWKB 3ROOB 1XGQB 1GIGH 4HQQL 2ICWA 1RVFL 3NZHH 2BY2A 5IG7B 2V17H 1FG9C 3VXRA 4U0RB 4DAGH 5GIRA 1HKLL 1L9NA 4PLNC 3GSVA 1JGVH 4ZFOB 1E4WH 2B7DT 4KMQA 3U4AA 5H94A 5DHYA 3O41B 5IROA 4MB4A 4LPWA 2UZIH 3DIFB 4PB0L 4IRJD 5IFAL 2Y1VA 5KSBA 5JMRA 4Z7QF 4P23B 4JG0H 1MLCA 2FATH 1A6VH 5EBMB 3MV7D 5EZJA 5D5MF 4PLJD 3VU2A 3TGXA 2IBZY 3DECA 5DJCA 4CW1B 3WCYA 3X14B 4A6YH 3VGAC 1UKQA 3ARDD 4LHUD 2NXZC 4PTTB 3N9GH 3O2VH 3RA7H 3S8WA 2OCFD 3QEHB 4PRIE 1QFPA 3CFKB 1NEZA 1HDMB 1CLYL 1XCQA 3SDCA 4GXUM 4DFIA 1YMHB 1D5IL 5D1QC 4WCYL 5JDSA 2WK2A 5IOPB 3MTRA 3GM0A 3OBAA 3WEXB 3BQUC 1JN6B 5D2NC 3C6SA 2NY0C 1A9BB 1KLUB 5K9KB 4OGZA 2F58L 3QAZC 1BECA 4MNQD 4NOFA 1MIML 3UCRA 3FAXA 1A3RL 4Y16D 1EHAA 4KQ3H 1FVDB 3X3GL 2NNAA 3X12B 1ZV5A 1FZJB 4XC1L 4OLYH 2QLVB 5LGHL 2PYED 1ZEAH 2CKBL 4WW2F 3LQAH 1T5WA 3TN0B 4DTGH 1KIPB 1A3LL 3O2DH 5EBLB 1BQHG 3H9HB 2ZKHL 3HNTH 4Y5YC 4ODVH 3VXSE 4P2OB 5DMIL 5F8RC 4WWKC 5IQ9A 3W11C 5E7FA 2VYRE 2EDEA 4I0PA 1UM6L 1ZA6B 2CDFA 2Q87A 4XP4L 4XGZA 3IDUA 3BXNA 2FEEI 3VWJB 3LKRB 4X9BA 1B2WH 5L8KB 2BVYA 4A6YA 5CAYB 3IJYA 5TH2B 1T22B 3MNVB 2WWMD 1MWAH 4P23C 1UJTA 2BSSB 2HFFB 3CXDH 3HNSH 1GHFH 4OFPA 4QY8A 5JR1H 4JRXE 5DRXA 3ZKNC 3DRTA 5SWSB 5DJDA 1CE1L 2EYSA 5EG6C 3I50H 4PPTA 4JFXA 1WIPA 2WINA 5I73B 4NO0B 2N7AA 4BH7A 5DD3H 5KSAA 5JTWA 4NN7B 5KN5B 2HFTA 4ZG1A 1OF2B 1PFCA 1VFUA 3FONA 1D9KD 4H8WL 4XP1H 4U6XB 3BP4A 4ZFZB 2X41A 4Y0GA 1DQJA 4G8FA 5BZWB 4O9HH 2VDLL 3DGGB 4YDLC 5ESVA 2HKFL 4KFZC 5IEKB 5HGHB 1MEXL 5IVZA 3ULUL 1ZT7A 3D2UA 3I6KB 3QG6B 3O3AA 2LAAA 4DQOH 3EOTL 5IB1B 4LOUC 1J1PL 4JFDD 5T1DH 3RWEB 1WCQA 3NIGF 1WJ3A 4NJ9L 4GW4B 2B8OT 3DSFL 3IRZA 4LCCA 1DZBA 2CKNA 5C09D 3B9EA 1CG9B 3KPQB 5JLZB 2FSEA 1ZGLB 1LO5A 3HI6L 5DD0H 3TV3L 1V3MA 1UC6A 3BKMH 5KJRL 4DVRL 3FCTB 4JFFD 3ZDZE 2E9JA 2C3VA 4RGNB 4KTDH 3F6IA 2V2XA 1CLOL 1FZMB 1FSKB 5IWLA 4JAMB 3QH3B 3AGVA 2NTFA 1R3JA 4PRIA 2YKLH 1IGYA 1K8DB 4ODBD 2IAMB 3VXPB 3QYCA 1QFUL 2EYRA 3BISA 3HFML 4QRUA 4X98B 2BVPA 3LKNB 3KPPB 3UJJL 1U8OA 2R9HD 2XA8H 1L0XA 1UYWL 3KG5A 4JFYB 2DQFA 3VWJC 2DIAA 4JO2H 3BWUC 2DI8A 4DK3A 1AI1L 4G80B 4KKLD 5HSFA 3HZMA 1W8OA 4R4ND 4LARL 4AY0A 4YXKL 1KELH 2R2EB 1P7HL 3HZVA 4HIXL 4G3YH 3RWCA 1WQVT 4CADB 4L3AA 4RX4D 5F1SA 2YD7A 2X44D 1MFBH 4XMKH 4S11A 1WFUA 1J8HE 2EDBA 1ZHBB 3VGEA 1JF5A 2PTTB 4K9EC 1QEWB 5HHXH 5D7JD 3VXSA 2CIIA 3D3VE 3TA3C 5CP3H 5HDBF 3HMXH 2R1XB 4OLVH 3VXOA 3Q3GA 4PGEA 3P4NA 1UZ6E 1W0VA 4YDJB 4FQXB 3NVQA 3MZTA 4LLUB 2I60L 2A9NH 2VUOA 5D7KD 1UH4A 3F12A 5D2LB 1MNUH 2HFEA 3B9KA 2R2HB 1S9XB 2F53E 4EI5B 1SJVA 5K9QI 2B4CL 1C1EH 3RU8H 1CT8B 1SJHA 4M7ZB 4JRXA 2FHBA 1ZWIB 1TLKA 1JPFB 2FD6H 3GK8H 4WFED 3OXSB 2QSVA 4Z95L 4F7MB 1FG2A 4GS7B 2A9ML 3H3KA 1I8LC 2BJMH 3DX9A 3CFCL 3GSUB 4OLWL 4YXHL 3OKNA 1MHCA 2XNAB 2GSGB 2J7LA 5FYKE 1JGDA 3I02A 3L95B 5IVOA 1T2QL 1FSKC 4QNPE 4YZFE 2J5LC 3GI8H 3H7BB 5BOZG 5GGRB 4JEGB 4YH6A 4B41A 3BWAB 1P5UA 4KJWD 5DTFB 3EJZD 3WFBH 2K3TA 4HF5L 1Q94A 2E7BA 2VITA 1CXLA 3OZ9L 2NXYB 4GW1B 5SWZB 2RQ8A 4X7SH 5DDHA 3V4PH 4ZTOL 3MRQB 4HWBH 4XP6H 3L7FB 1T03L 3MRHA 5BVPL 3B2UC 1X5XA 4D9RE 1T89C 1T66D 1F6AA 2VR5A 3GSNL 3HMXA 1MHEA 4UDUA 5D5MB 1UVQA 3HC0B 2AW2A 1AGFA 2QSTA 3MRMB 1T83C 4M62H 4XMPL 3RL2B 4M8QA 2H3NA 3QNYA 3D9AL 4HKXA 4O5LL 5GHWH 3MODL 4CVXA 2VC2H 4YFDB 3TYGL 4PB9L 3QPQC 1EZVY 2XV6B 4WUUB 3AXLB 2YA1A 5D1XB 3RHWF 5D72L 1BBDH 1NCDL 4G6FB 3GM8A 1OAKH 2VDOL 4FFYL 1U6AH 1DQQA 3VH8A 1WTGT 1MAKA 5DC9B 3IRPX 2ICWI 1I7TA 3X11B 5DJXB 2Y06L 1C12B 2I5YH 4Q6IB 3RWDA 1R0AH 1F58L 1I8KB 4EI5C 3MOBH 3IFPA 4L8CA 1I7RA 4KKCC 1M05B 4M7ZC 5J13C 1LO2H 4NO5B 1TVBA 3G5XB 4NFCA 4PD4K 5IM7B 2HJLB 2J6EL 4OZFB 1J8HA 3JWNC 1PBYA 5CWSB 3PP4L 1NFIA 3HN3A 4WW2B 4ZS7L 3SKUD 4N8VB 4ODXB 4GS7C 4HXBL 2CJUH 4APQB 4NZRL 5E8EA 1ZANL 4QF1A 3D3VA 5T5NF 3FZUD 4HWBA 3BO8A 5EWIL 4WHTB 5IT2L 1F90H 1AFVH 2XPGA 3MREA 1DQDL 5IHZA 3TPKA 5CUSL 4N8VG 4ZAKD 2A1WL 2P8PA 1IGIH 3VE0B 4QRPD 5BS0B 3RDTA 4ACPA 2NXYC 2F53A 3P3YA 4TSCH 5DFVD 1NBVL 4U1HB 1CF8H 1OM3H 4NSKB 5FECB 5EU6E 1S5IL 4LRIC 1CN4A 4YK4C 1IM9D 2DMKA 4N0RA 3ARBB 4YAQA 2IPTH 2EO1A 4RGOL 4F37F 4TQEL 3VFUA 5BV7B 5F71A 1ZKAA 2VLLA 5F7UA 4KKBD 1CDGA 5IKCB 3T0DA 1U3HA 4EVNB 1MJ8L 4TOYL 2HVKA 4JHWL 3T0EC 5ILTH 3QHZH 4NZTH 5JW3L 4H5SB 1KN2H 4MS8C 3GMRB 1B9ZA 3HZYB 5ALBL 4UTAH 4PRAB 3K1DA 4RIRB 1U8KB 4NKMA 5MP6H 5E4EB 4YUEH 3TBTA 1O7VA 1CI5A 1D7FA 1WC7B 5FYLE 5IMMB 3S34L 3JTSA 1XF5A 2Z9TA 3IS0X 3IDXL 4H88H 3SDAB 5FF6B 5IBUB 2E6PA 4X4XB 2QKIB 4KMTL 3KYNB 1EZVX 3OSKA 3VFSB 3RGVA 1JMZA 1EFXD 3GSRA 3RJQB 3Q1SH 1FFOA 4HCRH 3QO0A 4O2EB 4O58L 5JPNA 3OMZA 3S37H 2XG5A 1RZKC 1VHPA 3EFDH 5EUOF 3V4UL 1IAIH 3REWB 1DBML 1EGJH 2B5IB 1IZKA 4S1RH 5CHNB 2W0FB 4GRLD 1F4XH 5A16B 1C7TA 1HZHL 1WWCA 1WVZA 2NR6C 2OS7A 3EGSB 4JY6A 5FK9A 3JUYA 4QRTB 2D9CA 3IXAB 4BYHA 3L1OH 5GZOD 3ABZA 4EN3C 3LS5L 2BXZA 4LBEB 1OTTD 1C5DB 1AP2B 2DM3A 5IBTH 3PF2A 2XTLA 4MD0A 1FC1A 4PJEA 5E6YA 4P5TC 4JPVL 2GITA 5C3LD 2PW1A 1AQDB 3NTCL 3SCMB 3MBED 1YEFL 5J8OA 1H9VA 4MQ7A 2OMNA 5B39B 3D25B 2VNCA 4XHJD 4JQIH 1UG9A 4ZFFA 3NOIA 2P49B 1HYSD 1A64A 5TGBB 5KVDL 2ZNXA 4L8BB 4UILL 1K8IA 2DQJL 3T4AA 3CXHJ 3EYQC 5E08L 2X4UA 1YEHH 3NCMA 5GRJH 4ZFGL 5DFWH 2AJSH 5CP7A 1ZVSB 4LDEB 2MNUA 1B0RA 1U58A 5C9JB 4HCRA 2VN4A 3SKJL 5JOEA 3GMLA 4N0CD 5E4EC 1ZT1A 5E8OB 3VJ6A 3QIBD 3MRLB 4WIQA 5IHUL 5EU6A 3SDAC 1EGJA 1HOCB 3PWNB 4DZ8A 2OZ4L 1CR9H 1BX2B 4P2QE 2FH8A 3MRBA 1PGRB 3RP1A 2X4OB 1S7RB 2JJSA 1NCWL 5HHPA 3FFCB 1WICA 4UDTB 3L3GA 1RZFH 2ITDA 4HS3B 1DBJL 2XN9E 2E9BA 3EYVA 4NJAH 3BMVA 1QHOA 2J1KA 2J8HA 4RAVA 3T1WA 4P4KB 3WXVL 2JIXD 5D7LB 5I2IA 1H5BB 4R26L 1UCBH 3M8OL 3LPGA 3GGWB 2R56L 2VLKB 1Z5LA 5IQ7L 1QBMH 2XA3A 2WIIA 4RFEB 3W0WE 2QEJA 3P73A 1A7OH 3VDCA 3C87A 2EH8H 4WUKL 4LCIL 5LXGH 4HD9A 1RK1A 5GSVA 2IFFL 4YDKL 5DWUL 5LBSL 1G7LA 3M07A 5HI4D 1P4BL 3BD5A 1JNHB 1FVCA 1Z3GH 1HHGA 4OLUL 5FGBC 3IYLW 4GQ9L 3ZT7A 4FP8H 3SGEH 4CU6A 5CEXA 2DDQL 1KCKA 4BA8A 4EDWH 4ODTL 3BUTA 5L9DL 5LQBL 3U6RA 4XCFH 2GY5A 1BQLH 3QDGB 3RVVD 3QXAA 4CNIB 3RWFA 2WUBH 1WFNA 3IXTA 1DE4A 2FGWH 5JUEL 4PJAA 2A0LD 1CTNA 4CN4A 1Q72L 1XAUA 2DJUA 3S96B 4J3XA 1G7HB 5C0IB 1G9EA 4Y2OA 4PJ5E 3W2DH 3QNZA 1Q9LA 4EI6B 1WV7T 2AXGB 1LILA 1LGVA 5DUBB 4H1LA 2DAVA 3U0WH 2VLMD 1AQKH 4NHCH 5DMGD 2NY7L 2NPLX 4QRRE 2P5WB 1EO7A 1CXFA 3MJGX 4WFFD 3AAZB 3SE3A 1MCOL 1XIWA 2EDFA 4GXVH 4D0BA 1N0LA 2F19H 1K2DB 4U2ZA 5DSCA 1A21A 2DF3A 5JA8B 3CSBA 1LD9B 2R0WH 4L3CB 4MCYA 1SJEB 3SE4A 43CAA 5IB3B 1EVUA 4Q9RL 4IDJL 4JFEB 3RWIB 4ODWA 1ZA3B 4QOKB 3IJHA 1DUZA 3IDJA 4JR9L 5IMOA 3FB5A 1HHJA 2ADIB 2F8OA 2YPLE 3U7YH 3KPRD 4NRZB 2IQAB 2EDKA 2AGJL 4ZTPL 43C9A 2EC9U 1KB5H 5T5NG 3ARXA 1VCAA 4KKAD 3LN5B 2GEEA 2YS4A 4NWUH 1CICD 5HI5D 4GG6F 2FJHB 5DI8B 4PV8A 4QTIL 3P0VL 4XCNB 1UM5L 2O5YL 2J12B 4P2QA 2NZ9D 2LTQB 1RULL 1CLZL 4QRQA 1G7PA 1U36A 3FO1A 4KJQC 5FO7A 4GAGH 3VXTA 1RJLB 1YJDH 2R2BB 1MJJA 2A6KB 2RB8A 3V79C 2DQCL 2XN9A 4RNRA 1OPGL 4LGRB 3PQYE 4LVHC 5DJZA 2E3VA 4PS4L 3RZCB 5JOFA 3GSXA 2OMBA 5I17A 1CD8A 2IG2H 4XPFH 4RAUB 1DFBH 3QIUB 3V5DB 4PJ8A 4GBXC 1JPGA 1R5VA 5HYJB 1CIDA 3W0WA 3UO1H 2OL3B 2RFXB 3VMPA 3IF1B 1N5YL 5IVXF 2R69L 3MSPA 4JFZH 4AEFA 4AL8L 3H42H 1CLCA 4C56E 3GBMH 4JPKH 5E8DH 2D4DA 1OAUL 1UA6L 1K6QL 3HKFA 1Q9WB 2XFXA 1MRFH 3OAYH 1RU9L 4QXTA 5C0GB 1INQA 2W9EH 2BMKA 2CQVA 1K4CB 4G42A 1ZTXL 3ZKSD 1JZ8A 1GPOH 2B1AH 5SV4A 1MCJA 5EUOB 1KB5A 3HG1E 3G08B 3SQBA 5CJOL 5C2BH 3AU1A 3MV8E 5C07E 5HGBB 4XVUD 5C3TA 4OGYH 2I07B 5L6YL 3UTZA 3CNKA 3TNNB 3BKYL 1SY6A 4PJ5A 1G7JB 1GZPA 5JHLL 3UTTE 3GUTB 1IAKB 3OKDA 3QJFA 5I15H 4PRNB 3MO1A 1E4JA 4LCUB 4QRRA 4ELMF 1NUFA 3BVNB 1BFOB 1RK0B 1U8HA 3S88H 3QUZB 1I1FB 4TTDD 3MV9D 1FNHA 5EOQL 5J1TC 2AK4B 3NACL 1BFTA 2UWEF 1N3NB 3B6SB 4HPYL 3DI3B 1WUNT 3VXUD 3WSQH 4PTUA 3NPSC 1YEDA 4L8DB 4Y4HD 5IMLB 4EKXA 4OV5A 3MROB 2X4PA 1JGEB 1TPXB 3LKQA 3MFFA 2YPLA 3KLHC 1NC2B 2D31A 2EE6A 5F6HJ 3RZCC 3O8XD 1AKJB 4G6JH 1TZHA 1WZLA 2E7LA 2A77L 3ARFB 2ED7A 4AG4L 4UIMA 3QIUC 4D8PB 1QSFA 4FZ8H 3CX5J 4JHBA 4Z0XA 5DJ0B 5IK3B 1DBAH 4PV9A 4LKCB 1OAXH 3ZTJG 5IFHH 4U1MB 4CDHA 1XGPB 2DICA 1L9MA 2VUYA 3QXWA 1OGAD 4YHIA 2BSTA 5GSRA 1J1OL 2W65A 2Y4SA 3DXAE 3QZWA 1VB9A 2WWKO 1OTUD 4M03A 3HI1A 1UJ3B 4HS8L 4PJHE 3RWHB 3RKDD 3DROB 4R7DB 1G1YA 3I6GB 3QPXH 3WE6A 5J6GA 4OZGA 3T8XA 4F33A 3CDFA 4QKXB 1RIVH 4I9WE 5KW9H 3IDIA 1JNLL 1CD1B 1U3YA 3G5YA 4IEFB 2PCPB 4KXZI 1IGML 3GNML 1ZS8A 4B7LA 4GMTL 3MCKA 1A6AA 3E6FA 4QCIA 1BEYL 4UBDD 1K5NA 4OQTA 3AREB 2BNRD 3ARGA 4D2NA 4JN2B 1LE9B 4JFQB 4EUPH 2X4RA 2MPAL 2XTJE 4L9LB 1WBZA 2ADJB 4JM2F 4Q2ZB 4NZUH 5F9WC 4P46A 4C56A 1YDPB 3RVTC 2GTWA 1HILB 3B9AA 4LASL 2AEPL 4LQFL 2Q8BH 1Z6JT 4XCYB 4JRYE 4Y19E 4LIQL 1A1OB 2NMSA 4PGDB 3VRJA 2YA2A 4XTRD 4HIEB 2QQNH 3QUMA 1EV2E 5E1AA 3NFSH 1JTTA 4I48B 2YD2A 3U4EA 5FM4A 3VXNB 3MV8A 3IDGA 5C07A 1LQSR 3BEWA 1NCCL 3D69A 4JDTL 4KRPC 5F9JB 3IU4H 4M3JA 5F7MC 3BGMA 4HZAA 1TPXC 5BXFA 1DVFC 2NY2D 4K94C 5C0CE 4KZDH 1A1MB 4J6RH 1BM3L 4OF6A 3TEUA 3LN4A 1X4XA 3UTTA 4ZO9A 4CRPA 4JJ5B 5DK2B 5DURB 3JVGA 1S9YA 4BQCA 3DHJA 1BQSA 4PJDF 4XX1E 1IGJA 4UT9L 5F3HB 1NL0H 1HNFA 3VD3A 4OD1H 5ADPH 4UT7H 2G5RA 3TIEB 5E00B 3LH2H 1DL7H 1KTLB 1IEBB 2VISA 3JV5A 3MLXL 2KBGA 4LCWB 1KYOK 3OKMA 4HK3J 4HT1L 4HKBA 3BUYB 4V1DD 5ABDE 2ENSA 4P2RD 1F02I 3MNWA 4R90L 3R8BB 4K3EL 5MEQB 1QLEH 3OXRA 5E6IB 3RNKB 4EUPA 1MFEH 3CIQA 5GJSL 4PIRF 5DK0A 3BDYH 2VDKL 2JJTC 2PTUA 1VKXB 1FIGH 4QHLA 3MMEB 4BELD 4OCRH 1A7NL 3D18A 3ARQA 2VDPL 5MI0C 1REIA 4FQHB 1S7SA 3K81A 1KIQB 1A6TB 4QGYA 1CYGA 3C08H 1FCCA 5EIVA 2ED9A 1UM4L 1KFAL 3SDYL 5TQ2H 4Y4FA 3TT1L 3O11B 1FO0L 2AV7A 4GG6B 1X7QA 4RISL 5C6PB 4GXUN 3PQYD 1K4DB 1BZ9A 1G6RL 1J5OL 3H9SD 1E6OL 3ESUF 1E6JH 3DXAA 1GGYA 5DS8B 1AGEA 4PP1C 4PJHA 3T2NH 1MQKL 2ZPKL 3SKMB 4NUGL 1S7UA 3K8LA 1CDIA 1VGEH 1O0VA 5HVWA 4X9HA 4W6YB 3RGHA 1IL1A 4WEBL 1NBQA 3PGFL 1X5HA 1ITBB 3WIIH 1ZXQA 1KGCD 2P8LB 4MXWH 5HYSG 4MJIB 4RAHA 2Y6SD 3DV4B 5E94B 4GAYA 2VE6A 1NKOA 1N26A 5IESH 5IVXB 1IBGH 2D3VA 2M2DA 3NN8B 4UTBL 3VWKB 4UB0L 4ZXBD 3HG1D 1SYVB 4OZHF 1S7WB 2GIYA 2VR9A 3V6BR 4Y19A 4JRYA 1IGTB 1UXSA 3C5SA 5EC1B 4Z7VB 3VXQA 1CGYA 1F2XK 1MI5D 4OCSL 4N9OB 3DMMD 5D2NE 4U3HA 1J0JA 2YSSA 2V7HA 3S4SB 3T0BA 1CL7I 5C08D 2IMMA 1A7RH 4JVUA 3L3JB 4GKNA 5MENB 3WXWL 1BFSA 4ELKA 3CUPA 1YYLH 2VZ3A 4PR5A 5TDOA 1U8PA 5C0CA 3EO9L 4CN1A 2A83A 3C5ZD 2Y5TB 5CCKL 2KDGA 1JWSB 5CZVL 1H3GA 1QBLL 3R1GH 3F6LA 1YN6B 4YQXH 2AJYL 32C2A 3F58H 5ICYB 1SM3L 3OR6A 3GBNH 4CGTA 1AHWB 4ELMB 4I8DA 3BPCB 4NKIL 4LLDA 5ESQB 5E2UH 3P9MA 4W68A 5GS1C 1T21A 4NN6B 3QQ3A 4N90D 5K59F 2UWEB 5H2BA 1C08A 5I1IL 5INDB 5CEZH 5B38B 5BRZB 2BNUA