4QX8A

Crystal structure of histone demethylase kdm2a-h3k36me3 complex with alpha-kg
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
329
structure length
329
Chain Sequence
RTFDLEEKLQTNKYNANFVTFMEGKDFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIEMTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPSTVDFIDWVDNMWPRHLKESQTESTNAILEMQYPKVQKYCLMSVRGCYTDFHVDFGGTSVWYHIHQGGKVFWLIPPTAHNLELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSGWIHAVYTPTDTLVFGGNFLHSFNIPMQLKIYSIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKDFQKESLSMDME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 2A
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/structural protein
total genus 101
structure length 329
sequence length 329
chains with identical sequence C
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4qx8A01
4CCJA 5FYBA 2OQ7A 3AL6A 5A7SA 3KV4A 4GAZA 3K3OA 5FZ1A 4QWNA 5ISLA 2OT7A 2YBKA 2OX0A 5FXXA 3K2OA 3KVBA 5F3EA 5FZOB 4AAPA 3K3NA 2XUEA 3DXTA 4Y33A 4DIQA 5A3WA 2OS2A 4LIUA 2Q8DA 5IVEA 3U78A 5IVJA 2YU2A 3N9OA 3PU3A 3UYJA 4EYUA 3PUAA 5FZEA 4ASKA 5FYUA 2YPDA 5IVCA 2PXJA 4UF0B 5FZKA 5F39A 4LITA 2YBPA 3LDBA 3PURA 5IW0A 3ZLIA 5FYVA 2Q8CA 2P5BA 2W2IA 4QX7A 5FZ9A 5FPVA 5FZ7A 5F3GA 5FYHA 2OQ6A 3KV6A 5FZ3A 5IVBA 5FZGA 4LXLA 3DXUA 5FZHA 5A1LA 5LW9A 5FY4A 3PUQA 3ZPOA 5FXZA 4E4HA 4GD4A 4D6QA 4QXHA 4XDPA 4QU1A 4CCLA 4CCNA 5FPAA 5F2SA 5FYCA 5A7WB 5FZIA 5IWFA 4EZ4A 5FY8A 4NUBA 4BISA 5FPBA 1VRBA 4GJYA 5A1FA 5F2WA 4QX8A 4D6SA 4IGOA 2XMLA 5K4LA 5LY2A 3OPTA 3PU8A 2WWJA 4URAA 5FZ4A 4HONA 5A7PA 5KR7A 4IGPA 4V2VA 5FYYA 4CCOA 4D6RA 4BXFA 5FP8A 5FWJA 3AVSA 5F5CA 5FV3A 5F5IA 4Y3OA 5FYSA 2Q8EA 5F5AA 5FP4A 5A3NA 4HOOA 5FUPA 5FXVA 5FZOA 2GP5A 5CEHA 5FYZA 5A7OA 2YBSA 5FZBA 4IGQA 5F32A 5IVFA 4LIVA 3N9MA 3PUSA 3N9LA 5FZFA 4CCKA 4V2WA 5FZ6A 5LY1A 3N9PA 3KVAA 5IVYA 3LD8A 5A3PA 2VD7A 3AVRA 5LWBA 5FJKA 4UF0A 5FY5A 5FZDA 5F37A 3NJYA 5FUNA 4CCMA 5FPUA 2WWUA 2XDVA 5FPLA 5FY1A 5FZ8A 3AL5A 4GJZA 5FP7A 5FXWA 4AI9A 5F3IA 5FYMA 5A7QA 3N9NA 5A7NA 4XDOA 4CUGA 2YU1A 4BU2A 5FZMA 4QXCA 4DO0A 5FZAA 5FYIA 5ANQA 5E6HA 5A3TA 3KV5A 5FYTA 3KV9A 5FP9A 3PTRB 3PDQA 3N9QA 4Y4RA 5FBJA 5FZ0A 4C8DA 5A80A 3OPWA 5FY0A 3U4SA 2XXZA 5FZCA 4TN7A 4QXBA 5FWEA 5FY7A 5A7WA 5FY9A 4CSWA 4EZHA 5IVVA 5FZLA 3RVHA 5FJHA 5FP3A 5F3CA 2GP3A
chains in the Genus database with same CATH superfamily
2BVVA 1QY4A 1QJY2 1GQHA 2Z79A 2OQ7A 2VMHA 4AHXA 4R9BA 1C1LA 3K3OA 1NCQC 3U0ZA 1W3XA 2NQYA 4Q8KA 4CUAA 4L2NA 3KLSA 4MGSA 2VW1A 4QPGB 4E8DA 1UN1A 4ZS2A 3H0OA 5IVJA 4KL1A 3S57A 4A42A 1GZCA 4AEMA 1MS5A 3IAPA 5JI9A 3E5UA 3HEIA 3UK9A 5BXXA 2FCVA 2Y6JA 3GCXA 2C1FA 4ASKA 3NNGA 3POGA 1F35A 1H2LA 1I6XA 3FHAA 3HBKA 3B01A 3PLQA 4CPBA 2RS33 2UWCA 1BCXA 1U5ZA 5CADA 5LA2A 5CFCB 1JODA 2ZKNA 5IW0A 3SQOA 3T0AA 5CNAA 4AHYA 4QKFA 4XQWA 5KBFA 1BHGA 1E5IA 3IPVB 4R9AA 1AR91 5LBEA 5C71A 1PM4A 1UYPA 5LW9A 3PUQA 2ZX2A 4B4RA 2ZABA 4P9JA 5JWPA 1WA6X 3CU7A 3JBG3 4JX0A 4Y1UA 1C8NA 4QM8A 1NUKA 1ULPA 3ASIA 2R49A 3WD5A 4FBFA 3ZKUA 4EWDA 4QX3A 4HPKA 5IK7A 3IN9A 5F2WA 2C9AA 3T30A 1MPXA 1RL3A 5D8AB 1BKZA 3FUOA 4YW5A 4Q8LA 2RJ2A 1DQ4A 4XFAA 4AEDC 5K8SA 3IDBB 3HIFA 4JKLA 3OEAA 4P9IA 4WVMB 1VB2A 1OD3A 2TEPA 2R6QA 1PO12 4FCAA 5CB7A 3DYPA 2XJTA 5FWJA 3U75A 4LNVA 1KS4A 3IBMA 3LPFA 3MW4A 3VHRA 3V65A 3O1OA 2YFZA 1Y9QA 1Y9MA 2WFF2 1W6QB 2BEOA 1Q43A 2VZUA 1VR3A 3Q8BA 4V2WA 3FMGA 1Q8VA 1LESA 4BQXA 3ZPYA 3LD8A 5T55A 2WO1A 1Z0HA 2VD7A 2H0VA 1NCRA 2DTYA 4OUSA 5FOJB 3WW3A 5HCHA 1SEFA 2XDVA 4R8HA 4XDQA 2UWBA 3VBRC 4B1MA 3POFA 4CUBA 4XUOA 3WQ7A 4EN8B 5FY1A 3N7KA 4YSFA 1CAVB 4OCTA 1U0AA 3GHNA 3R4UA 4XAAA 3VN4A 3BCWA 3LA3A 2YXSA 4GA9A 2RDSA 4LJHA 2PHRA 4E2QA 2XLAA 4IV1A 1DQ6A 4RS5B 3KV9A 4FOVA 2OUJA 3VZOA 2JG9B 4NVPA 4IV3C 1L3JA 3U4SA 4CP0A 1U5IA 5I8TA 2Y26A 1EAH1 1KQRA 1UKGA 3VL9A 4H2AA 3K48A 4ZPIA 1OFNA 5DAVA 3M1HA 4HVRA 4AQ6A 5DN2A 3WQBA 3O1PA 1VAVA 2E53A 4CUGA 3OD4A 4YGDA 1W9SA 4Q0QA 4Y26A 2ZAAA 4Q4X3 2E6VA 4WBBA 4XPVA 3WVJA 2WINB 1ZVFA 5AC92 1BYHA 2F4PA 3NW4A 4HVQA 3WNOA 5BNPC 5FXXA 1W9WA 3ZXJA 2XUEA 4XZUG 4OI4A 4XF9A 5FMBA 4A3ZA 2ERFA 5ERLA 2PHFA 4AQTA 3UYJA 3K4AA 2A7AA 3PUAA 3CO2A 2Y6HA 4JV4A 2YPDA 4QHZA 4XIOA 4KNCA 1W6MA 2XJQA 1UO9A 1RUI2 4LKDA 4M3CE 5C9AB 1UD1A 4XFFA 2GNMA 1DQ2A 2JIJA 4RA0A 4CU9A 4M3CB 3POEA 1GYKA 2RS32 4TXWA 4QPWA 1XPWA 2DBNA 5IVBA 1GBGA 1OOPB 4GH4A 3H1MA 5CU1A 3DKQA 2L9LA 3JBG1 1NOVA 3Q8AA 2OA2A 3WUDA 2H0BA 2HEWF 1B35B 4FPEA 4FXGB 3MW3A 5F2SA 3VKNA 4CDWC 2J42A 3I2GA 5FMCA 2X8KA 4IETA 3E6CC 2Y8KA 4BISA 1AR82 1OMIA 1W8TA 1Y4WA 4Z2WA 2OPWA 2DVDA 3AKTA 3AYEA 4MHRA 4PQQA 4QX8A 2OXBA 4G4FA 3JBG2 4P14A 3CZJA 3RGBA 2QQPA 2ZMKA 2WWJA 2LRPA 4IGPA 4CCOA 2VAUA 1OUSA 4Y1VA 3OD0A 4Z82A 4AGRA 4CU6A 4ZU7A 3ILFA 2UY9A 3MUY1 5JOZA 4BPZA 1C1FA 3GJBA 3K4DA 4QKBA 4YW1A 4AEDA 2IXHA 4B1LA 1NQDA 5F5QA 5FZOA 5HV0A 3TN93 5JR2A 2D6MA 2WAAA 1K5MB 1UX6A 2V5DA 3VUOA 5DAQA 2D5HA 4JTOA 4Q27A 4UW5A 4AR2A 4I0AA 1N3QA 2XH6A 3KVAA 1SCSA 5IUQA 5IVYA 1CX4A 3WF4A 2HWF3 3RS6A 4DZGA 1GU3A 1DQ0A 4LHKA 1UWWA 2WLQA 2B46X 3CJIA 2UU8A 3OGRA 4BH9A 1QMJA 2BBAA 5HCBA 3O1UA 4GJZA 4XXAA 2VE1A 2ZCWA 1W04A 2D3RA 4OHXA 3HQUA 4XDOA 2CY6A 1XNKA 2IUWA 1M06G 4YGBA 5FREA 1XRUA 1VBB2 4ZZ5A 5L36A 5HV4A 1D4VB 1LJ7A 1XNBA 3CJXA 5JXIA 4UW3A 1REDA 4QGNA 3AKQA 5I93A 1BVP1 4BQ2A 4I2OA 2WDBA 4IEUA 3ME2A 2V72A 4FQZA 3H3ZA 1IOAA 1CIYA 1F4AA 3KS7A 1WCSA 2YC0A 3ZXLA 4AVSA 2E9QA 4Q4X1 4W6YA 4BK4A 4CEYB 3NAPA 5LRSA 3OYWB 3BUCA 1LECA 1H8TB 4OHZA 5CFDB 2RR12 2VL4A 1MQTB 4GQ7A 4KMQA 1JZ3A 3VBHA 4E8CA 5FYBA 1TMF3 4GMP3 4GAZA 3IIAA 2XB6C 1UIKA 3A22A 3LF7A 4PQ9A 2K2SA 3KWVA 1RUF1 3CDZB 3S7IA 1XBFA 4XBQA 1RVF3 1GOHA 2WNUC 4Q4X2 3USUB 1W9YA 1QJU2 3ZFGA 2VR4A 1FOD3 1UYXA 2ZPXA 3ILNA 5A3WA 3INAA 3VZKA 4NIAA 1GWLA 3AMMA 3SXWA 1W8HA 2XKPA 4OLLA 4LOTA 2C26A 5T52A 3AZVA 3D4KA 3I49A 1KDKA 3HQRA 1K5JA 2ZEXA 3ACFA 2D40A 3LCPA 3POYA 2BUKA 1AL23 2QQVA 4LBQB 2DDUA 3KSCA 5KC6A 2PAEA 1WWYA 5F6LB 4QPIC 4BWOA 3ZN5A 3A0NA 4BJ0A 5JR7B 1IGOA 4XJWA 2WBKA 5FZ9A 4DQAA 5FZ7A 5HI0A 1ULOA 2ZJCA 1LTEA 2N7GA 4OZXA 4K20A 3SEEA 2DU0A 5EJ1B 4RR3C 5IHRA 3HT2A 4WZFA 4FP2A 4LBQD 2OKXA 4QU1A 3LOBA 5C3RA 4A44A 5C33A 4AW7A 2OUHA 2ZOEB 4CDXB 1V00A 2PLV3 2YHJA 5FY8A 5A1AA 2PAKA 3GBFA 2ZMNA 1VBA3 4RQPA 2WNUA 3C8XA 4AEKA 4LA2A 4JZRA 4L11A 2X5IB 1RITA 4IGOA 4UOJA 3OPTA 2GMEA 3VV1A 4QQPA 4C91A 2G9ZA 1DZQA 4PHZA 2JDHA 4IEVA 3MIEA 4JGZB 3BU7A 2VO5A 5FYSA 5DDJ3 3TN91 1KFXL 1W8UA 3VDDB 2CNAA 1BEV1 3OGGA 3KQRA 4LKFA 3ZFEA 3I2OA 2J1UA 1ZZBA 2MEV2 3HD8B 5FZFA 2BVBA 2VMFA 2DCYA 2XJVA 5FO9B 2HWF1 1OI6A 1PMIA 4RR3A 4OI1A 3MV11 4CU7A 5JLVA 4OUEA 3TN92 1HQNA 3ZYIB 2HWD1 1I5ZA 1WMFA 1X50A 1YYNA 3GF6A 3LA2A 5F37A 1OURA 1FPN3 1O5LA 4Q29A 4UI9L 3OUJA 3TBDA 5I8YA 1JZ6A 3WNKA 1PGW1 1QGLA 2VTFA 3K77A 3CHXA 3TEYA 3UKVA 2HWF2 2A6XA 2YROA 5GALA 4CCEA 4DY5A 3KCCA 1EYBA 2AEYA 4LMFA 4A7KA 3WHTA 3ZFFC 4P5YA 4B7KA 1SMVA 1FYUA 3ES1A 5E16A 5A3TA 3SCHA 2XGXA 1G9FA 2B42B 4LO5B 5FZ0A 2VU9A 1PGW2 3KZ4C 4A7ZA 1D4M3 1Q8OA 5CKMA 4Q26A 4ASLA 1WW4A 2BNOA 1JBCA 4QM9A 5HBAA 2OIIA 3NL1A 1R082 4ISRA 3VHOA 1YHFA 4JGYB 5JOYA 1TMF1 4GMP1 4NHLA 1COV3 2V4AA 3BTXA 5JSPA 2JXAA 4XMAA 3MPPG 2XL9A 2ZZQA 1A8DA 2TUNA 2XWBB 4O9GA 1DGRN 1RVF1 3L2YA 4NPRA 1ODNA 1W90A 1VRH1 3OG2A 3IZOA 4JDOA 1PHMA 3KB5A 4DXZA 2PMWB 1FOD1 5EJ3A 5JOWA 3ALQA 2DUPA 4CDUB 3FFZA 1QWRA 2BYVE 2J1SA 1W0NA 3AFKA 1TMF2 1EUUA 3I59A 4K21A 2Q8DA 5BV6A 4C0BA 4CP9B 1VIWB 1H8VA 1BVVA 1AL21 1RVF2 1OFSA 3ZYBA 4HSJA 2TNFA 5C6CA 3DN7A 1OVPA 1HRI2 5JZGA 4UF0B 2PQQA 5IFTA 1TE1B 3IT8A 4MXVA 2HBTA 2BFUL 2XJRA 4WZCA 5BNNB 4COWA 3ATGA 3MYXA 5CIRA 3VBOA 4FTBA 1NLQA 3BU0A 1FMD1 3DPRA 5J48A 2P5BA 1CAXB 5CKQA 2I45A 4YZ3A 3WINE 1AL22 1IZ3A 1LGCA 1ND3C 3VD5A 4LXLA 3RYRA 1E5HA 1CD3G 3RMYA 3M70A 2PQSA 1WD3A 2PYTA 2WN2A 3POIA 4JRAA 2JDUA 1STMA 2BDRA 4NR1A 4QQ2A 2PLV1 1JU3A 3ZSJA 1FV2A 1VBA1 1VB4A 5AVPA 1XOYA 5ACA1 4LQRA 4FVVA 2ZX3A 2A1XA 2JDPA 5HPOA 3M8LA 4YM3A 4FPFA 3KCYA 1LNSA 1SG3A 3ORJA 1XC6A 1GWMA 3GCWA 4AVTA 2P17A 4N7UA 3CF6E 1F5JA 1BK0A 3VBFA 1VAKA 4BXFA 4LO4B 5DDJ1 5DUXA 4AEJA 5KC5A 1GZWB 2Y33A 1HDKA 3BIWE 2VXJA 3M4FA 1YIPA 3B02A 5FUPA 4LE4A 3PIJA 3U4XA 4Z8BA 1OQEA 1KXGA 3PUSA 3PUHA 5C8WA 4CCKA 3ETPA 2F17A 4UT5A 5LASA 1NZCA 4PDWB 4Q1RA 2V4VA 3D0JA 4TWTA 1BJQA 1W06A 1FPN1 2WZR2 3P3PA 5K0UC 2BBVA 1LEMA 2P2KA 2QCSB 1QJFA 3VD3A 2XR4A 5FPUA 5LK7B 4BB3A 4IDZA 4UFJA 3THCA 4OQ8A 1ZZ8A 1R1ZA 4X8NA 3D6EA 2QFEA 3OCPA 2R061 4Y1YA 1UZWA 1VJ2A 1WBLA 1OSGA 5F9TA 5LBCA 1YO8A 4HK9A 2XWJB 3ZXAC 2GU9A 3POJA 3VZNA 1RUD2 1IG3A 3QOPA 4FOYA 2AYHA 5BNOB 5BY5A 5JIUA 1DF0A 5I0RA 5A80A 1RUC1 3FE5A 5C4WC 2PELA 1C28A 2BP6A 3LOIA 4MGZE 1BMV1 1HB4A 1NX9A 4XUQA 2ARBA 2C9KA 2P3YA 4XUPA 2ZEWA 4QB1A 2IVJA 1OC1A 2R1DA 3C7OA 3L9JT 1J3PA 3OB8A 3WY6A 3NSTA 2UURA 3RZZA 1COV1 5JOXA 4Q2FA 1PO21 1D4M2 3NJVA 4MXWB 4HVOA 1UPIA 2D6OX 3PVEA 1DGRA 2RVAA 5FO7B 1NY71 1KFUL 2XBO1 4MGYE 3WQ0A 3TB0A 1RUJ1 3TWIA 4B4PA 3WNMA 3MLLA 5DMYA 2FDKA 1NA1B 4WM7B 3KVBA 4F8AA 3O1MA 3DXTA 1UOFA 4WM8A 4XJ8A 1RJ8A 1W8FA 4XXPA 4JC1A 1EY2A 3LFIA 2AH2A 4Y5SA 1QEXA 3PVNA 4W8JA 2AREA 1NY72 3GNEA 1C4RA 2D43A 3OGSA 4YW7A 2LROA 4MADA 2HJIA 5FYUA 4H7MA 1HV0A 1REEA 2NYYA 4MH0E 2Y34A 2E26A 1WUVA 1RIRA 3TEXA 3KQ4B 1PGSA 1FNZA 4N53B 1AR62 4CU8A 2RE9A 2IFWA 4LE3A 2ZHKA 3SH4A 3GALA 5H9QA 5FLJA 2WKKA 1UZVA 1KJLA 2RJLA 4FOQA 2QQOA 4GD4A 2P34A 2W1SA 3PMSA 3VHNA 2PTMA 3B94A 4UBHA 4CVUA 4P9LA 4ZU4A 5C8CB 4XACA 3UGHA 2WNVA 4N43B 1ZZCA 1VRBA 1VAMA 4Q4W1 3TEWA 3AJZA 3MICA 3VLBB 1JHNA 5K4LA 2ENRA 4OHYA 1BLZA 4BHPA 5F1RA 2ZS6B 4UW4A 3SCGA 2Q8OA 1QNWA 1U12A 2FZ1A 5LBBA 3ZN6A 3EQEA 3U14A 5DG2A 1LHNA 3I8TA 4XFHA 3ZYPA 1CZTA 4D6RA 4SLIA 1T2XA 5I91A 4UFMA 2WJSA 3EO6A 2LALA 2DWRA 3HJRA 5BUVA 2QZ3A 2XVKA 5FP4A 4B4QA 2H6BA 5A3NA 1PZ9A 1X8EA 3BOPA 4KG0A 3W20A 1VBD2 4RFRB 2WS91 1AXKA 3M7AA 1NAEA 3RNSA 1U5XA 4YVWA 2GMPA 3TYJA 2ZGKA 4XBNA 1NCQB 3AB0A 2UYBA 1EPZA 4XJ9A 4FPGA 5LY1A 5FKCA 1RJ7A 3I2IA 1S2KA 5EP9A 4AWDA 4R52A 1WD4A 2JG8A 3CEWA 3NWKA 1FT9A 4JQTA 2FDFA 4M4RA 4FPOB 3VDCA 5DZEA 2WC2A 2Q1MA 2E33A 3O0VA 1QQP3 3POSA 2WNOA 2VUAA 1QKQA 2VZTA 1J1TA 3F2ZA 3FUQA 1CN1A 1UYYA 3N36A 1TME3 5ABJB 1JZ4A 2GH2A 5FMDA 4PBPA 3QCWA 1PGL2 3AMPA 2W0XA 3USSA 1RUH3 3MO4A 1S2BA 3MF6A 3NV2A 4NN0A 4D7YA 3V0AB 5EFUA 4BQ1A 3I3QA 4CEWC 1GZ9A 1CAWB 2VZOA 2XHKA 1IQAA 3OPWA 3T1MA 4CXWA 1HRV3 4QXBA 2ZGRA 4P08A 1CQ9A 2VNVA 2ARCA 2WN3A 3AYDA 4AFAA 1ND2A 4B29A 1S0GA 4FFHA 1MACA 1ZRRA 4G9SB 1GQPA 1YI9A 4FAGA 2WO2A 2BGOA 2WT1A 2JECA 4MGQA 1TZOA 4SBVA 1PVC3 5KXCA 4ZKTB 5KWRA 2NMNA 3AZYA 1RUG2 1H9WA 2JDNA 4AEDB 4BQ5A 2D44A 3K51A 4JHZA 3I7DA 1H4HA 2VC9A 1QIQA 4HK8A 4E9KA 3N3HA 1GP6A 5DPNA 4RHV3 1F8VA 5A32A 2GDFA 4ARYA 2SBAA 2CHHA 4Y1XA 3U07A 3AKSA 5F6KA 2HWB3 3V64A 5CISA 4KQ7A 4MV2A 2CGNA 5FZEA 5A33A 5D2AA 3RQ0A 1SLAA 2W9XA 3GZAA 4XOGA 3E6DA 4P00B 1ENXA 2D3SA 1BZWA 3FLRA 5F8PA 1G9BA 3ZSLA 4PLNA 3QH6A 4YVSA 1QHDA 1RINA 4O65A 5IK8A 1QDOA 1MZFA 1XNTA 4Q1PA 3VBRB 3HAGA 2Y0OA 3URFA 1JYIA 3AC0A 4FP3A 1OA4A 4PLMA 3ZVXA 4D6QA 1YNAA 3FJSA 5KXBA 3HN1A 4W6WA 4XDPA 2VNGA 1W2TA 5DG1A 5GZDA 1HX6A 2VW0A 2LUWA 1CZVA 1YQ8A 2ZGMA 4LHLA 4YZ4A 3T09A 5FPBA 2AR6A 5DUWA 3I4IA 1JUIA 2VOTA 3Q8EA 3QH7A 4IV3B 2ORXA 4PBOA 2D3PA 1W2AX 2ZKLA 5C3SA 4MYEA 1WW6A 1MEC3 1JN2P 3S5QA 4P9WA 2CDPA 3IWZA 3TAYA 5J36A 3H1WA 3WF1A 1N1VA 3H9AA 1WCUA 2ET1A 4L8QA 5F5AA 1SPPB 2WSVA 1DP0A 5JUVA 2BGCA 1K12A 4FPCA 5FZBA 1PK6C 1NT0A 1QOTA 4PT6A 1LEDA 1NCRC 3N9LA 1CIWA 3JXSA 4ET7A 3BIEA 5BNPB 4ORFA 2PHLA 1UU6A 4M0HA 3MZHA 1J3RA 3HWJA 4F3JA 1QQP1 1AR92 1H1IA 5FUNA 2HWC1 1ZA4A 2ADEA 2DBIA 4LK6A 1QH6A 1TME1 4AGGA 2E7AA 2JB4A 2XVGA 4S2HA 4EN7B 2I2SA 2VVDA 4COYA 4IV1C 4XF0A 1LOAA 3B69A 4UXAA 3MV01 1RUH1 4AI9A 4WVVA 1JH5A 3MF9A 3MIGA 1LB2A 3H7JA 5IAVA 5A7NA 4TZDA 4MUVA 4H55A 1D0HA 4GULA 2Q1ZB 1GZTA 1HRV1 5KXDA 1W99A 5FO8B 1UZ0A 3RWKX 2QVSB 3UT0A 1W2NA 4GKXA 5A7WA 4E4DX 3LB9A 4QHBA 4XCBA 2P3KA 3THTA 1RUH2 1IG0A 1YXWA 2W46A 2VOVA 1R1A3 4NHYA 4CXYA 1PK6A 1DGWA 1DQ1A 4JKKA 2CGOA 4CDWB 1HXS3 4AQSA 2Y6LA 1HRV2 1PVC1 5HCFA 3SHRA 3W9AA 3FHIB 2JDZA 1Z7S3 3LE0A 3NNMA 1W39A 1APNA 1J1LA 2WZEA 4IESA 5FBZA 3T2OA 3AL6A 5A7SA 3RZMA 2FZ2A 2WZPP 4K7JA 1URXA 2AEZA 3PNAA 1T6GC 2G1MA 2VOXA 3KGZA 3LAGA 5FAXA 4UFLA 2NLRA 3O0XA 4FSJA 4RHV1 4ATEA 4TLFA 4XFGA 1I1EA 4QKDA 3WUCA 2RDNA 4Q0VA 1IHMA 1OT5A 2CTVA 2HWB1 3U11A 1MS4A 4LKSA 5CBLA 1AR73 2EIBA 3PU3A 3MIFA 1SFYA 2VQTA 4EYUA 2QQMA 3PHMA 4IQPA 5FLHA 5J96B 3NV1A 3PURA 4CUCA 2FHRA 3ZLIA 4GH4C 4OHVA 1YFWA 1V6NA 1QJX3 1EAH2 3WHUA 1AYN1 1F15A 2B4KA 1D2QA 2ZBJA 1X82A 1JW6A 4H14A 3RMXA 5IK4A 4HBNA 4DEVA 2ARAA 3UJQA 3ZPOA 4D0QA 3N4MA 3MUZ1 1RUF3 4ATFA 1PNGA 1OA3A 5FPAA 3PTYA 3IIIA 4Y1ZA 5L7OA 2QZ2A 4JHTA 4S2DA 4CP1A 3A21A 3C3VA 2DFCA 2BW8A 5CKNA 2RJKA 5C5TA 2P3JA 4Y22A 5GZCA 4N9IA 4UFHA 5A1FA 4LBKA 3LSDA 1MEC1 2DCZA 2GH8A 5LCWL 1LODA 2JB8A 2VVEA 2ZAHA 1UPSA 5L73A 1IPKA 4KWJA 4DB5A 1CZSA 2BERA 4YG6A 5FP8A 5KHIA 4QX1A 4NOTA 5CAZA 3DYOA 3VD9A 4ES9A 4AFMA 2WT2A 2R043 4R9DA 4CTEA 4JDMA 2O1QA 2YY1A 3WDXA 3I2HA 3E1F1 4QPGA 2JDKA 5C3OA 4K8FA 1YEWA 2VW2A 1O3SA 4UFKA 1REFA 1SLCA 1UXXX 3CJIC 3EHKA 2WNUB 4FPJA 5CA6A 5FJKA 3RYPA 4ZONA 1RC6A 4FT8A 3A23A 2NM1A 1AX1A 3B93A 2RG4A 4FFFA 4LTAA 3WF2A 2W1WA 3ZXFA 4NIHA 3UESA 4GWIA 3ZMOA 1HB1A 5FZ8A 3LKJA 5FXWA 3IPVA 5LEJA 4EROA 1B09A 2YGLA 3H3LA 1IS3A 5JAXA 3OOXA 5KXEA 2GN3A 1W2UA 2YU1A 3K4ZA 4IEPA 3WXPA 2JKBA 4QPIB 5FZMA 1YCIA 2OW4A 5FYTA 2HEVF 4A6OA 5K9YA 5CG8A 2X10A 1BEV3 3HQXA 3D8CA 1LOFA 2WZ8A 4XETA 1R1A1 1D7PM 4CSWA 1WCDJ 2QNKA 3JQXA 1ALYA 3NAPC 4RR3B 5DQ0A 5E88A 3VDAA 1QJEA 1POV3 3NJZA 5FZLA 1HXS1 2VNRA 3WLUA 3VBHC 5D8AA 4Z1VA 3RJ2X 2J1RA 1Z7S1 1RTVA 3NV4A 1O4YA 1IKPA 4BMEA 2XOMA 2HWD3 4WVMA 1DGLA 2G9GA 2GP3A 2JJ6A 3KF5A 4LO6B 4CRQA 5A3OA 5LEKA 3JCIA 1V6KA 3HT1A 3WG2A 2Y64A 3ZFGC 3H42B 2A3XA 2XQRA 3B00A 4BIFA 1NXD1 4X6RB 2RS53 1Z7S2 1W6QA 4BIOA 3BGAA 1AR71 3GHMA 2X05A 5EZWA 3U78A 3SKVA 3S30A 3WW1A 4AL9A 4XABA 4RGAA 2J22A 2VH9A 3SMHA 2XLFA 3ENRA 3H1YA 3T4VA 2BOIA 3ACIA 2PN5A 2ES3A 1UY2A 4I0BA 1O8SA 1S0FA 3I2KA 4INDA 1ZYBA 1J3QA 5GZGA 3VDBA 1QJX1 2ZGLA 1SDDB 1AR72 2P6CA 3I2FA 2CU5A 5GZFA 2CDOA 2KXLA 4XW3A 4QD2A 1CAVA 4L9BA 2XQXA 1XU1A 5EYXA 2JDMA 3UV9A 3MLKA 3WNPA 3RDIA 3M3CA 4MSVA 1W6NB 1MR5A 4RS5A 4GALA 3WEZA 2NPIA 1S0CA 2JG9A 1X9PA 1VRH3 1BBT3 2VZPA 1QJX2 4Q5OA 2J7MA 1RHI1 4I0WB 4RQPC 4Y20B 4DY3A 5FQ0B 3ECQA 4FO9A 1UY0A 2QKDA 2W94A 1US3A 1QNYA 1H6YA 4I02A 4PLOA 3ZFFB 1CJPA 2GALA 4AXOA 2P1BA 4K9SA 2CSGA 1LULA 4GJYA 1JZ7A 4ZHNA 2RMU3 2O0OA 4TYSA 1RUF2 3RI8A 3J9SA 2XMLA 1OOPC 3BALA 4KGGA 4QB6A 5LY2A 1XB9A 2OPKA 2W47A 5T5OA 2VZQA 4AI0A 4MX3A 5IAXA 1XNDA 3ZYFA 5GKAC 1CPNA 2ZEZA 3ZFEC 1SQ4A 4FFGA 4AE2A 2R041 1N3OA 1B35C 4NRQA 4LBOA 2XJPA 1FMD3 4CCDA 1LKNA 2ZGSA 4I3GA 3HMYA 3C7FA 5FXVA 2GP5A 3UL2A 1HQLA 2YBSA 3I2DA 1W0PA 2IXCA 3SH5A 4E4SA 3BTZA 1RB8G 4OFGA 4RGKA 2VXRA 1KS5A 2NZ9A 3FBYA 4NWWA 5E89A 1JHJA 3OTFA 1VBC3 3FHQA 5LZ6A 2R042 3I3DA 1QJZA 3ACHA 2IZWA 4PIZA 3VKFC 3VD7A 2ILMA 5FY5A 4GMP0 5ACA3 1PM7A 2YDEA 3S7EA 5C9AA 3WP4A 2B39A 2BOJA 2VECA 4BQ3A 3T08A 4LPLA 2ZTNA 1H0BA 3N35A 2MPFA 1E5SA 3TRSB 1ASJ3 3W5MA 4P9GA 1JOBA 1GMMA 1OOPA 1RUE3 1OF3A 2Q30A 1VBE3 2EALA 3OF1A 3POBA 3QBQA 3FZ3A 3CLPA 3PTRB 3VZLA 2ATFA 4JTNA 5FBJA 1B35A 4L97A 3WZ1A 1ND3B 3AKPA 3WP5A 1POV1 1HIXA 2RV9A 1G9DA 1WBFA 1LOBA 1DZRA 3HBZA 1W8OA 1UY3A 2XJUA 4FTEA 2UY8A 2WO7A 1BEV2 4QX0A 1ODMA 3J7MA 3CBNA 5IATA 3WDYA 1F31A 5J3UA 4S2FA 2VVFA 1NE4A 4IXLA 3MIDA 3AZZA 2Z2SB 1XYPA 3IKWA 2QJVA 3BI3A 2RS51 2R063 3QLQA 1S0BA 4LEJA 1ULFA 4K1YA 2HWD2 2Q5TA 1K5MA 3NKTA 2E7QA 5LA1A 4H7LA 4GXLA 2VNOA 4YGEA 5JZGC 1JOPA 4Y33A 4AZZA 2AENA 2CAVA 1WKYA 2J1AA 4UW6A 5HXMA 3WCRA 1RMU3 3EB7A 4X6QB 3ZKYA 1W6PB 1RUC3 1PNFA 3ZXGA 2IC1A 5L9RA 3VBOC 3LIGA 3DPRC 1CGPA 1A3KA 1G7YA 2PXJA 4XE9A 5F39A 3DCQA 4AHZA 3O5SA 5T5JA 3DL3A 4K8RB 4Z07A 2WFPA 2QQLA 2VUCA 5K0UB 2VMIA 1PO23 4NO4A 5JMOA 2BWAA 3DUIA 5F3GA 4BK5A 3KV6A 4FPHA 1UMIA 4LBJA 1BBT1 3H8XA 1SBEA 2P4EA 2XBO3 1LCLA 2HKXA 2IVIB 2J1TA 1RUJ3 2ZEYA 1R093 3ST7A 1XU2A 4A4AA 3JQWA 5I0SA 3WP3A 1I9RA 1Y7BA 4L0PA 5IWFA 4MO3M 3UNPA 2RMU1 4KBBA 2XKOA 3THPA 3VBFC 2JICA 4YFZA 1YQ2A 3X29B 1X8MA 4LORA 1VRH2 1BBT2 1Q3EA 5C4WB 3EYPA 3I97A 5EXOA 3HN3A 4PI2A 1D2SA 1FOD2 1ULGA 3OYWA 5LB6A 4D3WA 1H8TA 4FPLA 5IT6A 5CFDA 5KHKA 3J7NA 3LWCA 3VKLA 3ZYHA 1WLCA 2D5FA 2GNTA 3MIBA 2JWPA 2XJSA 3KT1A 2B45X 2UYAA 3AP4A 2R7EB 2GN7A 1QOSA 4LULA 3USUA 5A7OA 3KHCA 1UW8A 4V1PA 3APBA 1RUNA 4IGQA 1NE6A 1PMJX 1ZRCA 2X09A 1V9U3 1FXZA 1VBC1 4QQHA 1V6LA 3FC0A 2DTWA 4W50A 4BA6A 4MGIE 2DVBA 1FMD2 1OKOA 3BVCA 5LK5A 2J1VA 4DNYA 5A3PA 2H6CA 1KDMA 1YQCA 4LBQA 1A34A 4OULA 1S0IA 3ITQA 3RSJA 4CCMA 2BPA2 4Q4W3 4LBLA 4AF9A 4NPMA 4META 1VBC2 1ASJ1 2WQZC 5FPLA 1XSRA 1W9FA 3RWNA 2PLV2 1VBA2 2YC2A 1OLMA 1RUE1 1SZBA 4HSLA 5ACA2 3V0BB 4OZOA 1ENQA 1SFNA 1VBE1 4RGGA 2JDAA 2VOKA 4AG4A 5FZAA 2IXKA 5FYIA 2JKXA 4QQOA 4WV8A 4Y4RA 2OYZA 1ASJ2 3ZSMA 5FOBB 3RI9A 4HZFA 1UY4A 2XXZA 2Y38A 4NE9A 4CDXA 2WS93 1L7QA 3LFMA 5DDJ2 2ZA9A 4BM8A 5C7GA 4Q4V3 2X5IA 1RXFA 3ZIWA 1DHKB 5JSOA 1JUHA 1UAIA 5EYYA 3WDTA 2E63A 2JD9A 4CDQC 2PHTA 4HLTA 4AI1A 5LA9A 3O1SA 4EN0A 4JGZA 4WM8C 2YPJA 1SBDA 2QDRA 1G6NA 1V0AA 2VMCA 3R4SA 1WGPA 3VDDA 3PUIA 1ENRA 2OT7A 4XF1A 1LGNA 1W8NA 1FPN2 2OX0A 4QMAA 5J98B 4BQ4A 1UNBA 3PL0A 1DLLA 1O4TA 2YC4A 1ZBE3 1AZDA 1RMU1 1S0JA 1HN1A 1HN0A 2AACA 4B8EA 2FBEA 1JMUB 1MS1A 4AFCA 4DS0A 2W91A 3ZOIA 1C57A 1S55A 2R062 1O7FA 3T2PA 1JS9A 1TG7A 5L9BA 4XURA 3VBSB 1BK1A 3T0DA 1MS3A 2NP0A 1C8M3 2YV8A 4UAPA 5J7MA 3S0MA 4F7ZA 2P3IA 4XFBA 4YYOA 4UBGA 2WIIB 1LU2A 3OBTA 4YGCA 1BXHA 4QU2A 4BQYA 3N7MA 1RUC2 4CE8A 4JVAA 3ZXEA 1Y3TA 2TBVA 1GOGA 1BMV2 1WMDA 1Y9GA 4AYUA 3WP6A 3ZO0B 1R091 3CL1A 3J4UH 5FZHA 2ZHLA 2WNVC 2ORZA 2WUHA 4CDQA 4FI9A 4E4HA 4JAAA 3UGGA 1COV2 2FMYA 1PO22 5JDBA 4LUKA 4A6SA 3UGFA 1H30A 3AFGA 5IJRA 5D21A 5LBFA 1JTZX 1GLHA 3I3EA 1UX7A 4XC9A 2G4IA 2XBO2 4RYDA 3OUIA 5FKBA 1I3HA 1ZZ9A 1RUJ2 3J8F3 3NQHA 2VZ1A 4CEWB 4D69A 2Q4SA 1OA2A 2EIEA 4IE4A 4JGYA 5KHHA 2B8MA 2XUMA 1CAUA 3D3AA 1H2KA 5FZ4A 3OBAA 4AAXA 4MGTA 2EAAA 1L7LA 1S0DA 2W68A 4N9HA 4YVWC 5F5IA 2YG0A 2JD4A 4GB33 3GBWA 2W87A 4BCUA 1JZ8A 1ENSA 2R073 1V9U1 2EVXA 3DF0A 5FYZA 4CDUA 1UXZA 2JG8C 3JZVA 1W05A 4XHBA 4LLOA 3W21A 1AX2A 1WW7A 3DKWA 3OY8A 4CP9A 3VHPA 1NG0A 2R30A 1LENA 3AZXA 3T0BA 5LWBA 1Z78A 4ISQA 4FTSA 4UF0A 3AMHA 4E2SA 2XPJA 2QBXA 3D82A 1CWPA 3BPSA 3H8RA 5BNNA 5CYYA 1V6MA 3ZYRA 4L99A 1CAXA 2VCBA 3AL5A 1IPSA 2VBDA 4I01A 4KWLA 1ZZ6A 4MOAA 2Y6GA 5GLVA 3LEMA 5FYMA 2BJSA 4BLJA 4GKYA 1C5HA 3JD73 4Q4W2 2D97A 5C3PA 3T1LA 1WLWA 2A6ZA 5H9SA 1SLLA 4RN5A 2FMDA 1ND2C 4J25A 4M4PA 4UFIA 4FXKB 4CPBD 4A45A 4DFSA 4BDVB 2GC2A 4QXKA 1X33A 2EICA 4Q4V1 1ACCA 1MZEA 3M2MA 2ZGQA 2C24A 4EWAA 4HPKB 4QGLA 4DXRA 5FJHA 5JMCA 4R4XA 3AXDA 5J1XA 4HXCA 2WS92 3VL8A 5I0DA 2ZGOA 2EA7A 3LEKA 2HWC3 2FDHA 3UJOA 3RZHA 1GZWA 4Q4V2 1YJKA 4ZXKA 2C0ZA 3OSDA 5IFPA 4YZ5A 1LAJA 1SDWA 1V6OA 1VLNA 2V09A 3MIHA 1ZBE1 3JB4C 3SISA 3HR9A 1PX3A 1S0EA 3T4HB 3UKNA 4NMIA 4FPKA 3B5LB 4E4ZA 1C5IA 3HPNA 1IS4A 5H9RA 5FCCA 1C8M1 3H50A 1DQ5A 1PO13 3C7HA 1PK6B 2GC3A 4OI0A 5IVCA 1NCRB 1PX4A 1G8WA 4YVSC 1O5UA 1A8MA 4MG2A 2OVUA 2YBPA 4E27A 1Q8PA 3M3QA 3BODA 3ZX7A 3AXEA 1O6UA 5BYNA 3B9CA 1SLTA 1IS5A 4QX7A 1C8M2 1D0GA 4CCCA 1DCSA 3O1VA 5FUIA 1XSQA 4W4ZA 1YJLA 3J26N 5BNOA 3K46A 2LS6A 4XQ4A 1YQ5A 4IV1B 3ZIXA 1KGYA 1N1SA 1HV1A 4XILA 1UKRA 4DINB 3EMRA 4N53C 4YRDA 2EF6A 3J8F1 4XUTA 5GLTA 3AJYA 3O1RA 4URTA 4QX2A 4YW4A 3CIHA 2ZGNA 4NPLA 5L9VA 1UQXA 4P9XA 4XFIA 4MXWA 1AYM3 2VUJA 4OUMA 4V2VA 1MS8A 1WCQA 5FYYA 1O3RA 4GB31 3J8F2 3GYDA 2R071 1LU1A 1W6OA 3HNYM 5F5CA 4DEQA 1NA1A 4N43C 4WM7A 2A75A 1H4GA 1XE0A 3FBMA 3CZUA 4A2UA 5CEHA 1AYN3 1OPOA 3VBUC 2HH9A 1UU5A 4LK7A 5SV5A 1OD5A 4IL7A 4LT5A 1WW5A 1QJY1 5G04L 1CX1A 2AZ5A 1YFYA 1DFQA 4GB32 4N7IA 4K1ZA 3MI8A 3NNFA 4JCKA 3MFCA 3PJYA 3WW2A 5FDBA 1KITA 1LRHA 2Q0AA 1OH3A 1UF2C 1W6MB 2RDQA 2W5FA 5APAA 2KA3A 4N53A 1Q5OA 2DUQA 2K9ZA 1ZREA 4M0NA 4YNIA 1W8WA 2NMOA 2YB7A 4LR4A 3RZJA 3JD71 5F3IA 3GBGA 2R0HA 5BPXA 3S5AA 1OQ1A 2QQKA 1CONA 5JVVA 2PHUA 2CWSA 4QXCA 4DO0A 1F9KA 4F83A 4XTMA 4W6XA 4GH4B 1X36A 3FX3A 3JB8A 3NNLA 5FP9A 4XAEA 1ST8A 1LGBA 3FFQA 3PDQA 1RUI3 4YW3A 3R4DB 5C8CA 4Z2AA 4DXSA 4N43A 3JD72 4LBMA 5ABJC 5SV8A 3VBUA 3U10A 3VZJA 4BQWA 2VOWA 4K40A 5KHJA 1H9PA 3WQ1A 2ZZJA 4AFBA 1WMXA 4S2GA 4PIXA 2ADDA 3HVDA 3AYCA 4D8MA 1GNZA 2A73B 3M3IA 2W08A 4AOCA 1NQJA 1AR83 2YBKA 4J1XA 3IB3A 4XVHA 5F3EA 4AAPA 1QXRA 1QQP2 2QUOA 5FZOB 2YZ4A 2HWC2 4EN6B 2VQAA 4HANA 1TME2 3WR0A 1NCQA 2JE9A 2D93A 1PO11 2HYKA 4HKOA 3WDUA 4M00A 1A6CA 3ELNA 1AUYA 3O12A 3ZDSA 2PHWA 2HYXA 3SLIA 1UY1A 4E2GA 1VMHA 2DURA 5FRAA 2WFF1 1S2EA 1W3VA 4WVWA 5JI7A 4AFDA 5F7UA 3CJIB 1GP5A 1F2NA 3OBZA 1ZNPA 5ABJA 2FCUA 4ASMB 3F95A 2WABA 1O4ZA 5FIXA 4AHWA 2K46A 2Y6KA 4GWNA 4NHXA 4TLGA 5FYHA 1CR7A 1PIV3 1I5PA 1MS9A 2VY0A 3AP6A 5L7OC 2BFUS 2BZDA 2D7FA 4C1XA 3V0AA 1K42A 5J09A 3AYAA 1JYXA 4COVA 1CAWA 3SCFA 3O7OA 5GLUA 1XYNA 1PVC2 3I2JA 4CCNA 3WX5A 1IKQA 4GWJA 2ZHNA 5FZIA 3LEIA 1WCKA 2Y6FA 1EV13 3C7GA 3LA7A 1POQA 3SNMA 4XJUA 3THDA 1N47A 3QD6A 2PHDA 4MHUA 4XQDA 1AYM1 5FXZA 3ZR6A 4RHV2 4KU8A 2GSYA 1VBB3 1SHWB 3NAPB 4KI5M 3VD4A 5E8AA 5A7PA 1UOJA 2DUOA 4IEOA 3MEPA 2HWB2 3VBHB 2Y0IA 4I3PA 4QPGC 1J84A 4PI0A 2HEYF 1RYYA 3AVSA 5FV3A 3RG0A 3RYKA 2QDNA 1OF4A 1UU4A 4LHSA 4XMIA 2Q8EA 3RFRA 4EWEA 4YZ2A 5GJ6A 4YG3A 1AYM2 1HQWA 2K0GA 3BPZA 3AP7A 5IVFA 4LIVA 3N9MA 4DRVA 1H1AA 1AXYA 2WLPA 4HKWA 3VGIA 3IDAA 4P9YA 3ZFGB 1EPWA 3GZUC 4JRLA 2GC1A 4COZA 3I3MA 2P6HA 2RR13 4CP2A 5AC91 5CFCC 3AM2A 4EE2A 1RHI3 4OI2A 2WA3A 5E1RA 2WRAA 1AYN2 1SACA 5A3LA 1E5RA 1JI6A 1H1MA 3MGUA 1DYOA 1ZRFA 2A71A 1S1AA 1QJU3 4AI8A 1OXCA 1O91A 3NJXA 3AK0A 2A6VA 3U1XA 2Z42A 2WNEA 1YQ6A 3JUUA 2NN8A 1LOFC 2B7YA 2V73A 3VBRA 2VULA 3G6JB 4RSUA 5IK5A 3ZXKA 1DGWX 4TTGA 1RUI1 1QU0A 5ANQA 5E6HA 4DOUA 1ULCA 3GM8A 2W92A 4QHOA 1MEC2 2FDIA 1YWKA 2A6YA 3NNJA 2CL2A 4JDNA 4U36A 1IS6A 2X29A 1YLLA 3IMNA 3NRUA 5D8AC 2PAMA 5FY7A 1YI7A 2GZWA 2W1QA 4NHMA 2RS31 5FTTC 2BRTA 5IVVA 3E97A 3GXUA 4IV3A 4RQPB 5AVAA 1HJFA 2FCTA 1TNRA 4N8MA 3AMNA 4RL7A 1L7RA 4XYXA 1W9TA 2CAUA 5CFCA 3W59A 3T2TA 1UIJA 3CMGA 2BNNA 3NV3A 5CZKA 3V56A 5DUVA 1LOEA 1WLDA 1AF9A 1AR81 1YC61 2Z5WA 3KV4A 1SPPA 1V6IA 3MBWA 3HNBM 3UETA 4AI3A 1AL0G 1HLCA 1IQDC 3OUHA 3UKTA 5ISLA 5DUUA 4A7YA 1WMEA 3ZFEB 1XJAA 4DIQA 4QX5A 3WV6A 2WAOA 1FV3A 3TNQA 5BNPA 2R0FA 3E6BA 4Q0SA 2DF7A 5A6XA 2XL7A 2WWSA 3DECA 3DEMA 4COUA 2Q1FA 3D5OA 3KD4A 4TSVA 2QQJA 2WO3A 1F4HA 2MEV3 2V5YA 4RS5C 2PHXA 2Q8CA 1ZA7A 1PIV1 1R1A2 4ZZ8A 2JG9C 3VKOA 1N3PA 4QDQA 2F4LA 4RD7A 4GZ9A 1HXS2 1GFF2 4QGMA 3ACLA 4IERA 2I07B 3KT4A 4O61A 1QF3A 4XUNA 4QXHA 3R6SA 5JCTA 3S6PA 3O14A 4XEZA 1US2A 3BTYA 1PIV2 2D98A 2W95A 1EV11 3A7QA 4UWDA 5FMOS 4Z92B 4XHXA 2O14A 2IXIA 4KWKA 1OVSA 3QACA 4DPNA 1VBB1 3ZM8A 4BOWA 3DYMA 4YM0A 4CDWA 5KHGA 1VALA 3R0RA 2O8OA 5EWSA 2DV9A 3ZN4A 4HONA 5AFBA 3NKGA 3WSOA 3I3BA 1TEIA 4OHWA 4OMCA 1EV12 4XF4A 1O3TA 1UOBA 2ZGUA 4Q0PA 4AI2A 2B9VA 4HOOA 4ONUA 1POV0 2DYCA 2FD8A 3L2HA 2G19A 1R083 2A3WA 4YW2A 3ZMNA 4XF3A 2RR11 3G7DA 3AP9A 2ZGPA 4XZPA 5DAXA 3I59B 3DGTA 5C9AC 2IFRA 3N9PA 1JZ5A 1OPMA 1Q8QA 2AC1A 1YRZA 3AVRA 2VMGA 4I09A 5DABA 5LRRA 3O0WA 1VPHA 4OVEA 2QQIA 5I0TA 5JZGB 3KCXA 3RRDA 2QQUA 5JXGA 4GIQA 1RXGA 5ANNA 4BXSV 1QJU1 2KD7A 3MLJA 5A6QA 2GAUA 1OKQA 5I8SA 1RHI2 3VBOB 2KR2A 2ZX4A 3DPRB 2OZ6A 4IE7A 5FPZA 1J58A 3KHBA 5I0UA 4YFWA 4XIKA 5T54A 1HRI3 2XVLA 5D1IA 1F5FA 1C3HA 1FX5A 3KV5A 4IEZA 4DMIA 3B9IA 5T5LA 4FAHA 3NMBA 4BMBA 4Q4Y3 3N7LA 4ZU5A 2HBUA 4NJ4A 5JPNB 4YM2A 2EIDA 1N1TA 4IE0A 4BE3A 3RVHA 1ZZ7A 4MLOA 2ID4A 4C1WA 1XXNA 3ACGA 1OLME 3LQCA 1UZZA 3FN9A 4P5HA 5JXJA 2I74A 3VBFB 5GM0A 4CCJA 5HXVA 4ARXA 1K5MC 1XE7A 3AKRA 4AVCA 4NHKA 5DZFA 3ZYGA 4KG8A 4QT6A 2DFBA 1UYZA 4M3CA 1QH7A 4Q0UA 4QWNA 3FL7A 1NKGA 2VZRA 5A6YA 2JENA 1H6XA 1W8ZA 1DZTA 1PZ7A 3K3NA 4FPYA 4AGVA 4NAMA 4LO7A 2GC0A 2OS2A 4J6GA 1JYWA 3WF3A 1DDLA 2R16A 1V70A 2C6SA 2YU2A 5T3NA 3RZGA 4K6BA 2YUEA 3P6BA 4KGQA 5GLZA 1VMFA 3RZLA 1J83A 2VCCA 2A3YA 1EP0A 2MEV1 2W3JA 3LDBA 5T50A 4XTPA 3WCSA 3CKHA 5A6ZA 1UCXA 2QQNA 1G9CA 1AVBA 3GZTB 3IAQA 3JU9A 3Q9OA 5FPVA 3N7JA 2C5DA 3MPBA 5FZ3A 5FK8A 2A5ZA 4QPIA 3LGRA 1GKBA 2VQUA 1MZ5A 3KT7A 4YG0A 5A1LA 2WZR3 5HCAA 1RUOA 5FY4A 5H9PA 4DRRA 2EXJA 2O8QA 3A4UA 3ZXDA 4FQ4A 4LA3A 4B3NA 5FYCA 4CEYC 1YFUA 3RPQA 4EZ4A 1WZXA 2VZVA 4XCAA 4LLFA 1H8TC 2VBBA 3LDKA 4NUBA 4AVBA 5CFDC 1MQTC 4Y5Z0 1AHSA 1TNFA 2ZHMA 3WDVA 2RS52 2VUDA 2EXHA 2QE3A 5A3MA 1NYWA 5LA0A 1JXNA 4NRPA 1RUD3 2JX9A 5DAPA 5A70A 3E5XA 1CVNA 2VZ3A 2W1UA 5KR7A 1SBFA 4I30A 2PA7A 3VB9A 3ABZA 4IW3A 1AJOA 1NZIA 4C0HA 1NLSA 4Y24A 3NVCA 1JOJA 2EIGA 2FQPA 4ZS3A 2E31A 5JXHA 4Y3OA 1DIWA 4BYYA 1R081 2D6KA 2WA4A 1YFXA 5EPAA 4A41A 4CDQB 4LOSA 4MVTA 3M3EA 1DU3D 1KEXA 5EJZB 2VQ0A 4WM8B 2E32A 1GQGA 1LR5A 2HLEA 3PIGA 3MDPA 4OQ9A 1O3QA 3Q8CA 2DCJA 1PVXA 3KMHA 1OQDA 1PZ8A 2KM2A 1JYCA 1DYPA 2YMZA 2QQWA 5FZDA 1GUIA 1FAYA 4J1WA 1H2NA 1HB3A 3HNMA 1KJRA 1K3IA 4CEYA 1FATA 2WWUA 4HL0A 1CAUB 2BNMA 2VJXA 4IEXA 1AXZA 4MGKE 1MQTA 2CV6A 4AQ2A 5FP7A 1J59A 4R9CA 2JEMA 1Q56A 2DCKA 2EAKA 2UWAA 2RMU2 3PVOA 4KU7A 2WSUA 3H8UA 1HRI1 3N9NA 4MZUA 5A7QA 5T5PA 3SC7X 1W6NA 4CDXC 1NXMA 2VG9A 2VGDA 4LO8A 4WVZA 3MFAA 4Q4Y1 2OZJA 3KF3A 3BB6A 4Y20A 2LTNA 3N9QA 4C8DA 1XNAA 4AVAA 5FQ0A 2X5IC 1W0OA 2VMDA 1M4WA 3HOBA 2YGMA 3OY8B 4TN7A 4ITCA 3C2UA 5FZCA 3ZFFA 1AR63 5LATA 4EZHA 1W28A 4W65A 2LW8A 3EJKA 2WNVB 1O59A 2VM9A 2XLGA 4IE5A 1OLQA 2AUYA 1H2MA 5A3UA 4JGZC 4N90A 4Q4Y2 1OLRA 5TSWA 5J37A 2FDGA 1ULDA 1W2OA 3EBRA 3VDDC 2VCAA 3ZN6B 4NAOA 1LHVA 3Q8FA 5GLWA 2XHNA 5DZGA 2E7TA 5M0TA 1UOGA 3LPGA 4BZ4A 4KWUA 1DBNA 1JYTA 2BTVC 2WQ8A 3K2OA 2MHFA 4NRMA 3OJBA 2AGSA 2WT0A 1SLBA 4PF1A 3CNAA 4LBNA 3GZEA 5IVEA 1QXPA 2RS13 4YVWB 5FR3A 3KGLA 2QTWB 3RJRA 1RUE2 2JG8B 1P8JA 3LZZA 3POWA 2YFUA 5EHDA 1VBE2 4IE6A 4QQLA 5FLIA 2MNGA 2F6BA 2JIGA 1VBD3 5JSRA 1V6JA 1HW5A 1HJGA 1MVEA 3TOJA 1ZRIA 4YZ1A 3SITA 2W2IA 5K7PA 4K3UA 2ARXA 4LHNA 2JE8A 1QOOA 2WZR1 2W52A 1LHUA 4O9EA 3ZSEA 3ILRA 3DXUA 4A3XA 1UZYA 2VZSA 3I54A 4OMDA 4RFT0 4UYBA 3WT3A 1XYOA 1JU4A 1OUXA 3B3QE 1ONAA 1GV9A 2SLIA 1HB2A 4CCLA 2G9FA 1ND3A 4ES8A 3H8OA 3BTAA 1VMJA 3C7EA 4JGYC 2RM23 5B4XA 1OBNA 4X8PA 4YM1A 3SKJE 2ZX0A 1RUD1 4IEWA 3R05A 4BLIA 3ES4A 1ND2B 4NIDA 1GOFA 1ZBA3 3PU8A 2EXKA 3WDWA 1AJKA 1GANA 1RMU2 1ZM1A 3BOWA 3OBRA 3P1IA 4HN1A 4HMZA 4M3CF 4CDUC 5FPXA 4QAWA 1GICA 3WNLA 2HWE3 5FFOC 2C4XA 3MW2A 1G86A 1Y43B 2P37A 4FOWA 1D4M1 4ZXEA 1VE0A 1PMHX 1LOCA 3EXUA 5A32B 4D94A 2ZMLA 3NO8A 1W6PA 2J1EA 4HFSA 3SH3A 5BNNC 1KRIA 1LHOA 4G3YC 4NROA 3ZYJB 1RUG3 5A33B 2ZACA 4KBZA 1MVQA 3AMQA 1R092 2JDYA 3E5QA 3OGVA 4IEQA 3IDEA 5AFEA 3ETQA 1EUTA 3VKMA 5B2GB 1ZRDA 4P02B 2WQ4A 2EXIA 3K75B 5K0UA 3ZR5A 3ON7A 1WLTA 4O7XA 1K45A 1CJDA 1FNYA 1OHFA 2BV4A 4YVSB 5FK7A 1W6OB 5C70A 3H7YA 4BU2A 4NIGA 2IXLA 1X9TA 2Z4FA 4R4ZA 3DV8A 1AR61 3T2QA 3CQOA 4NWVA 4D7TA 3MHZA 2X53S 4PCRA 1QJY3 5C4WA 1IPJA 1XNCA 3B7MA 3GGLA 3WNXA 2E51A 1V9U2 4IUGA 3T3YA 3W5NA 4Y5TA 4CA9A 5FP3A 1GWKA 4ZY9A 5F3CA 3TEZA 4DXTA 5FMOL 2DVAA 2R32A 1N1YA 2VPVA 3FLPA 4LKEA 2VCMA 4QB2A 5FZ1A 2XONA 1GNYA 1WA4A 4IEYA 4PDWC 4FFIA 3AZWA 2BGPA 2VTXJ 4QDRA 2RS11 2B9UA 1TQ5A 4XBLA 4LIUA 2A70A 4JQRA 3IDCB 3TNPB 2LM3A 3VZMA 4CZSA 4B7EA 3N9OA 3WNNA 5L19A 4M01A 2IWGB 4YWAA 4HG6B 2PFWA 3VBUB 1ULEA 3H3UA 3IM0A 5JIAA 3WG3A 2VTXA 4XJAA 4EQVA 2D6PA 1ZX5A 5FZKA 1VBD1 2WYSA 2CYFA 4LITA 2RHPA 3FWEA 2YYOA 4OYUA 2RS12 1O8PA 1AX0A 4Y4YA 5EQUA 3FLTA 5FYVA 5BNOC 3KM5A 5FY0A 2GNDA 4QPYA 3V0BA 3A0KA 4XJZA 2A6WA 5DAWA 2VMEA 2OQ6A 3BYWA 3GJAA 3J7HA 4JKMA 5FZGA 4CYDA 5G05L 1RGSA 3WG1A 2B5HA 3U37A 1A78A 3VBSC 3WW4A 2BWCA 1NLRA 1AR93 3GDBA 3OPZA 4LUMA 2RM21 4YW6A 4XFCA 2BQPA 1X7NA 4QKNA 4HETA 5CG9A 5A7WB 3O1TA 4PJYA 3LDRA 1W03A 1PGL1 4PDWA 2BU9A 2DU1A 4PIYA 4AVVA 3OEBA 5DXDA 4U2AA 1ZBA1 2R1BA 3M3OA 4HT1T 1ZBE2 4D6SA 1QXJA 2Y60A 1GP4A 1UMHA 1NA1C 2RM22 1DG6A 3PMEA 1MS0A 4WM7C 4YLZA 4URAA 1KD7A 5C3QA 3BKZA 2CGPA 3AX4A 3LIHA 2HWE1 3OGJA 2WFF3 5EV7A 2Z69A 4NIIA 2WR9A 3LEGA 2IXJA 1MZ6A 1CPMA 4GWMA 5IYYA 1ZBA2 1FI2A 2GMMA 4HKLA 3AP5A 4DUVA 4DUWA 5C5UA 3P5BA 5F32A 1JZ2A 1T6BX 1JYNA 1GNHA 1LOGA 1Q8SA 5GZEA 1SLIA 4D7SA 5EIYB 1XQNA 3P3NA 5FZ6A 1GSLA 2HWE2 2WL1A 1OH4A 1RUG1 3ROUA 1UL9A 1CESA 3VBSA 4DUXA 1U5YA 2DCTA 3IMMA 2DVFA 3BN6A 3PVBB 3NJYA 2DVGA 4PF5A 1VP6A 1DLCA 2WYFA 2XG3A 2ZXQA 1JYVA 3ZSKA 1SCRA 1TVGA 4YPJA 1XE8A 2D6NA 4L92A 1G9AA 2VBPA 3WOGA 3SEPA 1S4CA 2ET7A 5C8CC 4AK3A 4YARA 2CWMA 5BNQA 1UMZA 2ZGTA 2D6LX 3WG4A 3LSEA 4KH9A 2W39A 1DYKA 3RZKA 2JE7A 1LHWA 3W58A 1QDCA 4EV0A 2FDJA 5FWEA 4HN0A 5FY9A 1R64A 1GR3A 4H3WA 5L7OB 1YUDA 3PJQA 1EAH3 3D0SA 4EN9B 1E57A 2ZX1A 4CEWA 2R072 4Y22B 2RDRA 5AC93 3ZDVA 3J7LA 5CVRA 4CXXA 5JPMB 1BQPA 2ETEA 3WF0A 4QDSA 1HKDA 4C90A 5B4NA 1SFPA 4EJRA 2GNBA 1YIFA
chains in the Genus database with same CATH topology
4CCJA 5FYBA 2OQ7A 3AL6A 5A7SA 3KV4A 4GAZA 3K3OA 5FZ1A 4QWNA 5ISLA 2OT7A 2YBKA 2OX0A 5FXXA 3K2OA 3KVBA 5F3EA 5FZOB 4AAPA 3K3NA 2XUEA 3DXTA 4Y33A 4DIQA 5A3WA 2OS2A 4LIUA 2Q8DA 5IVEA 3U78A 5IVJA 2YU2A 3N9OA 3PU3A 3UYJA 4EYUA 3PUAA 5FZEA 4ASKA 5FYUA 2YPDA 5IVCA 2PXJA 4UF0B 5FZKA 5F39A 4LITA 2YBPA 3LDBA 3PURA 5IW0A 3ZLIA 5FYVA 2Q8CA 2P5BA 2W2IA 4QX7A 5FZ9A 5FPVA 5FZ7A 5F3GA 5FYHA 2OQ6A 3KV6A 5FZ3A 5IVBA 5FZGA 4LXLA 3DXUA 5FZHA 5A1LA 5LW9A 5FY4A 3PUQA 3ZPOA 5FXZA 4E4HA 4GD4A 4D6QA 4QXHA 4XDPA 4QU1A 4CCLA 4CCNA 5FPAA 5F2SA 5FYCA 5A7WB 5FZIA 5IWFA 4EZ4A 5FY8A 4NUBA 4BISA 5FPBA 1VRBA 4GJYA 5A1FA 5F2WA 4QX8A 4D6SA 4IGOA 2XMLA 5K4LA 5LY2A 3OPTA 3PU8A 2WWJA 4URAA 5FZ4A 4HONA 5A7PA 5KR7A 4IGPA 4V2VA 5FYYA 4CCOA 4D6RA 4BXFA 5FP8A 5FWJA 3AVSA 5F5CA 5FV3A 5F5IA 4Y3OA 5FYSA 2Q8EA 5F5AA 5FP4A 5A3NA 4HOOA 5FUPA 5FXVA 5FZOA 2GP5A 5CEHA 5FYZA 5A7OA 2YBSA 5FZBA 4IGQA 5F32A 5IVFA 4LIVA 3N9MA 3PUSA 3N9LA 5FZFA 4CCKA 4V2WA 5FZ6A 5LY1A 3N9PA 3KVAA 5IVYA 3LD8A 5A3PA 2VD7A 3AVRA 5LWBA 5FJKA 4UF0A 5FY5A 5FZDA 5F37A 3NJYA 5FUNA 4CCMA 5FPUA 2WWUA 2XDVA 5FPLA 5FY1A 5FZ8A 3AL5A 4GJZA 5FP7A 5FXWA 4AI9A 5F3IA 5FYMA 5A7QA 3N9NA 5A7NA 4XDOA 4CUGA 2YU1A 4BU2A 5FZMA 4QXCA 4DO0A 5FZAA 5FYIA 5ANQA 5E6HA 5A3TA 3KV5A 5FYTA 3KV9A 5FP9A 3PTRB 3PDQA 3N9QA 4Y4RA 5FBJA 5FZ0A 4C8DA 5A80A 3OPWA 5FY0A 3U4SA 2XXZA 5FZCA 4TN7A 4QXBA 5FWEA 5FY7A 5A7WA 5FY9A 4CSWA 4EZHA 5IVVA 5FZLA 3RVHA 5FJHA 5FP3A 5F3CA 2GP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CCJ A;  5FYB A;  2OQ7 A;  3AL6 A;  5A7S A;  3KV4 A;  4GAZ A;  3K3O A;  5FZ1 A;  4QWN A;  5ISL A;  2OT7 A;  2YBK A;  2OX0 A;  5FXX A;  3K2O A;  3KVB A;  5F3E A;  5FZO B;  4AAP A;  3K3N A;  2XUE A;  3DXT A;  4Y33 A;  4DIQ A;  5A3W A;  2OS2 A;  4LIU A;  2Q8D A;  5IVE A;  3U78 A;  5IVJ A;  2YU2 A;  3N9O A;  3PU3 A;  3UYJ A;  4EYU A;  3PUA A;  5FZE A;  4ASK A;  5FYU A;  2YPD A;  5IVC A;  2PXJ A;  4UF0 B;  5FZK A;  5F39 A;  4LIT A;  2YBP A;  3LDB A;  3PUR A;  5IW0 A;  3ZLI A;  5FYV A;  2Q8C A;  2P5B A;  2W2I A;  4QX7 A;  5FZ9 A;  5FPV A;  5FZ7 A;  5F3G A;  5FYH A;  2OQ6 A;  3KV6 A;  5FZ3 A;  5IVB A;  5FZG A;  4LXL A;  3DXU A;  5FZH A;  5A1L A;  5LW9 A;  5FY4 A;  3PUQ A;  3ZPO A;  5FXZ A;  4E4H A;  4GD4 A;  4D6Q A;  4QXH A;  4XDP A;  4QU1 A;  4CCL A;  4CCN A;  5FPA A;  5F2S A;  5FYC A;  5A7W B;  5FZI A;  5IWF A;  4EZ4 A;  5FY8 A;  4NUB A;  4BIS A;  5FPB A;  1VRB A;  4GJY A;  5A1F A;  5F2W A;  4QX8 A;  4D6S A;  4IGO A;  2XML A;  5K4L A;  5LY2 A;  3OPT A;  3PU8 A;  2WWJ A;  4URA A;  5FZ4 A;  4HON A;  5A7P A;  5KR7 A;  4IGP A;  4V2V A;  5FYY A;  4CCO A;  4D6R A;  4BXF A;  5FP8 A;  5FWJ A;  3AVS A;  5F5C A;  5FV3 A;  5F5I A;  4Y3O A;  5FYS A;  2Q8E A;  5F5A A;  5FP4 A;  5A3N A;  4HOO A;  5FUP A;  5FXV A;  5FZO A;  2GP5 A;  5CEH A;  5FYZ A;  5A7O A;  2YBS A;  5FZB A;  4IGQ A;  5F32 A;  5IVF A;  4LIV A;  3N9M A;  3PUS A;  3N9L A;  5FZF A;  4CCK A;  4V2W A;  5FZ6 A;  5LY1 A;  3N9P A;  3KVA A;  5IVY A;  3LD8 A;  5A3P A;  2VD7 A;  3AVR A;  5LWB A;  5FJK A;  4UF0 A;  5FY5 A;  5FZD A;  5F37 A;  3NJY A;  5FUN A;  4CCM A;  5FPU A;  2WWU A;  2XDV A;  5FPL A;  5FY1 A;  5FZ8 A;  3AL5 A;  4GJZ A;  5FP7 A;  5FXW A;  4AI9 A;  5F3I A;  5FYM A;  5A7Q A;  3N9N A;  5A7N A;  4XDO A;  4CUG A;  2YU1 A;  4BU2 A;  5FZM A;  4QXC A;  4DO0 A;  5FZA A;  5FYI A;  5ANQ A;  5E6H A;  5A3T A;  3KV5 A;  5FYT A;  3KV9 A;  5FP9 A;  3PTR B;  3PDQ A;  3N9Q A;  4Y4R A;  5FBJ A;  5FZ0 A;  4C8D A;  5A80 A;  3OPW A;  5FY0 A;  3U4S A;  2XXZ A;  5FZC A;  4TN7 A;  4QXB A;  5FWE A;  5FY7 A;  5A7W A;  5FY9 A;  4CSW A;  4EZH A;  5IVV A;  5FZL A;  3RVH A;  5FJH A;  5FP3 A;  5F3C A;  2GP3 A; 
#chains in the Genus database with same CATH topology
 2BVV A;  1QY4 A;  1QJY 2;  1GQH A;  2Z79 A;  2OQ7 A;  2VMH A;  4AHX A;  4R9B A;  1C1L A;  3K3O A;  1NCQ C;  3U0Z A;  1W3X A;  2NQY A;  4Q8K A;  4CUA A;  4L2N A;  3KLS A;  4MGS A;  2VW1 A;  4QPG B;  4E8D A;  1UN1 A;  4ZS2 A;  3H0O A;  5IVJ A;  4KL1 A;  3S57 A;  4A42 A;  1GZC A;  4AEM A;  1MS5 A;  3IAP A;  5JI9 A;  3E5U A;  3HEI A;  3UK9 A;  5BXX A;  2FCV A;  2Y6J A;  3GCX A;  2C1F A;  4ASK A;  3NNG A;  3POG A;  1F35 A;  1H2L A;  1I6X A;  3FHA A;  3HBK A;  3B01 A;  3PLQ A;  4CPB A;  2RS3 3;  2UWC A;  1BCX A;  1U5Z A;  5CAD A;  5LA2 A;  5CFC B;  1JOD A;  2ZKN A;  5IW0 A;  3SQO A;  3T0A A;  5CNA A;  4AHY A;  4QKF A;  4XQW A;  5KBF A;  1BHG A;  1E5I A;  3IPV B;  4R9A A;  1AR9 1;  5LBE A;  5C71 A;  1PM4 A;  1UYP A;  5LW9 A;  3PUQ A;  2ZX2 A;  4B4R A;  2ZAB A;  4P9J A;  5JWP A;  1WA6 X;  3CU7 A;  3JBG 3;  4JX0 A;  4Y1U A;  1C8N A;  4QM8 A;  1NUK A;  1ULP A;  3ASI A;  2R49 A;  3WD5 A;  4FBF A;  3ZKU A;  4EWD A;  4QX3 A;  4HPK A;  5IK7 A;  3IN9 A;  5F2W A;  2C9A A;  3T30 A;  1MPX A;  1RL3 A;  5D8A B;  1BKZ A;  3FUO A;  4YW5 A;  4Q8L A;  2RJ2 A;  1DQ4 A;  4XFA A;  4AED C;  5K8S A;  3IDB B;  3HIF A;  4JKL A;  3OEA A;  4P9I A;  4WVM B;  1VB2 A;  1OD3 A;  2TEP A;  2R6Q A;  1PO1 2;  4FCA A;  5CB7 A;  3DYP A;  2XJT A;  5FWJ A;  3U75 A;  4LNV A;  1KS4 A;  3IBM A;  3LPF A;  3MW4 A;  3VHR A;  3V65 A;  3O1O A;  2YFZ A;  1Y9Q A;  1Y9M A;  2WFF 2;  1W6Q B;  2BEO A;  1Q43 A;  2VZU A;  1VR3 A;  3Q8B A;  4V2W A;  3FMG A;  1Q8V A;  1LES A;  4BQX A;  3ZPY A;  3LD8 A;  5T55 A;  2WO1 A;  1Z0H A;  2VD7 A;  2H0V A;  1NCR A;  2DTY A;  4OUS A;  5FOJ B;  3WW3 A;  5HCH A;  1SEF A;  2XDV A;  4R8H A;  4XDQ A;  2UWB A;  3VBR C;  4B1M A;  3POF A;  4CUB A;  4XUO A;  3WQ7 A;  4EN8 B;  5FY1 A;  3N7K A;  4YSF A;  1CAV B;  4OCT A;  1U0A A;  3GHN A;  3R4U A;  4XAA A;  3VN4 A;  3BCW A;  3LA3 A;  2YXS A;  4GA9 A;  2RDS A;  4LJH A;  2PHR A;  4E2Q A;  2XLA A;  4IV1 A;  1DQ6 A;  4RS5 B;  3KV9 A;  4FOV A;  2OUJ A;  3VZO A;  2JG9 B;  4NVP A;  4IV3 C;  1L3J A;  3U4S A;  4CP0 A;  1U5I A;  5I8T A;  2Y26 A;  1EAH 1;  1KQR A;  1UKG A;  3VL9 A;  4H2A A;  3K48 A;  4ZPI A;  1OFN A;  5DAV A;  3M1H A;  4HVR A;  4AQ6 A;  5DN2 A;  3WQB A;  3O1P A;  1VAV A;  2E53 A;  4CUG A;  3OD4 A;  4YGD A;  1W9S A;  4Q0Q A;  4Y26 A;  2ZAA A;  4Q4X 3;  2E6V A;  4WBB A;  4XPV A;  3WVJ A;  2WIN B;  1ZVF A;  5AC9 2;  1BYH A;  2F4P A;  3NW4 A;  4HVQ A;  3WNO A;  5BNP C;  5FXX A;  1W9W A;  3ZXJ A;  2XUE A;  4XZU G;  4OI4 A;  4XF9 A;  5FMB A;  4A3Z A;  2ERF A;  5ERL A;  2PHF A;  4AQT A;  3UYJ A;  3K4A A;  2A7A A;  3PUA A;  3CO2 A;  2Y6H A;  4JV4 A;  2YPD A;  4QHZ A;  4XIO A;  4KNC A;  1W6M A;  2XJQ A;  1UO9 A;  1RUI 2;  4LKD A;  4M3C E;  5C9A B;  1UD1 A;  4XFF A;  2GNM A;  1DQ2 A;  2JIJ A;  4RA0 A;  4CU9 A;  4M3C B;  3POE A;  1GYK A;  2RS3 2;  4TXW A;  4QPW A;  1XPW A;  2DBN A;  5IVB A;  1GBG A;  1OOP B;  4GH4 A;  3H1M A;  5CU1 A;  3DKQ A;  2L9L A;  3JBG 1;  1NOV A;  3Q8A A;  2OA2 A;  3WUD A;  2H0B A;  2HEW F;  1B35 B;  4FPE A;  4FXG B;  3MW3 A;  5F2S A;  3VKN A;  4CDW C;  2J42 A;  3I2G A;  5FMC A;  2X8K A;  4IET A;  3E6C C;  2Y8K A;  4BIS A;  1AR8 2;  1OMI A;  1W8T A;  1Y4W A;  4Z2W A;  2OPW A;  2DVD A;  3AKT A;  3AYE A;  4MHR A;  4PQQ A;  4QX8 A;  2OXB A;  4G4F A;  3JBG 2;  4P14 A;  3CZJ A;  3RGB A;  2QQP A;  2ZMK A;  2WWJ A;  2LRP A;  4IGP A;  4CCO A;  2VAU A;  1OUS A;  4Y1V A;  3OD0 A;  4Z82 A;  4AGR A;  4CU6 A;  4ZU7 A;  3ILF A;  2UY9 A;  3MUY 1;  5JOZ A;  4BPZ A;  1C1F A;  3GJB A;  3K4D A;  4QKB A;  4YW1 A;  4AED A;  2IXH A;  4B1L A;  1NQD A;  5F5Q A;  5FZO A;  5HV0 A;  3TN9 3;  5JR2 A;  2D6M A;  2WAA A;  1K5M B;  1UX6 A;  2V5D A;  3VUO A;  5DAQ A;  2D5H A;  4JTO A;  4Q27 A;  4UW5 A;  4AR2 A;  4I0A A;  1N3Q A;  2XH6 A;  3KVA A;  1SCS A;  5IUQ A;  5IVY A;  1CX4 A;  3WF4 A;  2HWF 3;  3RS6 A;  4DZG A;  1GU3 A;  1DQ0 A;  4LHK A;  1UWW A;  2WLQ A;  2B46 X;  3CJI A;  2UU8 A;  3OGR A;  4BH9 A;  1QMJ A;  2BBA A;  5HCB A;  3O1U A;  4GJZ A;  4XXA A;  2VE1 A;  2ZCW A;  1W04 A;  2D3R A;  4OHX A;  3HQU A;  4XDO A;  2CY6 A;  1XNK A;  2IUW A;  1M06 G;  4YGB A;  5FRE A;  1XRU A;  1VBB 2;  4ZZ5 A;  5L36 A;  5HV4 A;  1D4V B;  1LJ7 A;  1XNB A;  3CJX A;  5JXI A;  4UW3 A;  1RED A;  4QGN A;  3AKQ A;  5I93 A;  1BVP 1;  4BQ2 A;  4I2O A;  2WDB A;  4IEU A;  3ME2 A;  2V72 A;  4FQZ A;  3H3Z A;  1IOA A;  1CIY A;  1F4A A;  3KS7 A;  1WCS A;  2YC0 A;  3ZXL A;  4AVS A;  2E9Q A;  4Q4X 1;  4W6Y A;  4BK4 A;  4CEY B;  3NAP A;  5LRS A;  3OYW B;  3BUC A;  1LEC A;  1H8T B;  4OHZ A;  5CFD B;  2RR1 2;  2VL4 A;  1MQT B;  4GQ7 A;  4KMQ A;  1JZ3 A;  3VBH A;  4E8C A;  5FYB A;  1TMF 3;  4GMP 3;  4GAZ A;  3IIA A;  2XB6 C;  1UIK A;  3A22 A;  3LF7 A;  4PQ9 A;  2K2S A;  3KWV A;  1RUF 1;  3CDZ B;  3S7I A;  1XBF A;  4XBQ A;  1RVF 3;  1GOH A;  2WNU C;  4Q4X 2;  3USU B;  1W9Y A;  1QJU 2;  3ZFG A;  2VR4 A;  1FOD 3;  1UYX A;  2ZPX A;  3ILN A;  5A3W A;  3INA A;  3VZK A;  4NIA A;  1GWL A;  3AMM A;  3SXW A;  1W8H A;  2XKP A;  4OLL A;  4LOT A;  2C26 A;  5T52 A;  3AZV A;  3D4K A;  3I49 A;  1KDK A;  3HQR A;  1K5J A;  2ZEX A;  3ACF A;  2D40 A;  3LCP A;  3POY A;  2BUK A;  1AL2 3;  2QQV A;  4LBQ B;  2DDU A;  3KSC A;  5KC6 A;  2PAE A;  1WWY A;  5F6L B;  4QPI C;  4BWO A;  3ZN5 A;  3A0N A;  4BJ0 A;  5JR7 B;  1IGO A;  4XJW A;  2WBK A;  5FZ9 A;  4DQA A;  5FZ7 A;  5HI0 A;  1ULO A;  2ZJC A;  1LTE A;  2N7G A;  4OZX A;  4K20 A;  3SEE A;  2DU0 A;  5EJ1 B;  4RR3 C;  5IHR A;  3HT2 A;  4WZF A;  4FP2 A;  4LBQ D;  2OKX A;  4QU1 A;  3LOB A;  5C3R A;  4A44 A;  5C33 A;  4AW7 A;  2OUH A;  2ZOE B;  4CDX B;  1V00 A;  2PLV 3;  2YHJ A;  5FY8 A;  5A1A A;  2PAK A;  3GBF A;  2ZMN A;  1VBA 3;  4RQP A;  2WNU A;  3C8X A;  4AEK A;  4LA2 A;  4JZR A;  4L11 A;  2X5I B;  1RIT A;  4IGO A;  4UOJ A;  3OPT A;  2GME A;  3VV1 A;  4QQP A;  4C91 A;  2G9Z A;  1DZQ A;  4PHZ A;  2JDH A;  4IEV A;  3MIE A;  4JGZ B;  3BU7 A;  2VO5 A;  5FYS A;  5DDJ 3;  3TN9 1;  1KFX L;  1W8U A;  3VDD B;  2CNA A;  1BEV 1;  3OGG A;  3KQR A;  4LKF A;  3ZFE A;  3I2O A;  2J1U A;  1ZZB A;  2MEV 2;  3HD8 B;  5FZF A;  2BVB A;  2VMF A;  2DCY A;  2XJV A;  5FO9 B;  2HWF 1;  1OI6 A;  1PMI A;  4RR3 A;  4OI1 A;  3MV1 1;  4CU7 A;  5JLV A;  4OUE A;  3TN9 2;  1HQN A;  3ZYI B;  2HWD 1;  1I5Z A;  1WMF A;  1X50 A;  1YYN A;  3GF6 A;  3LA2 A;  5F37 A;  1OUR A;  1FPN 3;  1O5L A;  4Q29 A;  4UI9 L;  3OUJ A;  3TBD A;  5I8Y A;  1JZ6 A;  3WNK A;  1PGW 1;  1QGL A;  2VTF A;  3K77 A;  3CHX A;  3TEY A;  3UKV A;  2HWF 2;  2A6X A;  2YRO A;  5GAL A;  4CCE A;  4DY5 A;  3KCC A;  1EYB A;  2AEY A;  4LMF A;  4A7K A;  3WHT A;  3ZFF C;  4P5Y A;  4B7K A;  1SMV A;  1FYU A;  3ES1 A;  5E16 A;  5A3T A;  3SCH A;  2XGX A;  1G9F A;  2B42 B;  4LO5 B;  5FZ0 A;  2VU9 A;  1PGW 2;  3KZ4 C;  4A7Z A;  1D4M 3;  1Q8O A;  5CKM A;  4Q26 A;  4ASL A;  1WW4 A;  2BNO A;  1JBC A;  4QM9 A;  5HBA A;  2OII A;  3NL1 A;  1R08 2;  4ISR A;  3VHO A;  1YHF A;  4JGY B;  5JOY A;  1TMF 1;  4GMP 1;  4NHL A;  1COV 3;  2V4A A;  3BTX A;  5JSP A;  2JXA A;  4XMA A;  3MPP G;  2XL9 A;  2ZZQ A;  1A8D A;  2TUN A;  2XWB B;  4O9G A;  1DGR N;  1RVF 1;  3L2Y A;  4NPR A;  1ODN A;  1W90 A;  1VRH 1;  3OG2 A;  3IZO A;  4JDO A;  1PHM A;  3KB5 A;  4DXZ A;  2PMW B;  1FOD 1;  5EJ3 A;  5JOW A;  3ALQ A;  2DUP A;  4CDU B;  3FFZ A;  1QWR A;  2BYV E;  2J1S A;  1W0N A;  3AFK A;  1TMF 2;  1EUU A;  3I59 A;  4K21 A;  2Q8D A;  5BV6 A;  4C0B A;  4CP9 B;  1VIW B;  1H8V A;  1BVV A;  1AL2 1;  1RVF 2;  1OFS A;  3ZYB A;  4HSJ A;  2TNF A;  5C6C A;  3DN7 A;  1OVP A;  1HRI 2;  5JZG A;  4UF0 B;  2PQQ A;  5IFT A;  1TE1 B;  3IT8 A;  4MXV A;  2HBT A;  2BFU L;  2XJR A;  4WZC A;  5BNN B;  4COW A;  3ATG A;  3MYX A;  5CIR A;  3VBO A;  4FTB A;  1NLQ A;  3BU0 A;  1FMD 1;  3DPR A;  5J48 A;  2P5B A;  1CAX B;  5CKQ A;  2I45 A;  4YZ3 A;  3WIN E;  1AL2 2;  1IZ3 A;  1LGC A;  1ND3 C;  3VD5 A;  4LXL A;  3RYR A;  1E5H A;  1CD3 G;  3RMY A;  3M70 A;  2PQS A;  1WD3 A;  2PYT A;  2WN2 A;  3POI A;  4JRA A;  2JDU A;  1STM A;  2BDR A;  4NR1 A;  4QQ2 A;  2PLV 1;  1JU3 A;  3ZSJ A;  1FV2 A;  1VBA 1;  1VB4 A;  5AVP A;  1XOY A;  5ACA 1;  4LQR A;  4FVV A;  2ZX3 A;  2A1X A;  2JDP A;  5HPO A;  3M8L A;  4YM3 A;  4FPF A;  3KCY A;  1LNS A;  1SG3 A;  3ORJ A;  1XC6 A;  1GWM A;  3GCW A;  4AVT A;  2P17 A;  4N7U A;  3CF6 E;  1F5J A;  1BK0 A;  3VBF A;  1VAK A;  4BXF A;  4LO4 B;  5DDJ 1;  5DUX A;  4AEJ A;  5KC5 A;  1GZW B;  2Y33 A;  1HDK A;  3BIW E;  2VXJ A;  3M4F A;  1YIP A;  3B02 A;  5FUP A;  4LE4 A;  3PIJ A;  3U4X A;  4Z8B A;  1OQE A;  1KXG A;  3PUS A;  3PUH A;  5C8W A;  4CCK A;  3ETP A;  2F17 A;  4UT5 A;  5LAS A;  1NZC A;  4PDW B;  4Q1R A;  2V4V A;  3D0J A;  4TWT A;  1BJQ A;  1W06 A;  1FPN 1;  2WZR 2;  3P3P A;  5K0U C;  2BBV A;  1LEM A;  2P2K A;  2QCS B;  1QJF A;  3VD3 A;  2XR4 A;  5FPU A;  5LK7 B;  4BB3 A;  4IDZ A;  4UFJ A;  3THC A;  4OQ8 A;  1ZZ8 A;  1R1Z A;  4X8N A;  3D6E A;  2QFE A;  3OCP A;  2R06 1;  4Y1Y A;  1UZW A;  1VJ2 A;  1WBL A;  1OSG A;  5F9T A;  5LBC A;  1YO8 A;  4HK9 A;  2XWJ B;  3ZXA C;  2GU9 A;  3POJ A;  3VZN A;  1RUD 2;  1IG3 A;  3QOP A;  4FOY A;  2AYH A;  5BNO B;  5BY5 A;  5JIU A;  1DF0 A;  5I0R A;  5A80 A;  1RUC 1;  3FE5 A;  5C4W C;  2PEL A;  1C28 A;  2BP6 A;  3LOI A;  4MGZ E;  1BMV 1;  1HB4 A;  1NX9 A;  4XUQ A;  2ARB A;  2C9K A;  2P3Y A;  4XUP A;  2ZEW A;  4QB1 A;  2IVJ A;  1OC1 A;  2R1D A;  3C7O A;  3L9J T;  1J3P A;  3OB8 A;  3WY6 A;  3NST A;  2UUR A;  3RZZ A;  1COV 1;  5JOX A;  4Q2F A;  1PO2 1;  1D4M 2;  3NJV A;  4MXW B;  4HVO A;  1UPI A;  2D6O X;  3PVE A;  1DGR A;  2RVA A;  5FO7 B;  1NY7 1;  1KFU L;  2XBO 1;  4MGY E;  3WQ0 A;  3TB0 A;  1RUJ 1;  3TWI A;  4B4P A;  3WNM A;  3MLL A;  5DMY A;  2FDK A;  1NA1 B;  4WM7 B;  3KVB A;  4F8A A;  3O1M A;  3DXT A;  1UOF A;  4WM8 A;  4XJ8 A;  1RJ8 A;  1W8F A;  4XXP A;  4JC1 A;  1EY2 A;  3LFI A;  2AH2 A;  4Y5S A;  1QEX A;  3PVN A;  4W8J A;  2ARE A;  1NY7 2;  3GNE A;  1C4R A;  2D43 A;  3OGS A;  4YW7 A;  2LRO A;  4MAD A;  2HJI A;  5FYU A;  4H7M A;  1HV0 A;  1REE A;  2NYY A;  4MH0 E;  2Y34 A;  2E26 A;  1WUV A;  1RIR A;  3TEX A;  3KQ4 B;  1PGS A;  1FNZ A;  4N53 B;  1AR6 2;  4CU8 A;  2RE9 A;  2IFW A;  4LE3 A;  2ZHK A;  3SH4 A;  3GAL A;  5H9Q A;  5FLJ A;  2WKK A;  1UZV A;  1KJL A;  2RJL A;  4FOQ A;  2QQO A;  4GD4 A;  2P34 A;  2W1S A;  3PMS A;  3VHN A;  2PTM A;  3B94 A;  4UBH A;  4CVU A;  4P9L A;  4ZU4 A;  5C8C B;  4XAC A;  3UGH A;  2WNV A;  4N43 B;  1ZZC A;  1VRB A;  1VAM A;  4Q4W 1;  3TEW A;  3AJZ A;  3MIC A;  3VLB B;  1JHN A;  5K4L A;  2ENR A;  4OHY A;  1BLZ A;  4BHP A;  5F1R A;  2ZS6 B;  4UW4 A;  3SCG A;  2Q8O A;  1QNW A;  1U12 A;  2FZ1 A;  5LBB A;  3ZN6 A;  3EQE A;  3U14 A;  5DG2 A;  1LHN A;  3I8T A;  4XFH A;  3ZYP A;  1CZT A;  4D6R A;  4SLI A;  1T2X A;  5I91 A;  4UFM A;  2WJS A;  3EO6 A;  2LAL A;  2DWR A;  3HJR A;  5BUV A;  2QZ3 A;  2XVK A;  5FP4 A;  4B4Q A;  2H6B A;  5A3N A;  1PZ9 A;  1X8E A;  3BOP A;  4KG0 A;  3W20 A;  1VBD 2;  4RFR B;  2WS9 1;  1AXK A;  3M7A A;  1NAE A;  3RNS A;  1U5X A;  4YVW A;  2GMP A;  3TYJ A;  2ZGK A;  4XBN A;  1NCQ B;  3AB0 A;  2UYB A;  1EPZ A;  4XJ9 A;  4FPG A;  5LY1 A;  5FKC A;  1RJ7 A;  3I2I A;  1S2K A;  5EP9 A;  4AWD A;  4R52 A;  1WD4 A;  2JG8 A;  3CEW A;  3NWK A;  1FT9 A;  4JQT A;  2FDF A;  4M4R A;  4FPO B;  3VDC A;  5DZE A;  2WC2 A;  2Q1M A;  2E33 A;  3O0V A;  1QQP 3;  3POS A;  2WNO A;  2VUA A;  1QKQ A;  2VZT A;  1J1T A;  3F2Z A;  3FUQ A;  1CN1 A;  1UYY A;  3N36 A;  1TME 3;  5ABJ B;  1JZ4 A;  2GH2 A;  5FMD A;  4PBP A;  3QCW A;  1PGL 2;  3AMP A;  2W0X A;  3USS A;  1RUH 3;  3MO4 A;  1S2B A;  3MF6 A;  3NV2 A;  4NN0 A;  4D7Y A;  3V0A B;  5EFU A;  4BQ1 A;  3I3Q A;  4CEW C;  1GZ9 A;  1CAW B;  2VZO A;  2XHK A;  1IQA A;  3OPW A;  3T1M A;  4CXW A;  1HRV 3;  4QXB A;  2ZGR A;  4P08 A;  1CQ9 A;  2VNV A;  2ARC A;  2WN3 A;  3AYD A;  4AFA A;  1ND2 A;  4B29 A;  1S0G A;  4FFH A;  1MAC A;  1ZRR A;  4G9S B;  1GQP A;  1YI9 A;  4FAG A;  2WO2 A;  2BGO A;  2WT1 A;  2JEC A;  4MGQ A;  1TZO A;  4SBV A;  1PVC 3;  5KXC A;  4ZKT B;  5KWR A;  2NMN A;  3AZY A;  1RUG 2;  1H9W A;  2JDN A;  4AED B;  4BQ5 A;  2D44 A;  3K51 A;  4JHZ A;  3I7D A;  1H4H A;  2VC9 A;  1QIQ A;  4HK8 A;  4E9K A;  3N3H A;  1GP6 A;  5DPN A;  4RHV 3;  1F8V A;  5A32 A;  2GDF A;  4ARY A;  2SBA A;  2CHH A;  4Y1X A;  3U07 A;  3AKS A;  5F6K A;  2HWB 3;  3V64 A;  5CIS A;  4KQ7 A;  4MV2 A;  2CGN A;  5FZE A;  5A33 A;  5D2A A;  3RQ0 A;  1SLA A;  2W9X A;  3GZA A;  4XOG A;  3E6D A;  4P00 B;  1ENX A;  2D3S A;  1BZW A;  3FLR A;  5F8P A;  1G9B A;  3ZSL A;  4PLN A;  3QH6 A;  4YVS A;  1QHD A;  1RIN A;  4O65 A;  5IK8 A;  1QDO A;  1MZF A;  1XNT A;  4Q1P A;  3VBR B;  3HAG A;  2Y0O A;  3URF A;  1JYI A;  3AC0 A;  4FP3 A;  1OA4 A;  4PLM A;  3ZVX A;  4D6Q A;  1YNA A;  3FJS A;  5KXB A;  3HN1 A;  4W6W A;  4XDP A;  2VNG A;  1W2T A;  5DG1 A;  5GZD A;  1HX6 A;  2VW0 A;  2LUW A;  1CZV A;  1YQ8 A;  2ZGM A;  4LHL A;  4YZ4 A;  3T09 A;  5FPB A;  2AR6 A;  5DUW A;  3I4I A;  1JUI A;  2VOT A;  3Q8E A;  3QH7 A;  4IV3 B;  2ORX A;  4PBO A;  2D3P A;  1W2A X;  2ZKL A;  5C3S A;  4MYE A;  1WW6 A;  1MEC 3;  1JN2 P;  3S5Q A;  4P9W A;  2CDP A;  3IWZ A;  3TAY A;  5J36 A;  3H1W A;  3WF1 A;  1N1V A;  3H9A A;  1WCU A;  2ET1 A;  4L8Q A;  5F5A A;  1SPP B;  2WSV A;  1DP0 A;  5JUV A;  2BGC A;  1K12 A;  4FPC A;  5FZB A;  1PK6 C;  1NT0 A;  1QOT A;  4PT6 A;  1LED A;  1NCR C;  3N9L A;  1CIW A;  3JXS A;  4ET7 A;  3BIE A;  5BNP B;  4ORF A;  2PHL A;  1UU6 A;  4M0H A;  3MZH A;  1J3R A;  3HWJ A;  4F3J A;  1QQP 1;  1AR9 2;  1H1I A;  5FUN A;  2HWC 1;  1ZA4 A;  2ADE A;  2DBI A;  4LK6 A;  1QH6 A;  1TME 1;  4AGG A;  2E7A A;  2JB4 A;  2XVG A;  4S2H A;  4EN7 B;  2I2S A;  2VVD A;  4COY A;  4IV1 C;  4XF0 A;  1LOA A;  3B69 A;  4UXA A;  3MV0 1;  1RUH 1;  4AI9 A;  4WVV A;  1JH5 A;  3MF9 A;  3MIG A;  1LB2 A;  3H7J A;  5IAV A;  5A7N A;  4TZD A;  4MUV A;  4H55 A;  1D0H A;  4GUL A;  2Q1Z B;  1GZT A;  1HRV 1;  5KXD A;  1W99 A;  5FO8 B;  1UZ0 A;  3RWK X;  2QVS B;  3UT0 A;  1W2N A;  4GKX A;  5A7W A;  4E4D X;  3LB9 A;  4QHB A;  4XCB A;  2P3K A;  3THT A;  1RUH 2;  1IG0 A;  1YXW A;  2W46 A;  2VOV A;  1R1A 3;  4NHY A;  4CXY A;  1PK6 A;  1DGW A;  1DQ1 A;  4JKK A;  2CGO A;  4CDW B;  1HXS 3;  4AQS A;  2Y6L A;  1HRV 2;  1PVC 1;  5HCF A;  3SHR A;  3W9A A;  3FHI B;  2JDZ A;  1Z7S 3;  3LE0 A;  3NNM A;  1W39 A;  1APN A;  1J1L A;  2WZE A;  4IES A;  5FBZ A;  3T2O A;  3AL6 A;  5A7S A;  3RZM A;  2FZ2 A;  2WZP P;  4K7J A;  1URX A;  2AEZ A;  3PNA A;  1T6G C;  2G1M A;  2VOX A;  3KGZ A;  3LAG A;  5FAX A;  4UFL A;  2NLR A;  3O0X A;  4FSJ A;  4RHV 1;  4ATE A;  4TLF A;  4XFG A;  1I1E A;  4QKD A;  3WUC A;  2RDN A;  4Q0V A;  1IHM A;  1OT5 A;  2CTV A;  2HWB 1;  3U11 A;  1MS4 A;  4LKS A;  5CBL A;  1AR7 3;  2EIB A;  3PU3 A;  3MIF A;  1SFY A;  2VQT A;  4EYU A;  2QQM A;  3PHM A;  4IQP A;  5FLH A;  5J96 B;  3NV1 A;  3PUR A;  4CUC A;  2FHR A;  3ZLI A;  4GH4 C;  4OHV A;  1YFW A;  1V6N A;  1QJX 3;  1EAH 2;  3WHU A;  1AYN 1;  1F15 A;  2B4K A;  1D2Q A;  2ZBJ A;  1X82 A;  1JW6 A;  4H14 A;  3RMX A;  5IK4 A;  4HBN A;  4DEV A;  2ARA A;  3UJQ A;  3ZPO A;  4D0Q A;  3N4M A;  3MUZ 1;  1RUF 3;  4ATF A;  1PNG A;  1OA3 A;  5FPA A;  3PTY A;  3III A;  4Y1Z A;  5L7O A;  2QZ2 A;  4JHT A;  4S2D A;  4CP1 A;  3A21 A;  3C3V A;  2DFC A;  2BW8 A;  5CKN A;  2RJK A;  5C5T A;  2P3J A;  4Y22 A;  5GZC A;  4N9I A;  4UFH A;  5A1F A;  4LBK A;  3LSD A;  1MEC 1;  2DCZ A;  2GH8 A;  5LCW L;  1LOD A;  2JB8 A;  2VVE A;  2ZAH A;  1UPS A;  5L73 A;  1IPK A;  4KWJ A;  4DB5 A;  1CZS A;  2BER A;  4YG6 A;  5FP8 A;  5KHI A;  4QX1 A;  4NOT A;  5CAZ A;  3DYO A;  3VD9 A;  4ES9 A;  4AFM A;  2WT2 A;  2R04 3;  4R9D A;  4CTE A;  4JDM A;  2O1Q A;  2YY1 A;  3WDX A;  3I2H A;  3E1F 1;  4QPG A;  2JDK A;  5C3O A;  4K8F A;  1YEW A;  2VW2 A;  1O3S A;  4UFK A;  1REF A;  1SLC A;  1UXX X;  3CJI C;  3EHK A;  2WNU B;  4FPJ A;  5CA6 A;  5FJK A;  3RYP A;  4ZON A;  1RC6 A;  4FT8 A;  3A23 A;  2NM1 A;  1AX1 A;  3B93 A;  2RG4 A;  4FFF A;  4LTA A;  3WF2 A;  2W1W A;  3ZXF A;  4NIH A;  3UES A;  4GWI A;  3ZMO A;  1HB1 A;  5FZ8 A;  3LKJ A;  5FXW A;  3IPV A;  5LEJ A;  4ERO A;  1B09 A;  2YGL A;  3H3L A;  1IS3 A;  5JAX A;  3OOX A;  5KXE A;  2GN3 A;  1W2U A;  2YU1 A;  3K4Z A;  4IEP A;  3WXP A;  2JKB A;  4QPI B;  5FZM A;  1YCI A;  2OW4 A;  5FYT A;  2HEV F;  4A6O A;  5K9Y A;  5CG8 A;  2X10 A;  1BEV 3;  3HQX A;  3D8C A;  1LOF A;  2WZ8 A;  4XET A;  1R1A 1;  1D7P M;  4CSW A;  1WCD J;  2QNK A;  3JQX A;  1ALY A;  3NAP C;  4RR3 B;  5DQ0 A;  5E88 A;  3VDA A;  1QJE A;  1POV 3;  3NJZ A;  5FZL A;  1HXS 1;  2VNR A;  3WLU A;  3VBH C;  5D8A A;  4Z1V A;  3RJ2 X;  2J1R A;  1Z7S 1;  1RTV A;  3NV4 A;  1O4Y A;  1IKP A;  4BME A;  2XOM A;  2HWD 3;  4WVM A;  1DGL A;  2G9G A;  2GP3 A;  2JJ6 A;  3KF5 A;  4LO6 B;  4CRQ A;  5A3O A;  5LEK A;  3JCI A;  1V6K A;  3HT1 A;  3WG2 A;  2Y64 A;  3ZFG C;  3H42 B;  2A3X A;  2XQR A;  3B00 A;  4BIF A;  1NXD 1;  4X6R B;  2RS5 3;  1Z7S 2;  1W6Q A;  4BIO A;  3BGA A;  1AR7 1;  3GHM A;  2X05 A;  5EZW A;  3U78 A;  3SKV A;  3S30 A;  3WW1 A;  4AL9 A;  4XAB A;  4RGA A;  2J22 A;  2VH9 A;  3SMH A;  2XLF A;  3ENR A;  3H1Y A;  3T4V A;  2BOI A;  3ACI A;  2PN5 A;  2ES3 A;  1UY2 A;  4I0B A;  1O8S A;  1S0F A;  3I2K A;  4IND A;  1ZYB A;  1J3Q A;  5GZG A;  3VDB A;  1QJX 1;  2ZGL A;  1SDD B;  1AR7 2;  2P6C A;  3I2F A;  2CU5 A;  5GZF A;  2CDO A;  2KXL A;  4XW3 A;  4QD2 A;  1CAV A;  4L9B A;  2XQX A;  1XU1 A;  5EYX A;  2JDM A;  3UV9 A;  3MLK A;  3WNP A;  3RDI A;  3M3C A;  4MSV A;  1W6N B;  1MR5 A;  4RS5 A;  4GAL A;  3WEZ A;  2NPI A;  1S0C A;  2JG9 A;  1X9P A;  1VRH 3;  1BBT 3;  2VZP A;  1QJX 2;  4Q5O A;  2J7M A;  1RHI 1;  4I0W B;  4RQP C;  4Y20 B;  4DY3 A;  5FQ0 B;  3ECQ A;  4FO9 A;  1UY0 A;  2QKD A;  2W94 A;  1US3 A;  1QNY A;  1H6Y A;  4I02 A;  4PLO A;  3ZFF B;  1CJP A;  2GAL A;  4AXO A;  2P1B A;  4K9S A;  2CSG A;  1LUL A;  4GJY A;  1JZ7 A;  4ZHN A;  2RMU 3;  2O0O A;  4TYS A;  1RUF 2;  3RI8 A;  3J9S A;  2XML A;  1OOP C;  3BAL A;  4KGG A;  4QB6 A;  5LY2 A;  1XB9 A;  2OPK A;  2W47 A;  5T5O A;  2VZQ A;  4AI0 A;  4MX3 A;  5IAX A;  1XND A;  3ZYF A;  5GKA C;  1CPN A;  2ZEZ A;  3ZFE C;  1SQ4 A;  4FFG A;  4AE2 A;  2R04 1;  1N3O A;  1B35 C;  4NRQ A;  4LBO A;  2XJP A;  1FMD 3;  4CCD A;  1LKN A;  2ZGS A;  4I3G A;  3HMY A;  3C7F A;  5FXV A;  2GP5 A;  3UL2 A;  1HQL A;  2YBS A;  3I2D A;  1W0P A;  2IXC A;  3SH5 A;  4E4S A;  3BTZ A;  1RB8 G;  4OFG A;  4RGK A;  2VXR A;  1KS5 A;  2NZ9 A;  3FBY A;  4NWW A;  5E89 A;  1JHJ A;  3OTF A;  1VBC 3;  3FHQ A;  5LZ6 A;  2R04 2;  3I3D A;  1QJZ A;  3ACH A;  2IZW A;  4PIZ A;  3VKF C;  3VD7 A;  2ILM A;  5FY5 A;  4GMP 0;  5ACA 3;  1PM7 A;  2YDE A;  3S7E A;  5C9A A;  3WP4 A;  2B39 A;  2BOJ A;  2VEC A;  4BQ3 A;  3T08 A;  4LPL A;  2ZTN A;  1H0B A;  3N35 A;  2MPF A;  1E5S A;  3TRS B;  1ASJ 3;  3W5M A;  4P9G A;  1JOB A;  1GMM A;  1OOP A;  1RUE 3;  1OF3 A;  2Q30 A;  1VBE 3;  2EAL A;  3OF1 A;  3POB A;  3QBQ A;  3FZ3 A;  3CLP A;  3PTR B;  3VZL A;  2ATF A;  4JTN A;  5FBJ A;  1B35 A;  4L97 A;  3WZ1 A;  1ND3 B;  3AKP A;  3WP5 A;  1POV 1;  1HIX A;  2RV9 A;  1G9D A;  1WBF A;  1LOB A;  1DZR A;  3HBZ A;  1W8O A;  1UY3 A;  2XJU A;  4FTE A;  2UY8 A;  2WO7 A;  1BEV 2;  4QX0 A;  1ODM A;  3J7M A;  3CBN A;  5IAT A;  3WDY A;  1F31 A;  5J3U A;  4S2F A;  2VVF A;  1NE4 A;  4IXL A;  3MID A;  3AZZ A;  2Z2S B;  1XYP A;  3IKW A;  2QJV A;  3BI3 A;  2RS5 1;  2R06 3;  3QLQ A;  1S0B A;  4LEJ A;  1ULF A;  4K1Y A;  2HWD 2;  2Q5T A;  1K5M A;  3NKT A;  2E7Q A;  5LA1 A;  4H7L A;  4GXL A;  2VNO A;  4YGE A;  5JZG C;  1JOP A;  4Y33 A;  4AZZ A;  2AEN A;  2CAV A;  1WKY A;  2J1A A;  4UW6 A;  5HXM A;  3WCR A;  1RMU 3;  3EB7 A;  4X6Q B;  3ZKY A;  1W6P B;  1RUC 3;  1PNF A;  3ZXG A;  2IC1 A;  5L9R A;  3VBO C;  3LIG A;  3DPR C;  1CGP A;  1A3K A;  1G7Y A;  2PXJ A;  4XE9 A;  5F39 A;  3DCQ A;  4AHZ A;  3O5S A;  5T5J A;  3DL3 A;  4K8R B;  4Z07 A;  2WFP A;  2QQL A;  2VUC A;  5K0U B;  2VMI A;  1PO2 3;  4NO4 A;  5JMO A;  2BWA A;  3DUI A;  5F3G A;  4BK5 A;  3KV6 A;  4FPH A;  1UMI A;  4LBJ A;  1BBT 1;  3H8X A;  1SBE A;  2P4E A;  2XBO 3;  1LCL A;  2HKX A;  2IVI B;  2J1T A;  1RUJ 3;  2ZEY A;  1R09 3;  3ST7 A;  1XU2 A;  4A4A A;  3JQW A;  5I0S A;  3WP3 A;  1I9R A;  1Y7B A;  4L0P A;  5IWF A;  4MO3 M;  3UNP A;  2RMU 1;  4KBB A;  2XKO A;  3THP A;  3VBF C;  2JIC A;  4YFZ A;  1YQ2 A;  3X29 B;  1X8M A;  4LOR A;  1VRH 2;  1BBT 2;  1Q3E A;  5C4W B;  3EYP A;  3I97 A;  5EXO A;  3HN3 A;  4PI2 A;  1D2S A;  1FOD 2;  1ULG A;  3OYW A;  5LB6 A;  4D3W A;  1H8T A;  4FPL A;  5IT6 A;  5CFD A;  5KHK A;  3J7N A;  3LWC A;  3VKL A;  3ZYH A;  1WLC A;  2D5F A;  2GNT A;  3MIB A;  2JWP A;  2XJS A;  3KT1 A;  2B45 X;  2UYA A;  3AP4 A;  2R7E B;  2GN7 A;  1QOS A;  4LUL A;  3USU A;  5A7O A;  3KHC A;  1UW8 A;  4V1P A;  3APB A;  1RUN A;  4IGQ A;  1NE6 A;  1PMJ X;  1ZRC A;  2X09 A;  1V9U 3;  1FXZ A;  1VBC 1;  4QQH A;  1V6L A;  3FC0 A;  2DTW A;  4W50 A;  4BA6 A;  4MGI E;  2DVB A;  1FMD 2;  1OKO A;  3BVC A;  5LK5 A;  2J1V A;  4DNY A;  5A3P A;  2H6C A;  1KDM A;  1YQC A;  4LBQ A;  1A34 A;  4OUL A;  1S0I A;  3ITQ A;  3RSJ A;  4CCM A;  2BPA 2;  4Q4W 3;  4LBL A;  4AF9 A;  4NPM A;  4MET A;  1VBC 2;  1ASJ 1;  2WQZ C;  5FPL A;  1XSR A;  1W9F A;  3RWN A;  2PLV 2;  1VBA 2;  2YC2 A;  1OLM A;  1RUE 1;  1SZB A;  4HSL A;  5ACA 2;  3V0B B;  4OZO A;  1ENQ A;  1SFN A;  1VBE 1;  4RGG A;  2JDA A;  2VOK A;  4AG4 A;  5FZA A;  2IXK A;  5FYI A;  2JKX A;  4QQO A;  4WV8 A;  4Y4R A;  2OYZ A;  1ASJ 2;  3ZSM A;  5FOB B;  3RI9 A;  4HZF A;  1UY4 A;  2XXZ A;  2Y38 A;  4NE9 A;  4CDX A;  2WS9 3;  1L7Q A;  3LFM A;  5DDJ 2;  2ZA9 A;  4BM8 A;  5C7G A;  4Q4V 3;  2X5I A;  1RXF A;  3ZIW A;  1DHK B;  5JSO A;  1JUH A;  1UAI A;  5EYY A;  3WDT A;  2E63 A;  2JD9 A;  4CDQ C;  2PHT A;  4HLT A;  4AI1 A;  5LA9 A;  3O1S A;  4EN0 A;  4JGZ A;  4WM8 C;  2YPJ A;  1SBD A;  2QDR A;  1G6N A;  1V0A A;  2VMC A;  3R4S A;  1WGP A;  3VDD A;  3PUI A;  1ENR A;  2OT7 A;  4XF1 A;  1LGN A;  1W8N A;  1FPN 2;  2OX0 A;  4QMA A;  5J98 B;  4BQ4 A;  1UNB A;  3PL0 A;  1DLL A;  1O4T A;  2YC4 A;  1ZBE 3;  1AZD A;  1RMU 1;  1S0J A;  1HN1 A;  1HN0 A;  2AAC A;  4B8E A;  2FBE A;  1JMU B;  1MS1 A;  4AFC A;  4DS0 A;  2W91 A;  3ZOI A;  1C57 A;  1S55 A;  2R06 2;  1O7F A;  3T2P A;  1JS9 A;  1TG7 A;  5L9B A;  4XUR A;  3VBS B;  1BK1 A;  3T0D A;  1MS3 A;  2NP0 A;  1C8M 3;  2YV8 A;  4UAP A;  5J7M A;  3S0M A;  4F7Z A;  2P3I A;  4XFB A;  4YYO A;  4UBG A;  2WII B;  1LU2 A;  3OBT A;  4YGC A;  1BXH A;  4QU2 A;  4BQY A;  3N7M A;  1RUC 2;  4CE8 A;  4JVA A;  3ZXE A;  1Y3T A;  2TBV A;  1GOG A;  1BMV 2;  1WMD A;  1Y9G A;  4AYU A;  3WP6 A;  3ZO0 B;  1R09 1;  3CL1 A;  3J4U H;  5FZH A;  2ZHL A;  2WNV C;  2ORZ A;  2WUH A;  4CDQ A;  4FI9 A;  4E4H A;  4JAA A;  3UGG A;  1COV 2;  2FMY A;  1PO2 2;  5JDB A;  4LUK A;  4A6S A;  3UGF A;  1H30 A;  3AFG A;  5IJR A;  5D21 A;  5LBF A;  1JTZ X;  1GLH A;  3I3E A;  1UX7 A;  4XC9 A;  2G4I A;  2XBO 2;  4RYD A;  3OUI A;  5FKB A;  1I3H A;  1ZZ9 A;  1RUJ 2;  3J8F 3;  3NQH A;  2VZ1 A;  4CEW B;  4D69 A;  2Q4S A;  1OA2 A;  2EIE A;  4IE4 A;  4JGY A;  5KHH A;  2B8M A;  2XUM A;  1CAU A;  3D3A A;  1H2K A;  5FZ4 A;  3OBA A;  4AAX A;  4MGT A;  2EAA A;  1L7L A;  1S0D A;  2W68 A;  4N9H A;  4YVW C;  5F5I A;  2YG0 A;  2JD4 A;  4GB3 3;  3GBW A;  2W87 A;  4BCU A;  1JZ8 A;  1ENS A;  2R07 3;  1V9U 1;  2EVX A;  3DF0 A;  5FYZ A;  4CDU A;  1UXZ A;  2JG8 C;  3JZV A;  1W05 A;  4XHB A;  4LLO A;  3W21 A;  1AX2 A;  1WW7 A;  3DKW A;  3OY8 A;  4CP9 A;  3VHP A;  1NG0 A;  2R30 A;  1LEN A;  3AZX A;  3T0B A;  5LWB A;  1Z78 A;  4ISQ A;  4FTS A;  4UF0 A;  3AMH A;  4E2S A;  2XPJ A;  2QBX A;  3D82 A;  1CWP A;  3BPS A;  3H8R A;  5BNN A;  5CYY A;  1V6M A;  3ZYR A;  4L99 A;  1CAX A;  2VCB A;  3AL5 A;  1IPS A;  2VBD A;  4I01 A;  4KWL A;  1ZZ6 A;  4MOA A;  2Y6G A;  5GLV A;  3LEM A;  5FYM A;  2BJS A;  4BLJ A;  4GKY A;  1C5H A;  3JD7 3;  4Q4W 2;  2D97 A;  5C3P A;  3T1L A;  1WLW A;  2A6Z A;  5H9S A;  1SLL A;  4RN5 A;  2FMD A;  1ND2 C;  4J25 A;  4M4P A;  4UFI A;  4FXK B;  4CPB D;  4A45 A;  4DFS A;  4BDV B;  2GC2 A;  4QXK A;  1X33 A;  2EIC A;  4Q4V 1;  1ACC A;  1MZE A;  3M2M A;  2ZGQ A;  2C24 A;  4EWA A;  4HPK B;  4QGL A;  4DXR A;  5FJH A;  5JMC A;  4R4X A;  3AXD A;  5J1X A;  4HXC A;  2WS9 2;  3VL8 A;  5I0D A;  2ZGO A;  2EA7 A;  3LEK A;  2HWC 3;  2FDH A;  3UJO A;  3RZH A;  1GZW A;  4Q4V 2;  1YJK A;  4ZXK A;  2C0Z A;  3OSD A;  5IFP A;  4YZ5 A;  1LAJ A;  1SDW A;  1V6O A;  1VLN A;  2V09 A;  3MIH A;  1ZBE 1;  3JB4 C;  3SIS A;  3HR9 A;  1PX3 A;  1S0E A;  3T4H B;  3UKN A;  4NMI A;  4FPK A;  3B5L B;  4E4Z A;  1C5I A;  3HPN A;  1IS4 A;  5H9R A;  5FCC A;  1C8M 1;  3H50 A;  1DQ5 A;  1PO1 3;  3C7H A;  1PK6 B;  2GC3 A;  4OI0 A;  5IVC A;  1NCR B;  1PX4 A;  1G8W A;  4YVS C;  1O5U A;  1A8M A;  4MG2 A;  2OVU A;  2YBP A;  4E27 A;  1Q8P A;  3M3Q A;  3BOD A;  3ZX7 A;  3AXE A;  1O6U A;  5BYN A;  3B9C A;  1SLT A;  1IS5 A;  4QX7 A;  1C8M 2;  1D0G A;  4CCC A;  1DCS A;  3O1V A;  5FUI A;  1XSQ A;  4W4Z A;  1YJL A;  3J26 N;  5BNO A;  3K46 A;  2LS6 A;  4XQ4 A;  1YQ5 A;  4IV1 B;  3ZIX A;  1KGY A;  1N1S A;  1HV1 A;  4XIL A;  1UKR A;  4DIN B;  3EMR A;  4N53 C;  4YRD A;  2EF6 A;  3J8F 1;  4XUT A;  5GLT A;  3AJY A;  3O1R A;  4URT A;  4QX2 A;  4YW4 A;  3CIH A;  2ZGN A;  4NPL A;  5L9V A;  1UQX A;  4P9X A;  4XFI A;  4MXW A;  1AYM 3;  2VUJ A;  4OUM A;  4V2V A;  1MS8 A;  1WCQ A;  5FYY A;  1O3R A;  4GB3 1;  3J8F 2;  3GYD A;  2R07 1;  1LU1 A;  1W6O A;  3HNY M;  5F5C A;  4DEQ A;  1NA1 A;  4N43 C;  4WM7 A;  2A75 A;  1H4G A;  1XE0 A;  3FBM A;  3CZU A;  4A2U A;  5CEH A;  1AYN 3;  1OPO A;  3VBU C;  2HH9 A;  1UU5 A;  4LK7 A;  5SV5 A;  1OD5 A;  4IL7 A;  4LT5 A;  1WW5 A;  1QJY 1;  5G04 L;  1CX1 A;  2AZ5 A;  1YFY A;  1DFQ A;  4GB3 2;  4N7I A;  4K1Z A;  3MI8 A;  3NNF A;  4JCK A;  3MFC A;  3PJY A;  3WW2 A;  5FDB A;  1KIT A;  1LRH A;  2Q0A A;  1OH3 A;  1UF2 C;  1W6M B;  2RDQ A;  2W5F A;  5APA A;  2KA3 A;  4N53 A;  1Q5O A;  2DUQ A;  2K9Z A;  1ZRE A;  4M0N A;  4YNI A;  1W8W A;  2NMO A;  2YB7 A;  4LR4 A;  3RZJ A;  3JD7 1;  5F3I A;  3GBG A;  2R0H A;  5BPX A;  3S5A A;  1OQ1 A;  2QQK A;  1CON A;  5JVV A;  2PHU A;  2CWS A;  4QXC A;  4DO0 A;  1F9K A;  4F83 A;  4XTM A;  4W6X A;  4GH4 B;  1X36 A;  3FX3 A;  3JB8 A;  3NNL A;  5FP9 A;  4XAE A;  1ST8 A;  1LGB A;  3FFQ A;  3PDQ A;  1RUI 3;  4YW3 A;  3R4D B;  5C8C A;  4Z2A A;  4DXS A;  4N43 A;  3JD7 2;  4LBM A;  5ABJ C;  5SV8 A;  3VBU A;  3U10 A;  3VZJ A;  4BQW A;  2VOW A;  4K40 A;  5KHJ A;  1H9P A;  3WQ1 A;  2ZZJ A;  4AFB A;  1WMX A;  4S2G A;  4PIX A;  2ADD A;  3HVD A;  3AYC A;  4D8M A;  1GNZ A;  2A73 B;  3M3I A;  2W08 A;  4AOC A;  1NQJ A;  1AR8 3;  2YBK A;  4J1X A;  3IB3 A;  4XVH A;  5F3E A;  4AAP A;  1QXR A;  1QQP 2;  2QUO A;  5FZO B;  2YZ4 A;  2HWC 2;  4EN6 B;  2VQA A;  4HAN A;  1TME 2;  3WR0 A;  1NCQ A;  2JE9 A;  2D93 A;  1PO1 1;  2HYK A;  4HKO A;  3WDU A;  4M00 A;  1A6C A;  3ELN A;  1AUY A;  3O12 A;  3ZDS A;  2PHW A;  2HYX A;  3SLI A;  1UY1 A;  4E2G A;  1VMH A;  2DUR A;  5FRA A;  2WFF 1;  1S2E A;  1W3V A;  4WVW A;  5JI7 A;  4AFD A;  5F7U A;  3CJI B;  1GP5 A;  1F2N A;  3OBZ A;  1ZNP A;  5ABJ A;  2FCU A;  4ASM B;  3F95 A;  2WAB A;  1O4Z A;  5FIX A;  4AHW A;  2K46 A;  2Y6K A;  4GWN A;  4NHX A;  4TLG A;  5FYH A;  1CR7 A;  1PIV 3;  1I5P A;  1MS9 A;  2VY0 A;  3AP6 A;  5L7O C;  2BFU S;  2BZD A;  2D7F A;  4C1X A;  3V0A A;  1K42 A;  5J09 A;  3AYA A;  1JYX A;  4COV A;  1CAW A;  3SCF A;  3O7O A;  5GLU A;  1XYN A;  1PVC 2;  3I2J A;  4CCN A;  3WX5 A;  1IKQ A;  4GWJ A;  2ZHN A;  5FZI A;  3LEI A;  1WCK A;  2Y6F A;  1EV1 3;  3C7G A;  3LA7 A;  1POQ A;  3SNM A;  4XJU A;  3THD A;  1N47 A;  3QD6 A;  2PHD A;  4MHU A;  4XQD A;  1AYM 1;  5FXZ A;  3ZR6 A;  4RHV 2;  4KU8 A;  2GSY A;  1VBB 3;  1SHW B;  3NAP B;  4KI5 M;  3VD4 A;  5E8A A;  5A7P A;  1UOJ A;  2DUO A;  4IEO A;  3MEP A;  2HWB 2;  3VBH B;  2Y0I A;  4I3P A;  4QPG C;  1J84 A;  4PI0 A;  2HEY F;  1RYY A;  3AVS A;  5FV3 A;  3RG0 A;  3RYK A;  2QDN A;  1OF4 A;  1UU4 A;  4LHS A;  4XMI A;  2Q8E A;  3RFR A;  4EWE A;  4YZ2 A;  5GJ6 A;  4YG3 A;  1AYM 2;  1HQW A;  2K0G A;  3BPZ A;  3AP7 A;  5IVF A;  4LIV A;  3N9M A;  4DRV A;  1H1A A;  1AXY A;  2WLP A;  4HKW A;  3VGI A;  3IDA A;  4P9Y A;  3ZFG B;  1EPW A;  3GZU C;  4JRL A;  2GC1 A;  4COZ A;  3I3M A;  2P6H A;  2RR1 3;  4CP2 A;  5AC9 1;  5CFC C;  3AM2 A;  4EE2 A;  1RHI 3;  4OI2 A;  2WA3 A;  5E1R A;  2WRA A;  1AYN 2;  1SAC A;  5A3L A;  1E5R A;  1JI6 A;  1H1M A;  3MGU A;  1DYO A;  1ZRF A;  2A71 A;  1S1A A;  1QJU 3;  4AI8 A;  1OXC A;  1O91 A;  3NJX A;  3AK0 A;  2A6V A;  3U1X A;  2Z42 A;  2WNE A;  1YQ6 A;  3JUU A;  2NN8 A;  1LOF C;  2B7Y A;  2V73 A;  3VBR A;  2VUL A;  3G6J B;  4RSU A;  5IK5 A;  3ZXK A;  1DGW X;  4TTG A;  1RUI 1;  1QU0 A;  5ANQ A;  5E6H A;  4DOU A;  1ULC A;  3GM8 A;  2W92 A;  4QHO A;  1MEC 2;  2FDI A;  1YWK A;  2A6Y A;  3NNJ A;  2CL2 A;  4JDN A;  4U36 A;  1IS6 A;  2X29 A;  1YLL A;  3IMN A;  3NRU A;  5D8A C;  2PAM A;  5FY7 A;  1YI7 A;  2GZW A;  2W1Q A;  4NHM A;  2RS3 1;  5FTT C;  2BRT A;  5IVV A;  3E97 A;  3GXU A;  4IV3 A;  4RQP B;  5AVA A;  1HJF A;  2FCT A;  1TNR A;  4N8M A;  3AMN A;  4RL7 A;  1L7R A;  4XYX A;  1W9T A;  2CAU A;  5CFC A;  3W59 A;  3T2T A;  1UIJ A;  3CMG A;  2BNN A;  3NV3 A;  5CZK A;  3V56 A;  5DUV A;  1LOE A;  1WLD A;  1AF9 A;  1AR8 1;  1YC6 1;  2Z5W A;  3KV4 A;  1SPP A;  1V6I A;  3MBW A;  3HNB M;  3UET A;  4AI3 A;  1AL0 G;  1HLC A;  1IQD C;  3OUH A;  3UKT A;  5ISL A;  5DUU A;  4A7Y A;  1WME A;  3ZFE B;  1XJA A;  4DIQ A;  4QX5 A;  3WV6 A;  2WAO A;  1FV3 A;  3TNQ A;  5BNP A;  2R0F A;  3E6B A;  4Q0S A;  2DF7 A;  5A6X A;  2XL7 A;  2WWS A;  3DEC A;  3DEM A;  4COU A;  2Q1F A;  3D5O A;  3KD4 A;  4TSV A;  2QQJ A;  2WO3 A;  1F4H A;  2MEV 3;  2V5Y A;  4RS5 C;  2PHX A;  2Q8C A;  1ZA7 A;  1PIV 1;  1R1A 2;  4ZZ8 A;  2JG9 C;  3VKO A;  1N3P A;  4QDQ A;  2F4L A;  4RD7 A;  4GZ9 A;  1HXS 2;  1GFF 2;  4QGM A;  3ACL A;  4IER A;  2I07 B;  3KT4 A;  4O61 A;  1QF3 A;  4XUN A;  4QXH A;  3R6S A;  5JCT A;  3S6P A;  3O14 A;  4XEZ A;  1US2 A;  3BTY A;  1PIV 2;  2D98 A;  2W95 A;  1EV1 1;  3A7Q A;  4UWD A;  5FMO S;  4Z92 B;  4XHX A;  2O14 A;  2IXI A;  4KWK A;  1OVS A;  3QAC A;  4DPN A;  1VBB 1;  3ZM8 A;  4BOW A;  3DYM A;  4YM0 A;  4CDW A;  5KHG A;  1VAL A;  3R0R A;  2O8O A;  5EWS A;  2DV9 A;  3ZN4 A;  4HON A;  5AFB A;  3NKG A;  3WSO A;  3I3B A;  1TEI A;  4OHW A;  4OMC A;  1EV1 2;  4XF4 A;  1O3T A;  1UOB A;  2ZGU A;  4Q0P A;  4AI2 A;  2B9V A;  4HOO A;  4ONU A;  1POV 0;  2DYC A;  2FD8 A;  3L2H A;  2G19 A;  1R08 3;  2A3W A;  4YW2 A;  3ZMN A;  4XF3 A;  2RR1 1;  3G7D A;  3AP9 A;  2ZGP A;  4XZP A;  5DAX A;  3I59 B;  3DGT A;  5C9A C;  2IFR A;  3N9P A;  1JZ5 A;  1OPM A;  1Q8Q A;  2AC1 A;  1YRZ A;  3AVR A;  2VMG A;  4I09 A;  5DAB A;  5LRR A;  3O0W A;  1VPH A;  4OVE A;  2QQI A;  5I0T A;  5JZG B;  3KCX A;  3RRD A;  2QQU A;  5JXG A;  4GIQ A;  1RXG A;  5ANN A;  4BXS V;  1QJU 1;  2KD7 A;  3MLJ A;  5A6Q A;  2GAU A;  1OKQ A;  5I8S A;  1RHI 2;  3VBO B;  2KR2 A;  2ZX4 A;  3DPR B;  2OZ6 A;  4IE7 A;  5FPZ A;  1J58 A;  3KHB A;  5I0U A;  4YFW A;  4XIK A;  5T54 A;  1HRI 3;  2XVL A;  5D1I A;  1F5F A;  1C3H A;  1FX5 A;  3KV5 A;  4IEZ A;  4DMI A;  3B9I A;  5T5L A;  4FAH A;  3NMB A;  4BMB A;  4Q4Y 3;  3N7L A;  4ZU5 A;  2HBU A;  4NJ4 A;  5JPN B;  4YM2 A;  2EID A;  1N1T A;  4IE0 A;  4BE3 A;  3RVH A;  1ZZ7 A;  4MLO A;  2ID4 A;  4C1W A;  1XXN A;  3ACG A;  1OLM E;  3LQC A;  1UZZ A;  3FN9 A;  4P5H A;  5JXJ A;  2I74 A;  3VBF B;  5GM0 A;  4CCJ A;  5HXV A;  4ARX A;  1K5M C;  1XE7 A;  3AKR A;  4AVC A;  4NHK A;  5DZF A;  3ZYG A;  4KG8 A;  4QT6 A;  2DFB A;  1UYZ A;  4M3C A;  1QH7 A;  4Q0U A;  4QWN A;  3FL7 A;  1NKG A;  2VZR A;  5A6Y A;  2JEN A;  1H6X A;  1W8Z A;  1DZT A;  1PZ7 A;  3K3N A;  4FPY A;  4AGV A;  4NAM A;  4LO7 A;  2GC0 A;  2OS2 A;  4J6G A;  1JYW A;  3WF3 A;  1DDL A;  2R16 A;  1V70 A;  2C6S A;  2YU2 A;  5T3N A;  3RZG A;  4K6B A;  2YUE A;  3P6B A;  4KGQ A;  5GLZ A;  1VMF A;  3RZL A;  1J83 A;  2VCC A;  2A3Y A;  1EP0 A;  2MEV 1;  2W3J A;  3LDB A;  5T50 A;  4XTP A;  3WCS A;  3CKH A;  5A6Z A;  1UCX A;  2QQN A;  1G9C A;  1AVB A;  3GZT B;  3IAQ A;  3JU9 A;  3Q9O A;  5FPV A;  3N7J A;  2C5D A;  3MPB A;  5FZ3 A;  5FK8 A;  2A5Z A;  4QPI A;  3LGR A;  1GKB A;  2VQU A;  1MZ5 A;  3KT7 A;  4YG0 A;  5A1L A;  2WZR 3;  5HCA A;  1RUO A;  5FY4 A;  5H9P A;  4DRR A;  2EXJ A;  2O8Q A;  3A4U A;  3ZXD A;  4FQ4 A;  4LA3 A;  4B3N A;  5FYC A;  4CEY C;  1YFU A;  3RPQ A;  4EZ4 A;  1WZX A;  2VZV A;  4XCA A;  4LLF A;  1H8T C;  2VBB A;  3LDK A;  4NUB A;  4AVB A;  5CFD C;  1MQT C;  4Y5Z 0;  1AHS A;  1TNF A;  2ZHM A;  3WDV A;  2RS5 2;  2VUD A;  2EXH A;  2QE3 A;  5A3M A;  1NYW A;  5LA0 A;  1JXN A;  4NRP A;  1RUD 3;  2JX9 A;  5DAP A;  5A70 A;  3E5X A;  1CVN A;  2VZ3 A;  2W1U A;  5KR7 A;  1SBF A;  4I30 A;  2PA7 A;  3VB9 A;  3ABZ A;  4IW3 A;  1AJO A;  1NZI A;  4C0H A;  1NLS A;  4Y24 A;  3NVC A;  1JOJ A;  2EIG A;  2FQP A;  4ZS3 A;  2E31 A;  5JXH A;  4Y3O A;  1DIW A;  4BYY A;  1R08 1;  2D6K A;  2WA4 A;  1YFX A;  5EPA A;  4A41 A;  4CDQ B;  4LOS A;  4MVT A;  3M3E A;  1DU3 D;  1KEX A;  5EJZ B;  2VQ0 A;  4WM8 B;  2E32 A;  1GQG A;  1LR5 A;  2HLE A;  3PIG A;  3MDP A;  4OQ9 A;  1O3Q A;  3Q8C A;  2DCJ A;  1PVX A;  3KMH A;  1OQD A;  1PZ8 A;  2KM2 A;  1JYC A;  1DYP A;  2YMZ A;  2QQW A;  5FZD A;  1GUI A;  1FAY A;  4J1W A;  1H2N A;  1HB3 A;  3HNM A;  1KJR A;  1K3I A;  4CEY A;  1FAT A;  2WWU A;  4HL0 A;  1CAU B;  2BNM A;  2VJX A;  4IEX A;  1AXZ A;  4MGK E;  1MQT A;  2CV6 A;  4AQ2 A;  5FP7 A;  1J59 A;  4R9C A;  2JEM A;  1Q56 A;  2DCK A;  2EAK A;  2UWA A;  2RMU 2;  3PVO A;  4KU7 A;  2WSU A;  3H8U A;  1HRI 1;  3N9N A;  4MZU A;  5A7Q A;  5T5P A;  3SC7 X;  1W6N A;  4CDX C;  1NXM A;  2VG9 A;  2VGD A;  4LO8 A;  4WVZ A;  3MFA A;  4Q4Y 1;  2OZJ A;  3KF3 A;  3BB6 A;  4Y20 A;  2LTN A;  3N9Q A;  4C8D A;  1XNA A;  4AVA A;  5FQ0 A;  2X5I C;  1W0O A;  2VMD A;  1M4W A;  3HOB A;  2YGM A;  3OY8 B;  4TN7 A;  4ITC A;  3C2U A;  5FZC A;  3ZFF A;  1AR6 3;  5LAT A;  4EZH A;  1W28 A;  4W65 A;  2LW8 A;  3EJK A;  2WNV B;  1O59 A;  2VM9 A;  2XLG A;  4IE5 A;  1OLQ A;  2AUY A;  1H2M A;  5A3U A;  4JGZ C;  4N90 A;  4Q4Y 2;  1OLR A;  5TSW A;  5J37 A;  2FDG A;  1ULD A;  1W2O A;  3EBR A;  3VDD C;  2VCA A;  3ZN6 B;  4NAO A;  1LHV A;  3Q8F A;  5GLW A;  2XHN A;  5DZG A;  2E7T A;  5M0T A;  1UOG A;  3LPG A;  4BZ4 A;  4KWU A;  1DBN A;  1JYT A;  2BTV C;  2WQ8 A;  3K2O A;  2MHF A;  4NRM A;  3OJB A;  2AGS A;  2WT0 A;  1SLB A;  4PF1 A;  3CNA A;  4LBN A;  3GZE A;  5IVE A;  1QXP A;  2RS1 3;  4YVW B;  5FR3 A;  3KGL A;  2QTW B;  3RJR A;  1RUE 2;  2JG8 B;  1P8J A;  3LZZ A;  3POW A;  2YFU A;  5EHD A;  1VBE 2;  4IE6 A;  4QQL A;  5FLI A;  2MNG A;  2F6B A;  2JIG A;  1VBD 3;  5JSR A;  1V6J A;  1HW5 A;  1HJG A;  1MVE A;  3TOJ A;  1ZRI A;  4YZ1 A;  3SIT A;  2W2I A;  5K7P A;  4K3U A;  2ARX A;  4LHN A;  2JE8 A;  1QOO A;  2WZR 1;  2W52 A;  1LHU A;  4O9E A;  3ZSE A;  3ILR A;  3DXU A;  4A3X A;  1UZY A;  2VZS A;  3I54 A;  4OMD A;  4RFT 0;  4UYB A;  3WT3 A;  1XYO A;  1JU4 A;  1OUX A;  3B3Q E;  1ONA A;  1GV9 A;  2SLI A;  1HB2 A;  4CCL A;  2G9F A;  1ND3 A;  4ES8 A;  3H8O A;  3BTA A;  1VMJ A;  3C7E A;  4JGY C;  2RM2 3;  5B4X A;  1OBN A;  4X8P A;  4YM1 A;  3SKJ E;  2ZX0 A;  1RUD 1;  4IEW A;  3R05 A;  4BLI A;  3ES4 A;  1ND2 B;  4NID A;  1GOF A;  1ZBA 3;  3PU8 A;  2EXK A;  3WDW A;  1AJK A;  1GAN A;  1RMU 2;  1ZM1 A;  3BOW A;  3OBR A;  3P1I A;  4HN1 A;  4HMZ A;  4M3C F;  4CDU C;  5FPX A;  4QAW A;  1GIC A;  3WNL A;  2HWE 3;  5FFO C;  2C4X A;  3MW2 A;  1G86 A;  1Y43 B;  2P37 A;  4FOW A;  1D4M 1;  4ZXE A;  1VE0 A;  1PMH X;  1LOC A;  3EXU A;  5A32 B;  4D94 A;  2ZML A;  3NO8 A;  1W6P A;  2J1E A;  4HFS A;  3SH3 A;  5BNN C;  1KRI A;  1LHO A;  4G3Y C;  4NRO A;  3ZYJ B;  1RUG 3;  5A33 B;  2ZAC A;  4KBZ A;  1MVQ A;  3AMQ A;  1R09 2;  2JDY A;  3E5Q A;  3OGV A;  4IEQ A;  3IDE A;  5AFE A;  3ETQ A;  1EUT A;  3VKM A;  5B2G B;  1ZRD A;  4P02 B;  2WQ4 A;  2EXI A;  3K75 B;  5K0U A;  3ZR5 A;  3ON7 A;  1WLT A;  4O7X A;  1K45 A;  1CJD A;  1FNY A;  1OHF A;  2BV4 A;  4YVS B;  5FK7 A;  1W6O B;  5C70 A;  3H7Y A;  4BU2 A;  4NIG A;  2IXL A;  1X9T A;  2Z4F A;  4R4Z A;  3DV8 A;  1AR6 1;  3T2Q A;  3CQO A;  4NWV A;  4D7T A;  3MHZ A;  2X53 S;  4PCR A;  1QJY 3;  5C4W A;  1IPJ A;  1XNC A;  3B7M A;  3GGL A;  3WNX A;  2E51 A;  1V9U 2;  4IUG A;  3T3Y A;  3W5N A;  4Y5T A;  4CA9 A;  5FP3 A;  1GWK A;  4ZY9 A;  5F3C A;  3TEZ A;  4DXT A;  5FMO L;  2DVA A;  2R32 A;  1N1Y A;  2VPV A;  3FLP A;  4LKE A;  2VCM A;  4QB2 A;  5FZ1 A;  2XON A;  1GNY A;  1WA4 A;  4IEY A;  4PDW C;  4FFI A;  3AZW A;  2BGP A;  2VTX J;  4QDR A;  2RS1 1;  2B9U A;  1TQ5 A;  4XBL A;  4LIU A;  2A70 A;  4JQR A;  3IDC B;  3TNP B;  2LM3 A;  3VZM A;  4CZS A;  4B7E A;  3N9O A;  3WNN A;  5L19 A;  4M01 A;  2IWG B;  4YWA A;  4HG6 B;  2PFW A;  3VBU B;  1ULE A;  3H3U A;  3IM0 A;  5JIA A;  3WG3 A;  2VTX A;  4XJA A;  4EQV A;  2D6P A;  1ZX5 A;  5FZK A;  1VBD 1;  2WYS A;  2CYF A;  4LIT A;  2RHP A;  3FWE A;  2YYO A;  4OYU A;  2RS1 2;  1O8P A;  1AX0 A;  4Y4Y A;  5EQU A;  3FLT A;  5FYV A;  5BNO C;  3KM5 A;  5FY0 A;  2GND A;  4QPY A;  3V0B A;  3A0K A;  4XJZ A;  2A6W A;  5DAW A;  2VME A;  2OQ6 A;  3BYW A;  3GJA A;  3J7H A;  4JKM A;  5FZG A;  4CYD A;  5G05 L;  1RGS A;  3WG1 A;  2B5H A;  3U37 A;  1A78 A;  3VBS C;  3WW4 A;  2BWC A;  1NLR A;  1AR9 3;  3GDB A;  3OPZ A;  4LUM A;  2RM2 1;  4YW6 A;  4XFC A;  2BQP A;  1X7N A;  4QKN A;  4HET A;  5CG9 A;  5A7W B;  3O1T A;  4PJY A;  3LDR A;  1W03 A;  1PGL 1;  4PDW A;  2BU9 A;  2DU1 A;  4PIY A;  4AVV A;  3OEB A;  5DXD A;  4U2A A;  1ZBA 1;  2R1B A;  3M3O A;  4HT1 T;  1ZBE 2;  4D6S A;  1QXJ A;  2Y60 A;  1GP4 A;  1UMH A;  1NA1 C;  2RM2 2;  1DG6 A;  3PME A;  1MS0 A;  4WM7 C;  4YLZ A;  4URA A;  1KD7 A;  5C3Q A;  3BKZ A;  2CGP A;  3AX4 A;  3LIH A;  2HWE 1;  3OGJ A;  2WFF 3;  5EV7 A;  2Z69 A;  4NII A;  2WR9 A;  3LEG A;  2IXJ A;  1MZ6 A;  1CPM A;  4GWM A;  5IYY A;  1ZBA 2;  1FI2 A;  2GMM A;  4HKL A;  3AP5 A;  4DUV A;  4DUW A;  5C5U A;  3P5B A;  5F32 A;  1JZ2 A;  1T6B X;  1JYN A;  1GNH A;  1LOG A;  1Q8S A;  5GZE A;  1SLI A;  4D7S A;  5EIY B;  1XQN A;  3P3N A;  5FZ6 A;  1GSL A;  2HWE 2;  2WL1 A;  1OH4 A;  1RUG 1;  3ROU A;  1UL9 A;  1CES A;  3VBS A;  4DUX A;  1U5Y A;  2DCT A;  3IMM A;  2DVF A;  3BN6 A;  3PVB B;  3NJY A;  2DVG A;  4PF5 A;  1VP6 A;  1DLC A;  2WYF A;  2XG3 A;  2ZXQ A;  1JYV A;  3ZSK A;  1SCR A;  1TVG A;  4YPJ A;  1XE8 A;  2D6N A;  4L92 A;  1G9A A;  2VBP A;  3WOG A;  3SEP A;  1S4C A;  2ET7 A;  5C8C C;  4AK3 A;  4YAR A;  2CWM A;  5BNQ A;  1UMZ A;  2ZGT A;  2D6L X;  3WG4 A;  3LSE A;  4KH9 A;  2W39 A;  1DYK A;  3RZK A;  2JE7 A;  1LHW A;  3W58 A;  1QDC A;  4EV0 A;  2FDJ A;  5FWE A;  4HN0 A;  5FY9 A;  1R64 A;  1GR3 A;  4H3W A;  5L7O B;  1YUD A;  3PJQ A;  1EAH 3;  3D0S A;  4EN9 B;  1E57 A;  2ZX1 A;  4CEW A;  2R07 2;  4Y22 B;  2RDR A;  5AC9 3;  3ZDV A;  3J7L A;  5CVR A;  4CXX A;  5JPM B;  1BQP A;  2ETE A;  3WF0 A;  4QDS A;  1HKD A;  4C90 A;  5B4N A;  1SFP A;  4EJR A;  2GNB A;  1YIF A; 
#chains in the Genus database with same CATH homology
 4CCJ A;  5FYB A;  2OQ7 A;  3AL6 A;  5A7S A;  3KV4 A;  4GAZ A;  3K3O A;  5FZ1 A;  4QWN A;  5ISL A;  2OT7 A;  2YBK A;  2OX0 A;  5FXX A;  3K2O A;  3KVB A;  5F3E A;  5FZO B;  4AAP A;  3K3N A;  2XUE A;  3DXT A;  4Y33 A;  4DIQ A;  5A3W A;  2OS2 A;  4LIU A;  2Q8D A;  5IVE A;  3U78 A;  5IVJ A;  2YU2 A;  3N9O A;  3PU3 A;  3UYJ A;  4EYU A;  3PUA A;  5FZE A;  4ASK A;  5FYU A;  2YPD A;  5IVC A;  2PXJ A;  4UF0 B;  5FZK A;  5F39 A;  4LIT A;  2YBP A;  3LDB A;  3PUR A;  5IW0 A;  3ZLI A;  5FYV A;  2Q8C A;  2P5B A;  2W2I A;  4QX7 A;  5FZ9 A;  5FPV A;  5FZ7 A;  5F3G A;  5FYH A;  2OQ6 A;  3KV6 A;  5FZ3 A;  5IVB A;  5FZG A;  4LXL A;  3DXU A;  5FZH A;  5A1L A;  5LW9 A;  5FY4 A;  3PUQ A;  3ZPO A;  5FXZ A;  4E4H A;  4GD4 A;  4D6Q A;  4QXH A;  4XDP A;  4QU1 A;  4CCL A;  4CCN A;  5FPA A;  5F2S A;  5FYC A;  5A7W B;  5FZI A;  5IWF A;  4EZ4 A;  5FY8 A;  4NUB A;  4BIS A;  5FPB A;  1VRB A;  4GJY A;  5A1F A;  5F2W A;  4QX8 A;  4D6S A;  4IGO A;  2XML A;  5K4L A;  5LY2 A;  3OPT A;  3PU8 A;  2WWJ A;  4URA A;  5FZ4 A;  4HON A;  5A7P A;  5KR7 A;  4IGP A;  4V2V A;  5FYY A;  4CCO A;  4D6R A;  4BXF A;  5FP8 A;  5FWJ A;  3AVS A;  5F5C A;  5FV3 A;  5F5I A;  4Y3O A;  5FYS A;  2Q8E A;  5F5A A;  5FP4 A;  5A3N A;  4HOO A;  5FUP A;  5FXV A;  5FZO A;  2GP5 A;  5CEH A;  5FYZ A;  5A7O A;  2YBS A;  5FZB A;  4IGQ A;  5F32 A;  5IVF A;  4LIV A;  3N9M A;  3PUS A;  3N9L A;  5FZF A;  4CCK A;  4V2W A;  5FZ6 A;  5LY1 A;  3N9P A;  3KVA A;  5IVY A;  3LD8 A;  5A3P A;  2VD7 A;  3AVR A;  5LWB A;  5FJK A;  4UF0 A;  5FY5 A;  5FZD A;  5F37 A;  3NJY A;  5FUN A;  4CCM A;  5FPU A;  2WWU A;  2XDV A;  5FPL A;  5FY1 A;  5FZ8 A;  3AL5 A;  4GJZ A;  5FP7 A;  5FXW A;  4AI9 A;  5F3I A;  5FYM A;  5A7Q A;  3N9N A;  5A7N A;  4XDO A;  4CUG A;  2YU1 A;  4BU2 A;  5FZM A;  4QXC A;  4DO0 A;  5FZA A;  5FYI A;  5ANQ A;  5E6H A;  5A3T A;  3KV5 A;  5FYT A;  3KV9 A;  5FP9 A;  3PTR B;  3PDQ A;  3N9Q A;  4Y4R A;  5FBJ A;  5FZ0 A;  4C8D A;  5A80 A;  3OPW A;  5FY0 A;  3U4S A;  2XXZ A;  5FZC A;  4TN7 A;  4QXB A;  5FWE A;  5FY7 A;  5A7W A;  5FY9 A;  4CSW A;  4EZH A;  5IVV A;  5FZL A;  3RVH A;  5FJH A;  5FP3 A;  5F3C A;  2GP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...