4QX8A

Crystal structure of histone demethylase kdm2a-h3k36me3 complex with alpha-kg
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
329
structure length
329
Chain Sequence
RTFDLEEKLQTNKYNANFVTFMEGKDFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIEMTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPSTVDFIDWVDNMWPRHLKESQTESTNAILEMQYPKVQKYCLMSVRGCYTDFHVDFGGTSVWYHIHQGGKVFWLIPPTAHNLELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSGWIHAVYTPTDTLVFGGNFLHSFNIPMQLKIYSIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKDFQKESLSMDME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/structural protein
molecule keywords Lysine-specific demethylase 2A
total genus 101
structure length 329
sequence length 329
chains with identical sequence C
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4qx8A01
5FPAA 4GJZA 4BISA 3PU3A 3K3OA 5F37A 4D6QA 2WWUA 5FYMA 4C8DA 4CCLA 5FJKA 2VD7A 5FZFA 5FZ3A 3U4SA 5F39A 5IVVA 5IVEA 5FY5A 5FZHA 5IW0A 5FXXA 5F5AA 5FZMA 5A7PA 5FYCA 5FPUA 5FWEA 3U78A 3AVSA 4UF0A 5FYSA 5FYVA 4GAZA 2OX0A 3PDQA 3PTRB 4HOOA 4Y3OA 5FYZA 5IVCA 2GP5A 2W2IA 2OQ7A 3KVBA 5F2SA 4CSWA 5ANQA 5FPLA 5IVFA 4QXBA 5FP4A 4CCJA 5FZKA 4GD4A 5FZOB 5KR7A 4IGQA 5FZOA 5FP8A 2YU1A 5K4LA 4D6RA 4LIVA 4GJYA 3AL5A 5FYUA 3PUAA 4NUBA 5FYTA 2XMLA 4QX7A 3N9OA 5FY4A 3KV5A 3N9MA 5FP3A 5FPBA 3N9QA 2PXJA 5FZAA 5F5CA 3DXUA 4CCKA 3AL6A 4HONA 4AI9A 5F2WA 5FZGA 3KV9A 5F32A 5A3PA 2YU2A 4EZ4A 5IVBA 5FV3A 5FZ4A 3PUSA 2XXZA 3OPWA 5FZBA 5FY1A 5F5IA 5FYBA 2OT7A 5A80A 3KV4A 4Y33A 5FZCA 5A7SA 5F3IA 5LY2A 4V2VA 5FZ0A 3DXTA 5A3NA 3PURA 3N9LA 5ISLA 2YBPA 2GP3A 4QXCA 4ASKA 5FBJA 5FYHA 5FJHA 5FZ8A 5IWFA 2YBSA 3K3NA 2OQ6A 4CUGA 5FP7A 2XDVA 5FY7A 4EZHA 5FZ6A 2Q8EA 3N9NA 5IVJA 4QXHA 5IVYA 4XDOA 3NJYA 4DIQA 3LD8A 2OS2A 1VRBA 5FPVA 5FZ7A 5FWJA 5FZDA 4XDPA 5FXZA 5FXVA 5LW9A 4AAPA 5FZ1A 5FYYA 4LXLA 3OPTA 3ZLIA 4D6SA 5F3GA 5FZIA 3N9PA 5A3WA 4UF0B 5F3CA 4BXFA 5FZLA 4EYUA 2Q8CA 5FXWA 4BU2A 4CCOA 5LWBA 5CEHA 3K2OA 5A1FA 2YPDA 5FY8A 5FY0A 5A7OA 4IGPA 4QWNA 5FYIA 4Y4RA 3PUQA 5FUPA 5E6HA 3AVRA 5F3EA 4URAA 5A7WA 3KVAA 4E4HA 5A7WB 5FZ9A 4IGOA 5FUNA 5A7NA 4LIUA 2XUEA 3KV6A 5FY9A 2P5BA 4TN7A 3PU8A 4QU1A 3UYJA 5A3TA 4QX8A 5FP9A 2YBKA 4DO0A 5FZEA 4V2WA 5A7QA 2Q8DA 5A1LA 3LDBA 3RVHA 4CCNA 2WWJA 3ZPOA 4LITA 5LY1A 4CCMA
chains in the Genus database with same CATH superfamily
3D82A 5FR3A 5J37A 3DV8A 2YDEA 4PQ9A 1K12A 3C7HA 2A1XA 1IPJA 3K51A 4GXLA 2BGOA 2XVGA 3I2DA 2PAMA 3SKVA 1S0DA 1XE7A 2BW8A 2R32A 3VBFA 1YCIA 4FPGA 5JVVA 1OPMA 5JXJA 4JRLA 5AFBA 4OI2A 1W6PA 2XL9A 1RL3A 3ATGA 1BBT2 3E1F1 3ITQA 5F3CA 3NSTA 1IG0A 1YQ6A 4IEWA 1RUD2 5H9PA 3LPGA 1TMF1 2EXIA 4IEUA 5BNOB 4XE9A 4IEPA 5LA9A 4A42A 4DS0A 1REDA 4XABA 4PI0A 5B4XA 1OI6A 1VAMA 4QX1A 1HXS2 1SQ4A 1OKOA 2H0BA 5FZOA 3RWNA 3WP6A 3ZFFA 4FI9A 4ZS2A 2FMDA 3FHIB 1E5SA 3B01A 3ZR5A 4L97A 3CF6E 3KV5A 1AR92 2VUDA 4PF1A 4WVWA 3C3VA 4UFHA 3DXUA 3QBQA 1QOSA 1TEIA 1UZZA 2UWCA 1O3SA 3JBG1 4E8DA 1OMIA 4P00B 4Q4X1 2IXJA 2SBAA 4L99A 2WBKA 2DUOA 1VBC1 4QB2A 3ZXAC 4LE4A 4BK4A 5T50A 5FCCA 5F1RA 2W87A 4LTAA 5IK8A 1GV9A 2JWPA 3RFRA 3ROUA 3DPRA 5DMYA 1CPMA 4NMIA 3RJRA 1F8VA 3ZFEB 4AVCA 5HV4A 2GSYA 1U5ZA 4TXWA 4XJUA 4YGDA 2OZ6A 2Y6JA 3VDBA 1W9SA 2OQ6A 3I54A 1XYPA 3IB3A 4K7JA 1AJKA 4LA2A 1H2KA 1MS9A 2HBTA 4FO9A 3MUY1 4BHPA 1BHGA 1UOJA 2JG9B 1CZVA 2ZEYA 3AKPA 3RZZA 3E5XA 3M70A 2R49A 3VBUA 1KJRA 5HCFA 2PLV1 1JYTA 1VLNA 2PHXA 3O1MA 1N1VA 3HIFA 3VBOB 3I2JA 1CAVB 1NOVA 1XJAA 3ZN5A 4Z82A 3SC7X 1NCRB 2DDUA 5T5JA 3MPBA 1ZZ6A 1F35A 2JENA 2O14A 3AZYA 5DDJ3 4N90A 4LUMA 1UZ0A 1BBT1 2VZVA 5L9BA 2WZR3 1GNZA 3OB8A 1RJ8A 1S1AA 4IESA 4OHZA 1OFNA 4HKLA 4UW4A 3RZGA 5FLJA 5C4WC 1O6UA 2LROA 1RUOA 1JXNA 1RIRA 1VBB3 3GHNA 4COUA 4PI2A 3UESA 1EP0A 3PUIA 1WLCA 3AYAA 4Q4X3 3WNLA 1UPIA 3WG1A 4CDUA 3GYDA 4MYEA 4RA0A 2WO3A 3HT2A 4JGZA 4JGZB 4IETA 3O14A 4E2SA 1O5LA 1FOD3 1HRI3 1F31A 2DCZA 2I45A 2IZWA 2WNEA 2WWJA 3E6BA 3W58A 3ZDSA 4BQYA 3WVJA 3RS6A 4YLZA 2V72A 1LJ7A 2RDRA 2VMDA 4NWWA 3ZFFB 1AXZA 5ACA3 3K3OA 2BNMA 4DRRA 3J7MA 4C8DA 4M3CF 3MYXA 3VBHA 3O1TA 1C3HA 2J1AA 2GC1A 2VD7A 1PIV2 4QQHA 3ABZA 1JZ8A 3WP3A 3V56A 4A3XA 1DQ1A 4ASMB 1W6MB 2DU1A 3ZFGC 5IVVA 1CJPA 3IT8A 5FZHA 3RZHA 2WZR2 5DZGA 1B35B 3MLLA 2FCTA 5FZMA 1AR83 3OBAA 4XUNA 1ENRA 2WUHA 1S55A 4LHSA 4ZZ8A 1XU1A 3N4MA 3B5LB 2OX0A 3IMNA 4AFDA 3OSDA 4KU8A 4YFZA 4AVSA 1VBA3 3VV1A 5FPLA 1MS8A 1FT9A 1OQDA 4DUVA 4AG4A 4CEWA 1LU1A 2RS11 2RJ2A 1J3QA 1VMFA 2JG8C 5L73A 4OLLA 1BBT3 2OXBA 3ALQA 4YW7A 3MW2A 5FK8A 4QHZA 3WCSA 2C9AA 4JQTA 3FBMA 3RJ2X 5FYTA 2Z42A 2X05A 3ZSKA 2Y64A 3B9CA 2BP6A 4QX3A 2R1DA 2UY9A 5A6QA 1BVP1 1APNA 1BKZA 1VBB1 3HR9A 2E6VA 4XTPA 2D6NA 4YM3A 3WHUA 1H6YA 1OLMA 5KBFA 3IPVA 4YG6A 4YZ1A 4AHYA 5FV3A 5FZ4A 2VZOA 2JG9C 3PMEA 4HVOA 1C8NA 5JPNB 1CX4A 4Q4Y2 1RUJ1 2FCVA 3R4SA 5LY2A 3IDCB 3PIJA 2YMZA 5A3NA 4DZGA 5JMCA 3VBOC 4ATFA 3T09A 1DFQA 4ES8A 2IFWA 4QQ2A 2XG3A 4H14A 1S0CA 2YBSA 4MXWA 4QM9A 4RGGA 3WDUA 2RM21 2MEV3 4DQAA 4K40A 2WYFA 2QVSB 5AC91 2AR6A 2QQNA 2ZPXA 3NNLA 5I0DA 5A32B 3FHAA 3P3PA 2CGPA 4E2GA 2FCUA 1N3PA 1W8FA 4GZ9A 2YGLA 4Q0VA 4Y20B 5CFDB 2WFF1 4S2FA 5LBEA 3HNBM 3WY6A 1UAIA 1ZA4A 5FZ1A 1ND2A 3A0NA 1CESA 2CTVA 2VTXA 1STMA 1SFYA 2RS51 1VMHA 3OEBA 4AEJA 1L7LA 1E5RA 3DKQA 2A7AA 4AI2A 5J09A 2F4LA 1K5MB 1U0AA 2W39A 4HLTA 4N53B 1V0AA 2Y34A 1R081 2BJSA 2VNGA 4ZU5A 2E51A 4UW6A 1CD3G 5FZLA 4K20A 1AZDA 1Y3TA 2O8OA 3ZFGA 4CCOA 2YPDA 3CBNA 4XJ8A 4Z2AA 3IDEA 2X5IB 3DUIA 3KQRA 2BFUL 4GWMA 2MHFA 4R8HA 4Y22B 5F5QA 4AYUA 3PUQA 1S0GA 4FTSA 4ATEA 2XVLA 4KWJA 1W8NA 3AZZA 1RUH1 1GZ9A 3FUOA 2Q1FA 4URTA 3MUZ1 2UY8A 1NCQC 3M7AA 1F4AA 3OUJA 2C5DA 2A71A 3VBFB 3ZXGA 1MEC3 4LLOA 5LBCA 2JG8B 3HN3A 2QQKA 1NE4A 1YI9A 2YBKA 1RUD1 4KGGA 1D0GA 2BNNA 2D5HA 2WINB 1R083 3E6CC 3HBKA 1OKQA 2XONA 2RDSA 4MADA 3KCCA 4XQDA 5EPAA 3IZOA 1FV2A 2WDBA 4OUEA 2W47A 4KMQA 4B4PA 4BWOA 2B8MA 3NV2A 1IOAA 2ZX2A 3SNMA 3ME2A 4FP3A 1C5IA 3WW2A 4CP0A 1QJX2 3VDDA 1MZEA 1WCSA 4EN0A 2PHTA 5I8SA 3W20A 2XJUA 1MQTB 1S0JA 3KM5A 1WGPA 3ZYJB 4META 3OG2A 2VBDA 3IWZA 3R05A 3D0SA 5K0UC 4L92A 1HB1A 1UL9A 5J98B 1A34A 2ZEZA 1JYVA 2VAUA 1HV0A 4W6XA 2WWSA 2Y6KA 3AKSA 3GF6A 4UF0A 5FDBA 1N1TA 3UKVA 4Y3OA 2HBUA 2AC1A 1HN0A 1S2KA 2R042 2R072 3BYWA 3KVBA 4BA6A 2ILMA 2WN3A 3HBZA 3T1LA 4M4RA 1V6OA 3BTAA 1WKYA 2N7GA 2WSUA 3MICA 2JECA 4LKSA 4YVWC 1V6MA 1LAJA 2FD8A 3RSJA 1UO9A 2QE3A 2VOXA 3N3HA 3OUIA 4K3UA 4GMP1 1P8JA 4MOAA 4CVUA 2WLPA 4I3GA 2XBO2 3ILNA 2GZWA 5FREA 2RM22 5H9SA 2W91A 3C2UA 1B09A 1AX2A 4QPGA 4MZUA 4AI9A 3O1RA 5JPMB 5D1IA 1J3PA 1V9U2 2WN2A 1SFPA 3OOXA 1XNAA 4Q0PA 5I0TA 3A21A 4I09A 3AP6A 4ORFA 1H4GA 1JZ4A 1RHI1 1YC61 4XFGA 4XCAA 5FZCA 4NIAA 4V2VA 5LEKA 1S0FA 1ZBE1 3GBGA 4YZ2A 1TQ5A 3GZEA 2PFWA 2ZGUA 3MLJA 2XJPA 1ZRDA 1JOJA 4XPVA 3VDAA 3FLTA 4JKLA 3WF0A 3AMHA 1FXZA 2YYOA 1WLDA 2VNRA 3K3NA 1W0NA 4A41A 4CUGA 1AHSA 1EYBA 2E33A 3G7DA 1IS5A 3OGJA 4MVTA 1W3VA 4A7YA 1RXGA 5CG8A 3PIGA 4DXZA 3I2OA 5JOXA 1PNGA 4XYXA 4PDWB 5HCHA 4QD2A 4CUBA 2BPA2 1AYN3 3T0AA 3I59A 3OPTA 3I97A 1D4M1 4YYOA 1GLHA 3WG2A 4DEQA 2HWD2 1PO11 3H9AA 2JDPA 1TVGA 3FMGA 1VJ2A 4MGTA 4LBOA 1F5JA 5A3WA 2QTWB 1VRH1 1EAH3 3M1HA 2OYZA 2ZX3A 3CL1A 3FN9A 5E8AA 4YPJA 3GALA 1VIWB 5ACA2 4P9LA 4PT6A 3WOGA 4IGPA 5DDJ2 2FDJA 3HN1A 1DCSA 1KQRA 1AR62 1QOTA 1CAXB 4IDZA 1CAXA 1ZNPA 2ZABA 5K7PA 5CZKA 4BLIA 2VCAA 1SPPA 4JHZA 2ARAA 4CCDA 4CZSA 1HB4A 4PCRA 3ZXJA 5FUNA 1IG3A 1JZ3A 1ULOA 1Y7BA 2J22A 1OQEA 3KV6A 3WV6A 4LO8A 4AFCA 3PU8A 3UGFA 4YGCA 3UYJA 1B35C 5FP9A 4Q27A 4YVSA 3KCXA 4FCAA 2ZGQA 2JDZA 1U12A 2ZS6B 2R0FA 1DZRA 1O4YA 4QGNA 4FOWA 3TN92 4GH4C 5C33A 1OSGA 3NV1A 3W5NA 5JZGB 2R062 3LSEA 3PHMA 2W08A 4G9SB 1WBFA 4GB31 5DAVA 2VOTA 3M3OA 1FMD3 4MV2A 4LORA 4I0WB 1O59A 1VE0A 5K0UA 2IFRA 3LE0A 1ULDA 2NQYA 5EV7A 5FZ3A 2WQZC 5KHJA 3RYRA 2VBPA 3SCFA 3NQHA 1VBB2 1W6OA 2BRTA 5HXVA 3S7EA 4BQ4A 5A7PA 4CCCA 4YG3A 2EALA 4NHYA 4Q8LA 2HYKA 4HKWA 5DUVA 5EP9A 3VBUB 3NW4A 1FAYA 3WF1A 2A3WA 4CSWA 1QKQA 4ZZ5A 1UQXA 4QXBA 2QQWA 5FZOB 2C9KA 1Z78A 4U2AA 1DGWX 1AR82 1LHOA 2D3SA 3BN6A 2I74A 4CEYA 5LRSA 1DP0A 3ZN6A 2VZ1A 3NJXA 2WAAA 5FY4A 4EQVA 2XUMA 1FPN1 1DG6A 5EWSA 4BQ5A 2XJSA 4DB5A 5C70A 4MXWB 3TWIA 1OLRA 3WNXA 4N8MA 1PGW2 1Q8VA 2XWJB 4Q8KA 4UOJA 2V4AA 3FFQA 3WDWA 1ENSA 4YW4A 1HQWA 3RRDA 3O12A 5IVBA 3VL9A 1C4RA 5LK5A 3FBYA 4HK8A 4AZZA 3T0DA 2CYFA 1CAUA 3BIEA 5JAXA 2YUEA 4Q4X2 5DABA 1UNBA 1OOPA 1UU4A 1R1A3 2X53S 3DYMA 5FJHA 1E5HA 3KHBA 5ABJC 1CZTA 1W6MA 3POFA 5FP7A 5FY7A 3SCHA 3PJYA 4D0QA 3S0MA 1N3QA 3AB0A 5I0SA 2BZDA 4FOYA 1D4VB 4QPWA 2KXLA 5A6XA 1DQ2A 1W06A 5IJRA 2CNAA 3D0JA 1ZM1A 1BEV1 3T3YA 3NAPC 1W6QB 4OVEA 4AFMA 1VBA2 4D6SA 4I0AA 4AQSA 5H9RA 3N9PA 1MS1A 2JG8A 3IDAA 3VBRC 4BXSV 2EAAA 4RHV1 5FO8B 1WW4A 4B3NA 2RS33 2W9XA 2LW8A 1H1IA 4LLFA 2ORZA 1SACA 3EJKA 2E32A 4LK6A 1RUC2 2F6BA 5EJ3A 5I93A 1XE8A 2D98A 3OYWB 1BMV2 1HRV3 1XXNA 1KJLA 1DIWA 1MZ5A 1JMUB 4TWTA 1TG7A 1W6PB 3LKJA 4RL7A 1PGL2 3O1OA 2BGPA 4K1YA 2VVFA 3O0WA 1BXHA 1WW7A 3S5AA 5A3TA 2RR13 2Y8KA 1MZFA 4JKKA 2WNVA 1REFA 1LGCA 4UBHA 3LDBA 3T30A 2QQUA 4CCNA 4Z2WA 1C8M1 4DFSA 5L36A 5LY1A 1ZBA3 3WP5A 3FHQA 1WD3A 4OZOA 1UZYA 1LHNA 4DINB 4QX5A 5KXCA 4NIHA 1MS5A 1SEFA 2ET7A 1WCQA 3C7FA 5KHKA 4Y24A 4PLMA 3WEZA 4GQ7A 5HBAA 4CCEA 1G8WA 4F83A 5BYNA 1W9WA 1UYZA 3NJVA 2YROA 1OLME 2VG9A 3ELNA 3OGVA 2WZEA 3PVNA 4C90A 1YFUA 1UW8A 3LEKA 4RHV2 1LOCA 4P5YA 2D93A 1CZSA 2YFUA 3MHZA 1R091 1XBFA 4JKMA 4BLJA 3AP9A 1VB2A 1LCLA 2D3PA 1GKBA 3WG3A 2LS6A 4S2GA 1SMVA 2AZ5A 3DPRB 3GHMA 4UFMA 3RI9A 3TRSB 2HWB3 2P6CA 4CCJA 4U36A 2E7AA 3MBWA 4P02B 3AKTA 4Y1YA 5GZEA 4CP9A 1PGSA 1ND3A 2FBEA 5KR7A 2HLEA 1KXGA 3NV4A 4LUKA 2RS12 4NHXA 1K42A 1K5MA 1UIKA 2AGSA 4OMDA 1FX5A 1GWLA 2RS31 5E89A 5FMOS 2C26A 1ZRFA 1Y9QA 4FPYA 3QCWA 4NVPA 1O5UA 1R1ZA 5FFOC 2EF6A 4W65A 2BUKA 1Z7S2 1TME2 2VW1A 3HD8B 4NN0A 1KDMA 4KH9A 4YW1A 2VULA 3BTZA 2ZGSA 2JEMA 1UOGA 2RM23 5AC93 4LPLA 2J7MA 1BMV1 5A80A 2D3RA 2RR11 4RR3B 2P34A 2QQIA 3BOWA 4MGQA 3FZ3A 4Y33A 1AR61 3ACLA 1Y43B 5BNNA 1F9KA 3ACHA 3AJYA 1ZRIA 5C4WA 4QKDA 5A33A 1C8M3 3MW3A 2VMFA 2VECA 3JCIA 4CDWB 3AZWA 3MEPA 1QXJA 2VL4A 3ES1A 5A3OA 1WMDA 2PHLA 4EN7B 3D5OA 3TNPB 2GDFA 5LA0A 5JI9A 4OULA 1VPHA 1XE0A 4HFSA 4X6QB 4XDOA 4QX2A 4UBGA 1O3QA 2WQ8A 3KT4A 4Z1VA 4A6OA 4BQ1A 1PHMA 2ZGRA 1SZBA 4JDNA 5FXZA 5FXVA 4H3WA 4AAPA 1QDOA 3JD72 4LE3A 4LXLA 1JUIA 5DAQA 3IIAA 4RS5A 2FHRA 1QQP2 1FNYA 5GLWA 4CP2A 4DPNA 2NP0A 3N7JA 4NAOA 5GZCA 2XQXA 2W95A 4MGYE 4Q1RA 1LNSA 2ZMKA 4LMFA 2X8KA 5I8TA 3OBTA 3E97A 2YC4A 1ULEA 5FY0A 4E27A 3C8XA 5E16A 1RUF3 1W2TA 3NVCA 4WM7C 3M3IA 2PHUA 2P17A 2WNUC 2BBVA 1NG0A 3HT1A 1Q8QA 3O5SA 5E6HA 4NPLA 4WZFA 1POQA 3ZVXA 3M2MA 3SEPA 1H8TC 4AWDA 1JYNA 3AMNA 1EUUA 1L7RA 2XUEA 1UOBA 2WKKA 2IXHA 4XUOA 2W1QA 3HPNA 4KGQA 3B94A 2VTXJ 2HWC2 2BERA 1R092 2RMU3 4XURA 1L3JA 1XNBA 4W4ZA 4COYA 5H9QA 4XF3A 5KHGA 2UWAA 3Q8EA 3L9JT 4KWLA 4OYUA 3T2OA 1CN1A 3PU3A 4LO6B 3TAYA 3U11A 1DGRN 2KD7A 2UWBA 2Z2SB 4PJYA 1J59A 3HJRA 3SITA 3OGGA 5LASA 3SH5A 4GKYA 2B45X 3ZN6B 4J6GA 1NE6A 2YC0A 3A22A 1W8ZA 3Q8FA 3GBWA 3AVSA 4JCKA 2DUQA 2V5YA 4HOOA 3USUB 1DQ0A 2FDKA 1ODNA 2EXJA 1WCDJ 2W2IA 1LULA 2DVDA 1J58A 2OA2A 2GU9A 3LF7A 1COV3 4A6SA 3HNYM 4KWKA 2G19A 3VDDB 2DVFA 2VUJA 1NUKA 3B3QE 4GJYA 2VU9A 5FYUA 1QJY2 2G9ZA 1XU2A 3VDCA 2OW4A 3IAQA 4RR3C 1C57A 1PX3A 1ULGA 5FP3A 3WUCA 2IC1A 1X7NA 2PXJA 5FZAA 4M3CB 4A3ZA 1UU6A 3CU7A 3I4IA 2JDHA 4HVQA 2Q30A 4IXLA 4HONA 4L9BA 4BE3A 1MQTC 1S2EA 2GNBA 2DVAA 3AZXA 2V09A 3B02A 3QH7A 3WP4A 5F32A 2JG9A 5JIAA 4AFAA 3EMRA 2VVEA 4A44A 2DF7A 2D7FA 5J3UA 3PJQA 1YUDA 1OA2A 4IV1A 4Q4V2 4IV1B 4Y5Z0 1VP6A 2F17A 3VBOA 1QJY3 4LR4A 3DECA 5FMBA 3PUHA 1HLCA 2VQUA 3ZXFA 3N9LA 5D2AA 3SISA 5DXDA 2VOKA 2RHPA 4BJ0A 1IKPA 1DYOA 4QXCA 5FBJA 4LBQD 1LEDA 2ZOEB 1D4M3 3WW1A 3I49A 1RUD3 3U07A 4GULA 3AMQA 2Q8EA 3IAPA 5IVJA 1WA4A 1MS4A 4GALA 4DXRA 5A6YA 1ND2C 2YXSA 4FBFA 5C71A 4WM7B 4LO7A 1KEXA 4ZS3A 3DYPA 4NRQA 2FDGA 2VVDA 1AXYA 2WNUA 4XZUG 5JR7B 3ZYIB 3DN7A 3MFCA 1W8WA 3ACFA 4HXCA 1NKGA 5FZIA 3JQWA 1H8TA 1HDKA 1OHFA 3HQXA 1XYNA 2XJQA 5GLVA 3FX3A 3H7JA 4NIDA 2B46X 2QDNA 4RFRB 3QH6A 1VRH2 1VAVA 1JZ2A 1RMU1 5I0RA 1CIWA 1C5HA 4RFT0 5ERLA 3ZXKA 3M3CA 4A7ZA 4C91A 1ASJ2 5BNQA 1J83A 1YNAA 2R0HA 2ZGLA 4GA9A 4SLIA 2NLRA 3CEWA 4NWVA 5HXMA 4XAEA 3Q9OA 1QJU2 1UPSA 4R9DA 2QNKA 4XJWA 3H0OA 1JYCA 4PDWC 1S2BA 4GWJA 3O7OA 4XF4A 2FZ1A 3L2HA 5FQ0A 1NZCA 2Q5TA 3A23A 1I9RA 3ASIA 4TZDA 2Z4FA 2Y0OA 2ERFA 2J1TA 3CJIA 2VZRA 1GOFA 1OOPB 3WHTA 4M01A 1G9FA 1YYNA 1QJY1 4QQOA 5EJ1B 3VUOA 2J42A 4DUWA 1H1AA 2ZEWA 5FIXA 3DL3A 4ISRA 1A8DA 1FNZA 1RUH2 1AR72 2AH2A 1JOBA 2WWUA 3W21A 4W6WA 4X6RB 2G4IA 2W46A 3VDDC 3O1UA 1ZBE3 2QZ3A 2IWGB 3JD73 2P3KA 1FOD1 1HRI1 3WQ7A 1LOAA 4YWAA 2VMCA 4DXTA 5FPUA 3U78A 3HVDA 1EAH2 4BIOA 1TZOA 2GN3A 2CY6A 2Z69A 3KGZA 4N7IA 3VZJA 2QDRA 4X8PA 1JYXA 1A8MA 2W1WA 3WX5A 1IQAA 3EQEA 4FTBA 4NRMA 4XXPA 1YFWA 1LOGA 1XB9A 1Q8PA 1QJX1 4IERA 4FPJA 3PMSA 4IGQA 1MR5A 4MHRA 4GWNA 4IQPA 4QU2A 1NLSA 3AL5A 1MEC1 1Z7S3 5C4WB 1RUE1 4IV1C 4UW5A 4UYBA 4YW6A 5A1AA 2D6LX 2CWMA 4CDWC 4FVVA 1G9CA 3W59A 5LBBA 3UNPA 1Z0HA 4AVBA 2XWBB 4FFIA 3BPZA 4CDUB 2RS13 5FZGA 2JDAA 3THCA 1R1A1 4XUQA 4JGZC 2GH2A 1IGOA 3N35A 2P3IA 5DZEA 1XSRA 3FL7A 3U75A 1HQLA 4D7YA 1ASJ1 1N47A 3WW4A 2W0XA 1ND2B 2QCSB 3KV4A 3WZ1A 5JXIA 2HJIA 2EICA 4CEYB 2LRPA 1V9U3 3RGBA 3JB8A 3CZUA 2JDNA 3MZHA 2YBPA 3WDXA 4ASKA 4XDQA 1RUE3 1BEV3 3Q8CA 3H8RA 4E2QA 2CL2A 2C0ZA 3FLRA 2XBO3 1QH7A 3AFGA 3THPA 2XOMA 2WT1A 2YFZA 1RUJ3 4FPHA 3VD3A 2XB6C 3CJIC 3WD5A 5FTTC 5C3OA 5KXBA 3K4DA 5FZ7A 3U37A 3O1VA 4C1XA 4AK3A 4KBZA 2DUPA 3BTYA 4AI1A 2JDYA 3AX4A 4JDOA 4EWEA 1JU4A 2MEV1 1IQDC 4GWIA 1V9U1 2HWC3 3T4VA 5F6KA 2VZTA 3M4FA 4LK7A 3V0AA 2G9GA 3EYPA 3ZSJA 1PX4A 2TNFA 2XHNA 4L0PA 3ETPA 3K2OA 4CXYA 5FY8A 4XXAA 5D21A 4W50A 1GQGA 4P9GA 3J9SA 4LKEA 2Y6FA 1W39A 4PIZA 5SV8A 3SMHA 4KNCA 4AGRA 4QKFA 2WABA 4OI0A 1NXMA 5FMOL 3VHRA 3ZIXA 3ZKYA 2CDOA 5FZ9A 3URFA 4IGOA 4CUAA 3LEGA 3RMXA 1ONAA 4YM0A 3GGLA 1HRV2 1WBLA 3VKMA 3M3QA 3USSA 2JD9A 3Q8BA 2QFEA 5JXHA 1GOHA 2HWC1 2E26A 3MF9A 5T54A 3UK9A 4P08A 3WXPA 2ADEA 5A7QA 1AR91 2ZZJA 1MS3A 2Q8DA 5A1LA 5C5UA 5LB6A 3NNFA 1GZWA 1SG3A 2BQPA 2BTVC 5JZGC 1IZ3A 2R16A 4CTEA 3ZXDA 1ZZBA 3MPPG 3BI3A 1DGWA 1KD7A 1WUVA 4COVA 1ENXA 2JKBA 4LOSA 5FYMA 3RPQA 2XJRA 1J1TA 1AYN2 2BOIA 1HB3A 1TMF2 1U5IA 2ZZQA 4XUTA 4XF1A 1R1A2 4HBNA 1H30A 1RUI2 2GMEA 1C28A 4SBVA 5D8AB 4PQQA 4YNIA 2VQTA 1CJDA 3ZX7A 3I3EA 1WMFA 2GNDA 4E8CA 5C3QA 4A7KA 2Y6HA 5T5PA 3I3DA 1KFXL 1SCSA 4NO4A 2OQ7A 4Q4Y3 3LAGA 4MLOA 2PA7A 4XC9A 3T2TA 1GWMA 4B1LA 1EUTA 2Y6LA 4XFCA 4XF9A 3N36A 2X5IC 3E5QA 4K8FA 3BU0A 3AMMA 4D6RA 3DF0A 2YGMA 2XHKA 3KHCA 5FKCA 1W8TA 4MX3A 1TNFA 3ZSEA 2LTNA 3K77A 1ALYA 1V6KA 2BEOA 1WMXA 3CKHA 2IXCA 3AL6A 2PAEA 5EFUA 2JDUA 5E1RA 4M00A 2GMPA 3D8CA 5A3MA 4QGMA 2WA3A 4OHYA 5J48A 3ZFFC 1NCQA 4WM8C 1GBGA 1NQJA 2JB8A 2TBVA 2WZ8A 1YLLA 3OPWA 4QDQA 5F5IA 4CDXB 4D69A 3TB0A 3I2HA 4QAWA 2GALA 1QDCA 3DXTA 2W68A 3J7NA 4BM8A 1I1EA 1IHMA 3ZYFA 3H1YA 5HCBA 1W03A 2RDQA 2VXRA 4N43B 3T2QA 1PMIA 1D2QA 5EJZB 1WW5A 1GQHA 4QDRA 3OBZA 5A6ZA 1ULCA 4AF9A 3NJZA 2O0OA 2XL7A 3OUHA 1O8PA 1QQP1 2KM2A 2KR2A 5IK5A 1XNCA 1W0OA 3LD8A 4Q2FA 2W94A 4PBPA 3MV11 2NN8A 3NKTA 2Q8OA 5EIYB 1MVQA 4IW3A 4YG0A 1PIV3 2XLAA 3ON7A 1PM7A 5LW9A 3N7MA 1O3TA 2XLGA 4XHXA 4JZRA 2Q1ZB 3BVCA 3IKWA 4GKXA 1HJGA 2XKPA 5LRRA 1QY4A 1W05A 2LUWA 2HYXA 2PHDA 1SLTA 5T55A 4OI4A 5GM0A 3SLIA 3CJXA 1SCRA 5AFEA 1UN1A 3OJBA 1H1MA 2HKXA 4OQ9A 2WS91 4FP2A 4XEZA 5FYIA 3GCWA 4Y4RA 1D2SA 4QPGC 3VHNA 2BVVA 3SXWA 2DURA 3AJZA 3THTA 1CPNA 4FPLA 5F3EA 3L2YA 4E4HA 5L7OC 1POV1 4JV4A 1NA1B 4H7MA 3RZKA 1NA1A 3VD9A 4IEYA 5FY9A 4E4SA 2P5BA 1YI7A 2QJVA 5FAXA 1QGLA 4QU1A 4ZHNA 3ZYHA 3NNMA 5C9AA 4MGSA 4OHXA 5J7MA 4M4PA 3RZJA 2VQAA 2VGDA 1RVF3 3AM2A 4P9YA 1NQDA 3H3ZA 4N9IA 1HQNA 1JZ6A 4N9HA 2K46A 2XGXA 1UF2C 2WS93 5CNAA 3H1WA 1RUJ2 3P1IA 4KG0A 3RWKX 4FQZA 4YFWA 2LM3A 1UKRA 3WDVA 1E57A 1OBNA 2HWF3 5AVAA 2C24A 3CNAA 5FRAA 5FZFA 2GN7A 3CDZB 5BUVA 5C7GA 5JSRA 2WNUB 1WA6X 1WD4A 2ZAAA 2J1SA 3FUQA 5FYSA 1VBC3 3PVEA 4C1WA 5CIRA 3TEWA 3I2FA 1FMD1 3RNSA 1L7QA 4PLNA 3NMBA 1JTZX 1RVF1 5BNOA 1H0BA 1DZTA 1LESA 1QJZA 2C4XA 1UIJA 2ORXA 2YPJA 4IV3C 4AEDA 4AXOA 2OUJA 4XMIA 5GZFA 5LA2A 1VMJA 4NUBA 2CU5A 2HWF1 1YFYA 2XMLA 2Z5WA 1SHWB 4GIQA 1BVVA 4OUSA 1I5PA 2TUNA 2HWE3 3R0RA 2VZ3A 5B2GB 5C3SA 1LU2A 1I5ZA 5IFTA 1MPXA 3KQ4B 4K6BA 4OFGA 3BIWE 3D4KA 3ZYPA 4EE2A 1UD1A 2VZSA 1ZBA1 3OD4A 2FQPA 3MDPA 2EVXA 4YM2A 4MGKE 3AP5A 1GZCA 2X10A 1JZ5A 4NIIA 3TYJA 3DYOA 4F3JA 1O91A 2IXKA 1CGPA 4EWDA 2R073 3GZAA 3LWCA 4AI8A 1VB4A 1RYYA 1PVC2 2QQLA 4J1XA 5FO9B 1ZX5A 1DYPA 2WS92 4FAHA 5DDJ1 3A0KA 2JE8A 5KWRA 3AXEA 1HXS3 3I2IA 3I3QA 2J1UA 1C1FA 1LR5A 1PVC3 2HEWF 1H9WA 1I3HA 5K0UB 2DCYA 1NA1C 4LHNA 3VBSA 5AC92 1RUI3 1T6GC 2W5FA 3B93A 3VB9A 1NXD1 2UYBA 4OZXA 4XACA 3ZFEC 2ZGOA 1O4TA 3ZO0B 1SLCA 5GLUA 1CR7A 3LA7A 2HWB1 1LGNA 2JB4A 3JXSA 4V1PA 2OS2A 3HMYA 1AR81 2ENRA 3C7OA 3OBRA 2FZ2A 5JIUA 1SLAA 5EQUA 4IE5A 1V6LA 1KDKA 2PQQA 1GSLA 1XQNA 4PF5A 1ENQA 1PMJX 3U4XA 1DQ5A 4LA3A 1ZA7A 1J3RA 1X8MA 2X09A 1YXWA 3RYKA 1YIFA 4YW5A 3KF5A 4BYYA 5A1FA 1PM4A 1RUI1 5LWBA 1GZWB 4LHKA 5CISA 2JICA 3OPZA 1EV11 4R4XA 2VMGA 3BOPA 4WM7A 4B4QA 1AR63 3KVAA 1ZVFA 3UKNA 2ADDA 4Y20A 4OQ8A 3HOBA 1F15A 2Y26A 1UY4A 2DWRA 3I2GA 4I0BA 4ISQA 4LIUA 1ODMA 2IUWA 4AHWA 3WF4A 1DU3D 3J26N 4LJHA 4YGBA 1JW6A 1XNKA 1YJKA 1G9DA 4XFFA 1VBE3 4COWA 4J1WA 3MF6A 2GC0A 3GZTB 1JOPA 2VCCA 4HZFA 1HRV1 3P6BA 2WZR1 4LITA 1RUG2 4NHKA 1GP5A 4QPYA 3T4HB 2GMMA 4UWDA 4ZPIA 4ZY9A 2NZ9A 3ZFGB 4AEKA 1UZVA 3GZUC 2VE1A 1EV13 1PVC1 1SPPB 2BFUS 2ES3A 1SLBA 3VBHB 2ZCWA 4FPEA 1OQ1A 4KI5M 4M3CA 4TSVA 3ZMNA 4AFBA 2D43A 5J36A 4XJZA 1JZ7A 2WFF3 2D44A 3MIEA 1PGW1 2WT2A 5L9VA 1DLCA 3B9IA 3I7DA 2VMIA 4H7LA 5F5AA 1FYUA 2A3YA 5FYCA 4FFGA 2RS53 5T52A 4JGYC 2JE9A 1K3IA 1XRUA 2BU9A 2GNMA 5F2SA 2QQPA 5FO7B 1AVBA 5FKBA 1IPKA 3I8TA 2B42B 3H8OA 1OF4A 5FBZA 2AACA 1XSQA 3MGUA 4YW2A 5K4LA 2ZXQA 3AMPA 4ZU7A 2B9VA 4NE9A 3BCWA 2P4EA 1Q8OA 2VBBA 3H42B 5IK4A 2BYVE 3LOIA 3ORJA 4QX7A 4XBNA 5FPXA 4XVHA 3WF2A 4I2OA 5F5CA 1ZRCA 4RGKA 3LPFA 3P5BA 5JMOA 3MIBA 1F2NA 1GICA 4UXAA 5F2WA 1A6CA 1GQPA 2GC2A 2NM1A 5GZGA 4ZONA 4C0HA 2ZAHA 4YW3A 4Z07A 1RMU3 4YZ5A 1JS9A 1VBA1 2YU2A 3N7KA 1CIYA 1XYOA 3PUSA 3CLPA 2E63A 2A6VA 3ACIA 5FZBA 1VBE1 2DFCA 3QD6A 5EZWA 5A7SA 5GLZA 2XPJA 1REEA 4NIGA 3VBSC 1OA4A 1GFF2 2A6XA 5ACA1 4IEVA 4XF0A 3GJBA 2W3JA 5FYHA 2GNTA 3ZMOA 1YHFA 3MO4A 2QQJA 4XIOA 2B39A 3FE5A 3POJA 1W9FA 5BV6A 3VBUC 3H3UA 4Q4W3 4QXHA 3LOBA 4PLOA 3WQBA 1COV1 1V6IA 3WW3A 1RUH3 4AI3A 1PGL1 2Z79A 5FWJA 3TNQA 3D3AA 1TNRA 3LDRA 5DG2A 2K9ZA 3LCPA 1QMJA 2WZPP 1V00A 3WQ1A 1FV3A 3ZLIA 2UYAA 4ZKTB 5F3GA 3AYEA 4HN1A 4D8MA 1VBC2 1W2NA 1K5JA 4TTGA 1W2OA 2CAUA 3H7YA 3GJAA 1W04A 2FDIA 1NY71 2VW2A 3MIDA 3C7EA 3LZZA 4C0BA 4FFHA 4FPOB 3OD0A 3BB6A 1OH3A 4N53C 3SH4A 4MG2A 1CAWA 5FPZA 5EYYA 1I6XA 1UY3A 2HEVF 4KWUA 3ZYGA 5CFCB 4I30A 3IBMA 4URAA 2WQ4A 3J4UH 5A7WB 3EXUA 2VCBA 1JN2P 3CQOA 2ZMNA 4PDWA 1NLQA 4ITCA 4K1ZA 1GNYA 1DGLA 3VBHC 3VZNA 3BUCA 1FMD2 1VBD2 2QBXA 2QQOA 4QKBA 3U14A 5FOBB 3LIGA 2VPVA 3J7LA 1NCQB 4ZU4A 3OY8B 4FQ4A 3K4ZA 4CPBA 1EPWA 2YG0A 5F6LB 3ES4A 4GMP0 4IEQA 4CE8A 5FPAA 3AK0A 1DQ6A 5L9RA 4IV3B 4RQPC 5JLVA 4K9SA 4AEDB 5HCAA 3KMHA 1AL22 4LBQB 4NHLA 1O4ZA 4LBQA 5CKQA 4AI0A 1UMZA 3AKRA 1ZZCA 2R1BA 3J8F2 4UFJA 2YY1A 2DCJA 1RMU2 2XJVA 1O8SA 1HKDA 2R061 4LULA 5C9AC 4Q4W1 2I07B 1JODA 3VGIA 4AR2A 3O1PA 4UFLA 4JGYA 1GU3A 1S0BA 5DUUA 2A6WA 1CQ9A 2Y38A 4P14A 4GAZA 1W6NA 2XBO1 3WDYA 2XVKA 1DBNA 4QPIA 4UFIA 3RYPA 5FQ0B 1VRH3 2WA4A 5A70A 2VY0A 4P9XA 4BMEA 5KC6A 4DY5A 2GC3A 3VKFC 4AQTA 1YQ2A 2C1FA 3WLUA 5G05L 2EIGA 4LT5A 1X36A 2HWD3 5GLTA 4CU9A 3N9MA 4JX0A 5CADA 2ZACA 1DGRA 1F5FA 3VBSB 4GH4A 5HV0A 4CCKA 2FDHA 1NAEA 2F4PA 3K4AA 2GAUA 2JE7A 4YVWB 3O1SA 5FLHA 3U10A 3DCQA 3VHPA 3ST7A 5CBLA 5SV5A 1GZTA 1MVEA 1US3A 4QXKA 1BK0A 2MPFA 4UAPA 4Y1VA 3RG0A 4CP9B 4CDXA 1BEV2 3GDBA 1DYKA 3FC0A 2ZGMA 4MH0E 1EV12 1H2NA 1UZWA 2DCKA 3NNGA 4I02A 5FZ0A 5JDBA 3PURA 4GB33 4E4DX 4JDMA 2JJ6A 4MUVA 3ZOIA 3MFAA 4GMP3 3OCPA 4XHBA 5FZ8A 1UY0A 4IUGA 1X33A 1W99A 1Q3EA 3ETQA 3V64A 4HANA 4P5HA 4R9BA 1HB2A 3ZDVA 1W8HA 2WC2A 4IEOA 3N9NA 5JCTA 2RS52 1FI2A 1MEC2 2H6CA 3G6JB 1PNFA 1Q5OA 3EO6A 3IIIA 3I3BA 4AOCA 4JTOA 2VOVA 2ARBA 2EAKA 1HN1A 4QQPA 3VKOA 1IKQA 4L2NA 4QHBA 4RSUA 4XETA 5DPNA 1YQ5A 1BZWA 2PQSA 1OPOA 2VNVA 3LIHA 4XFBA 4FAGA 1LKNA 4XUPA 1JU3A 2VNOA 3MW4A 1OA3A 2CGNA 4YARA 2E7QA 1ULFA 4AEDC 4WM8B 2I2SA 2J1VA 3GNEA 1AXKA 4BXFA 3LFIA 5BNOC 1V70A 1JHJA 2PELA 3FJSA 3ACGA 3BKZA 4B7KA 1R64A 1NYWA 5A7OA 1Q56A 4QWNA 3SKJE 1G9AA 2DTYA 4IE4A 4A45A 4Q4Y1 5LK7B 4Y1ZA 4IEZA 4Q4V1 2BOJA 2IXLA 4LHLA 3AYDA 3MIHA 4RGAA 5IYYA 4K21A 1PO22 1OURA 2WFF2 1N3OA 4QM8A 5J1XA 2MNGA 3S57A 1X82A 5FOJB 5APAA 5ABJA 1DDLA 3INAA 3T08A 1AR73 1ZZ7A 2TEPA 2VJXA 5C9AB 4YVSB 3H50A 4QX0A 2D40A 1XNDA 5LBFA 5A3LA 3NO8A 4COZA 1LECA 4ASLA 5BNPC 2BGCA 2BWCA 4PHZA 4L8QA 1US2A 1YJLA 3KD4A 4FT8A 3I3MA 1C1LA 1H4HA 3AC0A 3ZPYA 1Y9MA 4QDSA 2J1RA 1BK1A 2PHFA 3QOPA 1K45A 4QGLA 3VZKA 4NR1A 5FJKA 2ZHLA 2ZHKA 2ZHMA 2QKDA 1O7FA 3O0VA 1W0PA 4UW3A 3M8LA 5F39A 4DNYA 2W92A 5IVEA 4FPFA 3WINE 2EA7A 5LATA 4D7SA 2EIDA 4Q26A 2JD4A 4QPIC 1G9BA 2YC2A 4M0NA 3UJOA 5G04L 1LOFA 4AQ6A 1O3RA 1YQCA 4S2HA 3JUUA 1PO13 4DXSA 5CG9A 1QHDA 4IE7A 3T0BA 3S7IA 3AXDA 1G7YA 1H8VA 1WLTA 3JD71 5IUQA 1QJU1 1NCRC 4LBMA 1IS4A 3MI8A 5FP8A 2QQMA 4AW7A 2DBIA 1COV2 2DVBA 2ZEXA 5JSPA 4E9KA 1QJEA 2C6SA 2R071 1K5MC 4BQ2A 5J96B 2DU0A 4TYSA 2PYTA 4O61A 3HQRA 1WZXA 3KF3A 3W9AA 4G3YC 4QB6A 3VHOA 3KV9A 5GKAC 4RN5A 4XJAA 1NZIA 1RUG3 4FOQA 4LO4B 3UJQA 3WNKA 5JUVA 3K46A 4QQLA 3NV3A 1AR71 4Q5OA 2D6MA 4WM8A 2UU8A 4B29A 1POV3 1VBD3 5E88A 4CDQB 2GP3A 3KSCA 3VZMA 3EBRA 4RHV3 4DMIA 3POGA 4MXVA 1YQ8A 1LB2A 1MACA 3GXUA 3K75B 1DF0A 1ASJ3 3RZLA 2O1QA 1B35A 2X5IA 4Y22A 4YVSC 1H9PA 3POIA 2A6YA 3K48A 3O0XA 2YV8A 5BNNC 4DRVA 3VBRB 3POWA 1UY2A 2H6BA 5BNPB 5DZFA 4LKDA 4L11A 4WBBA 4B4RA 1S0EA 5CVRA 2VMHA 4MHUA 5C8CB 2W52A 3H8UA 4YSFA 4CXXA 1NT0A 2ZTNA 3V0BA 1Q43A 1LHVA 3J7HA 5HI0A 2Q8CA 1DQ4A 4EN8B 4YM1A 1UYXA 1QJU3 2O8QA 4LBNA 4CA9A 2VXJA 5BY5A 2IXIA 2LALA 3EHKA 5JXGA 4CPBD 3ZKUA 4YGEA 5T3NA 3ZSLA 4JVAA 5IHRA 4RS5C 1AL23 3VD5A 4MGZE 2W1UA 3R4DB 4Q0UA 2Y33A 1CONA 3LQCA 4KBBA 1G6NA 2D5FA 4CUCA 3GCXA 5KHIA 4XJ9A 3PLQA 2WLQA 3AYCA 4CEYC 4BQWA 2WO7A 4HG6B 2ZX1A 4V2WA 4BOWA 5KC5A 2E7TA 3IPVB 4P9WA 2AEYA 4QPIB 5A3UA 1QU0A 2WAOA 3S5QA 5C3PA 2VQ0A 4WV8A 1LOFC 3MIFA 2WFPA 1OUSA 3S6PA 4D6QA 4JQRA 1AL21 4FPKA 1TE1B 2PN5A 3S30A 4BZ4A 1VALA 4XBQA 5IAVA 4BK5A 4CCLA 4Q0SA 4IE0A 4I3PA 3RMYA 4AAXA 4Q0QA 1RXFA 1RJ7A 3DPRC 1HW5A 1MS0A 3JBG2 2A6ZA 5CFDA 5F8PA 2OIIA 1KFUL 5FYVA 1UX6A 3AZVA 5FYZA 2BV4A 4EWAA 1ZZ9A 1UKGA 2PAKA 5IVCA 2GP5A 4XOGA 2QQVA 4QT6A 2XLFA 1BQPA 2RS32 2AEZA 2ZX4A 3T1MA 5FP4A 3HAGA 1OVSA 3ZFEA 2G9FA 4GD4A 3RQ0A 4Q29A 1ND3B 4GB32 3HWJA 4YZ4A 2EXKA 4N53A 3V0AB 5CFCA 5K8SA 4XFAA 2VTFA 3LB9A 4X8NA 2ARCA 3N9QA 1WW6A 2Y6GA 2Q0AA 1QJFA 3VBRA 5IFPA 4JTNA 1Y4WA 5DAXA 4XQ4A 3VN4A 2Q4SA 1OXCA 2L9LA 4OUMA 3SHRA 2YB7A 4EZ4A 2RV9A 4AVTA 4J25A 4RR3A 5FYBA 1EY2A 2OT7A 1RUNA 2OVUA 1PZ7A 3WF3A 1WMEA 3A7QA 3HNMA 4PIXA 1ZBA2 5IAXA 1KITA 2VH9A 3NAPA 3OY8A 1V6JA 3LEMA 3SEEA 1OD5A 4B1MA 1H2MA 2WRAA 4BB3A 2D6KA 4IV3A 4D7TA 2YZ4A 3LEIA 4LEJA 3CIHA 4DIQA 3LGRA 4ZXEA 5T5OA 1RUF2 5B4NA 3KT1A 5FPVA 1Q8SA 1OC1A 3PVBB 1QF3A 5JOWA 2SLIA 5DAWA 2JDMA 5FYYA 2VC9A 5BXXA 3NNJA 3JU9A 5DAPA 4ZXKA 2JIGA 3ZXEA 2CSGA 4CU8A 2JX9A 2HWE1 4UF0B 2B9UA 4EN6B 1QQP3 1OT5A 1W6NB 4E4ZA 2WO2A 1OLQA 3BGAA 3ECQA 3JBG3 5FXWA 1LOBA 5CEHA 3Q8AA 2XJTA 4NHMA 2CGOA 3WQ0A 3TEZA 4XTMA 3OTFA 1CX1A 5CB7A 1SBDA 2CDPA 1ST8A 1YRZA 1UXXX 3UT0A 3UGHA 2WNOA 1KS5A 2NMNA 4HK9A 2P3YA 3AVRA 2QUOA 4LBJA 2VZPA 5CU1A 2XKOA 5A7WA 2ZHNA 3VKNA 4AQ2A 3SCGA 4BPZA 1HXS1 1BJQA 4Y1XA 1POV0 1LEMA 4CDXC 2DVGA 4XMAA 1QNWA 1SFNA 2Y0IA 2OUHA 1UY1A 5DQ0A 4B8EA 1LHWA 2XR4A 3FFZA 4BQ3A 3GBFA 2R063 1RUE2 3KCYA 3H1MA 3TN93 1RINA 2BWAA 4HPKB 2PLV3 5JI7A 4EN9B 5F37A 4Z92B 3DGTA 4RYDA 1QNYA 3NKGA 2R7EB 1PK6A 3VL8A 1ND3C 1UCXA 3CO2A 4QB1A 1S0IA 1BCXA 5FY5A 1C8M2 2EXHA 2V73A 3ZIWA 3KGLA 4JGYB 4ES9A 5CFCC 1QXPA 2A5ZA 1T6BX 2RE9A 4Q4W2 2K0GA 4BIFA 4OHVA 2OKXA 3DEMA 3PTRB 4JAAA 2OPKA 2V5DA 3ZR6A 3USUA 4CEWC 1YFXA 1PO12 1EPZA 5FMDA 2DBNA 3I59B 5IVFA 2DV9A 1UYYA 3OF1A 4BMBA 3IM0A 5FZKA 5I91A 3TEXA 2YU1A 2ZGKA 3NAPB 4LIVA 3OGSA 1WCUA 2CV6A 5FPBA 3V65A 4CU6A 2ET1A 1TMF3 3WUDA 1JH5A 2ZBJA 4AGGA 1W8UA 1LODA 1WWYA 3CHXA 3LSDA 4WVMA 3WT3A 1VR3A 3KWVA 2HWE2 4HL0A 4NPMA 4WVMB 1NLRA 4Y26A 5DN2A 2AREA 2E9QA 4YRDA 2D6OX 1W2AX 3T2PA 4ONUA 1W9YA 1X9PA 2VZUA 5FY1A 4BCUA 5BNPA 1OH4A 5C8WA 2DFBA 1LRHA 3WNOA 2RMU1 4N7UA 4Y5SA 2KA3A 5C8CC 5JOYA 4F7ZA 2FDFA 1W28A 2ZGPA 4OCTA 3TN91 4W8JA 5IT6A 2ETEA 2UURA 5IWFA 1R082 4GH4B 1DHKB 4HN0A 5BPXA 5FZ6A 2VR4A 1AYM3 1N1YA 1XC6A 2V4VA 4FOVA 1GR3A 4B7EA 4PIYA 5HPOA 2W1SA 3ZN4A 2A3XA 2R30A 3BALA 3WNNA 5C3RA 2BNOA 1SBEA 5FMCA 2H0VA 4LNVA 4P9JA 4AHXA 2E53A 3F2ZA 1PVXA 1NCRA 1AJOA 1ZYBA 4CRQA 1PK6C 5JR2A 4QMAA 4MGIE 2DYCA 2WT0A 3TBDA 1LENA 5LCWL 1FATA 1HIXA 1J1LA 1Z7S1 5FUIA 4KG8A 5CYYA 1PO23 2CWSA 2RJLA 3QLQA 1AYM1 2HWF2 2A73B 2RG4A 4KU7A 4NJ4A 1DZQA 5IK7A 1W3XA 3C7GA 2NYYA 2A70A 3ZYRA 3NRUA 4FXGB 5A7NA 3WSOA 4A2UA 1RVF2 5EXOA 4TN7A 1H2LA 1AX0A 3BTXA 3JB4C 4RD7A 1GANA 2WR9A 3VLBB 1CWPA 5FZEA 3VBFC 4HETA 3LA2A 3UGGA 3DKWA 3ZSMA 2RVAA 2WYSA 4RQPB 4RQPA 3ENRA 5CAZA 4DO0A 3E6DA 3QACA 5JZGA 4GJZA 4JHTA 1PO21 3KS7A 5ANNA 3LDKA 5GALA 1CAUB 4BISA 4CEWB 1SLLA 1UMHA 3POEA 2P2KA 1OOPC 1RHI3 3WR0A 4ET7A 1D7PM 1RUC3 1U5YA 1YWKA 1AYM2 2R041 3OGRA 5ABJB 1ACCA 2WNVC 1SBFA 4H2AA 3U4SA 4H55A 4YZ3A 2HEYF 2VO5A 4Y1UA 1SLIA 4KL1A 5IW0A 3IDBB 5FXXA 3TOJA 3UL2A 5LZ6A 4HT1T 3JZVA 3WNMA 4DUXA 1H6XA 3V0BB 3X29B 1OD3A 4Q1PA 4NAMA 1FPN3 1X9TA 1JYIA 4CP1A 2P3JA 2QZ2A 3B7MA 3N7LA 4JC1A 5ANQA 2VCMA 1D4M2 4HVRA 3WNPA 4DOUA 1GYKA 1HX6A 2BVBA 3THDA 3UV9A 2G1MA 4FPCA 1UX7A 5L7OB 3OYWA 1IPSA 1RUG1 4Z8BA 3AKQA 3PUAA 1GNHA 3POBA 2D6PA 1F4HA 1QH6A 1RUC1 2R043 1GP4A 1IS6A 4G4FA 1KS4A 2VUAA 2OZJA 4XILA 5LA1A 1EAH1 2A75A 1VBD1 3ZM8A 4O7XA 3IMMA 1YEWA 4AVAA 3H3LA 2JDKA 5D8AA 4XIKA 2ZKNA 3BU7A 4AGVA 1JHNA 4UI9L 4WZCA 1YIPA 2VUCA 3J8F1 4IE6A 2ZX0A 4TLFA 1JBCA 2MEV2 5A3PA 2WIIB 1OUXA 5I0UA 1RHI2 2XXZA 4W6YA 1H8TB 4NPRA 1GWKA 1QJX3 4MSVA 5F3IA 3FWEA 4UFKA 1YO8A 3UKTA 3W5MA 1UYPA 2YHJA 4FXKB 4XCBA 5ISLA 4FSJA 3POYA 2ZGNA 3BPSA 4R52A 3U1XA 4Y4YA 2B5HA 4NOTA 4R9CA 3KZ4C 2XDVA 4EJRA 4EZHA 5I8YA 3WG4A 5IVYA 3VD7A 1S4CA 1OF3A 1VAKA 2AYHA 4NROA 4P9IA 1HV1A 1BLZA 1UOFA 4O65A 4YVWA 5JSOA 1PZ9A 2CHHA 5FZDA 4XDPA 1U5XA 1X8EA 2PLV2 2DTWA 3J8F3 4LBKA 4MO3M 5JOZA 1UWWA 2JKXA 4LBLA 3WCRA 1GP6A 2ID4A 2OPWA 3CJIB 3F95A 4WVZA 4F8AA 4HSLA 2ATFA 3HEIA 2JIJA 5JWPA 3VZLA 1UMIA 1ZZ8A 1RTVA 1AUYA 3AFKA 3SH3A 2PMWB 3E5UA 4WVVA 4O9EA 4AVVA 1RGSA 4N43A 2ZJCA 4CDQC 1JUHA 3ZXLA 4FTEA 3B00A 4LO5B 1FPN2 3MIGA 3CMGA 5C6CA 2D97A 1RITA 3NL1A 1VBE2 4HSJA 1QIQA 1CAWB 1WLWA 2ZMLA 1J84A 5FLIA 4OI1A 3NWKA 3RDIA 3POSA 4PBOA 2B4KA 4XQWA 2WJSA 5KXDA 1XOYA 3JQXA 4XW3A 5BNNB 5LEJA 4ARYA 3BODA 4HKOA 2R6QA 4D3WA 2E31A 2WNVB 4LKFA 4XAAA 3ILRA 2J1EA 4LQRA 4LOTA 4OMCA 4CDWA 2NPIA 4XZPA 5C5TA 1E5IA 2Y60A 1DLLA 5GZDA 4AHZA 2EIBA 2WO1A 3KT7A 1FOD2 1HRI2 4D94A 5TSWA 5L7OA 2VM9A 3PNAA 1R093 2RMU2 3U0ZA 1AYN1 4M3CE 4M0HA 5D8AC 5DG1A 4CU7A 1Y9GA 1AF9A 1T2XA 2VW0A 2Q1MA 4R4ZA 5GJ6A 1GMMA 3KB5A 2ZKLA 3B69A 3SQOA 1AX1A 2XQRA 1A3KA 4BQXA 4A4AA 4IL7A 2PHWA 1W8OA 1SDWA 4RS5B 1NY72 1N1SA 4S2DA 4R9AA 5K9YA 5A32A 1LHUA 3VZOA 3H8XA 5AVPA 4TLGA 5FWEA 3FLPA 2PTMA 4INDA 3PDQA 1BYHA 2XH6A 1M06G 4FFFA 5CKNA 4DEVA 1AR93 5EHDA 2CAVA 1ZREA 4UT5A 1UXZA 1GUIA 3GM8A 3PTYA 4IEXA 5DUWA 4K8RB 1JI6A 2AUYA 1RC6A 1LTEA 2HWB2 1LGBA 3MLKA 2AENA 3N9OA 4JRAA 1OVPA 2WSVA 4XBLA 5L19A 1W2UA 3UETA 1G86A 4AE2A 3R6SA 2PHRA 4QHOA 3PVOA 1W90A 3APBA 1OFSA 1W6OB 2RJKA 2VZQA 4BH9A 3RZMA 5CA6A 3AP7A 1TME3 2DCTA 2BDRA 1PIV1 1W6QA 1W9TA 2P37A 2JXAA 2RDNA 3IN9A 4N43C 2HWD1 5FK7A 1LOEA 2ARXA 1QOOA 2HH9A 3M3EA 4EV0A 4OHWA 3ILFA 2WL1A 4HMZA 4AL9A 2IVJA 3MV01 4XFIA 3ZYBA 5A33B 3D6EA 1QXRA 4DY3A 1GOGA 4NRPA 3TEYA 1MQTA 1PK6B 5KXEA 5T5LA 1V6NA 1KRIA 1QWRA 3VD4A 5F7UA 3HQUA 2ZA9A 2BBAA 5KHHA 2IVIB 3RI8A 2ZGTA 5CKMA 4XFHA 3NJYA 2VMEA 3A4UA 2FMYA 1VRBA 2P1BA 1CVNA 1ZBE2 1AL0G 3R4UA 4CXWA 1QEXA 1WCKA 1RUF1 1ULPA 1M4WA 3P3NA 2VOWA 4EROA 1IS3A 3KLSA 3LA3A 1D0HA 1UU5A 3AP4A 1PZ8A 1XPWA 2NMOA 4KQ7A 3I2KA 4EYUA 1NX9A 4I01A 4CDQA 2P6HA 3LFMA 2GH8A 1KGYA 1X50A 4BU2A 5IATA 4O9GA 5DUXA 1RB8G 1MZ6A 1HJFA 1XNTA 2X29A 5FUPA 2K2SA 1SDDB 5CFDC 2RR12 3CZJA 3OEAA 1ZRRA 1JYWA 1A78A 4AEMA 2B7YA 3EB7A 4CYDA 5F9TA 5M0TA 4QKNA 4QPGB 4Y5TA 5EYXA 3PL0A 1TME1 1CAVA 4QX8A 5C8CA 3VKLA 1PMHX 4CDUC 4Q4V3 4BDVB 3RVHA 1URXA 3WDTA 3ZPOA 4ARXA 4HPKA 2EIEA 4CCMA
chains in the Genus database with same CATH topology
5FPAA 4GJZA 4BISA 3PU3A 3K3OA 5F37A 4D6QA 2WWUA 5FYMA 4C8DA 4CCLA 5FJKA 2VD7A 5FZFA 5FZ3A 3U4SA 5F39A 5IVVA 5IVEA 5FY5A 5FZHA 5IW0A 5FXXA 5F5AA 5FZMA 5A7PA 5FYCA 5FPUA 5FWEA 3U78A 3AVSA 4UF0A 5FYSA 5FYVA 4GAZA 2OX0A 3PDQA 3PTRB 4HOOA 4Y3OA 5FYZA 5IVCA 2GP5A 2W2IA 2OQ7A 3KVBA 5F2SA 4CSWA 5ANQA 5FPLA 5IVFA 4QXBA 5FP4A 4CCJA 5FZKA 4GD4A 5FZOB 5KR7A 4IGQA 5FZOA 5FP8A 2YU1A 5K4LA 4D6RA 4LIVA 4GJYA 3AL5A 5FYUA 3PUAA 4NUBA 5FYTA 2XMLA 4QX7A 3N9OA 5FY4A 3KV5A 3N9MA 5FP3A 5FPBA 3N9QA 2PXJA 5FZAA 5F5CA 3DXUA 4CCKA 3AL6A 4HONA 4AI9A 5F2WA 5FZGA 3KV9A 5F32A 5A3PA 2YU2A 4EZ4A 5IVBA 5FV3A 5FZ4A 3PUSA 2XXZA 3OPWA 5FZBA 5FY1A 5F5IA 5FYBA 2OT7A 5A80A 3KV4A 4Y33A 5FZCA 5A7SA 5F3IA 5LY2A 4V2VA 5FZ0A 3DXTA 5A3NA 3PURA 3N9LA 5ISLA 2YBPA 2GP3A 4QXCA 4ASKA 5FBJA 5FYHA 5FJHA 5FZ8A 5IWFA 2YBSA 3K3NA 2OQ6A 4CUGA 5FP7A 2XDVA 5FY7A 4EZHA 5FZ6A 2Q8EA 3N9NA 5IVJA 4QXHA 5IVYA 4XDOA 3NJYA 4DIQA 3LD8A 2OS2A 1VRBA 5FPVA 5FZ7A 5FWJA 5FZDA 4XDPA 5FXZA 5FXVA 5LW9A 4AAPA 5FZ1A 5FYYA 4LXLA 3OPTA 3ZLIA 4D6SA 5F3GA 5FZIA 3N9PA 5A3WA 4UF0B 5F3CA 4BXFA 5FZLA 4EYUA 2Q8CA 5FXWA 4BU2A 4CCOA 5LWBA 5CEHA 3K2OA 5A1FA 2YPDA 5FY8A 5FY0A 5A7OA 4IGPA 4QWNA 5FYIA 4Y4RA 3PUQA 5FUPA 5E6HA 3AVRA 5F3EA 4URAA 5A7WA 3KVAA 4E4HA 5A7WB 5FZ9A 4IGOA 5FUNA 5A7NA 4LIUA 2XUEA 3KV6A 5FY9A 2P5BA 4TN7A 3PU8A 4QU1A 3UYJA 5A3TA 4QX8A 5FP9A 2YBKA 4DO0A 5FZEA 4V2WA 5A7QA 2Q8DA 5A1LA 3LDBA 3RVHA 4CCNA 2WWJA 3ZPOA 4LITA 5LY1A 4CCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FPA A;  4GJZ A;  4BIS A;  3PU3 A;  3K3O A;  5F37 A;  4D6Q A;  2WWU A;  5FYM A;  4C8D A;  4CCL A;  5FJK A;  2VD7 A;  5FZF A;  5FZ3 A;  3U4S A;  5F39 A;  5IVV A;  5IVE A;  5FY5 A;  5FZH A;  5IW0 A;  5FXX A;  5F5A A;  5FZM A;  5A7P A;  5FYC A;  5FPU A;  5FWE A;  3U78 A;  3AVS A;  4UF0 A;  5FYS A;  5FYV A;  4GAZ A;  2OX0 A;  3PDQ A;  3PTR B;  4HOO A;  4Y3O A;  5FYZ A;  5IVC A;  2GP5 A;  2W2I A;  2OQ7 A;  3KVB A;  5F2S A;  4CSW A;  5ANQ A;  5FPL A;  5IVF A;  4QXB A;  5FP4 A;  4CCJ A;  5FZK A;  4GD4 A;  5FZO B;  5KR7 A;  4IGQ A;  5FZO A;  5FP8 A;  2YU1 A;  5K4L A;  4D6R A;  4LIV A;  4GJY A;  3AL5 A;  5FYU A;  3PUA A;  4NUB A;  5FYT A;  2XML A;  4QX7 A;  3N9O A;  5FY4 A;  3KV5 A;  3N9M A;  5FP3 A;  5FPB A;  3N9Q A;  2PXJ A;  5FZA A;  5F5C A;  3DXU A;  4CCK A;  3AL6 A;  4HON A;  4AI9 A;  5F2W A;  5FZG A;  3KV9 A;  5F32 A;  5A3P A;  2YU2 A;  4EZ4 A;  5IVB A;  5FV3 A;  5FZ4 A;  3PUS A;  2XXZ A;  3OPW A;  5FZB A;  5FY1 A;  5F5I A;  5FYB A;  2OT7 A;  5A80 A;  3KV4 A;  4Y33 A;  5FZC A;  5A7S A;  5F3I A;  5LY2 A;  4V2V A;  5FZ0 A;  3DXT A;  5A3N A;  3PUR A;  3N9L A;  5ISL A;  2YBP A;  2GP3 A;  4QXC A;  4ASK A;  5FBJ A;  5FYH A;  5FJH A;  5FZ8 A;  5IWF A;  2YBS A;  3K3N A;  2OQ6 A;  4CUG A;  5FP7 A;  2XDV A;  5FY7 A;  4EZH A;  5FZ6 A;  2Q8E A;  3N9N A;  5IVJ A;  4QXH A;  5IVY A;  4XDO A;  3NJY A;  4DIQ A;  3LD8 A;  2OS2 A;  1VRB A;  5FPV A;  5FZ7 A;  5FWJ A;  5FZD A;  4XDP A;  5FXZ A;  5FXV A;  5LW9 A;  4AAP A;  5FZ1 A;  5FYY A;  4LXL A;  3OPT A;  3ZLI A;  4D6S A;  5F3G A;  5FZI A;  3N9P A;  5A3W A;  4UF0 B;  5F3C A;  4BXF A;  5FZL A;  4EYU A;  2Q8C A;  5FXW A;  4BU2 A;  4CCO A;  5LWB A;  5CEH A;  3K2O A;  5A1F A;  2YPD A;  5FY8 A;  5FY0 A;  5A7O A;  4IGP A;  4QWN A;  5FYI A;  4Y4R A;  3PUQ A;  5FUP A;  5E6H A;  3AVR A;  5F3E A;  4URA A;  5A7W A;  3KVA A;  4E4H A;  5A7W B;  5FZ9 A;  4IGO A;  5FUN A;  5A7N A;  4LIU A;  2XUE A;  3KV6 A;  5FY9 A;  2P5B A;  4TN7 A;  3PU8 A;  4QU1 A;  3UYJ A;  5A3T A;  4QX8 A;  5FP9 A;  2YBK A;  4DO0 A;  5FZE A;  4V2W A;  5A7Q A;  2Q8D A;  5A1L A;  3LDB A;  3RVH A;  4CCN A;  2WWJ A;  3ZPO A;  4LIT A;  5LY1 A;  4CCM A; 
#chains in the Genus database with same CATH topology
 3D82 A;  5FR3 A;  5J37 A;  3DV8 A;  2YDE A;  4PQ9 A;  1K12 A;  3C7H A;  2A1X A;  1IPJ A;  3K51 A;  4GXL A;  2BGO A;  2XVG A;  3I2D A;  2PAM A;  3SKV A;  1S0D A;  1XE7 A;  2BW8 A;  2R32 A;  3VBF A;  1YCI A;  4FPG A;  5JVV A;  1OPM A;  5JXJ A;  4JRL A;  5AFB A;  4OI2 A;  1W6P A;  2XL9 A;  1RL3 A;  3ATG A;  1BBT 2;  3E1F 1;  3ITQ A;  5F3C A;  3NST A;  1IG0 A;  1YQ6 A;  4IEW A;  1RUD 2;  5H9P A;  3LPG A;  1TMF 1;  2EXI A;  4IEU A;  5BNO B;  4XE9 A;  4IEP A;  5LA9 A;  4A42 A;  4DS0 A;  1RED A;  4XAB A;  4PI0 A;  5B4X A;  1OI6 A;  1VAM A;  4QX1 A;  1HXS 2;  1SQ4 A;  1OKO A;  2H0B A;  5FZO A;  3RWN A;  3WP6 A;  3ZFF A;  4FI9 A;  4ZS2 A;  2FMD A;  3FHI B;  1E5S A;  3B01 A;  3ZR5 A;  4L97 A;  3CF6 E;  3KV5 A;  1AR9 2;  2VUD A;  4PF1 A;  4WVW A;  3C3V A;  4UFH A;  3DXU A;  3QBQ A;  1QOS A;  1TEI A;  1UZZ A;  2UWC A;  1O3S A;  3JBG 1;  4E8D A;  1OMI A;  4P00 B;  4Q4X 1;  2IXJ A;  2SBA A;  4L99 A;  2WBK A;  2DUO A;  1VBC 1;  4QB2 A;  3ZXA C;  4LE4 A;  4BK4 A;  5T50 A;  5FCC A;  5F1R A;  2W87 A;  4LTA A;  5IK8 A;  1GV9 A;  2JWP A;  3RFR A;  3ROU A;  3DPR A;  5DMY A;  1CPM A;  4NMI A;  3RJR A;  1F8V A;  3ZFE B;  4AVC A;  5HV4 A;  2GSY A;  1U5Z A;  4TXW A;  4XJU A;  4YGD A;  2OZ6 A;  2Y6J A;  3VDB A;  1W9S A;  2OQ6 A;  3I54 A;  1XYP A;  3IB3 A;  4K7J A;  1AJK A;  4LA2 A;  1H2K A;  1MS9 A;  2HBT A;  4FO9 A;  3MUY 1;  4BHP A;  1BHG A;  1UOJ A;  2JG9 B;  1CZV A;  2ZEY A;  3AKP A;  3RZZ A;  3E5X A;  3M70 A;  2R49 A;  3VBU A;  1KJR A;  5HCF A;  2PLV 1;  1JYT A;  1VLN A;  2PHX A;  3O1M A;  1N1V A;  3HIF A;  3VBO B;  3I2J A;  1CAV B;  1NOV A;  1XJA A;  3ZN5 A;  4Z82 A;  3SC7 X;  1NCR B;  2DDU A;  5T5J A;  3MPB A;  1ZZ6 A;  1F35 A;  2JEN A;  2O14 A;  3AZY A;  5DDJ 3;  4N90 A;  4LUM A;  1UZ0 A;  1BBT 1;  2VZV A;  5L9B A;  2WZR 3;  1GNZ A;  3OB8 A;  1RJ8 A;  1S1A A;  4IES A;  4OHZ A;  1OFN A;  4HKL A;  4UW4 A;  3RZG A;  5FLJ A;  5C4W C;  1O6U A;  2LRO A;  1RUO A;  1JXN A;  1RIR A;  1VBB 3;  3GHN A;  4COU A;  4PI2 A;  3UES A;  1EP0 A;  3PUI A;  1WLC A;  3AYA A;  4Q4X 3;  3WNL A;  1UPI A;  3WG1 A;  4CDU A;  3GYD A;  4MYE A;  4RA0 A;  2WO3 A;  3HT2 A;  4JGZ A;  4JGZ B;  4IET A;  3O14 A;  4E2S A;  1O5L A;  1FOD 3;  1HRI 3;  1F31 A;  2DCZ A;  2I45 A;  2IZW A;  2WNE A;  2WWJ A;  3E6B A;  3W58 A;  3ZDS A;  4BQY A;  3WVJ A;  3RS6 A;  4YLZ A;  2V72 A;  1LJ7 A;  2RDR A;  2VMD A;  4NWW A;  3ZFF B;  1AXZ A;  5ACA 3;  3K3O A;  2BNM A;  4DRR A;  3J7M A;  4C8D A;  4M3C F;  3MYX A;  3VBH A;  3O1T A;  1C3H A;  2J1A A;  2GC1 A;  2VD7 A;  1PIV 2;  4QQH A;  3ABZ A;  1JZ8 A;  3WP3 A;  3V56 A;  4A3X A;  1DQ1 A;  4ASM B;  1W6M B;  2DU1 A;  3ZFG C;  5IVV A;  1CJP A;  3IT8 A;  5FZH A;  3RZH A;  2WZR 2;  5DZG A;  1B35 B;  3MLL A;  2FCT A;  5FZM A;  1AR8 3;  3OBA A;  4XUN A;  1ENR A;  2WUH A;  1S55 A;  4LHS A;  4ZZ8 A;  1XU1 A;  3N4M A;  3B5L B;  2OX0 A;  3IMN A;  4AFD A;  3OSD A;  4KU8 A;  4YFZ A;  4AVS A;  1VBA 3;  3VV1 A;  5FPL A;  1MS8 A;  1FT9 A;  1OQD A;  4DUV A;  4AG4 A;  4CEW A;  1LU1 A;  2RS1 1;  2RJ2 A;  1J3Q A;  1VMF A;  2JG8 C;  5L73 A;  4OLL A;  1BBT 3;  2OXB A;  3ALQ A;  4YW7 A;  3MW2 A;  5FK8 A;  4QHZ A;  3WCS A;  2C9A A;  4JQT A;  3FBM A;  3RJ2 X;  5FYT A;  2Z42 A;  2X05 A;  3ZSK A;  2Y64 A;  3B9C A;  2BP6 A;  4QX3 A;  2R1D A;  2UY9 A;  5A6Q A;  1BVP 1;  1APN A;  1BKZ A;  1VBB 1;  3HR9 A;  2E6V A;  4XTP A;  2D6N A;  4YM3 A;  3WHU A;  1H6Y A;  1OLM A;  5KBF A;  3IPV A;  4YG6 A;  4YZ1 A;  4AHY A;  5FV3 A;  5FZ4 A;  2VZO A;  2JG9 C;  3PME A;  4HVO A;  1C8N A;  5JPN B;  1CX4 A;  4Q4Y 2;  1RUJ 1;  2FCV A;  3R4S A;  5LY2 A;  3IDC B;  3PIJ A;  2YMZ A;  5A3N A;  4DZG A;  5JMC A;  3VBO C;  4ATF A;  3T09 A;  1DFQ A;  4ES8 A;  2IFW A;  4QQ2 A;  2XG3 A;  4H14 A;  1S0C A;  2YBS A;  4MXW A;  4QM9 A;  4RGG A;  3WDU A;  2RM2 1;  2MEV 3;  4DQA A;  4K40 A;  2WYF A;  2QVS B;  5AC9 1;  2AR6 A;  2QQN A;  2ZPX A;  3NNL A;  5I0D A;  5A32 B;  3FHA A;  3P3P A;  2CGP A;  4E2G A;  2FCU A;  1N3P A;  1W8F A;  4GZ9 A;  2YGL A;  4Q0V A;  4Y20 B;  5CFD B;  2WFF 1;  4S2F A;  5LBE A;  3HNB M;  3WY6 A;  1UAI A;  1ZA4 A;  5FZ1 A;  1ND2 A;  3A0N A;  1CES A;  2CTV A;  2VTX A;  1STM A;  1SFY A;  2RS5 1;  1VMH A;  3OEB A;  4AEJ A;  1L7L A;  1E5R A;  3DKQ A;  2A7A A;  4AI2 A;  5J09 A;  2F4L A;  1K5M B;  1U0A A;  2W39 A;  4HLT A;  4N53 B;  1V0A A;  2Y34 A;  1R08 1;  2BJS A;  2VNG A;  4ZU5 A;  2E51 A;  4UW6 A;  1CD3 G;  5FZL A;  4K20 A;  1AZD A;  1Y3T A;  2O8O A;  3ZFG A;  4CCO A;  2YPD A;  3CBN A;  4XJ8 A;  4Z2A A;  3IDE A;  2X5I B;  3DUI A;  3KQR A;  2BFU L;  4GWM A;  2MHF A;  4R8H A;  4Y22 B;  5F5Q A;  4AYU A;  3PUQ A;  1S0G A;  4FTS A;  4ATE A;  2XVL A;  4KWJ A;  1W8N A;  3AZZ A;  1RUH 1;  1GZ9 A;  3FUO A;  2Q1F A;  4URT A;  3MUZ 1;  2UY8 A;  1NCQ C;  3M7A A;  1F4A A;  3OUJ A;  2C5D A;  2A71 A;  3VBF B;  3ZXG A;  1MEC 3;  4LLO A;  5LBC A;  2JG8 B;  3HN3 A;  2QQK A;  1NE4 A;  1YI9 A;  2YBK A;  1RUD 1;  4KGG A;  1D0G A;  2BNN A;  2D5H A;  2WIN B;  1R08 3;  3E6C C;  3HBK A;  1OKQ A;  2XON A;  2RDS A;  4MAD A;  3KCC A;  4XQD A;  5EPA A;  3IZO A;  1FV2 A;  2WDB A;  4OUE A;  2W47 A;  4KMQ A;  4B4P A;  4BWO A;  2B8M A;  3NV2 A;  1IOA A;  2ZX2 A;  3SNM A;  3ME2 A;  4FP3 A;  1C5I A;  3WW2 A;  4CP0 A;  1QJX 2;  3VDD A;  1MZE A;  1WCS A;  4EN0 A;  2PHT A;  5I8S A;  3W20 A;  2XJU A;  1MQT B;  1S0J A;  3KM5 A;  1WGP A;  3ZYJ B;  4MET A;  3OG2 A;  2VBD A;  3IWZ A;  3R05 A;  3D0S A;  5K0U C;  4L92 A;  1HB1 A;  1UL9 A;  5J98 B;  1A34 A;  2ZEZ A;  1JYV A;  2VAU A;  1HV0 A;  4W6X A;  2WWS A;  2Y6K A;  3AKS A;  3GF6 A;  4UF0 A;  5FDB A;  1N1T A;  3UKV A;  4Y3O A;  2HBU A;  2AC1 A;  1HN0 A;  1S2K A;  2R04 2;  2R07 2;  3BYW A;  3KVB A;  4BA6 A;  2ILM A;  2WN3 A;  3HBZ A;  3T1L A;  4M4R A;  1V6O A;  3BTA A;  1WKY A;  2N7G A;  2WSU A;  3MIC A;  2JEC A;  4LKS A;  4YVW C;  1V6M A;  1LAJ A;  2FD8 A;  3RSJ A;  1UO9 A;  2QE3 A;  2VOX A;  3N3H A;  3OUI A;  4K3U A;  4GMP 1;  1P8J A;  4MOA A;  4CVU A;  2WLP A;  4I3G A;  2XBO 2;  3ILN A;  2GZW A;  5FRE A;  2RM2 2;  5H9S A;  2W91 A;  3C2U A;  1B09 A;  1AX2 A;  4QPG A;  4MZU A;  4AI9 A;  3O1R A;  5JPM B;  5D1I A;  1J3P A;  1V9U 2;  2WN2 A;  1SFP A;  3OOX A;  1XNA A;  4Q0P A;  5I0T A;  3A21 A;  4I09 A;  3AP6 A;  4ORF A;  1H4G A;  1JZ4 A;  1RHI 1;  1YC6 1;  4XFG A;  4XCA A;  5FZC A;  4NIA A;  4V2V A;  5LEK A;  1S0F A;  1ZBE 1;  3GBG A;  4YZ2 A;  1TQ5 A;  3GZE A;  2PFW A;  2ZGU A;  3MLJ A;  2XJP A;  1ZRD A;  1JOJ A;  4XPV A;  3VDA A;  3FLT A;  4JKL A;  3WF0 A;  3AMH A;  1FXZ A;  2YYO A;  1WLD A;  2VNR A;  3K3N A;  1W0N A;  4A41 A;  4CUG A;  1AHS A;  1EYB A;  2E33 A;  3G7D A;  1IS5 A;  3OGJ A;  4MVT A;  1W3V A;  4A7Y A;  1RXG A;  5CG8 A;  3PIG A;  4DXZ A;  3I2O A;  5JOX A;  1PNG A;  4XYX A;  4PDW B;  5HCH A;  4QD2 A;  4CUB A;  2BPA 2;  1AYN 3;  3T0A A;  3I59 A;  3OPT A;  3I97 A;  1D4M 1;  4YYO A;  1GLH A;  3WG2 A;  4DEQ A;  2HWD 2;  1PO1 1;  3H9A A;  2JDP A;  1TVG A;  3FMG A;  1VJ2 A;  4MGT A;  4LBO A;  1F5J A;  5A3W A;  2QTW B;  1VRH 1;  1EAH 3;  3M1H A;  2OYZ A;  2ZX3 A;  3CL1 A;  3FN9 A;  5E8A A;  4YPJ A;  3GAL A;  1VIW B;  5ACA 2;  4P9L A;  4PT6 A;  3WOG A;  4IGP A;  5DDJ 2;  2FDJ A;  3HN1 A;  1DCS A;  1KQR A;  1AR6 2;  1QOT A;  1CAX B;  4IDZ A;  1CAX A;  1ZNP A;  2ZAB A;  5K7P A;  5CZK A;  4BLI A;  2VCA A;  1SPP A;  4JHZ A;  2ARA A;  4CCD A;  4CZS A;  1HB4 A;  4PCR A;  3ZXJ A;  5FUN A;  1IG3 A;  1JZ3 A;  1ULO A;  1Y7B A;  2J22 A;  1OQE A;  3KV6 A;  3WV6 A;  4LO8 A;  4AFC A;  3PU8 A;  3UGF A;  4YGC A;  3UYJ A;  1B35 C;  5FP9 A;  4Q27 A;  4YVS A;  3KCX A;  4FCA A;  2ZGQ A;  2JDZ A;  1U12 A;  2ZS6 B;  2R0F A;  1DZR A;  1O4Y A;  4QGN A;  4FOW A;  3TN9 2;  4GH4 C;  5C33 A;  1OSG A;  3NV1 A;  3W5N A;  5JZG B;  2R06 2;  3LSE A;  3PHM A;  2W08 A;  4G9S B;  1WBF A;  4GB3 1;  5DAV A;  2VOT A;  3M3O A;  1FMD 3;  4MV2 A;  4LOR A;  4I0W B;  1O59 A;  1VE0 A;  5K0U A;  2IFR A;  3LE0 A;  1ULD A;  2NQY A;  5EV7 A;  5FZ3 A;  2WQZ C;  5KHJ A;  3RYR A;  2VBP A;  3SCF A;  3NQH A;  1VBB 2;  1W6O A;  2BRT A;  5HXV A;  3S7E A;  4BQ4 A;  5A7P A;  4CCC A;  4YG3 A;  2EAL A;  4NHY A;  4Q8L A;  2HYK A;  4HKW A;  5DUV A;  5EP9 A;  3VBU B;  3NW4 A;  1FAY A;  3WF1 A;  2A3W A;  4CSW A;  1QKQ A;  4ZZ5 A;  1UQX A;  4QXB A;  2QQW A;  5FZO B;  2C9K A;  1Z78 A;  4U2A A;  1DGW X;  1AR8 2;  1LHO A;  2D3S A;  3BN6 A;  2I74 A;  4CEY A;  5LRS A;  1DP0 A;  3ZN6 A;  2VZ1 A;  3NJX A;  2WAA A;  5FY4 A;  4EQV A;  2XUM A;  1FPN 1;  1DG6 A;  5EWS A;  4BQ5 A;  2XJS A;  4DB5 A;  5C70 A;  4MXW B;  3TWI A;  1OLR A;  3WNX A;  4N8M A;  1PGW 2;  1Q8V A;  2XWJ B;  4Q8K A;  4UOJ A;  2V4A A;  3FFQ A;  3WDW A;  1ENS A;  4YW4 A;  1HQW A;  3RRD A;  3O12 A;  5IVB A;  3VL9 A;  1C4R A;  5LK5 A;  3FBY A;  4HK8 A;  4AZZ A;  3T0D A;  2CYF A;  1CAU A;  3BIE A;  5JAX A;  2YUE A;  4Q4X 2;  5DAB A;  1UNB A;  1OOP A;  1UU4 A;  1R1A 3;  2X53 S;  3DYM A;  5FJH A;  1E5H A;  3KHB A;  5ABJ C;  1CZT A;  1W6M A;  3POF A;  5FP7 A;  5FY7 A;  3SCH A;  3PJY A;  4D0Q A;  3S0M A;  1N3Q A;  3AB0 A;  5I0S A;  2BZD A;  4FOY A;  1D4V B;  4QPW A;  2KXL A;  5A6X A;  1DQ2 A;  1W06 A;  5IJR A;  2CNA A;  3D0J A;  1ZM1 A;  1BEV 1;  3T3Y A;  3NAP C;  1W6Q B;  4OVE A;  4AFM A;  1VBA 2;  4D6S A;  4I0A A;  4AQS A;  5H9R A;  3N9P A;  1MS1 A;  2JG8 A;  3IDA A;  3VBR C;  4BXS V;  2EAA A;  4RHV 1;  5FO8 B;  1WW4 A;  4B3N A;  2RS3 3;  2W9X A;  2LW8 A;  1H1I A;  4LLF A;  2ORZ A;  1SAC A;  3EJK A;  2E32 A;  4LK6 A;  1RUC 2;  2F6B A;  5EJ3 A;  5I93 A;  1XE8 A;  2D98 A;  3OYW B;  1BMV 2;  1HRV 3;  1XXN A;  1KJL A;  1DIW A;  1MZ5 A;  1JMU B;  4TWT A;  1TG7 A;  1W6P B;  3LKJ A;  4RL7 A;  1PGL 2;  3O1O A;  2BGP A;  4K1Y A;  2VVF A;  3O0W A;  1BXH A;  1WW7 A;  3S5A A;  5A3T A;  2RR1 3;  2Y8K A;  1MZF A;  4JKK A;  2WNV A;  1REF A;  1LGC A;  4UBH A;  3LDB A;  3T30 A;  2QQU A;  4CCN A;  4Z2W A;  1C8M 1;  4DFS A;  5L36 A;  5LY1 A;  1ZBA 3;  3WP5 A;  3FHQ A;  1WD3 A;  4OZO A;  1UZY A;  1LHN A;  4DIN B;  4QX5 A;  5KXC A;  4NIH A;  1MS5 A;  1SEF A;  2ET7 A;  1WCQ A;  3C7F A;  5KHK A;  4Y24 A;  4PLM A;  3WEZ A;  4GQ7 A;  5HBA A;  4CCE A;  1G8W A;  4F83 A;  5BYN A;  1W9W A;  1UYZ A;  3NJV A;  2YRO A;  1OLM E;  2VG9 A;  3ELN A;  3OGV A;  2WZE A;  3PVN A;  4C90 A;  1YFU A;  1UW8 A;  3LEK A;  4RHV 2;  1LOC A;  4P5Y A;  2D93 A;  1CZS A;  2YFU A;  3MHZ A;  1R09 1;  1XBF A;  4JKM A;  4BLJ A;  3AP9 A;  1VB2 A;  1LCL A;  2D3P A;  1GKB A;  3WG3 A;  2LS6 A;  4S2G A;  1SMV A;  2AZ5 A;  3DPR B;  3GHM A;  4UFM A;  3RI9 A;  3TRS B;  2HWB 3;  2P6C A;  4CCJ A;  4U36 A;  2E7A A;  3MBW A;  4P02 B;  3AKT A;  4Y1Y A;  5GZE A;  4CP9 A;  1PGS A;  1ND3 A;  2FBE A;  5KR7 A;  2HLE A;  1KXG A;  3NV4 A;  4LUK A;  2RS1 2;  4NHX A;  1K42 A;  1K5M A;  1UIK A;  2AGS A;  4OMD A;  1FX5 A;  1GWL A;  2RS3 1;  5E89 A;  5FMO S;  2C26 A;  1ZRF A;  1Y9Q A;  4FPY A;  3QCW A;  4NVP A;  1O5U A;  1R1Z A;  5FFO C;  2EF6 A;  4W65 A;  2BUK A;  1Z7S 2;  1TME 2;  2VW1 A;  3HD8 B;  4NN0 A;  1KDM A;  4KH9 A;  4YW1 A;  2VUL A;  3BTZ A;  2ZGS A;  2JEM A;  1UOG A;  2RM2 3;  5AC9 3;  4LPL A;  2J7M A;  1BMV 1;  5A80 A;  2D3R A;  2RR1 1;  4RR3 B;  2P34 A;  2QQI A;  3BOW A;  4MGQ A;  3FZ3 A;  4Y33 A;  1AR6 1;  3ACL A;  1Y43 B;  5BNN A;  1F9K A;  3ACH A;  3AJY A;  1ZRI A;  5C4W A;  4QKD A;  5A33 A;  1C8M 3;  3MW3 A;  2VMF A;  2VEC A;  3JCI A;  4CDW B;  3AZW A;  3MEP A;  1QXJ A;  2VL4 A;  3ES1 A;  5A3O A;  1WMD A;  2PHL A;  4EN7 B;  3D5O A;  3TNP B;  2GDF A;  5LA0 A;  5JI9 A;  4OUL A;  1VPH A;  1XE0 A;  4HFS A;  4X6Q B;  4XDO A;  4QX2 A;  4UBG A;  1O3Q A;  2WQ8 A;  3KT4 A;  4Z1V A;  4A6O A;  4BQ1 A;  1PHM A;  2ZGR A;  1SZB A;  4JDN A;  5FXZ A;  5FXV A;  4H3W A;  4AAP A;  1QDO A;  3JD7 2;  4LE3 A;  4LXL A;  1JUI A;  5DAQ A;  3IIA A;  4RS5 A;  2FHR A;  1QQP 2;  1FNY A;  5GLW A;  4CP2 A;  4DPN A;  2NP0 A;  3N7J A;  4NAO A;  5GZC A;  2XQX A;  2W95 A;  4MGY E;  4Q1R A;  1LNS A;  2ZMK A;  4LMF A;  2X8K A;  5I8T A;  3OBT A;  3E97 A;  2YC4 A;  1ULE A;  5FY0 A;  4E27 A;  3C8X A;  5E16 A;  1RUF 3;  1W2T A;  3NVC A;  4WM7 C;  3M3I A;  2PHU A;  2P17 A;  2WNU C;  2BBV A;  1NG0 A;  3HT1 A;  1Q8Q A;  3O5S A;  5E6H A;  4NPL A;  4WZF A;  1POQ A;  3ZVX A;  3M2M A;  3SEP A;  1H8T C;  4AWD A;  1JYN A;  3AMN A;  1EUU A;  1L7R A;  2XUE A;  1UOB A;  2WKK A;  2IXH A;  4XUO A;  2W1Q A;  3HPN A;  4KGQ A;  3B94 A;  2VTX J;  2HWC 2;  2BER A;  1R09 2;  2RMU 3;  4XUR A;  1L3J A;  1XNB A;  4W4Z A;  4COY A;  5H9Q A;  4XF3 A;  5KHG A;  2UWA A;  3Q8E A;  3L9J T;  4KWL A;  4OYU A;  3T2O A;  1CN1 A;  3PU3 A;  4LO6 B;  3TAY A;  3U11 A;  1DGR N;  2KD7 A;  2UWB A;  2Z2S B;  4PJY A;  1J59 A;  3HJR A;  3SIT A;  3OGG A;  5LAS A;  3SH5 A;  4GKY A;  2B45 X;  3ZN6 B;  4J6G A;  1NE6 A;  2YC0 A;  3A22 A;  1W8Z A;  3Q8F A;  3GBW A;  3AVS A;  4JCK A;  2DUQ A;  2V5Y A;  4HOO A;  3USU B;  1DQ0 A;  2FDK A;  1ODN A;  2EXJ A;  1WCD J;  2W2I A;  1LUL A;  2DVD A;  1J58 A;  2OA2 A;  2GU9 A;  3LF7 A;  1COV 3;  4A6S A;  3HNY M;  4KWK A;  2G19 A;  3VDD B;  2DVF A;  2VUJ A;  1NUK A;  3B3Q E;  4GJY A;  2VU9 A;  5FYU A;  1QJY 2;  2G9Z A;  1XU2 A;  3VDC A;  2OW4 A;  3IAQ A;  4RR3 C;  1C57 A;  1PX3 A;  1ULG A;  5FP3 A;  3WUC A;  2IC1 A;  1X7N A;  2PXJ A;  5FZA A;  4M3C B;  4A3Z A;  1UU6 A;  3CU7 A;  3I4I A;  2JDH A;  4HVQ A;  2Q30 A;  4IXL A;  4HON A;  4L9B A;  4BE3 A;  1MQT C;  1S2E A;  2GNB A;  2DVA A;  3AZX A;  2V09 A;  3B02 A;  3QH7 A;  3WP4 A;  5F32 A;  2JG9 A;  5JIA A;  4AFA A;  3EMR A;  2VVE A;  4A44 A;  2DF7 A;  2D7F A;  5J3U A;  3PJQ A;  1YUD A;  1OA2 A;  4IV1 A;  4Q4V 2;  4IV1 B;  4Y5Z 0;  1VP6 A;  2F17 A;  3VBO A;  1QJY 3;  4LR4 A;  3DEC A;  5FMB A;  3PUH A;  1HLC A;  2VQU A;  3ZXF A;  3N9L A;  5D2A A;  3SIS A;  5DXD A;  2VOK A;  2RHP A;  4BJ0 A;  1IKP A;  1DYO A;  4QXC A;  5FBJ A;  4LBQ D;  1LED A;  2ZOE B;  1D4M 3;  3WW1 A;  3I49 A;  1RUD 3;  3U07 A;  4GUL A;  3AMQ A;  2Q8E A;  3IAP A;  5IVJ A;  1WA4 A;  1MS4 A;  4GAL A;  4DXR A;  5A6Y A;  1ND2 C;  2YXS A;  4FBF A;  5C71 A;  4WM7 B;  4LO7 A;  1KEX A;  4ZS3 A;  3DYP A;  4NRQ A;  2FDG A;  2VVD A;  1AXY A;  2WNU A;  4XZU G;  5JR7 B;  3ZYI B;  3DN7 A;  3MFC A;  1W8W A;  3ACF A;  4HXC A;  1NKG A;  5FZI A;  3JQW A;  1H8T A;  1HDK A;  1OHF A;  3HQX A;  1XYN A;  2XJQ A;  5GLV A;  3FX3 A;  3H7J A;  4NID A;  2B46 X;  2QDN A;  4RFR B;  3QH6 A;  1VRH 2;  1VAV A;  1JZ2 A;  1RMU 1;  5I0R A;  1CIW A;  1C5H A;  4RFT 0;  5ERL A;  3ZXK A;  3M3C A;  4A7Z A;  4C91 A;  1ASJ 2;  5BNQ A;  1J83 A;  1YNA A;  2R0H A;  2ZGL A;  4GA9 A;  4SLI A;  2NLR A;  3CEW A;  4NWV A;  5HXM A;  4XAE A;  3Q9O A;  1QJU 2;  1UPS A;  4R9D A;  2QNK A;  4XJW A;  3H0O A;  1JYC A;  4PDW C;  1S2B A;  4GWJ A;  3O7O A;  4XF4 A;  2FZ1 A;  3L2H A;  5FQ0 A;  1NZC A;  2Q5T A;  3A23 A;  1I9R A;  3ASI A;  4TZD A;  2Z4F A;  2Y0O A;  2ERF A;  2J1T A;  3CJI A;  2VZR A;  1GOF A;  1OOP B;  3WHT A;  4M01 A;  1G9F A;  1YYN A;  1QJY 1;  4QQO A;  5EJ1 B;  3VUO A;  2J42 A;  4DUW A;  1H1A A;  2ZEW A;  5FIX A;  3DL3 A;  4ISR A;  1A8D A;  1FNZ A;  1RUH 2;  1AR7 2;  2AH2 A;  1JOB A;  2WWU A;  3W21 A;  4W6W A;  4X6R B;  2G4I A;  2W46 A;  3VDD C;  3O1U A;  1ZBE 3;  2QZ3 A;  2IWG B;  3JD7 3;  2P3K A;  1FOD 1;  1HRI 1;  3WQ7 A;  1LOA A;  4YWA A;  2VMC A;  4DXT A;  5FPU A;  3U78 A;  3HVD A;  1EAH 2;  4BIO A;  1TZO A;  2GN3 A;  2CY6 A;  2Z69 A;  3KGZ A;  4N7I A;  3VZJ A;  2QDR A;  4X8P A;  1JYX A;  1A8M A;  2W1W A;  3WX5 A;  1IQA A;  3EQE A;  4FTB A;  4NRM A;  4XXP A;  1YFW A;  1LOG A;  1XB9 A;  1Q8P A;  1QJX 1;  4IER A;  4FPJ A;  3PMS A;  4IGQ A;  1MR5 A;  4MHR A;  4GWN A;  4IQP A;  4QU2 A;  1NLS A;  3AL5 A;  1MEC 1;  1Z7S 3;  5C4W B;  1RUE 1;  4IV1 C;  4UW5 A;  4UYB A;  4YW6 A;  5A1A A;  2D6L X;  2CWM A;  4CDW C;  4FVV A;  1G9C A;  3W59 A;  5LBB A;  3UNP A;  1Z0H A;  4AVB A;  2XWB B;  4FFI A;  3BPZ A;  4CDU B;  2RS1 3;  5FZG A;  2JDA A;  3THC A;  1R1A 1;  4XUQ A;  4JGZ C;  2GH2 A;  1IGO A;  3N35 A;  2P3I A;  5DZE A;  1XSR A;  3FL7 A;  3U75 A;  1HQL A;  4D7Y A;  1ASJ 1;  1N47 A;  3WW4 A;  2W0X A;  1ND2 B;  2QCS B;  3KV4 A;  3WZ1 A;  5JXI A;  2HJI A;  2EIC A;  4CEY B;  2LRP A;  1V9U 3;  3RGB A;  3JB8 A;  3CZU A;  2JDN A;  3MZH A;  2YBP A;  3WDX A;  4ASK A;  4XDQ A;  1RUE 3;  1BEV 3;  3Q8C A;  3H8R A;  4E2Q A;  2CL2 A;  2C0Z A;  3FLR A;  2XBO 3;  1QH7 A;  3AFG A;  3THP A;  2XOM A;  2WT1 A;  2YFZ A;  1RUJ 3;  4FPH A;  3VD3 A;  2XB6 C;  3CJI C;  3WD5 A;  5FTT C;  5C3O A;  5KXB A;  3K4D A;  5FZ7 A;  3U37 A;  3O1V A;  4C1X A;  4AK3 A;  4KBZ A;  2DUP A;  3BTY A;  4AI1 A;  2JDY A;  3AX4 A;  4JDO A;  4EWE A;  1JU4 A;  2MEV 1;  1IQD C;  4GWI A;  1V9U 1;  2HWC 3;  3T4V A;  5F6K A;  2VZT A;  3M4F A;  4LK7 A;  3V0A A;  2G9G A;  3EYP A;  3ZSJ A;  1PX4 A;  2TNF A;  2XHN A;  4L0P A;  3ETP A;  3K2O A;  4CXY A;  5FY8 A;  4XXA A;  5D21 A;  4W50 A;  1GQG A;  4P9G A;  3J9S A;  4LKE A;  2Y6F A;  1W39 A;  4PIZ A;  5SV8 A;  3SMH A;  4KNC A;  4AGR A;  4QKF A;  2WAB A;  4OI0 A;  1NXM A;  5FMO L;  3VHR A;  3ZIX A;  3ZKY A;  2CDO A;  5FZ9 A;  3URF A;  4IGO A;  4CUA A;  3LEG A;  3RMX A;  1ONA A;  4YM0 A;  3GGL A;  1HRV 2;  1WBL A;  3VKM A;  3M3Q A;  3USS A;  2JD9 A;  3Q8B A;  2QFE A;  5JXH A;  1GOH A;  2HWC 1;  2E26 A;  3MF9 A;  5T54 A;  3UK9 A;  4P08 A;  3WXP A;  2ADE A;  5A7Q A;  1AR9 1;  2ZZJ A;  1MS3 A;  2Q8D A;  5A1L A;  5C5U A;  5LB6 A;  3NNF A;  1GZW A;  1SG3 A;  2BQP A;  2BTV C;  5JZG C;  1IZ3 A;  2R16 A;  4CTE A;  3ZXD A;  1ZZB A;  3MPP G;  3BI3 A;  1DGW A;  1KD7 A;  1WUV A;  4COV A;  1ENX A;  2JKB A;  4LOS A;  5FYM A;  3RPQ A;  2XJR A;  1J1T A;  1AYN 2;  2BOI A;  1HB3 A;  1TMF 2;  1U5I A;  2ZZQ A;  4XUT A;  4XF1 A;  1R1A 2;  4HBN A;  1H30 A;  1RUI 2;  2GME A;  1C28 A;  4SBV A;  5D8A B;  4PQQ A;  4YNI A;  2VQT A;  1CJD A;  3ZX7 A;  3I3E A;  1WMF A;  2GND A;  4E8C A;  5C3Q A;  4A7K A;  2Y6H A;  5T5P A;  3I3D A;  1KFX L;  1SCS A;  4NO4 A;  2OQ7 A;  4Q4Y 3;  3LAG A;  4MLO A;  2PA7 A;  4XC9 A;  3T2T A;  1GWM A;  4B1L A;  1EUT A;  2Y6L A;  4XFC A;  4XF9 A;  3N36 A;  2X5I C;  3E5Q A;  4K8F A;  3BU0 A;  3AMM A;  4D6R A;  3DF0 A;  2YGM A;  2XHK A;  3KHC A;  5FKC A;  1W8T A;  4MX3 A;  1TNF A;  3ZSE A;  2LTN A;  3K77 A;  1ALY A;  1V6K A;  2BEO A;  1WMX A;  3CKH A;  2IXC A;  3AL6 A;  2PAE A;  5EFU A;  2JDU A;  5E1R A;  4M00 A;  2GMP A;  3D8C A;  5A3M A;  4QGM A;  2WA3 A;  4OHY A;  5J48 A;  3ZFF C;  1NCQ A;  4WM8 C;  1GBG A;  1NQJ A;  2JB8 A;  2TBV A;  2WZ8 A;  1YLL A;  3OPW A;  4QDQ A;  5F5I A;  4CDX B;  4D69 A;  3TB0 A;  3I2H A;  4QAW A;  2GAL A;  1QDC A;  3DXT A;  2W68 A;  3J7N A;  4BM8 A;  1I1E A;  1IHM A;  3ZYF A;  3H1Y A;  5HCB A;  1W03 A;  2RDQ A;  2VXR A;  4N43 B;  3T2Q A;  1PMI A;  1D2Q A;  5EJZ B;  1WW5 A;  1GQH A;  4QDR A;  3OBZ A;  5A6Z A;  1ULC A;  4AF9 A;  3NJZ A;  2O0O A;  2XL7 A;  3OUH A;  1O8P A;  1QQP 1;  2KM2 A;  2KR2 A;  5IK5 A;  1XNC A;  1W0O A;  3LD8 A;  4Q2F A;  2W94 A;  4PBP A;  3MV1 1;  2NN8 A;  3NKT A;  2Q8O A;  5EIY B;  1MVQ A;  4IW3 A;  4YG0 A;  1PIV 3;  2XLA A;  3ON7 A;  1PM7 A;  5LW9 A;  3N7M A;  1O3T A;  2XLG A;  4XHX A;  4JZR A;  2Q1Z B;  3BVC A;  3IKW A;  4GKX A;  1HJG A;  2XKP A;  5LRR A;  1QY4 A;  1W05 A;  2LUW A;  2HYX A;  2PHD A;  1SLT A;  5T55 A;  4OI4 A;  5GM0 A;  3SLI A;  3CJX A;  1SCR A;  5AFE A;  1UN1 A;  3OJB A;  1H1M A;  2HKX A;  4OQ9 A;  2WS9 1;  4FP2 A;  4XEZ A;  5FYI A;  3GCW A;  4Y4R A;  1D2S A;  4QPG C;  3VHN A;  2BVV A;  3SXW A;  2DUR A;  3AJZ A;  3THT A;  1CPN A;  4FPL A;  5F3E A;  3L2Y A;  4E4H A;  5L7O C;  1POV 1;  4JV4 A;  1NA1 B;  4H7M A;  3RZK A;  1NA1 A;  3VD9 A;  4IEY A;  5FY9 A;  4E4S A;  2P5B A;  1YI7 A;  2QJV A;  5FAX A;  1QGL A;  4QU1 A;  4ZHN A;  3ZYH A;  3NNM A;  5C9A A;  4MGS A;  4OHX A;  5J7M A;  4M4P A;  3RZJ A;  2VQA A;  2VGD A;  1RVF 3;  3AM2 A;  4P9Y A;  1NQD A;  3H3Z A;  4N9I A;  1HQN A;  1JZ6 A;  4N9H A;  2K46 A;  2XGX A;  1UF2 C;  2WS9 3;  5CNA A;  3H1W A;  1RUJ 2;  3P1I A;  4KG0 A;  3RWK X;  4FQZ A;  4YFW A;  2LM3 A;  1UKR A;  3WDV A;  1E57 A;  1OBN A;  2HWF 3;  5AVA A;  2C24 A;  3CNA A;  5FRA A;  5FZF A;  2GN7 A;  3CDZ B;  5BUV A;  5C7G A;  5JSR A;  2WNU B;  1WA6 X;  1WD4 A;  2ZAA A;  2J1S A;  3FUQ A;  5FYS A;  1VBC 3;  3PVE A;  4C1W A;  5CIR A;  3TEW A;  3I2F A;  1FMD 1;  3RNS A;  1L7Q A;  4PLN A;  3NMB A;  1JTZ X;  1RVF 1;  5BNO A;  1H0B A;  1DZT A;  1LES A;  1QJZ A;  2C4X A;  1UIJ A;  2ORX A;  2YPJ A;  4IV3 C;  4AED A;  4AXO A;  2OUJ A;  4XMI A;  5GZF A;  5LA2 A;  1VMJ A;  4NUB A;  2CU5 A;  2HWF 1;  1YFY A;  2XML A;  2Z5W A;  1SHW B;  4GIQ A;  1BVV A;  4OUS A;  1I5P A;  2TUN A;  2HWE 3;  3R0R A;  2VZ3 A;  5B2G B;  5C3S A;  1LU2 A;  1I5Z A;  5IFT A;  1MPX A;  3KQ4 B;  4K6B A;  4OFG A;  3BIW E;  3D4K A;  3ZYP A;  4EE2 A;  1UD1 A;  2VZS A;  1ZBA 1;  3OD4 A;  2FQP A;  3MDP A;  2EVX A;  4YM2 A;  4MGK E;  3AP5 A;  1GZC A;  2X10 A;  1JZ5 A;  4NII A;  3TYJ A;  3DYO A;  4F3J A;  1O91 A;  2IXK A;  1CGP A;  4EWD A;  2R07 3;  3GZA A;  3LWC A;  4AI8 A;  1VB4 A;  1RYY A;  1PVC 2;  2QQL A;  4J1X A;  5FO9 B;  1ZX5 A;  1DYP A;  2WS9 2;  4FAH A;  5DDJ 1;  3A0K A;  2JE8 A;  5KWR A;  3AXE A;  1HXS 3;  3I2I A;  3I3Q A;  2J1U A;  1C1F A;  1LR5 A;  1PVC 3;  2HEW F;  1H9W A;  1I3H A;  5K0U B;  2DCY A;  1NA1 C;  4LHN A;  3VBS A;  5AC9 2;  1RUI 3;  1T6G C;  2W5F A;  3B93 A;  3VB9 A;  1NXD 1;  2UYB A;  4OZX A;  4XAC A;  3ZFE C;  2ZGO A;  1O4T A;  3ZO0 B;  1SLC A;  5GLU A;  1CR7 A;  3LA7 A;  2HWB 1;  1LGN A;  2JB4 A;  3JXS A;  4V1P A;  2OS2 A;  3HMY A;  1AR8 1;  2ENR A;  3C7O A;  3OBR A;  2FZ2 A;  5JIU A;  1SLA A;  5EQU A;  4IE5 A;  1V6L A;  1KDK A;  2PQQ A;  1GSL A;  1XQN A;  4PF5 A;  1ENQ A;  1PMJ X;  3U4X A;  1DQ5 A;  4LA3 A;  1ZA7 A;  1J3R A;  1X8M A;  2X09 A;  1YXW A;  3RYK A;  1YIF A;  4YW5 A;  3KF5 A;  4BYY A;  5A1F A;  1PM4 A;  1RUI 1;  5LWB A;  1GZW B;  4LHK A;  5CIS A;  2JIC A;  3OPZ A;  1EV1 1;  4R4X A;  2VMG A;  3BOP A;  4WM7 A;  4B4Q A;  1AR6 3;  3KVA A;  1ZVF A;  3UKN A;  2ADD A;  4Y20 A;  4OQ8 A;  3HOB A;  1F15 A;  2Y26 A;  1UY4 A;  2DWR A;  3I2G A;  4I0B A;  4ISQ A;  4LIU A;  1ODM A;  2IUW A;  4AHW A;  3WF4 A;  1DU3 D;  3J26 N;  4LJH A;  4YGB A;  1JW6 A;  1XNK A;  1YJK A;  1G9D A;  4XFF A;  1VBE 3;  4COW A;  4J1W A;  3MF6 A;  2GC0 A;  3GZT B;  1JOP A;  2VCC A;  4HZF A;  1HRV 1;  3P6B A;  2WZR 1;  4LIT A;  1RUG 2;  4NHK A;  1GP5 A;  4QPY A;  3T4H B;  2GMM A;  4UWD A;  4ZPI A;  4ZY9 A;  2NZ9 A;  3ZFG B;  4AEK A;  1UZV A;  3GZU C;  2VE1 A;  1EV1 3;  1PVC 1;  1SPP B;  2BFU S;  2ES3 A;  1SLB A;  3VBH B;  2ZCW A;  4FPE A;  1OQ1 A;  4KI5 M;  4M3C A;  4TSV A;  3ZMN A;  4AFB A;  2D43 A;  5J36 A;  4XJZ A;  1JZ7 A;  2WFF 3;  2D44 A;  3MIE A;  1PGW 1;  2WT2 A;  5L9V A;  1DLC A;  3B9I A;  3I7D A;  2VMI A;  4H7L A;  5F5A A;  1FYU A;  2A3Y A;  5FYC A;  4FFG A;  2RS5 3;  5T52 A;  4JGY C;  2JE9 A;  1K3I A;  1XRU A;  2BU9 A;  2GNM A;  5F2S A;  2QQP A;  5FO7 B;  1AVB A;  5FKB A;  1IPK A;  3I8T A;  2B42 B;  3H8O A;  1OF4 A;  5FBZ A;  2AAC A;  1XSQ A;  3MGU A;  4YW2 A;  5K4L A;  2ZXQ A;  3AMP A;  4ZU7 A;  2B9V A;  4NE9 A;  3BCW A;  2P4E A;  1Q8O A;  2VBB A;  3H42 B;  5IK4 A;  2BYV E;  3LOI A;  3ORJ A;  4QX7 A;  4XBN A;  5FPX A;  4XVH A;  3WF2 A;  4I2O A;  5F5C A;  1ZRC A;  4RGK A;  3LPF A;  3P5B A;  5JMO A;  3MIB A;  1F2N A;  1GIC A;  4UXA A;  5F2W A;  1A6C A;  1GQP A;  2GC2 A;  2NM1 A;  5GZG A;  4ZON A;  4C0H A;  2ZAH A;  4YW3 A;  4Z07 A;  1RMU 3;  4YZ5 A;  1JS9 A;  1VBA 1;  2YU2 A;  3N7K A;  1CIY A;  1XYO A;  3PUS A;  3CLP A;  2E63 A;  2A6V A;  3ACI A;  5FZB A;  1VBE 1;  2DFC A;  3QD6 A;  5EZW A;  5A7S A;  5GLZ A;  2XPJ A;  1REE A;  4NIG A;  3VBS C;  1OA4 A;  1GFF 2;  2A6X A;  5ACA 1;  4IEV A;  4XF0 A;  3GJB A;  2W3J A;  5FYH A;  2GNT A;  3ZMO A;  1YHF A;  3MO4 A;  2QQJ A;  4XIO A;  2B39 A;  3FE5 A;  3POJ A;  1W9F A;  5BV6 A;  3VBU C;  3H3U A;  4Q4W 3;  4QXH A;  3LOB A;  4PLO A;  3WQB A;  1COV 1;  1V6I A;  3WW3 A;  1RUH 3;  4AI3 A;  1PGL 1;  2Z79 A;  5FWJ A;  3TNQ A;  3D3A A;  1TNR A;  3LDR A;  5DG2 A;  2K9Z A;  3LCP A;  1QMJ A;  2WZP P;  1V00 A;  3WQ1 A;  1FV3 A;  3ZLI A;  2UYA A;  4ZKT B;  5F3G A;  3AYE A;  4HN1 A;  4D8M A;  1VBC 2;  1W2N A;  1K5J A;  4TTG A;  1W2O A;  2CAU A;  3H7Y A;  3GJA A;  1W04 A;  2FDI A;  1NY7 1;  2VW2 A;  3MID A;  3C7E A;  3LZZ A;  4C0B A;  4FFH A;  4FPO B;  3OD0 A;  3BB6 A;  1OH3 A;  4N53 C;  3SH4 A;  4MG2 A;  1CAW A;  5FPZ A;  5EYY A;  1I6X A;  1UY3 A;  2HEV F;  4KWU A;  3ZYG A;  5CFC B;  4I30 A;  3IBM A;  4URA A;  2WQ4 A;  3J4U H;  5A7W B;  3EXU A;  2VCB A;  1JN2 P;  3CQO A;  2ZMN A;  4PDW A;  1NLQ A;  4ITC A;  4K1Z A;  1GNY A;  1DGL A;  3VBH C;  3VZN A;  3BUC A;  1FMD 2;  1VBD 2;  2QBX A;  2QQO A;  4QKB A;  3U14 A;  5FOB B;  3LIG A;  2VPV A;  3J7L A;  1NCQ B;  4ZU4 A;  3OY8 B;  4FQ4 A;  3K4Z A;  4CPB A;  1EPW A;  2YG0 A;  5F6L B;  3ES4 A;  4GMP 0;  4IEQ A;  4CE8 A;  5FPA A;  3AK0 A;  1DQ6 A;  5L9R A;  4IV3 B;  4RQP C;  5JLV A;  4K9S A;  4AED B;  5HCA A;  3KMH A;  1AL2 2;  4LBQ B;  4NHL A;  1O4Z A;  4LBQ A;  5CKQ A;  4AI0 A;  1UMZ A;  3AKR A;  1ZZC A;  2R1B A;  3J8F 2;  4UFJ A;  2YY1 A;  2DCJ A;  1RMU 2;  2XJV A;  1O8S A;  1HKD A;  2R06 1;  4LUL A;  5C9A C;  4Q4W 1;  2I07 B;  1JOD A;  3VGI A;  4AR2 A;  3O1P A;  4UFL A;  4JGY A;  1GU3 A;  1S0B A;  5DUU A;  2A6W A;  1CQ9 A;  2Y38 A;  4P14 A;  4GAZ A;  1W6N A;  2XBO 1;  3WDY A;  2XVK A;  1DBN A;  4QPI A;  4UFI A;  3RYP A;  5FQ0 B;  1VRH 3;  2WA4 A;  5A70 A;  2VY0 A;  4P9X A;  4BME A;  5KC6 A;  4DY5 A;  2GC3 A;  3VKF C;  4AQT A;  1YQ2 A;  2C1F A;  3WLU A;  5G05 L;  2EIG A;  4LT5 A;  1X36 A;  2HWD 3;  5GLT A;  4CU9 A;  3N9M A;  4JX0 A;  5CAD A;  2ZAC A;  1DGR A;  1F5F A;  3VBS B;  4GH4 A;  5HV0 A;  4CCK A;  2FDH A;  1NAE A;  2F4P A;  3K4A A;  2GAU A;  2JE7 A;  4YVW B;  3O1S A;  5FLH A;  3U10 A;  3DCQ A;  3VHP A;  3ST7 A;  5CBL A;  5SV5 A;  1GZT A;  1MVE A;  1US3 A;  4QXK A;  1BK0 A;  2MPF A;  4UAP A;  4Y1V A;  3RG0 A;  4CP9 B;  4CDX A;  1BEV 2;  3GDB A;  1DYK A;  3FC0 A;  2ZGM A;  4MH0 E;  1EV1 2;  1H2N A;  1UZW A;  2DCK A;  3NNG A;  4I02 A;  5FZ0 A;  5JDB A;  3PUR A;  4GB3 3;  4E4D X;  4JDM A;  2JJ6 A;  4MUV A;  3ZOI A;  3MFA A;  4GMP 3;  3OCP A;  4XHB A;  5FZ8 A;  1UY0 A;  4IUG A;  1X33 A;  1W99 A;  1Q3E A;  3ETQ A;  3V64 A;  4HAN A;  4P5H A;  4R9B A;  1HB2 A;  3ZDV A;  1W8H A;  2WC2 A;  4IEO A;  3N9N A;  5JCT A;  2RS5 2;  1FI2 A;  1MEC 2;  2H6C A;  3G6J B;  1PNF A;  1Q5O A;  3EO6 A;  3III A;  3I3B A;  4AOC A;  4JTO A;  2VOV A;  2ARB A;  2EAK A;  1HN1 A;  4QQP A;  3VKO A;  1IKQ A;  4L2N A;  4QHB A;  4RSU A;  4XET A;  5DPN A;  1YQ5 A;  1BZW A;  2PQS A;  1OPO A;  2VNV A;  3LIH A;  4XFB A;  4FAG A;  1LKN A;  4XUP A;  1JU3 A;  2VNO A;  3MW4 A;  1OA3 A;  2CGN A;  4YAR A;  2E7Q A;  1ULF A;  4AED C;  4WM8 B;  2I2S A;  2J1V A;  3GNE A;  1AXK A;  4BXF A;  3LFI A;  5BNO C;  1V70 A;  1JHJ A;  2PEL A;  3FJS A;  3ACG A;  3BKZ A;  4B7K A;  1R64 A;  1NYW A;  5A7O A;  1Q56 A;  4QWN A;  3SKJ E;  1G9A A;  2DTY A;  4IE4 A;  4A45 A;  4Q4Y 1;  5LK7 B;  4Y1Z A;  4IEZ A;  4Q4V 1;  2BOJ A;  2IXL A;  4LHL A;  3AYD A;  3MIH A;  4RGA A;  5IYY A;  4K21 A;  1PO2 2;  1OUR A;  2WFF 2;  1N3O A;  4QM8 A;  5J1X A;  2MNG A;  3S57 A;  1X82 A;  5FOJ B;  5APA A;  5ABJ A;  1DDL A;  3INA A;  3T08 A;  1AR7 3;  1ZZ7 A;  2TEP A;  2VJX A;  5C9A B;  4YVS B;  3H50 A;  4QX0 A;  2D40 A;  1XND A;  5LBF A;  5A3L A;  3NO8 A;  4COZ A;  1LEC A;  4ASL A;  5BNP C;  2BGC A;  2BWC A;  4PHZ A;  4L8Q A;  1US2 A;  1YJL A;  3KD4 A;  4FT8 A;  3I3M A;  1C1L A;  1H4H A;  3AC0 A;  3ZPY A;  1Y9M A;  4QDS A;  2J1R A;  1BK1 A;  2PHF A;  3QOP A;  1K45 A;  4QGL A;  3VZK A;  4NR1 A;  5FJK A;  2ZHL A;  2ZHK A;  2ZHM A;  2QKD A;  1O7F A;  3O0V A;  1W0P A;  4UW3 A;  3M8L A;  5F39 A;  4DNY A;  2W92 A;  5IVE A;  4FPF A;  3WIN E;  2EA7 A;  5LAT A;  4D7S A;  2EID A;  4Q26 A;  2JD4 A;  4QPI C;  1G9B A;  2YC2 A;  4M0N A;  3UJO A;  5G04 L;  1LOF A;  4AQ6 A;  1O3R A;  1YQC A;  4S2H A;  3JUU A;  1PO1 3;  4DXS A;  5CG9 A;  1QHD A;  4IE7 A;  3T0B A;  3S7I A;  3AXD A;  1G7Y A;  1H8V A;  1WLT A;  3JD7 1;  5IUQ A;  1QJU 1;  1NCR C;  4LBM A;  1IS4 A;  3MI8 A;  5FP8 A;  2QQM A;  4AW7 A;  2DBI A;  1COV 2;  2DVB A;  2ZEX A;  5JSP A;  4E9K A;  1QJE A;  2C6S A;  2R07 1;  1K5M C;  4BQ2 A;  5J96 B;  2DU0 A;  4TYS A;  2PYT A;  4O61 A;  3HQR A;  1WZX A;  3KF3 A;  3W9A A;  4G3Y C;  4QB6 A;  3VHO A;  3KV9 A;  5GKA C;  4RN5 A;  4XJA A;  1NZI A;  1RUG 3;  4FOQ A;  4LO4 B;  3UJQ A;  3WNK A;  5JUV A;  3K46 A;  4QQL A;  3NV3 A;  1AR7 1;  4Q5O A;  2D6M A;  4WM8 A;  2UU8 A;  4B29 A;  1POV 3;  1VBD 3;  5E88 A;  4CDQ B;  2GP3 A;  3KSC A;  3VZM A;  3EBR A;  4RHV 3;  4DMI A;  3POG A;  4MXV A;  1YQ8 A;  1LB2 A;  1MAC A;  3GXU A;  3K75 B;  1DF0 A;  1ASJ 3;  3RZL A;  2O1Q A;  1B35 A;  2X5I A;  4Y22 A;  4YVS C;  1H9P A;  3POI A;  2A6Y A;  3K48 A;  3O0X A;  2YV8 A;  5BNN C;  4DRV A;  3VBR B;  3POW A;  1UY2 A;  2H6B A;  5BNP B;  5DZF A;  4LKD A;  4L11 A;  4WBB A;  4B4R A;  1S0E A;  5CVR A;  2VMH A;  4MHU A;  5C8C B;  2W52 A;  3H8U A;  4YSF A;  4CXX A;  1NT0 A;  2ZTN A;  3V0B A;  1Q43 A;  1LHV A;  3J7H A;  5HI0 A;  2Q8C A;  1DQ4 A;  4EN8 B;  4YM1 A;  1UYX A;  1QJU 3;  2O8Q A;  4LBN A;  4CA9 A;  2VXJ A;  5BY5 A;  2IXI A;  2LAL A;  3EHK A;  5JXG A;  4CPB D;  3ZKU A;  4YGE A;  5T3N A;  3ZSL A;  4JVA A;  5IHR A;  4RS5 C;  1AL2 3;  3VD5 A;  4MGZ E;  2W1U A;  3R4D B;  4Q0U A;  2Y33 A;  1CON A;  3LQC A;  4KBB A;  1G6N A;  2D5F A;  4CUC A;  3GCX A;  5KHI A;  4XJ9 A;  3PLQ A;  2WLQ A;  3AYC A;  4CEY C;  4BQW A;  2WO7 A;  4HG6 B;  2ZX1 A;  4V2W A;  4BOW A;  5KC5 A;  2E7T A;  3IPV B;  4P9W A;  2AEY A;  4QPI B;  5A3U A;  1QU0 A;  2WAO A;  3S5Q A;  5C3P A;  2VQ0 A;  4WV8 A;  1LOF C;  3MIF A;  2WFP A;  1OUS A;  3S6P A;  4D6Q A;  4JQR A;  1AL2 1;  4FPK A;  1TE1 B;  2PN5 A;  3S30 A;  4BZ4 A;  1VAL A;  4XBQ A;  5IAV A;  4BK5 A;  4CCL A;  4Q0S A;  4IE0 A;  4I3P A;  3RMY A;  4AAX A;  4Q0Q A;  1RXF A;  1RJ7 A;  3DPR C;  1HW5 A;  1MS0 A;  3JBG 2;  2A6Z A;  5CFD A;  5F8P A;  2OII A;  1KFU L;  5FYV A;  1UX6 A;  3AZV A;  5FYZ A;  2BV4 A;  4EWA A;  1ZZ9 A;  1UKG A;  2PAK A;  5IVC A;  2GP5 A;  4XOG A;  2QQV A;  4QT6 A;  2XLF A;  1BQP A;  2RS3 2;  2AEZ A;  2ZX4 A;  3T1M A;  5FP4 A;  3HAG A;  1OVS A;  3ZFE A;  2G9F A;  4GD4 A;  3RQ0 A;  4Q29 A;  1ND3 B;  4GB3 2;  3HWJ A;  4YZ4 A;  2EXK A;  4N53 A;  3V0A B;  5CFC A;  5K8S A;  4XFA A;  2VTF A;  3LB9 A;  4X8N A;  2ARC A;  3N9Q A;  1WW6 A;  2Y6G A;  2Q0A A;  1QJF A;  3VBR A;  5IFP A;  4JTN A;  1Y4W A;  5DAX A;  4XQ4 A;  3VN4 A;  2Q4S A;  1OXC A;  2L9L A;  4OUM A;  3SHR A;  2YB7 A;  4EZ4 A;  2RV9 A;  4AVT A;  4J25 A;  4RR3 A;  5FYB A;  1EY2 A;  2OT7 A;  1RUN A;  2OVU A;  1PZ7 A;  3WF3 A;  1WME A;  3A7Q A;  3HNM A;  4PIX A;  1ZBA 2;  5IAX A;  1KIT A;  2VH9 A;  3NAP A;  3OY8 A;  1V6J A;  3LEM A;  3SEE A;  1OD5 A;  4B1M A;  1H2M A;  2WRA A;  4BB3 A;  2D6K A;  4IV3 A;  4D7T A;  2YZ4 A;  3LEI A;  4LEJ A;  3CIH A;  4DIQ A;  3LGR A;  4ZXE A;  5T5O A;  1RUF 2;  5B4N A;  3KT1 A;  5FPV A;  1Q8S A;  1OC1 A;  3PVB B;  1QF3 A;  5JOW A;  2SLI A;  5DAW A;  2JDM A;  5FYY A;  2VC9 A;  5BXX A;  3NNJ A;  3JU9 A;  5DAP A;  4ZXK A;  2JIG A;  3ZXE A;  2CSG A;  4CU8 A;  2JX9 A;  2HWE 1;  4UF0 B;  2B9U A;  4EN6 B;  1QQP 3;  1OT5 A;  1W6N B;  4E4Z A;  2WO2 A;  1OLQ A;  3BGA A;  3ECQ A;  3JBG 3;  5FXW A;  1LOB A;  5CEH A;  3Q8A A;  2XJT A;  4NHM A;  2CGO A;  3WQ0 A;  3TEZ A;  4XTM A;  3OTF A;  1CX1 A;  5CB7 A;  1SBD A;  2CDP A;  1ST8 A;  1YRZ A;  1UXX X;  3UT0 A;  3UGH A;  2WNO A;  1KS5 A;  2NMN A;  4HK9 A;  2P3Y A;  3AVR A;  2QUO A;  4LBJ A;  2VZP A;  5CU1 A;  2XKO A;  5A7W A;  2ZHN A;  3VKN A;  4AQ2 A;  3SCG A;  4BPZ A;  1HXS 1;  1BJQ A;  4Y1X A;  1POV 0;  1LEM A;  4CDX C;  2DVG A;  4XMA A;  1QNW A;  1SFN A;  2Y0I A;  2OUH A;  1UY1 A;  5DQ0 A;  4B8E A;  1LHW A;  2XR4 A;  3FFZ A;  4BQ3 A;  3GBF A;  2R06 3;  1RUE 2;  3KCY A;  3H1M A;  3TN9 3;  1RIN A;  2BWA A;  4HPK B;  2PLV 3;  5JI7 A;  4EN9 B;  5F37 A;  4Z92 B;  3DGT A;  4RYD A;  1QNY A;  3NKG A;  2R7E B;  1PK6 A;  3VL8 A;  1ND3 C;  1UCX A;  3CO2 A;  4QB1 A;  1S0I A;  1BCX A;  5FY5 A;  1C8M 2;  2EXH A;  2V73 A;  3ZIW A;  3KGL A;  4JGY B;  4ES9 A;  5CFC C;  1QXP A;  2A5Z A;  1T6B X;  2RE9 A;  4Q4W 2;  2K0G A;  4BIF A;  4OHV A;  2OKX A;  3DEM A;  3PTR B;  4JAA A;  2OPK A;  2V5D A;  3ZR6 A;  3USU A;  4CEW C;  1YFX A;  1PO1 2;  1EPZ A;  5FMD A;  2DBN A;  3I59 B;  5IVF A;  2DV9 A;  1UYY A;  3OF1 A;  4BMB A;  3IM0 A;  5FZK A;  5I91 A;  3TEX A;  2YU1 A;  2ZGK A;  3NAP B;  4LIV A;  3OGS A;  1WCU A;  2CV6 A;  5FPB A;  3V65 A;  4CU6 A;  2ET1 A;  1TMF 3;  3WUD A;  1JH5 A;  2ZBJ A;  4AGG A;  1W8U A;  1LOD A;  1WWY A;  3CHX A;  3LSD A;  4WVM A;  3WT3 A;  1VR3 A;  3KWV A;  2HWE 2;  4HL0 A;  4NPM A;  4WVM B;  1NLR A;  4Y26 A;  5DN2 A;  2ARE A;  2E9Q A;  4YRD A;  2D6O X;  1W2A X;  3T2P A;  4ONU A;  1W9Y A;  1X9P A;  2VZU A;  5FY1 A;  4BCU A;  5BNP A;  1OH4 A;  5C8W A;  2DFB A;  1LRH A;  3WNO A;  2RMU 1;  4N7U A;  4Y5S A;  2KA3 A;  5C8C C;  5JOY A;  4F7Z A;  2FDF A;  1W28 A;  2ZGP A;  4OCT A;  3TN9 1;  4W8J A;  5IT6 A;  2ETE A;  2UUR A;  5IWF A;  1R08 2;  4GH4 B;  1DHK B;  4HN0 A;  5BPX A;  5FZ6 A;  2VR4 A;  1AYM 3;  1N1Y A;  1XC6 A;  2V4V A;  4FOV A;  1GR3 A;  4B7E A;  4PIY A;  5HPO A;  2W1S A;  3ZN4 A;  2A3X A;  2R30 A;  3BAL A;  3WNN A;  5C3R A;  2BNO A;  1SBE A;  5FMC A;  2H0V A;  4LNV A;  4P9J A;  4AHX A;  2E53 A;  3F2Z A;  1PVX A;  1NCR A;  1AJO A;  1ZYB A;  4CRQ A;  1PK6 C;  5JR2 A;  4QMA A;  4MGI E;  2DYC A;  2WT0 A;  3TBD A;  1LEN A;  5LCW L;  1FAT A;  1HIX A;  1J1L A;  1Z7S 1;  5FUI A;  4KG8 A;  5CYY A;  1PO2 3;  2CWS A;  2RJL A;  3QLQ A;  1AYM 1;  2HWF 2;  2A73 B;  2RG4 A;  4KU7 A;  4NJ4 A;  1DZQ A;  5IK7 A;  1W3X A;  3C7G A;  2NYY A;  2A70 A;  3ZYR A;  3NRU A;  4FXG B;  5A7N A;  3WSO A;  4A2U A;  1RVF 2;  5EXO A;  4TN7 A;  1H2L A;  1AX0 A;  3BTX A;  3JB4 C;  4RD7 A;  1GAN A;  2WR9 A;  3VLB B;  1CWP A;  5FZE A;  3VBF C;  4HET A;  3LA2 A;  3UGG A;  3DKW A;  3ZSM A;  2RVA A;  2WYS A;  4RQP B;  4RQP A;  3ENR A;  5CAZ A;  4DO0 A;  3E6D A;  3QAC A;  5JZG A;  4GJZ A;  4JHT A;  1PO2 1;  3KS7 A;  5ANN A;  3LDK A;  5GAL A;  1CAU B;  4BIS A;  4CEW B;  1SLL A;  1UMH A;  3POE A;  2P2K A;  1OOP C;  1RHI 3;  3WR0 A;  4ET7 A;  1D7P M;  1RUC 3;  1U5Y A;  1YWK A;  1AYM 2;  2R04 1;  3OGR A;  5ABJ B;  1ACC A;  2WNV C;  1SBF A;  4H2A A;  3U4S A;  4H55 A;  4YZ3 A;  2HEY F;  2VO5 A;  4Y1U A;  1SLI A;  4KL1 A;  5IW0 A;  3IDB B;  5FXX A;  3TOJ A;  3UL2 A;  5LZ6 A;  4HT1 T;  3JZV A;  3WNM A;  4DUX A;  1H6X A;  3V0B B;  3X29 B;  1OD3 A;  4Q1P A;  4NAM A;  1FPN 3;  1X9T A;  1JYI A;  4CP1 A;  2P3J A;  2QZ2 A;  3B7M A;  3N7L A;  4JC1 A;  5ANQ A;  2VCM A;  1D4M 2;  4HVR A;  3WNP A;  4DOU A;  1GYK A;  1HX6 A;  2BVB A;  3THD A;  3UV9 A;  2G1M A;  4FPC A;  1UX7 A;  5L7O B;  3OYW A;  1IPS A;  1RUG 1;  4Z8B A;  3AKQ A;  3PUA A;  1GNH A;  3POB A;  2D6P A;  1F4H A;  1QH6 A;  1RUC 1;  2R04 3;  1GP4 A;  1IS6 A;  4G4F A;  1KS4 A;  2VUA A;  2OZJ A;  4XIL A;  5LA1 A;  1EAH 1;  2A75 A;  1VBD 1;  3ZM8 A;  4O7X A;  3IMM A;  1YEW A;  4AVA A;  3H3L A;  2JDK A;  5D8A A;  4XIK A;  2ZKN A;  3BU7 A;  4AGV A;  1JHN A;  4UI9 L;  4WZC A;  1YIP A;  2VUC A;  3J8F 1;  4IE6 A;  2ZX0 A;  4TLF A;  1JBC A;  2MEV 2;  5A3P A;  2WII B;  1OUX A;  5I0U A;  1RHI 2;  2XXZ A;  4W6Y A;  1H8T B;  4NPR A;  1GWK A;  1QJX 3;  4MSV A;  5F3I A;  3FWE A;  4UFK A;  1YO8 A;  3UKT A;  3W5M A;  1UYP A;  2YHJ A;  4FXK B;  4XCB A;  5ISL A;  4FSJ A;  3POY A;  2ZGN A;  3BPS A;  4R52 A;  3U1X A;  4Y4Y A;  2B5H A;  4NOT A;  4R9C A;  3KZ4 C;  2XDV A;  4EJR A;  4EZH A;  5I8Y A;  3WG4 A;  5IVY A;  3VD7 A;  1S4C A;  1OF3 A;  1VAK A;  2AYH A;  4NRO A;  4P9I A;  1HV1 A;  1BLZ A;  1UOF A;  4O65 A;  4YVW A;  5JSO A;  1PZ9 A;  2CHH A;  5FZD A;  4XDP A;  1U5X A;  1X8E A;  2PLV 2;  2DTW A;  3J8F 3;  4LBK A;  4MO3 M;  5JOZ A;  1UWW A;  2JKX A;  4LBL A;  3WCR A;  1GP6 A;  2ID4 A;  2OPW A;  3CJI B;  3F95 A;  4WVZ A;  4F8A A;  4HSL A;  2ATF A;  3HEI A;  2JIJ A;  5JWP A;  3VZL A;  1UMI A;  1ZZ8 A;  1RTV A;  1AUY A;  3AFK A;  3SH3 A;  2PMW B;  3E5U A;  4WVV A;  4O9E A;  4AVV A;  1RGS A;  4N43 A;  2ZJC A;  4CDQ C;  1JUH A;  3ZXL A;  4FTE A;  3B00 A;  4LO5 B;  1FPN 2;  3MIG A;  3CMG A;  5C6C A;  2D97 A;  1RIT A;  3NL1 A;  1VBE 2;  4HSJ A;  1QIQ A;  1CAW B;  1WLW A;  2ZML A;  1J84 A;  5FLI A;  4OI1 A;  3NWK A;  3RDI A;  3POS A;  4PBO A;  2B4K A;  4XQW A;  2WJS A;  5KXD A;  1XOY A;  3JQX A;  4XW3 A;  5BNN B;  5LEJ A;  4ARY A;  3BOD A;  4HKO A;  2R6Q A;  4D3W A;  2E31 A;  2WNV B;  4LKF A;  4XAA A;  3ILR A;  2J1E A;  4LQR A;  4LOT A;  4OMC A;  4CDW A;  2NPI A;  4XZP A;  5C5T A;  1E5I A;  2Y60 A;  1DLL A;  5GZD A;  4AHZ A;  2EIB A;  2WO1 A;  3KT7 A;  1FOD 2;  1HRI 2;  4D94 A;  5TSW A;  5L7O A;  2VM9 A;  3PNA A;  1R09 3;  2RMU 2;  3U0Z A;  1AYN 1;  4M3C E;  4M0H A;  5D8A C;  5DG1 A;  4CU7 A;  1Y9G A;  1AF9 A;  1T2X A;  2VW0 A;  2Q1M A;  4R4Z A;  5GJ6 A;  1GMM A;  3KB5 A;  2ZKL A;  3B69 A;  3SQO A;  1AX1 A;  2XQR A;  1A3K A;  4BQX A;  4A4A A;  4IL7 A;  2PHW A;  1W8O A;  1SDW A;  4RS5 B;  1NY7 2;  1N1S A;  4S2D A;  4R9A A;  5K9Y A;  5A32 A;  1LHU A;  3VZO A;  3H8X A;  5AVP A;  4TLG A;  5FWE A;  3FLP A;  2PTM A;  4IND A;  3PDQ A;  1BYH A;  2XH6 A;  1M06 G;  4FFF A;  5CKN A;  4DEV A;  1AR9 3;  5EHD A;  2CAV A;  1ZRE A;  4UT5 A;  1UXZ A;  1GUI A;  3GM8 A;  3PTY A;  4IEX A;  5DUW A;  4K8R B;  1JI6 A;  2AUY A;  1RC6 A;  1LTE A;  2HWB 2;  1LGB A;  3MLK A;  2AEN A;  3N9O A;  4JRA A;  1OVP A;  2WSV A;  4XBL A;  5L19 A;  1W2U A;  3UET A;  1G86 A;  4AE2 A;  3R6S A;  2PHR A;  4QHO A;  3PVO A;  1W90 A;  3APB A;  1OFS A;  1W6O B;  2RJK A;  2VZQ A;  4BH9 A;  3RZM A;  5CA6 A;  3AP7 A;  1TME 3;  2DCT A;  2BDR A;  1PIV 1;  1W6Q A;  1W9T A;  2P37 A;  2JXA A;  2RDN A;  3IN9 A;  4N43 C;  2HWD 1;  5FK7 A;  1LOE A;  2ARX A;  1QOO A;  2HH9 A;  3M3E A;  4EV0 A;  4OHW A;  3ILF A;  2WL1 A;  4HMZ A;  4AL9 A;  2IVJ A;  3MV0 1;  4XFI A;  3ZYB A;  5A33 B;  3D6E A;  1QXR A;  4DY3 A;  1GOG A;  4NRP A;  3TEY A;  1MQT A;  1PK6 B;  5KXE A;  5T5L A;  1V6N A;  1KRI A;  1QWR A;  3VD4 A;  5F7U A;  3HQU A;  2ZA9 A;  2BBA A;  5KHH A;  2IVI B;  3RI8 A;  2ZGT A;  5CKM A;  4XFH A;  3NJY A;  2VME A;  3A4U A;  2FMY A;  1VRB A;  2P1B A;  1CVN A;  1ZBE 2;  1AL0 G;  3R4U A;  4CXW A;  1QEX A;  1WCK A;  1RUF 1;  1ULP A;  1M4W A;  3P3N A;  2VOW A;  4ERO A;  1IS3 A;  3KLS A;  3LA3 A;  1D0H A;  1UU5 A;  3AP4 A;  1PZ8 A;  1XPW A;  2NMO A;  4KQ7 A;  3I2K A;  4EYU A;  1NX9 A;  4I01 A;  4CDQ A;  2P6H A;  3LFM A;  2GH8 A;  1KGY A;  1X50 A;  4BU2 A;  5IAT A;  4O9G A;  5DUX A;  1RB8 G;  1MZ6 A;  1HJF A;  1XNT A;  2X29 A;  5FUP A;  2K2S A;  1SDD B;  5CFD C;  2RR1 2;  3CZJ A;  3OEA A;  1ZRR A;  1JYW A;  1A78 A;  4AEM A;  2B7Y A;  3EB7 A;  4CYD A;  5F9T A;  5M0T A;  4QKN A;  4QPG B;  4Y5T A;  5EYX A;  3PL0 A;  1TME 1;  1CAV A;  4QX8 A;  5C8C A;  3VKL A;  1PMH X;  4CDU C;  4Q4V 3;  4BDV B;  3RVH A;  1URX A;  3WDT A;  3ZPO A;  4ARX A;  4HPK A;  2EIE A;  4CCM A; 
#chains in the Genus database with same CATH homology
 5FPA A;  4GJZ A;  4BIS A;  3PU3 A;  3K3O A;  5F37 A;  4D6Q A;  2WWU A;  5FYM A;  4C8D A;  4CCL A;  5FJK A;  2VD7 A;  5FZF A;  5FZ3 A;  3U4S A;  5F39 A;  5IVV A;  5IVE A;  5FY5 A;  5FZH A;  5IW0 A;  5FXX A;  5F5A A;  5FZM A;  5A7P A;  5FYC A;  5FPU A;  5FWE A;  3U78 A;  3AVS A;  4UF0 A;  5FYS A;  5FYV A;  4GAZ A;  2OX0 A;  3PDQ A;  3PTR B;  4HOO A;  4Y3O A;  5FYZ A;  5IVC A;  2GP5 A;  2W2I A;  2OQ7 A;  3KVB A;  5F2S A;  4CSW A;  5ANQ A;  5FPL A;  5IVF A;  4QXB A;  5FP4 A;  4CCJ A;  5FZK A;  4GD4 A;  5FZO B;  5KR7 A;  4IGQ A;  5FZO A;  5FP8 A;  2YU1 A;  5K4L A;  4D6R A;  4LIV A;  4GJY A;  3AL5 A;  5FYU A;  3PUA A;  4NUB A;  5FYT A;  2XML A;  4QX7 A;  3N9O A;  5FY4 A;  3KV5 A;  3N9M A;  5FP3 A;  5FPB A;  3N9Q A;  2PXJ A;  5FZA A;  5F5C A;  3DXU A;  4CCK A;  3AL6 A;  4HON A;  4AI9 A;  5F2W A;  5FZG A;  3KV9 A;  5F32 A;  5A3P A;  2YU2 A;  4EZ4 A;  5IVB A;  5FV3 A;  5FZ4 A;  3PUS A;  2XXZ A;  3OPW A;  5FZB A;  5FY1 A;  5F5I A;  5FYB A;  2OT7 A;  5A80 A;  3KV4 A;  4Y33 A;  5FZC A;  5A7S A;  5F3I A;  5LY2 A;  4V2V A;  5FZ0 A;  3DXT A;  5A3N A;  3PUR A;  3N9L A;  5ISL A;  2YBP A;  2GP3 A;  4QXC A;  4ASK A;  5FBJ A;  5FYH A;  5FJH A;  5FZ8 A;  5IWF A;  2YBS A;  3K3N A;  2OQ6 A;  4CUG A;  5FP7 A;  2XDV A;  5FY7 A;  4EZH A;  5FZ6 A;  2Q8E A;  3N9N A;  5IVJ A;  4QXH A;  5IVY A;  4XDO A;  3NJY A;  4DIQ A;  3LD8 A;  2OS2 A;  1VRB A;  5FPV A;  5FZ7 A;  5FWJ A;  5FZD A;  4XDP A;  5FXZ A;  5FXV A;  5LW9 A;  4AAP A;  5FZ1 A;  5FYY A;  4LXL A;  3OPT A;  3ZLI A;  4D6S A;  5F3G A;  5FZI A;  3N9P A;  5A3W A;  4UF0 B;  5F3C A;  4BXF A;  5FZL A;  4EYU A;  2Q8C A;  5FXW A;  4BU2 A;  4CCO A;  5LWB A;  5CEH A;  3K2O A;  5A1F A;  2YPD A;  5FY8 A;  5FY0 A;  5A7O A;  4IGP A;  4QWN A;  5FYI A;  4Y4R A;  3PUQ A;  5FUP A;  5E6H A;  3AVR A;  5F3E A;  4URA A;  5A7W A;  3KVA A;  4E4H A;  5A7W B;  5FZ9 A;  4IGO A;  5FUN A;  5A7N A;  4LIU A;  2XUE A;  3KV6 A;  5FY9 A;  2P5B A;  4TN7 A;  3PU8 A;  4QU1 A;  3UYJ A;  5A3T A;  4QX8 A;  5FP9 A;  2YBK A;  4DO0 A;  5FZE A;  4V2W A;  5A7Q A;  2Q8D A;  5A1L A;  3LDB A;  3RVH A;  4CCN A;  2WWJ A;  3ZPO A;  4LIT A;  5LY1 A;  4CCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...