4QXCA

Crystal structure of histone demethylase kdm2a-h3k36me2 with nog
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
329
structure length
329
Chain Sequence
b'RTFDLEEKLQTNKYNANFVTFMEGKDFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIEMTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPSTVDFIDWVDNMWPRHLKESQTESTNAILEMQYPKVQKYCLMSVRGCYTDFHVDFGGTSVWYHIHQGGKVFWLIPPTAHNLELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSGWIHAVYTPTDTLVFGGNFLHSFNIPMQLKIYSIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKDFQKESLSMDME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 2A
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/structural protein
total genus 109
structure length 329
sequence length 329
chains with identical sequence C
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4qxcA01
5FP9A 5FZ9A 2Q8EA 4TN7A 5FZOA 4QXHA 4HONA 5FY5A 4QXCA 4V2VA 5A7OA 4EZ4A 5FZGA 4DIQA 4IGOA 3PUAA 3AL5A 5FZBA 2Q8DA 5F3IA 2PXJA 3KVBA 3PURA 5FJKA 5FZMA 5FZDA 5FXWA 5A7WB 5FPVA 2OT7A 4CCLA 5ISLA 5FUNA 2W2IA 5FXVA 4UF0B 3OPTA 4BISA 5F5CA 5FYUA 5FZ7A 3N9PA 2WWUA 2OQ6A 5FYZA 3PTRB 3UYJA 4D6RA 2YU2A 3NJYA 5F2SA 2XXZA 3KVAA 5IVEA 4IGQA 3AL6A 4XDPA 4URAA 5FXZA 5IVJA 2OQ7A 5FYVA 5FP8A 5IVVA 5LW9A 4CCOA 5A3TA 4GAZA 5FYTA 5F5IA 3U4SA 5FY4A 5F2WA 5A3NA 5FYSA 5FZ4A 5FYIA 5F3GA 5A7PA 5LY2A 5ANQA 4LIUA 5FP3A 4LXLA 3K3NA 5FPAA 4AI9A 5FYMA 4CCJA 3DXUA 5FYYA 4DO0A 5FZCA 5FZLA 5F3CA 4D6SA 5FWEA 2OS2A 2XDVA 3RVHA 5A1FA 5FY7A 5KR7A 5FZKA 5FZOB 4AAPA 4BU2A 4QWNA 5F39A 4XDOA 5IW0A 1VRBA 4Y33A 5A3PA 5FY9A 5IVCA 5FZFA 5FZ1A 2GP3A 5FJHA 5FP4A 5FZHA 4BXFA 3LD8A 3OPWA 2YBPA 5A3WA 5F3EA 3KV4A 3PU3A 5FZEA 4EYUA 3KV5A 4D6QA 2XMLA 5LWBA 5FZ0A 3K2OA 3N9NA 5FYHA 3PU8A 3PUQA 5A80A 5F5AA 5IVBA 4HOOA 5CEHA 5E6HA 5FPLA 5FV3A 4CCNA 4CSWA 4Y3OA 5A7SA 4QX7A 4C8DA 3K3OA 4LIVA 3LDBA 5A1LA 5FUPA 3N9QA 3DXTA 4QXBA 5FYCA 5IVYA 5IVFA 3U78A 5FPUA 5F32A 3KV6A 2OX0A 5FWJA 5FZAA 3PDQA 4NUBA 2YBKA 2YPDA 2GP5A 5FZIA 5FZ3A 4ASKA 2XUEA 2WWJA 4GD4A 5FP7A 2VD7A 4QX8A 5A7NA 5F37A 5FY8A 5FBJA 3AVRA 5IWFA 4Y4RA 3AVSA 5FZ6A 2Q8CA 3N9MA 5FY0A 5K4LA 3ZLIA 4CCMA 4CUGA 2P5BA 2YU1A 2YBSA 5A7WA 4LITA 5LY1A 3N9LA 3ZPOA 5FXXA 5A7QA 4EZHA 4UF0A 3PUSA 4GJYA 4GJZA 3N9OA 4CCKA 5FYBA 5FY1A 4V2WA 5FPBA 4E4HA 4IGPA 4QU1A 3KV9A 5FZ8A
chains in the Genus database with same CATH superfamily
5CKMA 5EHDA 2Z2SB 2RJLA 4W4ZA 3I3DA 4MZUA 2RR11 4X8PA 2EXIA 3ELNA 4HL0A 4XF3A 5I0RA 4R8HA 1VMFA 4LK6A 5FZBA 3EMRA 4CCLA 4PLMA 1W8OA 2GSYA 1MS1A 4XUQA 4A7KA 4YFZA 5JSPA 1Q8SA 1UWWA 4MG2A 2YC0A 3VN4A 2BP6A 3LDRA 4FFFA 2V73A 3THDA 2ZGQA 3T3YA 1LOGA 3UGFA 1GOGA 4TYSA 3CZUA 2FCVA 4IEPA 4YVSC 2CU5A 4C0BA 4D3WA 1S1AA 1MACA 4N90A 4YW7A 2XGXA 1YCIA 5JAXA 1IZ3A 5LATA 3AMNA 4H2AA 4AF9A 4A7ZA 5JR2A 3WQ1A 2XJVA 4Z2AA 4J25A 3WVJA 4CDXB 4NO4A 4JTNA 3VUOA 2PAEA 3F2ZA 3W21A 2OQ7A 3H8UA 4XJZA 3E97A 1GZWA 2A71A 4PBOA 5FMOL 3W58A 4R4ZA 1RUJ1 2R49A 4Y22B 4A7YA 3VD3A 5ACA2 1MZFA 2W68A 5F5IA 4GKYA 2CV6A 2BBVA 3ZN5A 1J83A 1JOPA 1QH7A 4FXGB 1S0GA 5FZ4A 2VVFA 3S30A 1GP5A 1XC6A 2W0XA 2YDEA 5EYXA 1Q3EA 2HEWF 1GBGA 1GMMA 2Y6FA 3FBYA 3FHIB 4XFHA 4XTMA 4B8EA 2KXLA 1SLIA 5HXMA 2BBAA 1ULDA 4QQPA 2WNVA 4XILA 1N1TA 4WV8A 1FI2A 3QCWA 3POWA 1EAH2 3O0WA 4AG4A 1DGWA 4AI0A 2J42A 2A75A 5DQ0A 1YI9A 1PIV1 2VH9A 1AYM3 3Q8BA 4Q4X1 1LGNA 4MH0E 4HVRA 3W5NA 1V9U3 2JE8A 1SPPB 4BIOA 1JYIA 3N7MA 4FPKA 1H4GA 4A2UA 1HB4A 4TLGA 3VBUA 3LD8A 3OJBA 3QACA 2J22A 4S2GA 5CYYA 3HAGA 3OPZA 4YGBA 3SC7X 2DVAA 3UKNA 5IFPA 1X7NA 1G9AA 1W3VA 4RGAA 2IXKA 5FZ0A 1R1ZA 5J37A 2WZPP 1RUG3 4CU7A 4MGTA 3HQXA 4QKBA 2ET1A 1FNZA 4EN6B 5A6QA 4META 1IS4A 1W2UA 2LTNA 2Y6GA 1LNSA 1D4M3 2VBPA 1DLLA 1LENA 3LSEA 3LA3A 4AEDA 4AK3A 5GM0A 1O91A 3RS6A 3CKHA 4Z1VA 5C9AC 3CNAA 3EYPA 4M0NA 3V0BB 1ZVFA 3BGAA 4QGMA 3JQXA 1T6GC 5B4XA 1RUE2 2HWD1 4DUVA 2ZACA 3Q8CA 4NIAA 4EWDA 2ZOEB 4YNIA 4RN5A 4M3CF 3VKFC 1DP0A 1LGCA 5I0UA 1KJRA 3AVRA 1EV11 2NYYA 4HSJA 1DQ2A 2VMHA 1NZCA 4L9BA 3WCSA 4CPBD 3VL8A 4QPIB 4GXLA 1G9FA 3NJXA 1SCRA 4GALA 4OHVA 5APAA 1CAVB 1REDA 4BCUA 2QQIA 3INAA 2QE3A 2LROA 1CIYA 5FPBA 4OHZA 5BNOA 4AVSA 4AGGA 2QVSB 4QU1A 3MGUA 1OFSA 4WM8B 4KGGA 3TN93 5FZOA 4MGSA 1S0DA 5HI0A 4YZ4A 1RUH2 4XJ8A 4RR3A 3O0XA 2WNUB 4QPWA 3VBOA 2HWB1 4FTSA 5BY5A 4UW6A 1C5IA 4GB33 4LLOA 4LKEA 3ZFEB 3MW3A 5C3RA 2XJTA 2AH2A 3I7DA 5DDJ1 4UBGA 4C1XA 4DRVA 1JZ4A 3HNYM 2LM3A 4SLIA 5JZGB 2R1BA 1F4AA 3OD0A 4IV1B 4RQPC 4LA2A 1AR61 1JHJA 1LOAA 2VCAA 3KZ4C 3SHRA 3FLTA 1R64A 1UY2A 4C0HA 4PBPA 4PJYA 2GC1A 3KQRA 2BTVC 3E6BA 3BI3A 4M01A 5LBFA 1RUNA 2ZX2A 1FYUA 3KS7A 2D6OX 1KXGA 1RXGA 1T6BX 4LR4A 1GR3A 1WCSA 4NHKA 3SMHA 4BQ4A 1OMIA 4LULA 4NHXA 3RWKX 3CIHA 1QXPA 4LHLA 3LIGA 2CSGA 2WC2A 4QX3A 1VMJA 1H1AA 1VBC3 4Q26A 1V6KA 1TME3 2VE1A 2UWAA 4CCEA 2BPA2 3BTXA 1CESA 4UW4A 2XVGA 2VOKA 4HKOA 3MZHA 5FWEA 3RZZA 2OS2A 2P3YA 3QH7A 5KR7A 1ZZ6A 1XNAA 1YO8A 2CYFA 2TEPA 1VBB2 1NXMA 4MGZE 5CFDC 3GNEA 4A3XA 1CN1A 2X05A 3DKWA 4GMP3 3H3LA 2GP3A 1PGSA 5T54A 1M4WA 1J1LA 1OD3A 1GKBA 1ULFA 2YBPA 3EHKA 3M4FA 2YPJA 3I3QA 3RJ2X 2IFWA 2J1TA 4PF1A 2D7FA 5FZEA 2E51A 3W9AA 1PMHX 4IV3B 1DZTA 1F35A 1UY0A 3J8F1 3FUOA 2XJRA 3G7DA 1IS3A 4XACA 3BPSA 5LZ6A 2ZZJA 1YQ2A 2YZ4A 5CFCB 2G9ZA 2A6XA 1UN1A 1FXZA 5JOXA 1L7QA 3PUQA 1T2XA 4ARXA 1KQRA 1UYPA 5FO7B 2XL7A 3FL7A 2VTXJ 1SLTA 2RMU1 3I59B 3NNFA 4PLNA 4CPBA 3D3AA 4M00A 3VBFB 4JDMA 1NA1B 1LGBA 3NNJA 2QQLA 4Q1RA 4QGNA 5A1LA 1HRV1 2Y0OA 2OZJA 1XB9A 2KR2A 2ERFA 3C7OA 3KV6A 2AEZA 1CX4A 4CP9A 2WFF1 4Q4W1 3VHPA 4XUNA 3RFRA 2R062 5LBBA 5T50A 2BVBA 4CEWC 2RM22 3KSCA 3ZFGC 4ZZ8A 1Q43A 4XF1A 4F83A 1RUC2 1HQLA 3LWCA 2CWSA 1O8SA 3T0DA 5KWRA 2LUWA 3ACIA 4FXKB 1ZBE2 1AR71 1L3JA 2BNOA 1X33A 2YBSA 5GKAC 3WNPA 3I2OA 1ASJ2 2P34A 3P5BA 4YPJA 1K5MA 2XBO1 4AAXA 2ZGUA 2BWCA 2D3PA 4FPLA 2DVFA 2W9XA 3WW2A 3K51A 1P8JA 4IEWA 3MF6A 1NCRC 4AEMA 1C1LA 1KGYA 4OHXA 3ZSKA 4EZ4A 5JSRA 2G1MA 3HWJA 4QDSA 4JDNA 1PVC1 5A7OA 1NLQA 4TXWA 4E4DX 4RHV3 4XFBA 4AYUA 2XJSA 3H7JA 2UYBA 3RRDA 2XLFA 2WAOA 4LEJA 4FTEA 1TMF1 3M2MA 3PL0A 4P9GA 2WLPA 1JTZX 1YYNA 3IT8A 1VAVA 5A3OA 3TBDA 3ZN6B 3V0AB 3UV9A 1LCLA 4LTAA 2BZDA 4FO9A 1HW5A 4CE8A 4JV4A 1OQDA 3UYJA 4D6RA 1PGL2 3VDDA 2A3XA 3KVAA 4IEUA 2WBKA 2E7AA 2X8KA 5HV0A 1AR82 1GNHA 1OD5A 4AVBA 3USUB 2KM2A 1CAXB 3ATGA 3B9CA 4JKMA 3ZKUA 3GGLA 1HRI2 3D6EA 2BW8A 2QQNA 1LEMA 5J09A 5T3NA 4IE4A 1HXS2 2UY8A 2VUAA 1VBE2 4XXPA 5FYIA 2DCKA 3WF1A 1NQJA 2Y0IA 1UIJA 3AZWA 3I8TA 5DUVA 1ZNPA 3GM8A 5GLUA 2W95A 3HNBM 5FYYA 1OKQA 1WA4A 1RUD2 2AYHA 2Y33A 5EV7A 5FR3A 3H42B 3KCYA 1D7PM 4O9GA 1WW6A 3ZYHA 4Q0UA 2V5DA 3WXPA 2QQUA 4QWNA 4XJ9A 1X82A 2BJSA 2NZ9A 3OBTA 2Q4SA 3AJYA 4XFIA 5FUIA 3H9AA 5FZHA 1CVNA 3ZXGA 3CJIA 4ZPIA 4FT8A 1CZTA 4Y1UA 3WP6A 4D69A 5FRAA 4ZKTB 2FDJA 3PU3A 1H4HA 1W99A 2VXRA 1YC61 2XMLA 2VMGA 3LB9A 1QH6A 4DFSA 1QDCA 1OXCA 3IMMA 4AHZA 3ACGA 2IZWA 3TB0A 1WLCA 4KGQA 1JYVA 1PK6A 1QOTA 1E57A 2EAKA 3BALA 4GWJA 5F5AA 1UU6A 4Y4YA 3K4AA 3VDBA 2E7TA 5DAVA 1S0CA 2V72A 1LHUA 1WCDJ 4FOWA 4LIVA 4Q4V3 3ZYIB 4Y26A 4AHWA 3R0RA 3LZZA 2EA7A 2W92A 3DXTA 2CWMA 2V5YA 4KG8A 4AXOA 2ZTNA 3WG1A 3O1PA 4UYBA 1EPWA 1I3HA 4BK5A 2QDNA 3NNGA 2YBKA 4RS5A 2IUWA 3H7YA 4INDA 1PO22 1QOOA 1XNBA 5A7NA 3RWNA 4DRRA 2PHLA 3ZDSA 4Y22A 4QKFA 5E88A 1PZ8A 4KBZA 3VL9A 2WN2A 2IVJA 4PLOA 3ENRA 1XE8A 3AKRA 3HQRA 1RTVA 1Q56A 1ZRIA 3IDCB 1FV2A 1O8PA 5FY1A 4AL9A 4AR2A 4NMIA 4YW2A 2X29A 5LRSA 1OBNA 4KL1A 1LOFA 2VZOA 2JXAA 2MNGA 1ENRA 4S2FA 1FMD2 1M06G 1JI6A 3ZXLA 1WW4A 3IIAA 4R9BA 3ZOIA 4CUBA 3AKQA 1PIV2 3UKVA 2GNBA 4Q4X2 2R30A 4B7EA 1W9YA 3VZJA 3FC0A 4FI9A 4MXWB 5HCBA 1QQP3 1AXYA 4YARA 2OT7A 5D8AA 1LKNA 4A3ZA 4GZ9A 3VBHB 4PDWC 2J1VA 4B29A 4XUTA 2VZSA 5K0UC 4EQVA 2OYZA 3KB5A 5JMCA 4NRPA 3LAGA 3VBRC 2JKXA 1RHI3 2VW1A 1XE7A 3AKSA 4DXRA 4RFRB 2R0FA 5DPNA 3SKVA 3VZKA 2HJIA 4YRDA 1VBD1 1S2BA 1HJGA 2BFUS 1Y9MA 2G9GA 1D2QA 3GZTB 3KM5A 3PVEA 4GAZA 4ZU4A 1RUI3 4E8CA 5I8YA 5JWPA 3GF6A 1N3OA 5EQUA 1K3IA 1OF4A 2F17A 2MEV1 4HETA 1D2SA 4CXXA 2HWD2 1VALA 1UMHA 4H14A 4GWNA 3K4ZA 3KF3A 3IDAA 4E8DA 1BLZA 1AYN3 2JDYA 2W1UA 2DU1A 1MS8A 2QQWA 1EV12 3PVOA 5DZEA 3M3OA 1B35B 1SFPA 4Q4Y3 3C3VA 5CFDB 1AL22 3CEWA 3IN9A 2NN8A 4UOJA 1CAVA 4FFHA 2RS53 1RUE1 2EIGA 1LHVA 3MLJA 5KXCA 4XABA 4BXFA 4B1MA 4CDXC 3OEBA 2DBIA 2P2KA 1WW7A 1CPMA 1F15A 1AR92 2W91A 4CDWA 2WO1A 1LULA 3FJSA 1H2LA 3ZYRA 3RZJA 5FLJA 3ZR6A 4QX1A 1UZVA 1OLMA 4LBQD 3H8XA 3MYXA 4JZRA 1J3PA 1KDKA 1MEC3 5FFOC 3SKJE 4HBNA 1NE4A 5BNPC 4QX2A 2EXKA 2XB6C 1OSGA 5DDJ2 3AZXA 3FZ3A 2OPKA 1S2EA 4QU2A 5JXHA 4AEJA 1H8TA 2RVAA 3C7FA 3O0VA 1W8WA 2VU9A 3NAPB 2E32A 2PAKA 2Y26A 1RUH1 3WHUA 4DUWA 5FMOS 2FDGA 5C3SA 1DYKA 1BYHA 1Z0HA 4G3YC 4S2HA 4ZY9A 1SEFA 4EJRA 3LIHA 4QX8A 3OYWB 2GC2A 2J1AA 3WNKA 4OHYA 2PLV1 4MGIE 3JUUA 5IWFA 3UGHA 4NPMA 2DF7A 2XHKA 5BUVA 5FY0A 5K4LA 5LA1A 5T5PA 1C57A 3G6JB 4CDQB 2YHJA 2VNRA 1F31A 5F5QA 1NCRB 3N9OA 3AYEA 5SV5A 3W20A 3ZYPA 2P17A 1S0FA 4P9XA 2VULA 2A3WA 4P14A 1W6QB 1YQCA 1FPN1 4DNYA 5KHKA 5KXBA 2F4PA 3GXUA 3J7NA 4N43A 1UKRA 4BYYA 4LO5B 3PUAA 1CIWA 3WF4A 1GNZA 5FJKA 1MZ6A 5FXWA 5ISLA 2W94A 3RYPA 2VQUA 3VGIA 4PT6A 5B2GB 2P4EA 2VM9A 1W6NB 4HG6B 3RI8A 1NAEA 4AQ2A 4CXWA 4XYXA 3IIIA 3J8F2 2RS33 1FOD3 3H1MA 1NCQB 3JU9A 1QJX2 1ZRRA 4FP3A 1TE1B 4YW6A 5IAXA 1H0BA 4XTPA 1IOAA 3HPNA 4FAHA 4QPGB 4KQ7A 1CPNA 4QPIC 1DIWA 2F6BA 4YZ2A 1BEV3 1W9WA 2GAUA 5JOYA 3HQUA 3ON7A 2L9LA 3DPRB 4IGQA 3VB9A 5K9YA 1QJY3 4JGZA 5C7GA 2B46X 5FYVA 1HRV2 4H7MA 4XUOA 3SCGA 4NHLA 1G8WA 5A3TA 2VZTA 2WS93 2WFF2 3FLRA 4Q4W2 4WM8C 4CDUB 4A4AA 5K7PA 3VKOA 4OVEA 4QT6A 3B69A 4Q2FA 5ANQA 4LIUA 3AM2A 1L7LA 1RC6A 3O1TA 1D0GA 3E5QA 5G04L 2WNUC 3ZXJA 5FYMA 1MZ5A 3D0SA 1YJLA 2WNEA 2FMDA 1C1FA 2D6MA 5FZCA 3ZFEC 1ND3A 3U10A 4LBQA 2XDVA 5A1FA 3N7JA 5C5UA 3FE5A 2Y6JA 4XE9A 2RDQA 3ZFFB 4KU8A 2JDNA 3FN9A 1AYM1 2BGCA 4XDOA 3WQ7A 5C3QA 5JZGC 1RGSA 4IV1C 5FY9A 2RM21 5FZFA 1NG0A 2AGSA 1W0NA 1W28A 2XG3A 4I30A 1RUC1 4YM0A 2RDRA 1K5JA 4PI2A 3AK0A 3O14A 1YFUA 5KHIA 1OQ1A 2D3RA 2WFPA 4EYUA 2VZRA 4OLLA 5EPAA 3UT0A 3PMSA 2YYOA 2ZKLA 3RPQA 2HEYF 2D98A 1OOPC 4MSVA 4WBBA 2WJSA 5LCWL 2GN7A 3AB0A 1OA3A 1QJU3 4AI8A 3AP4A 4FPFA 4YVSA 3FMGA 5GZEA 3SH3A 2VZ3A 3RZHA 2MPFA 5FPLA 5FV3A 4OMDA 3OF1A 2HBTA 2ZBJA 4AVTA 2Q1MA 1H9PA 1JUIA 2YC2A 1VLNA 2Q8OA 3LPFA 5C4WC 5IATA 5A33A 4K1YA 4K6BA 1F4HA 5CU1A 1JZ3A 5FZIA 2JDPA 4TWTA 4YW1A 1CAXA 5FO8B 3OG2A 2I74A 4JVAA 1H2MA 4JRLA 1YLLA 5DN2A 1WCUA 1ZZ7A 5E89A 5FZ6A 1JYNA 2WINB 4IESA 3E6CC 1F5JA 4IV3C 1A8MA 2VY0A 3CHXA 1PGL1 5JVVA 4IL7A 1I6XA 4RD7A 4ZXEA 5FKCA 4QAWA 5IUQA 3HT2A 4RGGA 4XUPA 4QM8A 4AOCA 5CFCC 5L36A 3RDIA 5JXGA 1AF9A 4BMEA 1DYOA 5IK5A 3NMBA 1AXKA 2IXIA 3KV9A 1ZZ9A 1JOJA 4NR1A 5FZ8A 2BWAA 4FPJA 4XOGA 1HXS1 1NA1C 4QXCA 4V2VA 4YVWC 5C71A 1E5RA 3WHTA 4NIGA 1RYYA 1FATA 1RVF3 1WGPA 3BPZA 1YIPA 4JKLA 3POJA 3GBGA 5A7WB 2HWF3 2EXJA 3ETPA 2ADEA 3ZXEA 3J7LA 1OUSA 3ZKYA 1BHGA 3D82A 1WLTA 3POGA 5F5CA 4YWAA 4ZU5A 3RZGA 2OA2A 3N9PA 1N1SA 2OQ6A 3UESA 3VZMA 3H8RA 1BMV2 2IC1A 2Q1FA 1UZ0A 2B42B 1Q8QA 1RMU2 5C9AA 1V6LA 2WZ8A 4NHMA 1CZSA 1TZOA 2GNTA 2LW8A 4QX0A 3U1XA 5M0TA 4MVTA 1DLCA 1VE0A 3TRSB 5LRRA 2DYCA 3CF6E 1W05A 4NWWA 1I9RA 4P5YA 1PX3A 4JQRA 5ERLA 5J96B 1LRHA 2UYAA 3AXEA 5LASA 1CAUA 3MV01 3OCPA 3OUIA 2DTYA 4OUSA 3AP7A 1TQ5A 2E31A 5FPAA 3QOPA 4XPVA 1TME1 1QF3A 1POV0 2JB8A 2WYSA 5JXIA 5C33A 1CAWB 3S5AA 1RUF2 4HPKA 5D2AA 1MR5A 3BB6A 4COWA 1SLBA 5A6YA 4E4ZA 1SLLA 4KWKA 1CD3G 4OQ8A 4DXSA 3LCPA 1BZWA 3ST7A 4XBNA 4GA9A 3I2FA 1PO21 1BBT3 4GMP1 1HQWA 4WVZA 5E1RA 4P02B 1YHFA 4MLOA 1O4TA 5FPZA 1A8DA 2RDSA 1IG0A 1U5XA 1ODMA 1UPSA 2VUDA 2XH6A 4NAOA 5FK8A 1JN2P 4NOTA 2H6CA 2VMFA 1VBA3 3EB7A 1KFXL 3GZAA 3R4UA 3LFMA 4L99A 3WF3A 3USSA 5BNPB 4P9YA 4MXWA 3S5QA 1RIRA 1VB4A 2R043 4X6RB 3RJRA 4AWDA 1PO13 5F7UA 4H7LA 2W5FA 1EUTA 3VBSB 3BTZA 5FCCA 2VBDA 2XHNA 4RQPA 1R092 4M4PA 5E6HA 1N3QA 4CSWA 5FKBA 4Q5OA 1VRH3 1FMD1 3GDBA 1OF3A 4XXAA 3RGBA 4QHOA 4CP1A 4EN8B 5FYCA 4Q8KA 4OI1A 3GHNA 5FPUA 1HDKA 2D93A 2Y6HA 5FBZA 3MW2A 2YPDA 4OFGA 1UZZA 3T2PA 4MUVA 3MFCA 1W2TA 1EYBA 4K1ZA 1VBD2 3GYDA 2B9UA 3NQHA 2WABA 5A70A 4P08A 5HCFA 1VB2A 2PHDA 1PGW1 3AVSA 4BHPA 4X6QB 4XBQA 3AMPA 1O5LA 3T0AA 3RSJA 3HT1A 5CAZA 1QKQA 2MEV2 4X8NA 1LEDA 5A6ZA 3THCA 3U37A 4OMCA 2NM1A 3AFKA 4JGYB 2IVIB 2QNKA 5CIRA 4ZU7A 3S0MA 2VPVA 2P37A 3POBA 4FAGA 4IERA 4LE4A 5LBEA 1ND2B 4DS0A 2GNMA 2PHTA 1ZM1A 3P3PA 1BQPA 3DEMA 2WO3A 4Q29A 3VLBB 1C3HA 5IJRA 4PHZA 5KC6A 1I5PA 1W0OA 4RHV1 3CL1A 2CTVA 4I0AA 4LBOA 3B9IA 1US3A 4M4RA 1J58A 2RS13 3A0KA 1HV0A 1LU1A 4GH4B 5C8CA 4MX3A 2FCUA 1AL21 5AVAA 2R16A 4XJWA 2GC0A 5CADA 3FHQA 1AHSA 3JBG3 4LE3A 2EAAA 2P3KA 3LFIA 1NYWA 4M0HA 2W08A 1D4VB 1GOFA 4E4SA 4M3CA 4FPYA 1SBDA 1C8M3 4MXVA 3D5OA 1ULGA 1DZRA 1KD7A 3N3HA 2WZR3 4BLIA 1K12A 1AR91 2ORZA 3WF2A 4Z92B 3JQWA 5FP8A 4KNCA 4CEWA 2K9ZA 1JW6A 2YXSA 3IAQA 3M3IA 3UJQA 3ZFGA 1W6MB 3JD73 4W50A 3T08A 1LHNA 4A41A 4ASLA 3NSTA 1Q8PA 2W52A 5FK7A 1G7YA 3S7IA 5A7PA 5LY2A 5FP3A 5L7OB 3NV1A 4JAAA 5F3CA 2VO5A 1KS4A 2PLV2 3S57A 1UYXA 3C7GA 5DG1A 1DYPA 1I1EA 1OH4A 3VBHC 1QHDA 1OKOA 3KHBA 2OUHA 4L11A 5FY7A 5FZKA 2AEYA 3AX4A 2XKPA 4AAPA 1CGPA 4WM7A 3I2HA 3AKTA 4LKDA 5IW0A 4Q27A 2B8MA 2RHPA 3WEZA 4KWUA 1W90A 1XQNA 1W2NA 4EROA 1ZBA3 2VZ1A 4LOTA 1R083 1FPN2 1OOPB 3DYMA 1COV3 1UOGA 2GDFA 2HWC3 1RITA 3BU0A 3AKPA 4LUMA 2MHFA 2GH2A 3N9NA 4DPNA 4JKKA 3GCXA 5C3PA 3TEYA 4LA3A 1IGOA 5GLVA 4QM9A 3ZYBA 1R1A3 2E53A 2J7MA 4HOOA 2IXJA 5A7SA 1W8HA 2QQPA 5C4WB 3I97A 3M8LA 4NRQA 1IQDC 5F6KA 2ZGKA 1JBCA 4K8FA 1JXNA 4AI1A 2ZMLA 3WCRA 3WP5A 4ASMB 3RZKA 1GQPA 1B35C 2JG9C 2RR13 2FBEA 2ZHKA 3MO4A 2V4AA 3PIGA 4NUBA 1MS3A 1Z78A 3KT7A 3WOGA 3KF5A 2I2SA 4XJUA 1KDMA 2ZHMA 2V09A 3AP6A 5FBJA 1ACCA 5A3MA 1WMXA 2DVDA 1QNYA 1JYCA 2Q8CA 2C4XA 1S55A 3HMYA 4B3NA 1QJX1 1JZ8A 1WLWA 4QGLA 1GFF2 2QQKA 2R073 2Y8KA 2YU1A 2Z4FA 4HK8A 4LKSA 5DZFA 3D4KA 3BIEA 4UFLA 4OQ9A 2E63A 1ULPA 1RUOA 4N8MA 3U11A 4UF0A 2WQZC 4ES9A 4GJZA 4LBKA 5FQ0B 4HFSA 3WG2A 1W39A 4V2WA 4N7IA 1K42A 4YVWB 4N53B 2VVDA 4ZS2A 1OC1A 1BK1A 1ZZBA 2TUNA 3KCXA 3OPTA 4UT5A 1NXD1 4OI2A 1VRH2 2X5IC 4HK9A 4TN7A 4HONA 4CXYA 1RUJ3 4Y20B 3OUJA 1DBNA 1AYM2 1GNYA 1IPSA 2JJ6A 3NAPC 5DAWA 3C8XA 2WLQA 3MLLA 1V9U2 1ULOA 5FZMA 2K0GA 2VMIA 2R1DA 2RE9A 1SDWA 2ZEXA 4P9IA 3DCQA 2DCZA 1GWLA 1JODA 3BODA 2ZMKA 4LMFA 2VNGA 3HVDA 2WWUA 3LF7A 1WCQA 4F8AA 4YG6A 3HJRA 5FYZA 2A7AA 3WX5A 1GZ9A 1NY72 1RHI1 2JD4A 1RUG2 1XXNA 2NPIA 3I2DA 4XFGA 4WVMA 4CDQC 1H2KA 1W6PA 1WBFA 2JDZA 2O8QA 2UWCA 5AFBA 5IK8A 1IKPA 1W2AX 3AZVA 3OY8B 1D4M2 1KITA 1X9PA 2ZZQA 3B00A 2I07B 4LQRA 4YG3A 3W5MA 4XCBA 3TEXA 3OUHA 2WRAA 4UWDA 3ITQA 5C70A 5A32A 2B7YA 3U4SA 3LE0A 2AENA 3VBOC 5A3NA 1E5SA 1YFWA 5FYSA 4ATFA 1OH3A 1DQ1A 3I2KA 5CKNA 3K3NA 4R9DA 5FOBB 2VW2A 1AYN1 2PHWA 1V6NA 2VGDA 2WL1A 2YC4A 3UGGA 2WT2A 2DCJA 3EJKA 2E9QA 3N4MA 2VOXA 3LOBA 4L92A 4D94A 2CHHA 4NPLA 3IPVB 2DFCA 2IWGB 1W6OA 4BU2A 1NCQC 3LEKA 4IEYA 1LHOA 2RS51 3LEIA 5A3PA 5DXDA 3ORJA 3H1WA 4XZUG 4QPGC 1UKGA 5IT6A 2OIIA 3RG0A 3OGJA 1U5IA 2J1RA 3DPRC 5HCHA 1N1YA 3MEPA 4H55A 1FV3A 3TN92 4D6QA 1LECA 3WP3A 4LHKA 4BLJA 2AR6A 5FTTC 4PDWA 3T2QA 3UKTA 5K0UA 2I45A 1U12A 4TZDA 2JE9A 2ZABA 5DAXA 4CDUC 1MEC1 5IFTA 3K77A 1QGLA 2Y6KA 1VR3A 4GB32 4IXLA 3VBRA 2PTMA 1MVQA 1ZX5A 3CO2A 2VNOA 2VQ0A 2PA7A 1BCXA 3BTAA 1BKZA 4YZ3A 5IVYA 4AVAA 1LHWA 1W2OA 1AX2A 5FWJA 3TNPB 2XQXA 1LESA 1LJ7A 3PDQA 1APNA 3HOBA 5J1XA 3T4VA 5LB6A 3ZFFC 4ET7A 3ZXAC 1S0JA 3R6SA 1UU4A 1PM7A 2UWBA 2HWB3 1SACA 2Y6LA 5HXVA 3OTFA 3T0BA 4Y4RA 4BQ1A 5KHHA 1BMV1 2J1EA 1ULEA 3ZLIA 4NRMA 5C5TA 5DAQA 4Z82A 5LY1A 1RMU1 1AR63 1VBC2 4IUGA 1TME2 4TLFA 1H2NA 3A4UA 5FYBA 3T1MA 4Z07A 4A6SA 4MO3M 4EV0A 1UCXA 3R05A 2WO7A 4IEXA 2WWSA 1PMJX 4LKFA 5ABJB 2Y38A 1O3SA 5DUWA 1JMUB 3HN1A 4S2DA 2VOVA 1ULCA 1DGRN 4DQAA 5EJ1B 4CDXA 1GP6A 4BA6A 5CKQA 5FLIA 5I8TA 3WP4A 4BQ2A 2X10A 3AZYA 1OT5A 1QEXA 1QIQA 4HVQA 4LT5A 5FPVA 2CGNA 3CU7A 2JDMA 2ZX4A 2RDNA 2WT1A 1JYXA 5FO9B 2BGPA 4HANA 1RUF1 4HKLA 4IE7A 4QXKA 3O1MA 2RS31 1FOD1 1DG6A 1MQTC 1OFNA 5FIXA 2QJVA 3RYKA 4E9KA 2QKDA 2WSUA 3PTRB 2EIEA 2JICA 3E1F1 3WDXA 2YY1A 4HT1T 4DXTA 3HIFA 1LAJA 1BEV1 1PZ7A 1IS6A 3JZVA 4YZ1A 4LORA 5DG2A 1QJY1 5H9SA 3NWKA 1XOYA 3BIWE 4O7XA 5E8AA 1SPPA 4CTEA 3OOXA 2WYFA 4LBNA 4N9HA 3VKLA 2WS91 4XFAA 5F2WA 4ONUA 2H0VA 2P6HA 1Y9QA 1HQNA 4BOWA 2C9AA 1R091 1N1VA 3GBWA 1AJOA 3R4SA 5FMBA 1HX6A 1IS5A 4NN0A 3B7MA 2DU0A 1PGW2 2RMU3 4D6SA 1JZ6A 2FMYA 3A7QA 1SLAA 1WMEA 2XOMA 5BXXA 3WG4A 1XYNA 1QMJA 4Q0QA 3VHOA 3L9JT 1S0BA 2WIIB 2VOTA 4ZS3A 2JECA 1W9FA 2CDOA 2ZGPA 3QLQA 3ZSLA 1OA4A 3N36A 5JDBA 1URXA 4I09A 4GIQA 2D44A 2HEVF 1BVP1 1ENQA 2D97A 3PMEA 3WY6A 1ZA7A 3H8OA 4L0PA 2CGPA 4K9SA 5DZGA 4AVVA 2O14A 3MUZ1 1F2NA 1O4YA 1VAMA 2Q5TA 1XNKA 4B1LA 5I8SA 3V0BA 1XYOA 3WNNA 1QOSA 1QU0A 3E6DA 1ZREA 2JDAA 2BOIA 2WNVB 1CJPA 1DQ4A 3A22A 3NV3A 3OSDA 4LBMA 4UI9L 4RHV2 1JZ5A 3T2TA 1QJU1 1Z7S3 3FBMA 2XBO3 3NRUA 5CEHA 1WZXA 1I5ZA 4XVHA 1ST8A 3AFGA 3DN7A 4C8DA 2JG9B 4LO7A 4QX7A 5BV6A 3WQBA 2C0ZA 1PNFA 4QPIA 3LDBA 1JU4A 5B4NA 4CUAA 3AC0A 3VBUB 2Y60A 1XNTA 3SLIA 4K7JA 2OKXA 1OQEA 3I49A 1PVC3 2CNAA 3OBAA 3MI8A 4AQSA 1SLCA 3MPPG 4HSLA 2XUEA 4YM2A 4AHYA 5F37A 4WM8A 1UIKA 5EIYB 3ES4A 1UYZA 3VD7A 4R52A 3B01A 1TMF3 1F8VA 3V64A 5FMCA 2F4LA 1FNYA 2C1FA 4CCMA 4FFIA 1KS5A 1PK6C 2WNUA 3AMQA 1ZZ8A 3P3NA 4AEDB 1YQ8A 5LA9A 3ZFEA 5BPXA 5A7QA 1YEWA 4BM8A 1G9CA 1U0AA 4XIOA 2WA4A 2X5IB 3VBSC 4E4HA 3UL2A 2FD8A 1SFNA 5JZGA 4MGYE 1CWPA 4IV1A 2WT0A 4XDPA 4ARYA 4C90A 1SCSA 2EF6A 1GV9A 5FP9A 4DY3A 3I3BA 4IE6A 5IAVA 3V56A 2C9KA 5FZGA 2Q1ZB 4AZZA 4L2NA 3GZUC 2YV8A 1QXJA 5EWSA 3H0OA 4OULA 2QCSB 4GQ7A 2HWF1 5FUNA 4KI5M 3BOPA 5L73A 3CJXA 2A6WA 4P00B 2ZGLA 4BISA 3LPGA 5FYUA 1VJ2A 2ADDA 5BNOB 1JYWA 4A6OA 4EN0A 2VAUA 1Y3TA 2WSVA 3QD6A 2VZPA 3O12A 2A1XA 4DMIA 1PHMA 3M7AA 5T5OA 1G9DA 5EXOA 1D0HA 1JH5A 2PQQA 5C4WA 4DINB 1XRUA 2E33A 4QHBA 4JGYC 3ZMNA 2OXBA 3MIEA 3NVCA 4RR3B 4I2OA 1WBLA 3VBOB 1WKYA 4Q4V2 2O1QA 1W8UA 3POFA 1C4RA 3O1UA 2ZXQA 4NWVA 4NIIA 2VJXA 2FHRA 1ND2C 4MGQA 3VZNA 1XJAA 2BNNA 1X36A 1KJLA 5F3GA 4UFMA 2ZPXA 4G4FA 2W1SA 1H8VA 4CCDA 1JYTA 4IV3A 2Z42A 3KCCA 4FOVA 3WNXA 4TSVA 2A3YA 4HN1A 3C7HA 2CAUA 1UXXX 4GH4C 4MGKE 5CFCA 1EUUA 3VHNA 1YNAA 2TBVA 3RI9A 5A3LA 1UY1A 4CEYC 5HBAA 4AHXA 1YXWA 3J7HA 4Y33A 3I59A 3WDUA 2NMNA 3VBFA 4YZ5A 2BERA 3ZYGA 4YVWA 1NA1A 4QD2A 3I4IA 3OPWA 2Z5WA 3ZIWA 3MIHA 4WVWA 3RZMA 1VBA1 3D0JA 4QQLA 3SEEA 5GLZA 3OGVA 2VMDA 1SBEA 4B4QA 4CA9A 1W3XA 2Q30A 3PLQA 1QQP2 1SZBA 3AP9A 3UNPA 3AJZA 5FMDA 1MS4A 1CONA 5ANNA 5L7OC 4R9AA 5A3UA 1VRH1 4FQZA 4RA0A 2PHRA 1REEA 1UMIA 4UFIA 1U5ZA 4C1WA 5ACA3 2GMPA 2ZKNA 2WQ4A 4I3GA 4BDVB 1RHI2 2TNFA 3IDBB 4I01A 5F32A 1V9U1 2FDIA 2YG0A 3IBMA 3MPBA 5FZ3A 1UQXA 5FP7A 4BB3A 4CDWC 1WMDA 1GQGA 4XHXA 4N9IA 2SLIA 2EIDA 3DECA 5FPXA 2OVUA 2YGLA 1GSLA 3K75B 3QH6A 2XJQA 1EAH3 2WN3A 4W6WA 3PVNA 1RUI2 3I3EA 1RB8G 1NY71 4IETA 1RUG1 3MBWA 3SISA 1QXRA 1UZYA 5DUUA 3NJZA 5KXDA 4CP9B 4NPRA 5JLVA 5FAXA 4E2SA 1AYN2 1D4M1 3ZN6A 3V0AA 2ZX1A 4OI4A 3IKWA 2VQTA 1U5YA 3POEA 4Q4Y2 4R4XA 2WR9A 2C26A 3IWZA 4DY5A 5GZCA 2JG8C 3KT4A 3T2OA 1GYKA 4XAAA 2G4IA 2RS52 1O5UA 3N35A 4D7SA 1IG3A 3SCHA 5F3IA 3USUA 5FZDA 5LA2A 3C7EA 2NP0A 2ET7A 2C24A 5L9VA 3F95A 1K5MB 1MQTB 1XNCA 1UXZA 2VCCA 4LLFA 3OB8A 3WQ0A 2BEOA 2D6KA 2YGMA 4KBBA 2QZ3A 4GWIA 1WWYA 5GALA 3B94A 2A70A 3IZOA 3J9SA 4AGRA 3DYOA 4NJ4A 4QPYA 3JBG1 1IPJA 3T09A 5EJZB 3CQOA 3MHZA 4XQWA 3HBZA 4IE0A 3VKNA 5JUVA 3LKJA 1VAKA 3ZYJB 1MEC2 1ZA4A 1H1IA 3LOIA 3RMYA 4A45A 3TN91 2E26A 4B4RA 4N53C 3ZSEA 2VW0A 1J3QA 3OGRA 2DVBA 3ZVXA 3JD71 3HD8B 5FY4A 1JZ7A 4DZGA 2ZEYA 3EQEA 4MOAA 4AQ6A 2J1UA 1IQAA 3N7KA 4FTBA 4AI3A 4GB31 3ASIA 3SCFA 4AI9A 5JIUA 5E16A 5FZLA 1UY3A 1POV3 4XEZA 4LPLA 1QWRA 4PQ9A 1G9BA 5I0TA 3SNMA 1TEIA 2AZ5A 5KBFA 3ZIXA 1AZDA 1W8FA 2GN3A 1Y9GA 5JCTA 3NO8A 4MADA 1RUH3 2FZ1A 3WW3A 2C6SA 1W8ZA 2FQPA 3KD4A 1V6MA 5FP4A 3FWEA 3GALA 3SXWA 1US2A 3NJVA 1CQ9A 4PCRA 2FDHA 4FPEA 1Y4WA 2CAVA 1ZBA1 4FSJA 4YGEA 3WINE 4CVUA 1K45A 1HB1A 2ZAHA 1COV1 2HWC1 3MIFA 1VBC1 2PQSA 1ODNA 5C6CA 3CLPA 4G9SB 4EWAA 1AX0A 5BNNC 5IVBA 1R1A1 4GKXA 2HYKA 1NOVA 1V6JA 2ZCWA 1A3KA 3JB8A 2RS32 1FOD2 3CJIB 3ZX7A 2VZVA 1OVPA 2W3JA 1UOJA 3TOJA 3TEZA 4LO4B 5FZAA 1GU3A 3ZPYA 3ZSMA 1QJEA 3BYWA 2QQVA 4BQ3A 2GP5A 2ID4A 3P1IA 1BEV2 3R4DB 2VC9A 3U07A 4D0QA 1DQ0A 3PJYA 1LOEA 4Q8LA 3VV1A 1IPKA 1PK6B 1QJY2 3J7MA 5KXEA 1FX5A 1J1TA 4F3JA 1O6UA 4XETA 3HR9A 1X8EA 3WNMA 5KHGA 4LO8A 4XFCA 3B02A 1NX9A 2R071 2WS92 5FREA 5FDBA 1VBB3 1MZEA 3LSDA 5EZWA 2QQOA 2XLGA 3A23A 4RFT0 4Y24A 1F9KA 3VBHA 4DUXA 3O1SA 1CX1A 1OURA 4CP2A 3JXSA 3M3CA 1A34A 1O59A 4RS5B 1CZVA 4XZPA 4BMBA 4NHYA 5I93A 2UY9A 4ORFA 1Y43B 2YB7A 5EYYA 2GALA 3POSA 4HZFA 5GJ6A 1YI7A 4XQ4A 1XSQA 4XJAA 3V65A 2XVLA 1DF0A 1VMHA 2PXJA 3OBZA 3LEGA 3PURA 4MHUA 3EXUA 3FFQA 5JXJA 1LB2A 4WZFA 3BTYA 4L97A 4XQDA 4AGVA 2W39A 4YFWA 2VZQA 4J1WA 4OCTA 1ENSA 4FOYA 3NV2A 1UW8A 3DYPA 1UU5A 4CU6A 2WKKA 1ZRDA 1QJU2 1QY4A 2R063 2A5ZA 2HWE3 2D6PA 5L9RA 4CP0A 5IK7A 2RM23 2JG9A 1B35A 4QMAA 4PQQA 5CFDA 4COZA 4ZXKA 4FOQA 4I02A 3OBRA 1RUC3 4QDQA 4URAA 4F7ZA 1OHFA 5D8AB 4BQ5A 4BIFA 5ABJC 1ZBE3 1NUKA 1UX6A 5AVPA 4J1XA 1ASJ3 3ALQA 4XF4A 4AQTA 2AACA 4XHBA 3ABZA 5SV8A 3MLKA 2NQYA 1UOFA 1YRZA 4BH9A 4DO0A 4JDOA 2VMEA 1V6IA 2NMOA 4CEYB 1YQ6A 3VD5A 2OZ6A 4Z8BA 2IXHA 1QJZA 4QHZA 1KEXA 2WZEA 4UW3A 2J1SA 1O3QA 4XMIA 3GJBA 2X5IA 4KMQA 3CDZB 5FZ1A 3HEIA 4ZZ5A 3AYCA 1OLME 5KHJA 3NAPA 2VXJA 5F3EA 2XR4A 3KV4A 4YW4A 3APBA 2VOWA 2XONA 4HLTA 3FX3A 5JOZA 1H6YA 5GZFA 4PF5A 1STMA 5DABA 1UO9A 2R6QA 1OI6A 4OI0A 3B3QE 1VPHA 3K2OA 3MFAA 1RVF2 3OYWA 3NV4A 3PU8A 4LHSA 5A80A 2HWF2 1TG7A 1QDOA 3IM0A 1AR83 2GZWA 1RJ7A 3K3OA 2R7EB 1O3RA 4CDQA 2EXHA 4JTOA 1S0EA 1DU3D 5FUPA 5AC93 2FCTA 1HRI3 2EIBA 3CBNA 1UYYA 3M1HA 1NCRA 1HXS3 1MS0A 1WMFA 1WW5A 2JDKA 3NNMA 4CDWB 1VBE3 4Q0SA 4R9CA 3WDVA 2Q0AA 1W6QA 3HNMA 5LEJA 4EE2A 2BGOA 5CISA 3BCWA 1HKDA 4K20A 3S6PA 1AVBA 2AUYA 2D5FA 3ZMOA 1V70A 1RUD3 2QFEA 3SITA 2WQ8A 3N9MA 1S0IA 2RV9A 1W04A 3OEAA 1H8TB 1IHMA 2W1QA 3N9LA 2WNVC 1AXZA 2A6VA 1W03A 3NKTA 1W6NA 3L2YA 1WD4A 1JZ2A 1J59A 4MHRA 5J98B 3JB4C 1NCQA 3MW4A 4Q4V1 1HB3A 2JG8B 4IGPA 4XC9A 3W59A 3KLSA 2Q8EA 4COVA 2O8OA 4QPGA 2H6BA 5JR7B 2VUCA 5CG8A 3VBUC 2JB4A 1G6NA 1OVSA 1UD1A 4BJ0A 3LEMA 5JOWA 2XKOA 3DPRA 4IEOA 3KVBA 1BBT2 4UFHA 3SH5A 3RQ0A 3MIGA 2ZGSA 2XPJA 2ZGOA 4P9JA 4XAEA 3WDYA 4BQWA 3VDAA 4FPCA 1UF2C 4DEQA 2P3JA 4SBVA 1FAYA 4CDUA 1VBA2 2B9VA 1PX4A 1LU2A 1X50A 2DCYA 3K4DA 2YMZA 3Q8EA 4D7TA 2R042 3M3EA 1PO12 2YU2A 4AEDC 3NJYA 3UK9A 5H9QA 3I3MA 5T5LA 4N43B 1PO23 3Q8AA 3Q8FA 2V4VA 3WF0A 3BN6A 5L9BA 4RL7A 4CYDA 1UY4A 5AFEA 1SDDB 4RYDA 1YUDA 2EICA 5CVRA 3U75A 1Q5OA 3ZFFA 2C5DA 1O3TA 3S7EA 3KMHA 5GLTA 4W65A 4FVVA 1GOHA 1L7RA 3IAPA 3AMHA 3PVBB 1NKGA 2DUQA 3ECQA 1WD3A 1QQP1 4KU7A 4PIZA 5C8CC 1KRIA 2DBNA 4LXLA 3OGGA 1C28A 1O7FA 2YROA 4XMAA 2QQMA 5F8PA 2BYVE 2ARXA 3O5SA 3VHRA 5CB7A 1X8MA 2ES3A 1FMD3 3SH4A 1JUHA 2P6CA 4JGZB 1XU2A 1PIV3 1XU1A 4Q4X3 5BNOC 4GMP0 5F39A 2VQAA 5IVCA 3I2JA 3ZXKA 4AFBA 5IYYA 2ZS6B 2XJPA 2PHXA 2LS6A 1FT9A 2HWE2 3ES1A 3J26N 3LDKA 4UAPA 4URTA 5A3WA 4K8RB 2KD7A 1DGWX 1HLCA 3U0ZA 1RUI1 3IDEA 4RR3C 3VKMA 2QDRA 3PNAA 3PIJA 5BNNB 1B09A 1A78A 3ILFA 1ND3B 5D21A 2JENA 3MDPA 2RJ2A 4LBQB 5J3UA 2XLAA 2WAAA 4XF0A 3UJOA 1Z7S1 1MQTA 2VZUA 3UETA 2RS12 4Y5SA 1E5IA 1OLRA 3ZM8A 1V00A 1PMIA 1ZRFA 4YW5A 4Q4Y1 4WM7C 4QB6A 4A44A 3JBG2 5IVFA 1V0AA 1YWKA 1O4ZA 2ZGRA 3VDCA 1DDLA 2K46A 1E5HA 4PI0A 3TAYA 3BVCA 2HWD3 1A6CA 4GWMA 3BKZA 1ZRCA 2VBBA 1C8M2 2W1WA 1GLHA 4GD4A 4H3WA 4XIKA 1YQ5A 5EP9A 2WZR2 4U36A 2DCTA 3C2UA 4YVSB 1EV13 2VECA 5F6LB 2YUEA 2B39A 1AL23 3A0NA 3D8CA 3FFZA 3WNLA 3JD72 3THPA 2A73B 4UFJA 5A7WA 3NNLA 1GZTA 4ISQA 4K40A 3DV8A 5IK4A 1S4CA 3T4HB 5FXXA 4LJHA 2BNMA 2OPWA 2QUOA 4OUMA 2JDHA 5A33B 4JHZA 1NZIA 3MF9A 3O7OA 4K3UA 4MV2A 2JKBA 4Q0VA 4OZXA 5EFUA 2VVEA 4WVVA 1LOBA 1AR93 3O1OA 3ZR5A 4BE3A 4E2GA 5AC92 2A6YA 4IEQA 1C8NA 3L2HA 5JPNB 2GMMA 3CMGA 1C5HA 2OW4A 2VMCA 2DFBA 2VTXA 2JD9A 3B93A 2Q8DA 1XNDA 1JOBA 5KC5A 3FUQA 4AVCA 1BJQA 2XWBB 1Q8OA 4JC1A 4D8MA 1PVXA 2ZGTA 3NW4A 1CR7A 1ZBA2 4Y1XA 5DDJ3 1R082 4QQOA 4I3PA 4AFMA 2ARCA 4QB1A 2BOJA 2PAMA 4ISRA 1COV2 3WDTA 5GZGA 2HWC2 4BZ4A 4NVPA 4RSUA 1WLDA 4AE2A 2N7GA 2Y34A 2Z69A 2CL2A 1R1A2 1BK0A 1SMVA 3SEPA 5DAPA 1CAWA 1W8TA 3ILRA 3AL6A 5JPMB 1GWMA 4W8JA 5IVJA 2FZ2A 2QBXA 1MS5A 2E6VA 3AMMA 3VZLA 5IVVA 2BQPA 2QQJA 4HVOA 3WG3A 1J3RA 1WA6X 2PN5A 3DL3A 2JEMA 4HKWA 1AX1A 5FYTA 4Z2WA 2G19A 2RR12 2CDPA 4AFDA 5LEKA 1N47A 3PHMA 4YGCA 4JCKA 3H1YA 1GICA 3X29B 3THTA 5C3OA 4XDQA 4E2QA 3E5XA 2FDKA 1DCSA 3BU7A 4P5HA 3DXUA 5CZKA 4CCJA 4DB5A 4YSFA 3PUHA 5BNPA 5C9AB 5I0SA 1K5MC 4WZCA 2D40A 2ETEA 2X53S 1YJKA 4QQHA 1DGLA 2R072 3VBSA 4QKDA 4MYEA 4C91A 1XE0A 2VG9A 1HIXA 4IEVA 1CAUB 2VUJA 3GJAA 1EP0A 1EPZA 2DUPA 4DEVA 4AFAA 2GNDA 3AYDA 1SQ4A 4I0BA 4LNVA 4YLZA 5C8WA 1H30A 3J8F3 3KV5A 3GBFA 2PMWB 1RUJ2 4CCCA 5K8SA 3K48A 1QJX3 2BVVA 1VIWB 3I54A 4AI2A 5FYHA 2ZA9A 1GUIA 4HPKB 4W6XA 2DV9A 2ZAAA 2ZEWA 4XURA 4PIXA 1OLQA 2ILMA 1SFYA 4CU9A 3WW1A 2K2SA 4CCNA 5JMOA 4ATEA 4Y1VA 1RINA 5CBLA 4LUKA 3VDDC 3TYJA 1HRV3 4KH9A 2GC3A 3Q9OA 5G05L 1GZWB 5ACA1 4JGYA 3TEWA 2WFF3 2DTWA 4JRAA 4Q4W3 2XQRA 1H6XA 3OGSA 4EWEA 3ZSJA 3DGTA 2VNVA 3U14A 1NE6A 1W9SA 2HYXA 2ORXA 1OA2A 3WUCA 3WSOA 1ND2A 1HN1A 1Y7BA 5L19A 1S2KA 2EVXA 2HH9A 3J4UH 4O65A 4P9WA 3KQ4B 3ZYFA 1W9TA 2ZMNA 4RQPB 4UBHA 4NROA 3WW4A 2O0OA 3ZDVA 4DXZA 1EAH1 1AR73 2XUMA 5LK5A 2W87A 5A6XA 2P5BA 2QZ2A 3ILNA 3WT3A 3U4XA 4EZHA 4GH4A 4JX0A 1DGRA 3PUSA 5BNQA 2IXLA 1ALYA 1TVGA 2CGOA 4CCKA 2GMEA 4CU8A 4Q0PA 3TNQA 4XF9A 2GH8A 3ACLA 1JS9A 4CEYA 4ZHNA 3A21A 4ZONA 4AFCA 5FZ9A 2PELA 4QXHA 4BQYA 1N3PA 3CJIC 1TNRA 2DVGA 4DIQA 1JU3A 2ZHNA 4YM3A 1HB2A 3H3UA 1GP4A 4J6GA 1SHWB 1VP6A 3PUIA 1RJ8A 2HKXA 4Y5TA 2E7QA 3IMNA 1W6MA 4YW3A 4M3CE 2BU9A 3ACFA 1DFQA 5EJ3A 1UNBA 4B4PA 4FPHA 5FZ7A 5H9PA 4CZSA 2UU8A 3HBKA 3MIBA 4IEZA 1MS9A 5L7OA 5I91A 2JE7A 4QDRA 2D3SA 2VTFA 4N7UA 5T55A 4BPZA 5GLWA 5IVEA 1YFXA 2B45X 2ZEZA 4B7KA 1GWKA 4LBJA 3ROUA 4CUCA 2R0HA 5TSWA 5LW9A 1ZYBA 3JCIA 1LODA 4RS5C 4CCOA 5J7MA 2Y64A 5C8CB 1UMZA 1RVF1 4FFGA 4LBLA 2HBUA 5GZDA 1OOPA 3O1RA 4TTGA 2HWB2 4Q1PA 5T52A 5I0DA 1CJDA 3T30A 4M3CB 2D6LX 1OUXA 2ARAA 1NLRA 1POV1 3H3ZA 3KGZA 3SQOA 5DUXA 3RVHA 2D6NA 1J84A 1QNWA 5FZOB 3WLUA 3CZJA 4CEWB 3VD4A 3WR0A 4P9LA 1AR62 2VL4A 3GCWA 1LOFC 1VRBA 2EALA 3NKGA 1POQA 4I0WB 3ZFGB 1ONAA 5FJHA 1V6OA 2WNOA 3ETQA 1G86A 2JG8A 3N7LA 3TWIA 4O9EA 5CNAA 1DQ6A 4NAMA 5J48A 2BDRA 3H50A 3P6BA 4PIYA 5H9RA 2ZHLA 4KWLA 5JSOA 3RNSA 2WO2A 4KWJA 1H9WA 3PTYA 5D8AC 3DKQA 3URFA 1DZQA 3I2IA 3GZEA 4U2AA 2ZGMA 1DQ5A 3RZLA 3FLPA 1LTEA 1RMU3 3ZXFA 3NL1A 3ACHA 4IQPA 4K21A 4WM7B 2XVKA 3PJQA 4YG0A 1EY2A 4Y3OA 5JI9A 4RGKA 3POIA 2YFZA 5CG9A 3MIDA 3BUCA 2JWPA 1YIFA 3N9QA 4QXBA 4EN9B 1RL3A 4UW5A 1AJKA 1W0PA 3AZZA 5FQ0A 2OX0A 1BBT1 4NE9A 4N53A 2W46A 1PNGA 4HN0A 2RG4A 2WWJA 3QBQA 3M3QA 2VD7A 5FLHA 1GANA 5LK7B 1SBFA 1HJFA 4IE5A 5FY8A 4D7YA 4Y20A 4AW7A 1WUVA 2JIJA 1RUF3 2ZGNA 3KWVA 1LOCA 4CUGA 4YM1A 3E5UA 2D43A 1TNFA 2R041 4XFFA 4FPGA 1PO11 4NIHA 4YYOA 1VBB1 3ZPOA 4COYA 4O61A 1PM4A 3MICA 2ZX3A 4GJYA 1H1MA 2VR4A 1PZ9A 3LA7A 3GHMA 2WUHA 4XW3A 2JIGA 5JI7A 2IFRA 2QTWB 2P3IA 2RMU2 5T5JA 3VZOA 2B4KA 5IHRA 2LRPA 2W47A 1ENXA 4QQ2A 5FY5A 5LBCA 1BVVA 1UX7A 3FHAA 4IW3A 3WV6A 2PYTA 3WZ1A 4IGOA 5FOJB 2DUOA 3OY8A 3AL5A 1X9TA 4EN7B 1R093 1DHKB 2W2IA 5FXVA 4BK4A 2ZJCA 4UF0B 4CRQA 5BYNA 5F1RA 4IDZA 2WDBA 3ZXDA 1MPXA 2P1BA 5BNNA 3LA2A 1XYPA 2DWRA 2FDFA 3B5LB 3VD9A 3EBRA 1AR72 3RYRA 3ZO0B 1XPWA 2CY6A 1Z7S2 5HCAA 3KGLA 3AP5A 1H8TC 2XXZA 2R061 5F2SA 2HWE1 4HXCA 2XBO2 3LGRA 1NLSA 2XL9A 1XBFA 4E27A 1VBD3 2LALA 3IPVA 1HV1A 5FXZA 5JIAA 3ZN4A 1AL0G 4FBFA 3MV11 4OHWA 4OUEA 5A1AA 4Y1YA 1GZCA 4LK7A 2RJKA 1ZBE1 4AEKA 2HLEA 3T1LA 2BV4A 1PVC2 1MVEA 2MEV3 1ASJ1 4FCAA 1XSRA 4UXAA 3OD4A 2JX9A 5LA0A 1JHNA 2RS11 1ZZCA 2B5HA 2ATFA 2D5HA 3DF0A 4QKNA 2XWJB 4WVMB 4LHNA 1W6PB 3KHCA 5F9TA 1TMF2 2AREA 3WD5A 1BXHA 2A6ZA 1WCKA 1RXFA 2AC1A 4BQXA 4COUA 1LR5A 1KFUL 2ZX0A 4ITCA 4Y1ZA 2UURA 1RUE3 4Y5Z0 3WDWA 4XCAA 5A32B 4V1PA 5HV4A 5J36A 1C8M1 1Q8VA 2IXCA 4HMZA 2PHUA 4GULA 2WZR1 2XJUA 1SG3A 3HN3A 4N43C 4FP2A 5HPOA 4QB2A 2SBAA 2NLRA 2ENRA 3BOWA 4L8QA 2H0BA 5LWBA 2R32A 4W6YA 2PHFA 5DMYA 4FQ4A 1UZWA 1IKQA 1UPIA 2BUKA 2YFUA 4OZOA 4LOSA 3K46A 5D1IA 3VDDB 1NQDA 1W6OB 2PFWA 2BRTA 4DOUA 1AR81 2WA3A 3DUIA 4BXSV 3LQCA 1UOBA 3M70A 5AC91 1HRI1 1NT0A 2Z79A 3EO6A 4XBLA 1W06A 2G9FA 3KT1A 3U78A 3VBFC 3I2GA 4LO6B 4YGDA 3RMXA 2VCBA 4ES8A 1VBE1 3ME2A 4JGZC 2DDUA 2BFUL 3MUY1 1OPMA 5ABJA 2JDUA 1UL9A 2VCMA 3AXDA 4PDWB 4ASKA 3POYA 1AUYA 3AYAA 1UAIA 1R081 4KG0A 1F5FA 5K0UB 4NIDA 1REFA 2PLV3 2KA3A 1RUD1 4FPOB 3O1VA 2GU9A 3VBRB 1HN0A 2DURA 4QX5A 3WUDA 4UFKA 4A42A 4OYUA 4LITA 3WNOA 5CA6A 1OPOA 2X09A 1ND3C 4JQTA 1YFYA 2ARBA 1GQHA 2OUJA 3IB3A 1QJFA 4JHTA 4BWOA 1FPN3 1W8NA
chains in the Genus database with same CATH topology
5FP9A 5FZ9A 2Q8EA 4TN7A 5FZOA 4QXHA 4HONA 5FY5A 4QXCA 4V2VA 5A7OA 4EZ4A 5FZGA 4DIQA 4IGOA 3PUAA 3AL5A 5FZBA 2Q8DA 5F3IA 2PXJA 3KVBA 3PURA 5FJKA 5FZMA 5FZDA 5FXWA 5A7WB 5FPVA 2OT7A 4CCLA 5ISLA 5FUNA 2W2IA 5FXVA 4UF0B 3OPTA 4BISA 5F5CA 5FYUA 5FZ7A 3N9PA 2WWUA 2OQ6A 5FYZA 3PTRB 3UYJA 4D6RA 2YU2A 3NJYA 5F2SA 2XXZA 3KVAA 5IVEA 4IGQA 3AL6A 4XDPA 4URAA 5FXZA 5IVJA 2OQ7A 5FYVA 5FP8A 5IVVA 5LW9A 4CCOA 5A3TA 4GAZA 5FYTA 5F5IA 3U4SA 5FY4A 5F2WA 5A3NA 5FYSA 5FZ4A 5FYIA 5F3GA 5A7PA 5LY2A 5ANQA 4LIUA 5FP3A 4LXLA 3K3NA 5FPAA 4AI9A 5FYMA 4CCJA 3DXUA 5FYYA 4DO0A 5FZCA 5FZLA 5F3CA 4D6SA 5FWEA 2OS2A 2XDVA 3RVHA 5A1FA 5FY7A 5KR7A 5FZKA 5FZOB 4AAPA 4BU2A 4QWNA 5F39A 4XDOA 5IW0A 1VRBA 4Y33A 5A3PA 5FY9A 5IVCA 5FZFA 5FZ1A 2GP3A 5FJHA 5FP4A 5FZHA 4BXFA 3LD8A 3OPWA 2YBPA 5A3WA 5F3EA 3KV4A 3PU3A 5FZEA 4EYUA 3KV5A 4D6QA 2XMLA 5LWBA 5FZ0A 3K2OA 3N9NA 5FYHA 3PU8A 3PUQA 5A80A 5F5AA 5IVBA 4HOOA 5CEHA 5E6HA 5FPLA 5FV3A 4CCNA 4CSWA 4Y3OA 5A7SA 4QX7A 4C8DA 3K3OA 4LIVA 3LDBA 5A1LA 5FUPA 3N9QA 3DXTA 4QXBA 5FYCA 5IVYA 5IVFA 3U78A 5FPUA 5F32A 3KV6A 2OX0A 5FWJA 5FZAA 3PDQA 4NUBA 2YBKA 2YPDA 2GP5A 5FZIA 5FZ3A 4ASKA 2XUEA 2WWJA 4GD4A 5FP7A 2VD7A 4QX8A 5A7NA 5F37A 5FY8A 5FBJA 3AVRA 5IWFA 4Y4RA 3AVSA 5FZ6A 2Q8CA 3N9MA 5FY0A 5K4LA 3ZLIA 4CCMA 4CUGA 2P5BA 2YU1A 2YBSA 5A7WA 4LITA 5LY1A 3N9LA 3ZPOA 5FXXA 5A7QA 4EZHA 4UF0A 3PUSA 4GJYA 4GJZA 3N9OA 4CCKA 5FYBA 5FY1A 4V2WA 5FPBA 4E4HA 4IGPA 4QU1A 3KV9A 5FZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FP9 A;  5FZ9 A;  2Q8E A;  4TN7 A;  5FZO A;  4QXH A;  4HON A;  5FY5 A;  4QXC A;  4V2V A;  5A7O A;  4EZ4 A;  5FZG A;  4DIQ A;  4IGO A;  3PUA A;  3AL5 A;  5FZB A;  2Q8D A;  5F3I A;  2PXJ A;  3KVB A;  3PUR A;  5FJK A;  5FZM A;  5FZD A;  5FXW A;  5A7W B;  5FPV A;  2OT7 A;  4CCL A;  5ISL A;  5FUN A;  2W2I A;  5FXV A;  4UF0 B;  3OPT A;  4BIS A;  5F5C A;  5FYU A;  5FZ7 A;  3N9P A;  2WWU A;  2OQ6 A;  5FYZ A;  3PTR B;  3UYJ A;  4D6R A;  2YU2 A;  3NJY A;  5F2S A;  2XXZ A;  3KVA A;  5IVE A;  4IGQ A;  3AL6 A;  4XDP A;  4URA A;  5FXZ A;  5IVJ A;  2OQ7 A;  5FYV A;  5FP8 A;  5IVV A;  5LW9 A;  4CCO A;  5A3T A;  4GAZ A;  5FYT A;  5F5I A;  3U4S A;  5FY4 A;  5F2W A;  5A3N A;  5FYS A;  5FZ4 A;  5FYI A;  5F3G A;  5A7P A;  5LY2 A;  5ANQ A;  4LIU A;  5FP3 A;  4LXL A;  3K3N A;  5FPA A;  4AI9 A;  5FYM A;  4CCJ A;  3DXU A;  5FYY A;  4DO0 A;  5FZC A;  5FZL A;  5F3C A;  4D6S A;  5FWE A;  2OS2 A;  2XDV A;  3RVH A;  5A1F A;  5FY7 A;  5KR7 A;  5FZK A;  5FZO B;  4AAP A;  4BU2 A;  4QWN A;  5F39 A;  4XDO A;  5IW0 A;  1VRB A;  4Y33 A;  5A3P A;  5FY9 A;  5IVC A;  5FZF A;  5FZ1 A;  2GP3 A;  5FJH A;  5FP4 A;  5FZH A;  4BXF A;  3LD8 A;  3OPW A;  2YBP A;  5A3W A;  5F3E A;  3KV4 A;  3PU3 A;  5FZE A;  4EYU A;  3KV5 A;  4D6Q A;  2XML A;  5LWB A;  5FZ0 A;  3K2O A;  3N9N A;  5FYH A;  3PU8 A;  3PUQ A;  5A80 A;  5F5A A;  5IVB A;  4HOO A;  5CEH A;  5E6H A;  5FPL A;  5FV3 A;  4CCN A;  4CSW A;  4Y3O A;  5A7S A;  4QX7 A;  4C8D A;  3K3O A;  4LIV A;  3LDB A;  5A1L A;  5FUP A;  3N9Q A;  3DXT A;  4QXB A;  5FYC A;  5IVY A;  5IVF A;  3U78 A;  5FPU A;  5F32 A;  3KV6 A;  2OX0 A;  5FWJ A;  5FZA A;  3PDQ A;  4NUB A;  2YBK A;  2YPD A;  2GP5 A;  5FZI A;  5FZ3 A;  4ASK A;  2XUE A;  2WWJ A;  4GD4 A;  5FP7 A;  2VD7 A;  4QX8 A;  5A7N A;  5F37 A;  5FY8 A;  5FBJ A;  3AVR A;  5IWF A;  4Y4R A;  3AVS A;  5FZ6 A;  2Q8C A;  3N9M A;  5FY0 A;  5K4L A;  3ZLI A;  4CCM A;  4CUG A;  2P5B A;  2YU1 A;  2YBS A;  5A7W A;  4LIT A;  5LY1 A;  3N9L A;  3ZPO A;  5FXX A;  5A7Q A;  4EZH A;  4UF0 A;  3PUS A;  4GJY A;  4GJZ A;  3N9O A;  4CCK A;  5FYB A;  5FY1 A;  4V2W A;  5FPB A;  4E4H A;  4IGP A;  4QU1 A;  3KV9 A;  5FZ8 A; 
#chains in the Genus database with same CATH topology
 5CKM A;  5EHD A;  2Z2S B;  2RJL A;  4W4Z A;  3I3D A;  4MZU A;  2RR1 1;  4X8P A;  2EXI A;  3ELN A;  4HL0 A;  4XF3 A;  5I0R A;  4R8H A;  1VMF A;  4LK6 A;  5FZB A;  3EMR A;  4CCL A;  4PLM A;  1W8O A;  2GSY A;  1MS1 A;  4XUQ A;  4A7K A;  4YFZ A;  5JSP A;  1Q8S A;  1UWW A;  4MG2 A;  2YC0 A;  3VN4 A;  2BP6 A;  3LDR A;  4FFF A;  2V73 A;  3THD A;  2ZGQ A;  3T3Y A;  1LOG A;  3UGF A;  1GOG A;  4TYS A;  3CZU A;  2FCV A;  4IEP A;  4YVS C;  2CU5 A;  4C0B A;  4D3W A;  1S1A A;  1MAC A;  4N90 A;  4YW7 A;  2XGX A;  1YCI A;  5JAX A;  1IZ3 A;  5LAT A;  3AMN A;  4H2A A;  4AF9 A;  4A7Z A;  5JR2 A;  3WQ1 A;  2XJV A;  4Z2A A;  4J25 A;  3WVJ A;  4CDX B;  4NO4 A;  4JTN A;  3VUO A;  2PAE A;  3F2Z A;  3W21 A;  2OQ7 A;  3H8U A;  4XJZ A;  3E97 A;  1GZW A;  2A71 A;  4PBO A;  5FMO L;  3W58 A;  4R4Z A;  1RUJ 1;  2R49 A;  4Y22 B;  4A7Y A;  3VD3 A;  5ACA 2;  1MZF A;  2W68 A;  5F5I A;  4GKY A;  2CV6 A;  2BBV A;  3ZN5 A;  1J83 A;  1JOP A;  1QH7 A;  4FXG B;  1S0G A;  5FZ4 A;  2VVF A;  3S30 A;  1GP5 A;  1XC6 A;  2W0X A;  2YDE A;  5EYX A;  1Q3E A;  2HEW F;  1GBG A;  1GMM A;  2Y6F A;  3FBY A;  3FHI B;  4XFH A;  4XTM A;  4B8E A;  2KXL A;  1SLI A;  5HXM A;  2BBA A;  1ULD A;  4QQP A;  2WNV A;  4XIL A;  1N1T A;  4WV8 A;  1FI2 A;  3QCW A;  3POW A;  1EAH 2;  3O0W A;  4AG4 A;  1DGW A;  4AI0 A;  2J42 A;  2A75 A;  5DQ0 A;  1YI9 A;  1PIV 1;  2VH9 A;  1AYM 3;  3Q8B A;  4Q4X 1;  1LGN A;  4MH0 E;  4HVR A;  3W5N A;  1V9U 3;  2JE8 A;  1SPP B;  4BIO A;  1JYI A;  3N7M A;  4FPK A;  1H4G A;  4A2U A;  1HB4 A;  4TLG A;  3VBU A;  3LD8 A;  3OJB A;  3QAC A;  2J22 A;  4S2G A;  5CYY A;  3HAG A;  3OPZ A;  4YGB A;  3SC7 X;  2DVA A;  3UKN A;  5IFP A;  1X7N A;  1G9A A;  1W3V A;  4RGA A;  2IXK A;  5FZ0 A;  1R1Z A;  5J37 A;  2WZP P;  1RUG 3;  4CU7 A;  4MGT A;  3HQX A;  4QKB A;  2ET1 A;  1FNZ A;  4EN6 B;  5A6Q A;  4MET A;  1IS4 A;  1W2U A;  2LTN A;  2Y6G A;  1LNS A;  1D4M 3;  2VBP A;  1DLL A;  1LEN A;  3LSE A;  3LA3 A;  4AED A;  4AK3 A;  5GM0 A;  1O91 A;  3RS6 A;  3CKH A;  4Z1V A;  5C9A C;  3CNA A;  3EYP A;  4M0N A;  3V0B B;  1ZVF A;  3BGA A;  4QGM A;  3JQX A;  1T6G C;  5B4X A;  1RUE 2;  2HWD 1;  4DUV A;  2ZAC A;  3Q8C A;  4NIA A;  4EWD A;  2ZOE B;  4YNI A;  4RN5 A;  4M3C F;  3VKF C;  1DP0 A;  1LGC A;  5I0U A;  1KJR A;  3AVR A;  1EV1 1;  2NYY A;  4HSJ A;  1DQ2 A;  2VMH A;  1NZC A;  4L9B A;  3WCS A;  4CPB D;  3VL8 A;  4QPI B;  4GXL A;  1G9F A;  3NJX A;  1SCR A;  4GAL A;  4OHV A;  5APA A;  1CAV B;  1RED A;  4BCU A;  2QQI A;  3INA A;  2QE3 A;  2LRO A;  1CIY A;  5FPB A;  4OHZ A;  5BNO A;  4AVS A;  4AGG A;  2QVS B;  4QU1 A;  3MGU A;  1OFS A;  4WM8 B;  4KGG A;  3TN9 3;  5FZO A;  4MGS A;  1S0D A;  5HI0 A;  4YZ4 A;  1RUH 2;  4XJ8 A;  4RR3 A;  3O0X A;  2WNU B;  4QPW A;  3VBO A;  2HWB 1;  4FTS A;  5BY5 A;  4UW6 A;  1C5I A;  4GB3 3;  4LLO A;  4LKE A;  3ZFE B;  3MW3 A;  5C3R A;  2XJT A;  2AH2 A;  3I7D A;  5DDJ 1;  4UBG A;  4C1X A;  4DRV A;  1JZ4 A;  3HNY M;  2LM3 A;  4SLI A;  5JZG B;  2R1B A;  1F4A A;  3OD0 A;  4IV1 B;  4RQP C;  4LA2 A;  1AR6 1;  1JHJ A;  1LOA A;  2VCA A;  3KZ4 C;  3SHR A;  3FLT A;  1R64 A;  1UY2 A;  4C0H A;  4PBP A;  4PJY A;  2GC1 A;  3KQR A;  2BTV C;  3E6B A;  3BI3 A;  4M01 A;  5LBF A;  1RUN A;  2ZX2 A;  1FYU A;  3KS7 A;  2D6O X;  1KXG A;  1RXG A;  1T6B X;  4LR4 A;  1GR3 A;  1WCS A;  4NHK A;  3SMH A;  4BQ4 A;  1OMI A;  4LUL A;  4NHX A;  3RWK X;  3CIH A;  1QXP A;  4LHL A;  3LIG A;  2CSG A;  2WC2 A;  4QX3 A;  1VMJ A;  1H1A A;  1VBC 3;  4Q26 A;  1V6K A;  1TME 3;  2VE1 A;  2UWA A;  4CCE A;  2BPA 2;  3BTX A;  1CES A;  4UW4 A;  2XVG A;  2VOK A;  4HKO A;  3MZH A;  5FWE A;  3RZZ A;  2OS2 A;  2P3Y A;  3QH7 A;  5KR7 A;  1ZZ6 A;  1XNA A;  1YO8 A;  2CYF A;  2TEP A;  1VBB 2;  1NXM A;  4MGZ E;  5CFD C;  3GNE A;  4A3X A;  1CN1 A;  2X05 A;  3DKW A;  4GMP 3;  3H3L A;  2GP3 A;  1PGS A;  5T54 A;  1M4W A;  1J1L A;  1OD3 A;  1GKB A;  1ULF A;  2YBP A;  3EHK A;  3M4F A;  2YPJ A;  3I3Q A;  3RJ2 X;  2IFW A;  2J1T A;  4PF1 A;  2D7F A;  5FZE A;  2E51 A;  3W9A A;  1PMH X;  4IV3 B;  1DZT A;  1F35 A;  1UY0 A;  3J8F 1;  3FUO A;  2XJR A;  3G7D A;  1IS3 A;  4XAC A;  3BPS A;  5LZ6 A;  2ZZJ A;  1YQ2 A;  2YZ4 A;  5CFC B;  2G9Z A;  2A6X A;  1UN1 A;  1FXZ A;  5JOX A;  1L7Q A;  3PUQ A;  1T2X A;  4ARX A;  1KQR A;  1UYP A;  5FO7 B;  2XL7 A;  3FL7 A;  2VTX J;  1SLT A;  2RMU 1;  3I59 B;  3NNF A;  4PLN A;  4CPB A;  3D3A A;  4M00 A;  3VBF B;  4JDM A;  1NA1 B;  1LGB A;  3NNJ A;  2QQL A;  4Q1R A;  4QGN A;  5A1L A;  1HRV 1;  2Y0O A;  2OZJ A;  1XB9 A;  2KR2 A;  2ERF A;  3C7O A;  3KV6 A;  2AEZ A;  1CX4 A;  4CP9 A;  2WFF 1;  4Q4W 1;  3VHP A;  4XUN A;  3RFR A;  2R06 2;  5LBB A;  5T50 A;  2BVB A;  4CEW C;  2RM2 2;  3KSC A;  3ZFG C;  4ZZ8 A;  1Q43 A;  4XF1 A;  4F83 A;  1RUC 2;  1HQL A;  3LWC A;  2CWS A;  1O8S A;  3T0D A;  5KWR A;  2LUW A;  3ACI A;  4FXK B;  1ZBE 2;  1AR7 1;  1L3J A;  2BNO A;  1X33 A;  2YBS A;  5GKA C;  3WNP A;  3I2O A;  1ASJ 2;  2P34 A;  3P5B A;  4YPJ A;  1K5M A;  2XBO 1;  4AAX A;  2ZGU A;  2BWC A;  2D3P A;  4FPL A;  2DVF A;  2W9X A;  3WW2 A;  3K51 A;  1P8J A;  4IEW A;  3MF6 A;  1NCR C;  4AEM A;  1C1L A;  1KGY A;  4OHX A;  3ZSK A;  4EZ4 A;  5JSR A;  2G1M A;  3HWJ A;  4QDS A;  4JDN A;  1PVC 1;  5A7O A;  1NLQ A;  4TXW A;  4E4D X;  4RHV 3;  4XFB A;  4AYU A;  2XJS A;  3H7J A;  2UYB A;  3RRD A;  2XLF A;  2WAO A;  4LEJ A;  4FTE A;  1TMF 1;  3M2M A;  3PL0 A;  4P9G A;  2WLP A;  1JTZ X;  1YYN A;  3IT8 A;  1VAV A;  5A3O A;  3TBD A;  3ZN6 B;  3V0A B;  3UV9 A;  1LCL A;  4LTA A;  2BZD A;  4FO9 A;  1HW5 A;  4CE8 A;  4JV4 A;  1OQD A;  3UYJ A;  4D6R A;  1PGL 2;  3VDD A;  2A3X A;  3KVA A;  4IEU A;  2WBK A;  2E7A A;  2X8K A;  5HV0 A;  1AR8 2;  1GNH A;  1OD5 A;  4AVB A;  3USU B;  2KM2 A;  1CAX B;  3ATG A;  3B9C A;  4JKM A;  3ZKU A;  3GGL A;  1HRI 2;  3D6E A;  2BW8 A;  2QQN A;  1LEM A;  5J09 A;  5T3N A;  4IE4 A;  1HXS 2;  2UY8 A;  2VUA A;  1VBE 2;  4XXP A;  5FYI A;  2DCK A;  3WF1 A;  1NQJ A;  2Y0I A;  1UIJ A;  3AZW A;  3I8T A;  5DUV A;  1ZNP A;  3GM8 A;  5GLU A;  2W95 A;  3HNB M;  5FYY A;  1OKQ A;  1WA4 A;  1RUD 2;  2AYH A;  2Y33 A;  5EV7 A;  5FR3 A;  3H42 B;  3KCY A;  1D7P M;  4O9G A;  1WW6 A;  3ZYH A;  4Q0U A;  2V5D A;  3WXP A;  2QQU A;  4QWN A;  4XJ9 A;  1X82 A;  2BJS A;  2NZ9 A;  3OBT A;  2Q4S A;  3AJY A;  4XFI A;  5FUI A;  3H9A A;  5FZH A;  1CVN A;  3ZXG A;  3CJI A;  4ZPI A;  4FT8 A;  1CZT A;  4Y1U A;  3WP6 A;  4D69 A;  5FRA A;  4ZKT B;  2FDJ A;  3PU3 A;  1H4H A;  1W99 A;  2VXR A;  1YC6 1;  2XML A;  2VMG A;  3LB9 A;  1QH6 A;  4DFS A;  1QDC A;  1OXC A;  3IMM A;  4AHZ A;  3ACG A;  2IZW A;  3TB0 A;  1WLC A;  4KGQ A;  1JYV A;  1PK6 A;  1QOT A;  1E57 A;  2EAK A;  3BAL A;  4GWJ A;  5F5A A;  1UU6 A;  4Y4Y A;  3K4A A;  3VDB A;  2E7T A;  5DAV A;  1S0C A;  2V72 A;  1LHU A;  1WCD J;  4FOW A;  4LIV A;  4Q4V 3;  3ZYI B;  4Y26 A;  4AHW A;  3R0R A;  3LZZ A;  2EA7 A;  2W92 A;  3DXT A;  2CWM A;  2V5Y A;  4KG8 A;  4AXO A;  2ZTN A;  3WG1 A;  3O1P A;  4UYB A;  1EPW A;  1I3H A;  4BK5 A;  2QDN A;  3NNG A;  2YBK A;  4RS5 A;  2IUW A;  3H7Y A;  4IND A;  1PO2 2;  1QOO A;  1XNB A;  5A7N A;  3RWN A;  4DRR A;  2PHL A;  3ZDS A;  4Y22 A;  4QKF A;  5E88 A;  1PZ8 A;  4KBZ A;  3VL9 A;  2WN2 A;  2IVJ A;  4PLO A;  3ENR A;  1XE8 A;  3AKR A;  3HQR A;  1RTV A;  1Q56 A;  1ZRI A;  3IDC B;  1FV2 A;  1O8P A;  5FY1 A;  4AL9 A;  4AR2 A;  4NMI A;  4YW2 A;  2X29 A;  5LRS A;  1OBN A;  4KL1 A;  1LOF A;  2VZO A;  2JXA A;  2MNG A;  1ENR A;  4S2F A;  1FMD 2;  1M06 G;  1JI6 A;  3ZXL A;  1WW4 A;  3IIA A;  4R9B A;  3ZOI A;  4CUB A;  3AKQ A;  1PIV 2;  3UKV A;  2GNB A;  4Q4X 2;  2R30 A;  4B7E A;  1W9Y A;  3VZJ A;  3FC0 A;  4FI9 A;  4MXW B;  5HCB A;  1QQP 3;  1AXY A;  4YAR A;  2OT7 A;  5D8A A;  1LKN A;  4A3Z A;  4GZ9 A;  3VBH B;  4PDW C;  2J1V A;  4B29 A;  4XUT A;  2VZS A;  5K0U C;  4EQV A;  2OYZ A;  3KB5 A;  5JMC A;  4NRP A;  3LAG A;  3VBR C;  2JKX A;  1RHI 3;  2VW1 A;  1XE7 A;  3AKS A;  4DXR A;  4RFR B;  2R0F A;  5DPN A;  3SKV A;  3VZK A;  2HJI A;  4YRD A;  1VBD 1;  1S2B A;  1HJG A;  2BFU S;  1Y9M A;  2G9G A;  1D2Q A;  3GZT B;  3KM5 A;  3PVE A;  4GAZ A;  4ZU4 A;  1RUI 3;  4E8C A;  5I8Y A;  5JWP A;  3GF6 A;  1N3O A;  5EQU A;  1K3I A;  1OF4 A;  2F17 A;  2MEV 1;  4HET A;  1D2S A;  4CXX A;  2HWD 2;  1VAL A;  1UMH A;  4H14 A;  4GWN A;  3K4Z A;  3KF3 A;  3IDA A;  4E8D A;  1BLZ A;  1AYN 3;  2JDY A;  2W1U A;  2DU1 A;  1MS8 A;  2QQW A;  1EV1 2;  3PVO A;  5DZE A;  3M3O A;  1B35 B;  1SFP A;  4Q4Y 3;  3C3V A;  5CFD B;  1AL2 2;  3CEW A;  3IN9 A;  2NN8 A;  4UOJ A;  1CAV A;  4FFH A;  2RS5 3;  1RUE 1;  2EIG A;  1LHV A;  3MLJ A;  5KXC A;  4XAB A;  4BXF A;  4B1M A;  4CDX C;  3OEB A;  2DBI A;  2P2K A;  1WW7 A;  1CPM A;  1F15 A;  1AR9 2;  2W91 A;  4CDW A;  2WO1 A;  1LUL A;  3FJS A;  1H2L A;  3ZYR A;  3RZJ A;  5FLJ A;  3ZR6 A;  4QX1 A;  1UZV A;  1OLM A;  4LBQ D;  3H8X A;  3MYX A;  4JZR A;  1J3P A;  1KDK A;  1MEC 3;  5FFO C;  3SKJ E;  4HBN A;  1NE4 A;  5BNP C;  4QX2 A;  2EXK A;  2XB6 C;  1OSG A;  5DDJ 2;  3AZX A;  3FZ3 A;  2OPK A;  1S2E A;  4QU2 A;  5JXH A;  4AEJ A;  1H8T A;  2RVA A;  3C7F A;  3O0V A;  1W8W A;  2VU9 A;  3NAP B;  2E32 A;  2PAK A;  2Y26 A;  1RUH 1;  3WHU A;  4DUW A;  5FMO S;  2FDG A;  5C3S A;  1DYK A;  1BYH A;  1Z0H A;  4G3Y C;  4S2H A;  4ZY9 A;  1SEF A;  4EJR A;  3LIH A;  4QX8 A;  3OYW B;  2GC2 A;  2J1A A;  3WNK A;  4OHY A;  2PLV 1;  4MGI E;  3JUU A;  5IWF A;  3UGH A;  4NPM A;  2DF7 A;  2XHK A;  5BUV A;  5FY0 A;  5K4L A;  5LA1 A;  5T5P A;  1C57 A;  3G6J B;  4CDQ B;  2YHJ A;  2VNR A;  1F31 A;  5F5Q A;  1NCR B;  3N9O A;  3AYE A;  5SV5 A;  3W20 A;  3ZYP A;  2P17 A;  1S0F A;  4P9X A;  2VUL A;  2A3W A;  4P14 A;  1W6Q B;  1YQC A;  1FPN 1;  4DNY A;  5KHK A;  5KXB A;  2F4P A;  3GXU A;  3J7N A;  4N43 A;  1UKR A;  4BYY A;  4LO5 B;  3PUA A;  1CIW A;  3WF4 A;  1GNZ A;  5FJK A;  1MZ6 A;  5FXW A;  5ISL A;  2W94 A;  3RYP A;  2VQU A;  3VGI A;  4PT6 A;  5B2G B;  2P4E A;  2VM9 A;  1W6N B;  4HG6 B;  3RI8 A;  1NAE A;  4AQ2 A;  4CXW A;  4XYX A;  3III A;  3J8F 2;  2RS3 3;  1FOD 3;  3H1M A;  1NCQ B;  3JU9 A;  1QJX 2;  1ZRR A;  4FP3 A;  1TE1 B;  4YW6 A;  5IAX A;  1H0B A;  4XTP A;  1IOA A;  3HPN A;  4FAH A;  4QPG B;  4KQ7 A;  1CPN A;  4QPI C;  1DIW A;  2F6B A;  4YZ2 A;  1BEV 3;  1W9W A;  2GAU A;  5JOY A;  3HQU A;  3ON7 A;  2L9L A;  3DPR B;  4IGQ A;  3VB9 A;  5K9Y A;  1QJY 3;  4JGZ A;  5C7G A;  2B46 X;  5FYV A;  1HRV 2;  4H7M A;  4XUO A;  3SCG A;  4NHL A;  1G8W A;  5A3T A;  2VZT A;  2WS9 3;  2WFF 2;  3FLR A;  4Q4W 2;  4WM8 C;  4CDU B;  4A4A A;  5K7P A;  3VKO A;  4OVE A;  4QT6 A;  3B69 A;  4Q2F A;  5ANQ A;  4LIU A;  3AM2 A;  1L7L A;  1RC6 A;  3O1T A;  1D0G A;  3E5Q A;  5G04 L;  2WNU C;  3ZXJ A;  5FYM A;  1MZ5 A;  3D0S A;  1YJL A;  2WNE A;  2FMD A;  1C1F A;  2D6M A;  5FZC A;  3ZFE C;  1ND3 A;  3U10 A;  4LBQ A;  2XDV A;  5A1F A;  3N7J A;  5C5U A;  3FE5 A;  2Y6J A;  4XE9 A;  2RDQ A;  3ZFF B;  4KU8 A;  2JDN A;  3FN9 A;  1AYM 1;  2BGC A;  4XDO A;  3WQ7 A;  5C3Q A;  5JZG C;  1RGS A;  4IV1 C;  5FY9 A;  2RM2 1;  5FZF A;  1NG0 A;  2AGS A;  1W0N A;  1W28 A;  2XG3 A;  4I30 A;  1RUC 1;  4YM0 A;  2RDR A;  1K5J A;  4PI2 A;  3AK0 A;  3O14 A;  1YFU A;  5KHI A;  1OQ1 A;  2D3R A;  2WFP A;  4EYU A;  2VZR A;  4OLL A;  5EPA A;  3UT0 A;  3PMS A;  2YYO A;  2ZKL A;  3RPQ A;  2HEY F;  2D98 A;  1OOP C;  4MSV A;  4WBB A;  2WJS A;  5LCW L;  2GN7 A;  3AB0 A;  1OA3 A;  1QJU 3;  4AI8 A;  3AP4 A;  4FPF A;  4YVS A;  3FMG A;  5GZE A;  3SH3 A;  2VZ3 A;  3RZH A;  2MPF A;  5FPL A;  5FV3 A;  4OMD A;  3OF1 A;  2HBT A;  2ZBJ A;  4AVT A;  2Q1M A;  1H9P A;  1JUI A;  2YC2 A;  1VLN A;  2Q8O A;  3LPF A;  5C4W C;  5IAT A;  5A33 A;  4K1Y A;  4K6B A;  1F4H A;  5CU1 A;  1JZ3 A;  5FZI A;  2JDP A;  4TWT A;  4YW1 A;  1CAX A;  5FO8 B;  3OG2 A;  2I74 A;  4JVA A;  1H2M A;  4JRL A;  1YLL A;  5DN2 A;  1WCU A;  1ZZ7 A;  5E89 A;  5FZ6 A;  1JYN A;  2WIN B;  4IES A;  3E6C C;  1F5J A;  4IV3 C;  1A8M A;  2VY0 A;  3CHX A;  1PGL 1;  5JVV A;  4IL7 A;  1I6X A;  4RD7 A;  4ZXE A;  5FKC A;  4QAW A;  5IUQ A;  3HT2 A;  4RGG A;  4XUP A;  4QM8 A;  4AOC A;  5CFC C;  5L36 A;  3RDI A;  5JXG A;  1AF9 A;  4BME A;  1DYO A;  5IK5 A;  3NMB A;  1AXK A;  2IXI A;  3KV9 A;  1ZZ9 A;  1JOJ A;  4NR1 A;  5FZ8 A;  2BWA A;  4FPJ A;  4XOG A;  1HXS 1;  1NA1 C;  4QXC A;  4V2V A;  4YVW C;  5C71 A;  1E5R A;  3WHT A;  4NIG A;  1RYY A;  1FAT A;  1RVF 3;  1WGP A;  3BPZ A;  1YIP A;  4JKL A;  3POJ A;  3GBG A;  5A7W B;  2HWF 3;  2EXJ A;  3ETP A;  2ADE A;  3ZXE A;  3J7L A;  1OUS A;  3ZKY A;  1BHG A;  3D82 A;  1WLT A;  3POG A;  5F5C A;  4YWA A;  4ZU5 A;  3RZG A;  2OA2 A;  3N9P A;  1N1S A;  2OQ6 A;  3UES A;  3VZM A;  3H8R A;  1BMV 2;  2IC1 A;  2Q1F A;  1UZ0 A;  2B42 B;  1Q8Q A;  1RMU 2;  5C9A A;  1V6L A;  2WZ8 A;  4NHM A;  1CZS A;  1TZO A;  2GNT A;  2LW8 A;  4QX0 A;  3U1X A;  5M0T A;  4MVT A;  1DLC A;  1VE0 A;  3TRS B;  5LRR A;  2DYC A;  3CF6 E;  1W05 A;  4NWW A;  1I9R A;  4P5Y A;  1PX3 A;  4JQR A;  5ERL A;  5J96 B;  1LRH A;  2UYA A;  3AXE A;  5LAS A;  1CAU A;  3MV0 1;  3OCP A;  3OUI A;  2DTY A;  4OUS A;  3AP7 A;  1TQ5 A;  2E31 A;  5FPA A;  3QOP A;  4XPV A;  1TME 1;  1QF3 A;  1POV 0;  2JB8 A;  2WYS A;  5JXI A;  5C33 A;  1CAW B;  3S5A A;  1RUF 2;  4HPK A;  5D2A A;  1MR5 A;  3BB6 A;  4COW A;  1SLB A;  5A6Y A;  4E4Z A;  1SLL A;  4KWK A;  1CD3 G;  4OQ8 A;  4DXS A;  3LCP A;  1BZW A;  3ST7 A;  4XBN A;  4GA9 A;  3I2F A;  1PO2 1;  1BBT 3;  4GMP 1;  1HQW A;  4WVZ A;  5E1R A;  4P02 B;  1YHF A;  4MLO A;  1O4T A;  5FPZ A;  1A8D A;  2RDS A;  1IG0 A;  1U5X A;  1ODM A;  1UPS A;  2VUD A;  2XH6 A;  4NAO A;  5FK8 A;  1JN2 P;  4NOT A;  2H6C A;  2VMF A;  1VBA 3;  3EB7 A;  1KFX L;  3GZA A;  3R4U A;  3LFM A;  4L99 A;  3WF3 A;  3USS A;  5BNP B;  4P9Y A;  4MXW A;  3S5Q A;  1RIR A;  1VB4 A;  2R04 3;  4X6R B;  3RJR A;  4AWD A;  1PO1 3;  5F7U A;  4H7L A;  2W5F A;  1EUT A;  3VBS B;  3BTZ A;  5FCC A;  2VBD A;  2XHN A;  4RQP A;  1R09 2;  4M4P A;  5E6H A;  1N3Q A;  4CSW A;  5FKB A;  4Q5O A;  1VRH 3;  1FMD 1;  3GDB A;  1OF3 A;  4XXA A;  3RGB A;  4QHO A;  4CP1 A;  4EN8 B;  5FYC A;  4Q8K A;  4OI1 A;  3GHN A;  5FPU A;  1HDK A;  2D93 A;  2Y6H A;  5FBZ A;  3MW2 A;  2YPD A;  4OFG A;  1UZZ A;  3T2P A;  4MUV A;  3MFC A;  1W2T A;  1EYB A;  4K1Z A;  1VBD 2;  3GYD A;  2B9U A;  3NQH A;  2WAB A;  5A70 A;  4P08 A;  5HCF A;  1VB2 A;  2PHD A;  1PGW 1;  3AVS A;  4BHP A;  4X6Q B;  4XBQ A;  3AMP A;  1O5L A;  3T0A A;  3RSJ A;  3HT1 A;  5CAZ A;  1QKQ A;  2MEV 2;  4X8N A;  1LED A;  5A6Z A;  3THC A;  3U37 A;  4OMC A;  2NM1 A;  3AFK A;  4JGY B;  2IVI B;  2QNK A;  5CIR A;  4ZU7 A;  3S0M A;  2VPV A;  2P37 A;  3POB A;  4FAG A;  4IER A;  4LE4 A;  5LBE A;  1ND2 B;  4DS0 A;  2GNM A;  2PHT A;  1ZM1 A;  3P3P A;  1BQP A;  3DEM A;  2WO3 A;  4Q29 A;  3VLB B;  1C3H A;  5IJR A;  4PHZ A;  5KC6 A;  1I5P A;  1W0O A;  4RHV 1;  3CL1 A;  2CTV A;  4I0A A;  4LBO A;  3B9I A;  1US3 A;  4M4R A;  1J58 A;  2RS1 3;  3A0K A;  1HV0 A;  1LU1 A;  4GH4 B;  5C8C A;  4MX3 A;  2FCU A;  1AL2 1;  5AVA A;  2R16 A;  4XJW A;  2GC0 A;  5CAD A;  3FHQ A;  1AHS A;  3JBG 3;  4LE3 A;  2EAA A;  2P3K A;  3LFI A;  1NYW A;  4M0H A;  2W08 A;  1D4V B;  1GOF A;  4E4S A;  4M3C A;  4FPY A;  1SBD A;  1C8M 3;  4MXV A;  3D5O A;  1ULG A;  1DZR A;  1KD7 A;  3N3H A;  2WZR 3;  4BLI A;  1K12 A;  1AR9 1;  2ORZ A;  3WF2 A;  4Z92 B;  3JQW A;  5FP8 A;  4KNC A;  4CEW A;  2K9Z A;  1JW6 A;  2YXS A;  3IAQ A;  3M3I A;  3UJQ A;  3ZFG A;  1W6M B;  3JD7 3;  4W50 A;  3T08 A;  1LHN A;  4A41 A;  4ASL A;  3NST A;  1Q8P A;  2W52 A;  5FK7 A;  1G7Y A;  3S7I A;  5A7P A;  5LY2 A;  5FP3 A;  5L7O B;  3NV1 A;  4JAA A;  5F3C A;  2VO5 A;  1KS4 A;  2PLV 2;  3S57 A;  1UYX A;  3C7G A;  5DG1 A;  1DYP A;  1I1E A;  1OH4 A;  3VBH C;  1QHD A;  1OKO A;  3KHB A;  2OUH A;  4L11 A;  5FY7 A;  5FZK A;  2AEY A;  3AX4 A;  2XKP A;  4AAP A;  1CGP A;  4WM7 A;  3I2H A;  3AKT A;  4LKD A;  5IW0 A;  4Q27 A;  2B8M A;  2RHP A;  3WEZ A;  4KWU A;  1W90 A;  1XQN A;  1W2N A;  4ERO A;  1ZBA 3;  2VZ1 A;  4LOT A;  1R08 3;  1FPN 2;  1OOP B;  3DYM A;  1COV 3;  1UOG A;  2GDF A;  2HWC 3;  1RIT A;  3BU0 A;  3AKP A;  4LUM A;  2MHF A;  2GH2 A;  3N9N A;  4DPN A;  4JKK A;  3GCX A;  5C3P A;  3TEY A;  4LA3 A;  1IGO A;  5GLV A;  4QM9 A;  3ZYB A;  1R1A 3;  2E53 A;  2J7M A;  4HOO A;  2IXJ A;  5A7S A;  1W8H A;  2QQP A;  5C4W B;  3I97 A;  3M8L A;  4NRQ A;  1IQD C;  5F6K A;  2ZGK A;  1JBC A;  4K8F A;  1JXN A;  4AI1 A;  2ZML A;  3WCR A;  3WP5 A;  4ASM B;  3RZK A;  1GQP A;  1B35 C;  2JG9 C;  2RR1 3;  2FBE A;  2ZHK A;  3MO4 A;  2V4A A;  3PIG A;  4NUB A;  1MS3 A;  1Z78 A;  3KT7 A;  3WOG A;  3KF5 A;  2I2S A;  4XJU A;  1KDM A;  2ZHM A;  2V09 A;  3AP6 A;  5FBJ A;  1ACC A;  5A3M A;  1WMX A;  2DVD A;  1QNY A;  1JYC A;  2Q8C A;  2C4X A;  1S55 A;  3HMY A;  4B3N A;  1QJX 1;  1JZ8 A;  1WLW A;  4QGL A;  1GFF 2;  2QQK A;  2R07 3;  2Y8K A;  2YU1 A;  2Z4F A;  4HK8 A;  4LKS A;  5DZF A;  3D4K A;  3BIE A;  4UFL A;  4OQ9 A;  2E63 A;  1ULP A;  1RUO A;  4N8M A;  3U11 A;  4UF0 A;  2WQZ C;  4ES9 A;  4GJZ A;  4LBK A;  5FQ0 B;  4HFS A;  3WG2 A;  1W39 A;  4V2W A;  4N7I A;  1K42 A;  4YVW B;  4N53 B;  2VVD A;  4ZS2 A;  1OC1 A;  1BK1 A;  1ZZB A;  2TUN A;  3KCX A;  3OPT A;  4UT5 A;  1NXD 1;  4OI2 A;  1VRH 2;  2X5I C;  4HK9 A;  4TN7 A;  4HON A;  4CXY A;  1RUJ 3;  4Y20 B;  3OUJ A;  1DBN A;  1AYM 2;  1GNY A;  1IPS A;  2JJ6 A;  3NAP C;  5DAW A;  3C8X A;  2WLQ A;  3MLL A;  1V9U 2;  1ULO A;  5FZM A;  2K0G A;  2VMI A;  2R1D A;  2RE9 A;  1SDW A;  2ZEX A;  4P9I A;  3DCQ A;  2DCZ A;  1GWL A;  1JOD A;  3BOD A;  2ZMK A;  4LMF A;  2VNG A;  3HVD A;  2WWU A;  3LF7 A;  1WCQ A;  4F8A A;  4YG6 A;  3HJR A;  5FYZ A;  2A7A A;  3WX5 A;  1GZ9 A;  1NY7 2;  1RHI 1;  2JD4 A;  1RUG 2;  1XXN A;  2NPI A;  3I2D A;  4XFG A;  4WVM A;  4CDQ C;  1H2K A;  1W6P A;  1WBF A;  2JDZ A;  2O8Q A;  2UWC A;  5AFB A;  5IK8 A;  1IKP A;  1W2A X;  3AZV A;  3OY8 B;  1D4M 2;  1KIT A;  1X9P A;  2ZZQ A;  3B00 A;  2I07 B;  4LQR A;  4YG3 A;  3W5M A;  4XCB A;  3TEX A;  3OUH A;  2WRA A;  4UWD A;  3ITQ A;  5C70 A;  5A32 A;  2B7Y A;  3U4S A;  3LE0 A;  2AEN A;  3VBO C;  5A3N A;  1E5S A;  1YFW A;  5FYS A;  4ATF A;  1OH3 A;  1DQ1 A;  3I2K A;  5CKN A;  3K3N A;  4R9D A;  5FOB B;  2VW2 A;  1AYN 1;  2PHW A;  1V6N A;  2VGD A;  2WL1 A;  2YC4 A;  3UGG A;  2WT2 A;  2DCJ A;  3EJK A;  2E9Q A;  3N4M A;  2VOX A;  3LOB A;  4L92 A;  4D94 A;  2CHH A;  4NPL A;  3IPV B;  2DFC A;  2IWG B;  1W6O A;  4BU2 A;  1NCQ C;  3LEK A;  4IEY A;  1LHO A;  2RS5 1;  3LEI A;  5A3P A;  5DXD A;  3ORJ A;  3H1W A;  4XZU G;  4QPG C;  1UKG A;  5IT6 A;  2OII A;  3RG0 A;  3OGJ A;  1U5I A;  2J1R A;  3DPR C;  5HCH A;  1N1Y A;  3MEP A;  4H55 A;  1FV3 A;  3TN9 2;  4D6Q A;  1LEC A;  3WP3 A;  4LHK A;  4BLJ A;  2AR6 A;  5FTT C;  4PDW A;  3T2Q A;  3UKT A;  5K0U A;  2I45 A;  1U12 A;  4TZD A;  2JE9 A;  2ZAB A;  5DAX A;  4CDU C;  1MEC 1;  5IFT A;  3K77 A;  1QGL A;  2Y6K A;  1VR3 A;  4GB3 2;  4IXL A;  3VBR A;  2PTM A;  1MVQ A;  1ZX5 A;  3CO2 A;  2VNO A;  2VQ0 A;  2PA7 A;  1BCX A;  3BTA A;  1BKZ A;  4YZ3 A;  5IVY A;  4AVA A;  1LHW A;  1W2O A;  1AX2 A;  5FWJ A;  3TNP B;  2XQX A;  1LES A;  1LJ7 A;  3PDQ A;  1APN A;  3HOB A;  5J1X A;  3T4V A;  5LB6 A;  3ZFF C;  4ET7 A;  3ZXA C;  1S0J A;  3R6S A;  1UU4 A;  1PM7 A;  2UWB A;  2HWB 3;  1SAC A;  2Y6L A;  5HXV A;  3OTF A;  3T0B A;  4Y4R A;  4BQ1 A;  5KHH A;  1BMV 1;  2J1E A;  1ULE A;  3ZLI A;  4NRM A;  5C5T A;  5DAQ A;  4Z82 A;  5LY1 A;  1RMU 1;  1AR6 3;  1VBC 2;  4IUG A;  1TME 2;  4TLF A;  1H2N A;  3A4U A;  5FYB A;  3T1M A;  4Z07 A;  4A6S A;  4MO3 M;  4EV0 A;  1UCX A;  3R05 A;  2WO7 A;  4IEX A;  2WWS A;  1PMJ X;  4LKF A;  5ABJ B;  2Y38 A;  1O3S A;  5DUW A;  1JMU B;  3HN1 A;  4S2D A;  2VOV A;  1ULC A;  1DGR N;  4DQA A;  5EJ1 B;  4CDX A;  1GP6 A;  4BA6 A;  5CKQ A;  5FLI A;  5I8T A;  3WP4 A;  4BQ2 A;  2X10 A;  3AZY A;  1OT5 A;  1QEX A;  1QIQ A;  4HVQ A;  4LT5 A;  5FPV A;  2CGN A;  3CU7 A;  2JDM A;  2ZX4 A;  2RDN A;  2WT1 A;  1JYX A;  5FO9 B;  2BGP A;  4HAN A;  1RUF 1;  4HKL A;  4IE7 A;  4QXK A;  3O1M A;  2RS3 1;  1FOD 1;  1DG6 A;  1MQT C;  1OFN A;  5FIX A;  2QJV A;  3RYK A;  4E9K A;  2QKD A;  2WSU A;  3PTR B;  2EIE A;  2JIC A;  3E1F 1;  3WDX A;  2YY1 A;  4HT1 T;  4DXT A;  3HIF A;  1LAJ A;  1BEV 1;  1PZ7 A;  1IS6 A;  3JZV A;  4YZ1 A;  4LOR A;  5DG2 A;  1QJY 1;  5H9S A;  3NWK A;  1XOY A;  3BIW E;  4O7X A;  5E8A A;  1SPP A;  4CTE A;  3OOX A;  2WYF A;  4LBN A;  4N9H A;  3VKL A;  2WS9 1;  4XFA A;  5F2W A;  4ONU A;  2H0V A;  2P6H A;  1Y9Q A;  1HQN A;  4BOW A;  2C9A A;  1R09 1;  1N1V A;  3GBW A;  1AJO A;  3R4S A;  5FMB A;  1HX6 A;  1IS5 A;  4NN0 A;  3B7M A;  2DU0 A;  1PGW 2;  2RMU 3;  4D6S A;  1JZ6 A;  2FMY A;  3A7Q A;  1SLA A;  1WME A;  2XOM A;  5BXX A;  3WG4 A;  1XYN A;  1QMJ A;  4Q0Q A;  3VHO A;  3L9J T;  1S0B A;  2WII B;  2VOT A;  4ZS3 A;  2JEC A;  1W9F A;  2CDO A;  2ZGP A;  3QLQ A;  3ZSL A;  1OA4 A;  3N36 A;  5JDB A;  1URX A;  4I09 A;  4GIQ A;  2D44 A;  2HEV F;  1BVP 1;  1ENQ A;  2D97 A;  3PME A;  3WY6 A;  1ZA7 A;  3H8O A;  4L0P A;  2CGP A;  4K9S A;  5DZG A;  4AVV A;  2O14 A;  3MUZ 1;  1F2N A;  1O4Y A;  1VAM A;  2Q5T A;  1XNK A;  4B1L A;  5I8S A;  3V0B A;  1XYO A;  3WNN A;  1QOS A;  1QU0 A;  3E6D A;  1ZRE A;  2JDA A;  2BOI A;  2WNV B;  1CJP A;  1DQ4 A;  3A22 A;  3NV3 A;  3OSD A;  4LBM A;  4UI9 L;  4RHV 2;  1JZ5 A;  3T2T A;  1QJU 1;  1Z7S 3;  3FBM A;  2XBO 3;  3NRU A;  5CEH A;  1WZX A;  1I5Z A;  4XVH A;  1ST8 A;  3AFG A;  3DN7 A;  4C8D A;  2JG9 B;  4LO7 A;  4QX7 A;  5BV6 A;  3WQB A;  2C0Z A;  1PNF A;  4QPI A;  3LDB A;  1JU4 A;  5B4N A;  4CUA A;  3AC0 A;  3VBU B;  2Y60 A;  1XNT A;  3SLI A;  4K7J A;  2OKX A;  1OQE A;  3I49 A;  1PVC 3;  2CNA A;  3OBA A;  3MI8 A;  4AQS A;  1SLC A;  3MPP G;  4HSL A;  2XUE A;  4YM2 A;  4AHY A;  5F37 A;  4WM8 A;  1UIK A;  5EIY B;  3ES4 A;  1UYZ A;  3VD7 A;  4R52 A;  3B01 A;  1TMF 3;  1F8V A;  3V64 A;  5FMC A;  2F4L A;  1FNY A;  2C1F A;  4CCM A;  4FFI A;  1KS5 A;  1PK6 C;  2WNU A;  3AMQ A;  1ZZ8 A;  3P3N A;  4AED B;  1YQ8 A;  5LA9 A;  3ZFE A;  5BPX A;  5A7Q A;  1YEW A;  4BM8 A;  1G9C A;  1U0A A;  4XIO A;  2WA4 A;  2X5I B;  3VBS C;  4E4H A;  3UL2 A;  2FD8 A;  1SFN A;  5JZG A;  4MGY E;  1CWP A;  4IV1 A;  2WT0 A;  4XDP A;  4ARY A;  4C90 A;  1SCS A;  2EF6 A;  1GV9 A;  5FP9 A;  4DY3 A;  3I3B A;  4IE6 A;  5IAV A;  3V56 A;  2C9K A;  5FZG A;  2Q1Z B;  4AZZ A;  4L2N A;  3GZU C;  2YV8 A;  1QXJ A;  5EWS A;  3H0O A;  4OUL A;  2QCS B;  4GQ7 A;  2HWF 1;  5FUN A;  4KI5 M;  3BOP A;  5L73 A;  3CJX A;  2A6W A;  4P00 B;  2ZGL A;  4BIS A;  3LPG A;  5FYU A;  1VJ2 A;  2ADD A;  5BNO B;  1JYW A;  4A6O A;  4EN0 A;  2VAU A;  1Y3T A;  2WSV A;  3QD6 A;  2VZP A;  3O12 A;  2A1X A;  4DMI A;  1PHM A;  3M7A A;  5T5O A;  1G9D A;  5EXO A;  1D0H A;  1JH5 A;  2PQQ A;  5C4W A;  4DIN B;  1XRU A;  2E33 A;  4QHB A;  4JGY C;  3ZMN A;  2OXB A;  3MIE A;  3NVC A;  4RR3 B;  4I2O A;  1WBL A;  3VBO B;  1WKY A;  4Q4V 2;  2O1Q A;  1W8U A;  3POF A;  1C4R A;  3O1U A;  2ZXQ A;  4NWV A;  4NII A;  2VJX A;  2FHR A;  1ND2 C;  4MGQ A;  3VZN A;  1XJA A;  2BNN A;  1X36 A;  1KJL A;  5F3G A;  4UFM A;  2ZPX A;  4G4F A;  2W1S A;  1H8V A;  4CCD A;  1JYT A;  4IV3 A;  2Z42 A;  3KCC A;  4FOV A;  3WNX A;  4TSV A;  2A3Y A;  4HN1 A;  3C7H A;  2CAU A;  1UXX X;  4GH4 C;  4MGK E;  5CFC A;  1EUU A;  3VHN A;  1YNA A;  2TBV A;  3RI9 A;  5A3L A;  1UY1 A;  4CEY C;  5HBA A;  4AHX A;  1YXW A;  3J7H A;  4Y33 A;  3I59 A;  3WDU A;  2NMN A;  3VBF A;  4YZ5 A;  2BER A;  3ZYG A;  4YVW A;  1NA1 A;  4QD2 A;  3I4I A;  3OPW A;  2Z5W A;  3ZIW A;  3MIH A;  4WVW A;  3RZM A;  1VBA 1;  3D0J A;  4QQL A;  3SEE A;  5GLZ A;  3OGV A;  2VMD A;  1SBE A;  4B4Q A;  4CA9 A;  1W3X A;  2Q30 A;  3PLQ A;  1QQP 2;  1SZB A;  3AP9 A;  3UNP A;  3AJZ A;  5FMD A;  1MS4 A;  1CON A;  5ANN A;  5L7O C;  4R9A A;  5A3U A;  1VRH 1;  4FQZ A;  4RA0 A;  2PHR A;  1REE A;  1UMI A;  4UFI A;  1U5Z A;  4C1W A;  5ACA 3;  2GMP A;  2ZKN A;  2WQ4 A;  4I3G A;  4BDV B;  1RHI 2;  2TNF A;  3IDB B;  4I01 A;  5F32 A;  1V9U 1;  2FDI A;  2YG0 A;  3IBM A;  3MPB A;  5FZ3 A;  1UQX A;  5FP7 A;  4BB3 A;  4CDW C;  1WMD A;  1GQG A;  4XHX A;  4N9I A;  2SLI A;  2EID A;  3DEC A;  5FPX A;  2OVU A;  2YGL A;  1GSL A;  3K75 B;  3QH6 A;  2XJQ A;  1EAH 3;  2WN3 A;  4W6W A;  3PVN A;  1RUI 2;  3I3E A;  1RB8 G;  1NY7 1;  4IET A;  1RUG 1;  3MBW A;  3SIS A;  1QXR A;  1UZY A;  5DUU A;  3NJZ A;  5KXD A;  4CP9 B;  4NPR A;  5JLV A;  5FAX A;  4E2S A;  1AYN 2;  1D4M 1;  3ZN6 A;  3V0A A;  2ZX1 A;  4OI4 A;  3IKW A;  2VQT A;  1U5Y A;  3POE A;  4Q4Y 2;  4R4X A;  2WR9 A;  2C26 A;  3IWZ A;  4DY5 A;  5GZC A;  2JG8 C;  3KT4 A;  3T2O A;  1GYK A;  4XAA A;  2G4I A;  2RS5 2;  1O5U A;  3N35 A;  4D7S A;  1IG3 A;  3SCH A;  5F3I A;  3USU A;  5FZD A;  5LA2 A;  3C7E A;  2NP0 A;  2ET7 A;  2C24 A;  5L9V A;  3F95 A;  1K5M B;  1MQT B;  1XNC A;  1UXZ A;  2VCC A;  4LLF A;  3OB8 A;  3WQ0 A;  2BEO A;  2D6K A;  2YGM A;  4KBB A;  2QZ3 A;  4GWI A;  1WWY A;  5GAL A;  3B94 A;  2A70 A;  3IZO A;  3J9S A;  4AGR A;  3DYO A;  4NJ4 A;  4QPY A;  3JBG 1;  1IPJ A;  3T09 A;  5EJZ B;  3CQO A;  3MHZ A;  4XQW A;  3HBZ A;  4IE0 A;  3VKN A;  5JUV A;  3LKJ A;  1VAK A;  3ZYJ B;  1MEC 2;  1ZA4 A;  1H1I A;  3LOI A;  3RMY A;  4A45 A;  3TN9 1;  2E26 A;  4B4R A;  4N53 C;  3ZSE A;  2VW0 A;  1J3Q A;  3OGR A;  2DVB A;  3ZVX A;  3JD7 1;  3HD8 B;  5FY4 A;  1JZ7 A;  4DZG A;  2ZEY A;  3EQE A;  4MOA A;  4AQ6 A;  2J1U A;  1IQA A;  3N7K A;  4FTB A;  4AI3 A;  4GB3 1;  3ASI A;  3SCF A;  4AI9 A;  5JIU A;  5E16 A;  5FZL A;  1UY3 A;  1POV 3;  4XEZ A;  4LPL A;  1QWR A;  4PQ9 A;  1G9B A;  5I0T A;  3SNM A;  1TEI A;  2AZ5 A;  5KBF A;  3ZIX A;  1AZD A;  1W8F A;  2GN3 A;  1Y9G A;  5JCT A;  3NO8 A;  4MAD A;  1RUH 3;  2FZ1 A;  3WW3 A;  2C6S A;  1W8Z A;  2FQP A;  3KD4 A;  1V6M A;  5FP4 A;  3FWE A;  3GAL A;  3SXW A;  1US2 A;  3NJV A;  1CQ9 A;  4PCR A;  2FDH A;  4FPE A;  1Y4W A;  2CAV A;  1ZBA 1;  4FSJ A;  4YGE A;  3WIN E;  4CVU A;  1K45 A;  1HB1 A;  2ZAH A;  1COV 1;  2HWC 1;  3MIF A;  1VBC 1;  2PQS A;  1ODN A;  5C6C A;  3CLP A;  4G9S B;  4EWA A;  1AX0 A;  5BNN C;  5IVB A;  1R1A 1;  4GKX A;  2HYK A;  1NOV A;  1V6J A;  2ZCW A;  1A3K A;  3JB8 A;  2RS3 2;  1FOD 2;  3CJI B;  3ZX7 A;  2VZV A;  1OVP A;  2W3J A;  1UOJ A;  3TOJ A;  3TEZ A;  4LO4 B;  5FZA A;  1GU3 A;  3ZPY A;  3ZSM A;  1QJE A;  3BYW A;  2QQV A;  4BQ3 A;  2GP5 A;  2ID4 A;  3P1I A;  1BEV 2;  3R4D B;  2VC9 A;  3U07 A;  4D0Q A;  1DQ0 A;  3PJY A;  1LOE A;  4Q8L A;  3VV1 A;  1IPK A;  1PK6 B;  1QJY 2;  3J7M A;  5KXE A;  1FX5 A;  1J1T A;  4F3J A;  1O6U A;  4XET A;  3HR9 A;  1X8E A;  3WNM A;  5KHG A;  4LO8 A;  4XFC A;  3B02 A;  1NX9 A;  2R07 1;  2WS9 2;  5FRE A;  5FDB A;  1VBB 3;  1MZE A;  3LSD A;  5EZW A;  2QQO A;  2XLG A;  3A23 A;  4RFT 0;  4Y24 A;  1F9K A;  3VBH A;  4DUX A;  3O1S A;  1CX1 A;  1OUR A;  4CP2 A;  3JXS A;  3M3C A;  1A34 A;  1O59 A;  4RS5 B;  1CZV A;  4XZP A;  4BMB A;  4NHY A;  5I93 A;  2UY9 A;  4ORF A;  1Y43 B;  2YB7 A;  5EYY A;  2GAL A;  3POS A;  4HZF A;  5GJ6 A;  1YI7 A;  4XQ4 A;  1XSQ A;  4XJA A;  3V65 A;  2XVL A;  1DF0 A;  1VMH A;  2PXJ A;  3OBZ A;  3LEG A;  3PUR A;  4MHU A;  3EXU A;  3FFQ A;  5JXJ A;  1LB2 A;  4WZF A;  3BTY A;  4L97 A;  4XQD A;  4AGV A;  2W39 A;  4YFW A;  2VZQ A;  4J1W A;  4OCT A;  1ENS A;  4FOY A;  3NV2 A;  1UW8 A;  3DYP A;  1UU5 A;  4CU6 A;  2WKK A;  1ZRD A;  1QJU 2;  1QY4 A;  2R06 3;  2A5Z A;  2HWE 3;  2D6P A;  5L9R A;  4CP0 A;  5IK7 A;  2RM2 3;  2JG9 A;  1B35 A;  4QMA A;  4PQQ A;  5CFD A;  4COZ A;  4ZXK A;  4FOQ A;  4I02 A;  3OBR A;  1RUC 3;  4QDQ A;  4URA A;  4F7Z A;  1OHF A;  5D8A B;  4BQ5 A;  4BIF A;  5ABJ C;  1ZBE 3;  1NUK A;  1UX6 A;  5AVP A;  4J1X A;  1ASJ 3;  3ALQ A;  4XF4 A;  4AQT A;  2AAC A;  4XHB A;  3ABZ A;  5SV8 A;  3MLK A;  2NQY A;  1UOF A;  1YRZ A;  4BH9 A;  4DO0 A;  4JDO A;  2VME A;  1V6I A;  2NMO A;  4CEY B;  1YQ6 A;  3VD5 A;  2OZ6 A;  4Z8B A;  2IXH A;  1QJZ A;  4QHZ A;  1KEX A;  2WZE A;  4UW3 A;  2J1S A;  1O3Q A;  4XMI A;  3GJB A;  2X5I A;  4KMQ A;  3CDZ B;  5FZ1 A;  3HEI A;  4ZZ5 A;  3AYC A;  1OLM E;  5KHJ A;  3NAP A;  2VXJ A;  5F3E A;  2XR4 A;  3KV4 A;  4YW4 A;  3APB A;  2VOW A;  2XON A;  4HLT A;  3FX3 A;  5JOZ A;  1H6Y A;  5GZF A;  4PF5 A;  1STM A;  5DAB A;  1UO9 A;  2R6Q A;  1OI6 A;  4OI0 A;  3B3Q E;  1VPH A;  3K2O A;  3MFA A;  1RVF 2;  3OYW A;  3NV4 A;  3PU8 A;  4LHS A;  5A80 A;  2HWF 2;  1TG7 A;  1QDO A;  3IM0 A;  1AR8 3;  2GZW A;  1RJ7 A;  3K3O A;  2R7E B;  1O3R A;  4CDQ A;  2EXH A;  4JTO A;  1S0E A;  1DU3 D;  5FUP A;  5AC9 3;  2FCT A;  1HRI 3;  2EIB A;  3CBN A;  1UYY A;  3M1H A;  1NCR A;  1HXS 3;  1MS0 A;  1WMF A;  1WW5 A;  2JDK A;  3NNM A;  4CDW B;  1VBE 3;  4Q0S A;  4R9C A;  3WDV A;  2Q0A A;  1W6Q A;  3HNM A;  5LEJ A;  4EE2 A;  2BGO A;  5CIS A;  3BCW A;  1HKD A;  4K20 A;  3S6P A;  1AVB A;  2AUY A;  2D5F A;  3ZMO A;  1V70 A;  1RUD 3;  2QFE A;  3SIT A;  2WQ8 A;  3N9M A;  1S0I A;  2RV9 A;  1W04 A;  3OEA A;  1H8T B;  1IHM A;  2W1Q A;  3N9L A;  2WNV C;  1AXZ A;  2A6V A;  1W03 A;  3NKT A;  1W6N A;  3L2Y A;  1WD4 A;  1JZ2 A;  1J59 A;  4MHR A;  5J98 B;  3JB4 C;  1NCQ A;  3MW4 A;  4Q4V 1;  1HB3 A;  2JG8 B;  4IGP A;  4XC9 A;  3W59 A;  3KLS A;  2Q8E A;  4COV A;  2O8O A;  4QPG A;  2H6B A;  5JR7 B;  2VUC A;  5CG8 A;  3VBU C;  2JB4 A;  1G6N A;  1OVS A;  1UD1 A;  4BJ0 A;  3LEM A;  5JOW A;  2XKO A;  3DPR A;  4IEO A;  3KVB A;  1BBT 2;  4UFH A;  3SH5 A;  3RQ0 A;  3MIG A;  2ZGS A;  2XPJ A;  2ZGO A;  4P9J A;  4XAE A;  3WDY A;  4BQW A;  3VDA A;  4FPC A;  1UF2 C;  4DEQ A;  2P3J A;  4SBV A;  1FAY A;  4CDU A;  1VBA 2;  2B9V A;  1PX4 A;  1LU2 A;  1X50 A;  2DCY A;  3K4D A;  2YMZ A;  3Q8E A;  4D7T A;  2R04 2;  3M3E A;  1PO1 2;  2YU2 A;  4AED C;  3NJY A;  3UK9 A;  5H9Q A;  3I3M A;  5T5L A;  4N43 B;  1PO2 3;  3Q8A A;  3Q8F A;  2V4V A;  3WF0 A;  3BN6 A;  5L9B A;  4RL7 A;  4CYD A;  1UY4 A;  5AFE A;  1SDD B;  4RYD A;  1YUD A;  2EIC A;  5CVR A;  3U75 A;  1Q5O A;  3ZFF A;  2C5D A;  1O3T A;  3S7E A;  3KMH A;  5GLT A;  4W65 A;  4FVV A;  1GOH A;  1L7R A;  3IAP A;  3AMH A;  3PVB B;  1NKG A;  2DUQ A;  3ECQ A;  1WD3 A;  1QQP 1;  4KU7 A;  4PIZ A;  5C8C C;  1KRI A;  2DBN A;  4LXL A;  3OGG A;  1C28 A;  1O7F A;  2YRO A;  4XMA A;  2QQM A;  5F8P A;  2BYV E;  2ARX A;  3O5S A;  3VHR A;  5CB7 A;  1X8M A;  2ES3 A;  1FMD 3;  3SH4 A;  1JUH A;  2P6C A;  4JGZ B;  1XU2 A;  1PIV 3;  1XU1 A;  4Q4X 3;  5BNO C;  4GMP 0;  5F39 A;  2VQA A;  5IVC A;  3I2J A;  3ZXK A;  4AFB A;  5IYY A;  2ZS6 B;  2XJP A;  2PHX A;  2LS6 A;  1FT9 A;  2HWE 2;  3ES1 A;  3J26 N;  3LDK A;  4UAP A;  4URT A;  5A3W A;  4K8R B;  2KD7 A;  1DGW X;  1HLC A;  3U0Z A;  1RUI 1;  3IDE A;  4RR3 C;  3VKM A;  2QDR A;  3PNA A;  3PIJ A;  5BNN B;  1B09 A;  1A78 A;  3ILF A;  1ND3 B;  5D21 A;  2JEN A;  3MDP A;  2RJ2 A;  4LBQ B;  5J3U A;  2XLA A;  2WAA A;  4XF0 A;  3UJO A;  1Z7S 1;  1MQT A;  2VZU A;  3UET A;  2RS1 2;  4Y5S A;  1E5I A;  1OLR A;  3ZM8 A;  1V00 A;  1PMI A;  1ZRF A;  4YW5 A;  4Q4Y 1;  4WM7 C;  4QB6 A;  4A44 A;  3JBG 2;  5IVF A;  1V0A A;  1YWK A;  1O4Z A;  2ZGR A;  3VDC A;  1DDL A;  2K46 A;  1E5H A;  4PI0 A;  3TAY A;  3BVC A;  2HWD 3;  1A6C A;  4GWM A;  3BKZ A;  1ZRC A;  2VBB A;  1C8M 2;  2W1W A;  1GLH A;  4GD4 A;  4H3W A;  4XIK A;  1YQ5 A;  5EP9 A;  2WZR 2;  4U36 A;  2DCT A;  3C2U A;  4YVS B;  1EV1 3;  2VEC A;  5F6L B;  2YUE A;  2B39 A;  1AL2 3;  3A0N A;  3D8C A;  3FFZ A;  3WNL A;  3JD7 2;  3THP A;  2A73 B;  4UFJ A;  5A7W A;  3NNL A;  1GZT A;  4ISQ A;  4K40 A;  3DV8 A;  5IK4 A;  1S4C A;  3T4H B;  5FXX A;  4LJH A;  2BNM A;  2OPW A;  2QUO A;  4OUM A;  2JDH A;  5A33 B;  4JHZ A;  1NZI A;  3MF9 A;  3O7O A;  4K3U A;  4MV2 A;  2JKB A;  4Q0V A;  4OZX A;  5EFU A;  2VVE A;  4WVV A;  1LOB A;  1AR9 3;  3O1O A;  3ZR5 A;  4BE3 A;  4E2G A;  5AC9 2;  2A6Y A;  4IEQ A;  1C8N A;  3L2H A;  5JPN B;  2GMM A;  3CMG A;  1C5H A;  2OW4 A;  2VMC A;  2DFB A;  2VTX A;  2JD9 A;  3B93 A;  2Q8D A;  1XND A;  1JOB A;  5KC5 A;  3FUQ A;  4AVC A;  1BJQ A;  2XWB B;  1Q8O A;  4JC1 A;  4D8M A;  1PVX A;  2ZGT A;  3NW4 A;  1CR7 A;  1ZBA 2;  4Y1X A;  5DDJ 3;  1R08 2;  4QQO A;  4I3P A;  4AFM A;  2ARC A;  4QB1 A;  2BOJ A;  2PAM A;  4ISR A;  1COV 2;  3WDT A;  5GZG A;  2HWC 2;  4BZ4 A;  4NVP A;  4RSU A;  1WLD A;  4AE2 A;  2N7G A;  2Y34 A;  2Z69 A;  2CL2 A;  1R1A 2;  1BK0 A;  1SMV A;  3SEP A;  5DAP A;  1CAW A;  1W8T A;  3ILR A;  3AL6 A;  5JPM B;  1GWM A;  4W8J A;  5IVJ A;  2FZ2 A;  2QBX A;  1MS5 A;  2E6V A;  3AMM A;  3VZL A;  5IVV A;  2BQP A;  2QQJ A;  4HVO A;  3WG3 A;  1J3R A;  1WA6 X;  2PN5 A;  3DL3 A;  2JEM A;  4HKW A;  1AX1 A;  5FYT A;  4Z2W A;  2G19 A;  2RR1 2;  2CDP A;  4AFD A;  5LEK A;  1N47 A;  3PHM A;  4YGC A;  4JCK A;  3H1Y A;  1GIC A;  3X29 B;  3THT A;  5C3O A;  4XDQ A;  4E2Q A;  3E5X A;  2FDK A;  1DCS A;  3BU7 A;  4P5H A;  3DXU A;  5CZK A;  4CCJ A;  4DB5 A;  4YSF A;  3PUH A;  5BNP A;  5C9A B;  5I0S A;  1K5M C;  4WZC A;  2D40 A;  2ETE A;  2X53 S;  1YJK A;  4QQH A;  1DGL A;  2R07 2;  3VBS A;  4QKD A;  4MYE A;  4C91 A;  1XE0 A;  2VG9 A;  1HIX A;  4IEV A;  1CAU B;  2VUJ A;  3GJA A;  1EP0 A;  1EPZ A;  2DUP A;  4DEV A;  4AFA A;  2GND A;  3AYD A;  1SQ4 A;  4I0B A;  4LNV A;  4YLZ A;  5C8W A;  1H30 A;  3J8F 3;  3KV5 A;  3GBF A;  2PMW B;  1RUJ 2;  4CCC A;  5K8S A;  3K48 A;  1QJX 3;  2BVV A;  1VIW B;  3I54 A;  4AI2 A;  5FYH A;  2ZA9 A;  1GUI A;  4HPK B;  4W6X A;  2DV9 A;  2ZAA A;  2ZEW A;  4XUR A;  4PIX A;  1OLQ A;  2ILM A;  1SFY A;  4CU9 A;  3WW1 A;  2K2S A;  4CCN A;  5JMO A;  4ATE A;  4Y1V A;  1RIN A;  5CBL A;  4LUK A;  3VDD C;  3TYJ A;  1HRV 3;  4KH9 A;  2GC3 A;  3Q9O A;  5G05 L;  1GZW B;  5ACA 1;  4JGY A;  3TEW A;  2WFF 3;  2DTW A;  4JRA A;  4Q4W 3;  2XQR A;  1H6X A;  3OGS A;  4EWE A;  3ZSJ A;  3DGT A;  2VNV A;  3U14 A;  1NE6 A;  1W9S A;  2HYX A;  2ORX A;  1OA2 A;  3WUC A;  3WSO A;  1ND2 A;  1HN1 A;  1Y7B A;  5L19 A;  1S2K A;  2EVX A;  2HH9 A;  3J4U H;  4O65 A;  4P9W A;  3KQ4 B;  3ZYF A;  1W9T A;  2ZMN A;  4RQP B;  4UBH A;  4NRO A;  3WW4 A;  2O0O A;  3ZDV A;  4DXZ A;  1EAH 1;  1AR7 3;  2XUM A;  5LK5 A;  2W87 A;  5A6X A;  2P5B A;  2QZ2 A;  3ILN A;  3WT3 A;  3U4X A;  4EZH A;  4GH4 A;  4JX0 A;  1DGR A;  3PUS A;  5BNQ A;  2IXL A;  1ALY A;  1TVG A;  2CGO A;  4CCK A;  2GME A;  4CU8 A;  4Q0P A;  3TNQ A;  4XF9 A;  2GH8 A;  3ACL A;  1JS9 A;  4CEY A;  4ZHN A;  3A21 A;  4ZON A;  4AFC A;  5FZ9 A;  2PEL A;  4QXH A;  4BQY A;  1N3P A;  3CJI C;  1TNR A;  2DVG A;  4DIQ A;  1JU3 A;  2ZHN A;  4YM3 A;  1HB2 A;  3H3U A;  1GP4 A;  4J6G A;  1SHW B;  1VP6 A;  3PUI A;  1RJ8 A;  2HKX A;  4Y5T A;  2E7Q A;  3IMN A;  1W6M A;  4YW3 A;  4M3C E;  2BU9 A;  3ACF A;  1DFQ A;  5EJ3 A;  1UNB A;  4B4P A;  4FPH A;  5FZ7 A;  5H9P A;  4CZS A;  2UU8 A;  3HBK A;  3MIB A;  4IEZ A;  1MS9 A;  5L7O A;  5I91 A;  2JE7 A;  4QDR A;  2D3S A;  2VTF A;  4N7U A;  5T55 A;  4BPZ A;  5GLW A;  5IVE A;  1YFX A;  2B45 X;  2ZEZ A;  4B7K A;  1GWK A;  4LBJ A;  3ROU A;  4CUC A;  2R0H A;  5TSW A;  5LW9 A;  1ZYB A;  3JCI A;  1LOD A;  4RS5 C;  4CCO A;  5J7M A;  2Y64 A;  5C8C B;  1UMZ A;  1RVF 1;  4FFG A;  4LBL A;  2HBU A;  5GZD A;  1OOP A;  3O1R A;  4TTG A;  2HWB 2;  4Q1P A;  5T52 A;  5I0D A;  1CJD A;  3T30 A;  4M3C B;  2D6L X;  1OUX A;  2ARA A;  1NLR A;  1POV 1;  3H3Z A;  3KGZ A;  3SQO A;  5DUX A;  3RVH A;  2D6N A;  1J84 A;  1QNW A;  5FZO B;  3WLU A;  3CZJ A;  4CEW B;  3VD4 A;  3WR0 A;  4P9L A;  1AR6 2;  2VL4 A;  3GCW A;  1LOF C;  1VRB A;  2EAL A;  3NKG A;  1POQ A;  4I0W B;  3ZFG B;  1ONA A;  5FJH A;  1V6O A;  2WNO A;  3ETQ A;  1G86 A;  2JG8 A;  3N7L A;  3TWI A;  4O9E A;  5CNA A;  1DQ6 A;  4NAM A;  5J48 A;  2BDR A;  3H50 A;  3P6B A;  4PIY A;  5H9R A;  2ZHL A;  4KWL A;  5JSO A;  3RNS A;  2WO2 A;  4KWJ A;  1H9W A;  3PTY A;  5D8A C;  3DKQ A;  3URF A;  1DZQ A;  3I2I A;  3GZE A;  4U2A A;  2ZGM A;  1DQ5 A;  3RZL A;  3FLP A;  1LTE A;  1RMU 3;  3ZXF A;  3NL1 A;  3ACH A;  4IQP A;  4K21 A;  4WM7 B;  2XVK A;  3PJQ A;  4YG0 A;  1EY2 A;  4Y3O A;  5JI9 A;  4RGK A;  3POI A;  2YFZ A;  5CG9 A;  3MID A;  3BUC A;  2JWP A;  1YIF A;  3N9Q A;  4QXB A;  4EN9 B;  1RL3 A;  4UW5 A;  1AJK A;  1W0P A;  3AZZ A;  5FQ0 A;  2OX0 A;  1BBT 1;  4NE9 A;  4N53 A;  2W46 A;  1PNG A;  4HN0 A;  2RG4 A;  2WWJ A;  3QBQ A;  3M3Q A;  2VD7 A;  5FLH A;  1GAN A;  5LK7 B;  1SBF A;  1HJF A;  4IE5 A;  5FY8 A;  4D7Y A;  4Y20 A;  4AW7 A;  1WUV A;  2JIJ A;  1RUF 3;  2ZGN A;  3KWV A;  1LOC A;  4CUG A;  4YM1 A;  3E5U A;  2D43 A;  1TNF A;  2R04 1;  4XFF A;  4FPG A;  1PO1 1;  4NIH A;  4YYO A;  1VBB 1;  3ZPO A;  4COY A;  4O61 A;  1PM4 A;  3MIC A;  2ZX3 A;  4GJY A;  1H1M A;  2VR4 A;  1PZ9 A;  3LA7 A;  3GHM A;  2WUH A;  4XW3 A;  2JIG A;  5JI7 A;  2IFR A;  2QTW B;  2P3I A;  2RMU 2;  5T5J A;  3VZO A;  2B4K A;  5IHR A;  2LRP A;  2W47 A;  1ENX A;  4QQ2 A;  5FY5 A;  5LBC A;  1BVV A;  1UX7 A;  3FHA A;  4IW3 A;  3WV6 A;  2PYT A;  3WZ1 A;  4IGO A;  5FOJ B;  2DUO A;  3OY8 A;  3AL5 A;  1X9T A;  4EN7 B;  1R09 3;  1DHK B;  2W2I A;  5FXV A;  4BK4 A;  2ZJC A;  4UF0 B;  4CRQ A;  5BYN A;  5F1R A;  4IDZ A;  2WDB A;  3ZXD A;  1MPX A;  2P1B A;  5BNN A;  3LA2 A;  1XYP A;  2DWR A;  2FDF A;  3B5L B;  3VD9 A;  3EBR A;  1AR7 2;  3RYR A;  3ZO0 B;  1XPW A;  2CY6 A;  1Z7S 2;  5HCA A;  3KGL A;  3AP5 A;  1H8T C;  2XXZ A;  2R06 1;  5F2S A;  2HWE 1;  4HXC A;  2XBO 2;  3LGR A;  1NLS A;  2XL9 A;  1XBF A;  4E27 A;  1VBD 3;  2LAL A;  3IPV A;  1HV1 A;  5FXZ A;  5JIA A;  3ZN4 A;  1AL0 G;  4FBF A;  3MV1 1;  4OHW A;  4OUE A;  5A1A A;  4Y1Y A;  1GZC A;  4LK7 A;  2RJK A;  1ZBE 1;  4AEK A;  2HLE A;  3T1L A;  2BV4 A;  1PVC 2;  1MVE A;  2MEV 3;  1ASJ 1;  4FCA A;  1XSR A;  4UXA A;  3OD4 A;  2JX9 A;  5LA0 A;  1JHN A;  2RS1 1;  1ZZC A;  2B5H A;  2ATF A;  2D5H A;  3DF0 A;  4QKN A;  2XWJ B;  4WVM B;  4LHN A;  1W6P B;  3KHC A;  5F9T A;  1TMF 2;  2ARE A;  3WD5 A;  1BXH A;  2A6Z A;  1WCK A;  1RXF A;  2AC1 A;  4BQX A;  4COU A;  1LR5 A;  1KFU L;  2ZX0 A;  4ITC A;  4Y1Z A;  2UUR A;  1RUE 3;  4Y5Z 0;  3WDW A;  4XCA A;  5A32 B;  4V1P A;  5HV4 A;  5J36 A;  1C8M 1;  1Q8V A;  2IXC A;  4HMZ A;  2PHU A;  4GUL A;  2WZR 1;  2XJU A;  1SG3 A;  3HN3 A;  4N43 C;  4FP2 A;  5HPO A;  4QB2 A;  2SBA A;  2NLR A;  2ENR A;  3BOW A;  4L8Q A;  2H0B A;  5LWB A;  2R32 A;  4W6Y A;  2PHF A;  5DMY A;  4FQ4 A;  1UZW A;  1IKQ A;  1UPI A;  2BUK A;  2YFU A;  4OZO A;  4LOS A;  3K46 A;  5D1I A;  3VDD B;  1NQD A;  1W6O B;  2PFW A;  2BRT A;  4DOU A;  1AR8 1;  2WA3 A;  3DUI A;  4BXS V;  3LQC A;  1UOB A;  3M70 A;  5AC9 1;  1HRI 1;  1NT0 A;  2Z79 A;  3EO6 A;  4XBL A;  1W06 A;  2G9F A;  3KT1 A;  3U78 A;  3VBF C;  3I2G A;  4LO6 B;  4YGD A;  3RMX A;  2VCB A;  4ES8 A;  1VBE 1;  3ME2 A;  4JGZ C;  2DDU A;  2BFU L;  3MUY 1;  1OPM A;  5ABJ A;  2JDU A;  1UL9 A;  2VCM A;  3AXD A;  4PDW B;  4ASK A;  3POY A;  1AUY A;  3AYA A;  1UAI A;  1R08 1;  4KG0 A;  1F5F A;  5K0U B;  4NID A;  1REF A;  2PLV 3;  2KA3 A;  1RUD 1;  4FPO B;  3O1V A;  2GU9 A;  3VBR B;  1HN0 A;  2DUR A;  4QX5 A;  3WUD A;  4UFK A;  4A42 A;  4OYU A;  4LIT A;  3WNO A;  5CA6 A;  1OPO A;  2X09 A;  1ND3 C;  4JQT A;  1YFY A;  2ARB A;  1GQH A;  2OUJ A;  3IB3 A;  1QJF A;  4JHT A;  4BWO A;  1FPN 3;  1W8N A; 
#chains in the Genus database with same CATH homology
 5FP9 A;  5FZ9 A;  2Q8E A;  4TN7 A;  5FZO A;  4QXH A;  4HON A;  5FY5 A;  4QXC A;  4V2V A;  5A7O A;  4EZ4 A;  5FZG A;  4DIQ A;  4IGO A;  3PUA A;  3AL5 A;  5FZB A;  2Q8D A;  5F3I A;  2PXJ A;  3KVB A;  3PUR A;  5FJK A;  5FZM A;  5FZD A;  5FXW A;  5A7W B;  5FPV A;  2OT7 A;  4CCL A;  5ISL A;  5FUN A;  2W2I A;  5FXV A;  4UF0 B;  3OPT A;  4BIS A;  5F5C A;  5FYU A;  5FZ7 A;  3N9P A;  2WWU A;  2OQ6 A;  5FYZ A;  3PTR B;  3UYJ A;  4D6R A;  2YU2 A;  3NJY A;  5F2S A;  2XXZ A;  3KVA A;  5IVE A;  4IGQ A;  3AL6 A;  4XDP A;  4URA A;  5FXZ A;  5IVJ A;  2OQ7 A;  5FYV A;  5FP8 A;  5IVV A;  5LW9 A;  4CCO A;  5A3T A;  4GAZ A;  5FYT A;  5F5I A;  3U4S A;  5FY4 A;  5F2W A;  5A3N A;  5FYS A;  5FZ4 A;  5FYI A;  5F3G A;  5A7P A;  5LY2 A;  5ANQ A;  4LIU A;  5FP3 A;  4LXL A;  3K3N A;  5FPA A;  4AI9 A;  5FYM A;  4CCJ A;  3DXU A;  5FYY A;  4DO0 A;  5FZC A;  5FZL A;  5F3C A;  4D6S A;  5FWE A;  2OS2 A;  2XDV A;  3RVH A;  5A1F A;  5FY7 A;  5KR7 A;  5FZK A;  5FZO B;  4AAP A;  4BU2 A;  4QWN A;  5F39 A;  4XDO A;  5IW0 A;  1VRB A;  4Y33 A;  5A3P A;  5FY9 A;  5IVC A;  5FZF A;  5FZ1 A;  2GP3 A;  5FJH A;  5FP4 A;  5FZH A;  4BXF A;  3LD8 A;  3OPW A;  2YBP A;  5A3W A;  5F3E A;  3KV4 A;  3PU3 A;  5FZE A;  4EYU A;  3KV5 A;  4D6Q A;  2XML A;  5LWB A;  5FZ0 A;  3K2O A;  3N9N A;  5FYH A;  3PU8 A;  3PUQ A;  5A80 A;  5F5A A;  5IVB A;  4HOO A;  5CEH A;  5E6H A;  5FPL A;  5FV3 A;  4CCN A;  4CSW A;  4Y3O A;  5A7S A;  4QX7 A;  4C8D A;  3K3O A;  4LIV A;  3LDB A;  5A1L A;  5FUP A;  3N9Q A;  3DXT A;  4QXB A;  5FYC A;  5IVY A;  5IVF A;  3U78 A;  5FPU A;  5F32 A;  3KV6 A;  2OX0 A;  5FWJ A;  5FZA A;  3PDQ A;  4NUB A;  2YBK A;  2YPD A;  2GP5 A;  5FZI A;  5FZ3 A;  4ASK A;  2XUE A;  2WWJ A;  4GD4 A;  5FP7 A;  2VD7 A;  4QX8 A;  5A7N A;  5F37 A;  5FY8 A;  5FBJ A;  3AVR A;  5IWF A;  4Y4R A;  3AVS A;  5FZ6 A;  2Q8C A;  3N9M A;  5FY0 A;  5K4L A;  3ZLI A;  4CCM A;  4CUG A;  2P5B A;  2YU1 A;  2YBS A;  5A7W A;  4LIT A;  5LY1 A;  3N9L A;  3ZPO A;  5FXX A;  5A7Q A;  4EZH A;  4UF0 A;  3PUS A;  4GJY A;  4GJZ A;  3N9O A;  4CCK A;  5FYB A;  5FY1 A;  4V2W A;  5FPB A;  4E4H A;  4IGP A;  4QU1 A;  3KV9 A;  5FZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...