4QXCA

Crystal structure of histone demethylase kdm2a-h3k36me2 with nog
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
329
structure length
329
Chain Sequence
RTFDLEEKLQTNKYNANFVTFMEGKDFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIEMTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPSTVDFIDWVDNMWPRHLKESQTESTNAILEMQYPKVQKYCLMSVRGCYTDFHVDFGGTSVWYHIHQGGKVFWLIPPTAHNLELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSGWIHAVYTPTDTLVFGGNFLHSFNIPMQLKIYSIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKDFQKESLSMDME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/structural protein
molecule keywords Lysine-specific demethylase 2A
total genus 109
structure length 329
sequence length 329
chains with identical sequence C
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4qxcA01
3KV5A 3ZLIA 5CEHA 4BU2A 3K3NA 5F2WA 3LDBA 2YBPA 3OPTA 5FP7A 5F5AA 5FZ3A 5E6HA 5FZGA 5A3WA 2GP3A 2WWUA 4AAPA 5A7SA 4XDPA 4IGQA 5FUPA 5FZKA 5FZDA 2VD7A 5IVJA 5F3GA 5FYCA 4QX8A 4CCOA 4HOOA 5FYIA 5FP4A 2YPDA 4ASKA 2YBSA 5FWJA 3PU3A 2PXJA 3AVSA 3UYJA 5FPLA 4QWNA 5A3TA 4QX7A 4C8DA 4TN7A 2OX0A 2XUEA 5FZ4A 4Y4RA 5FZ8A 5ISLA 4GD4A 5A7WA 3PDQA 4QU1A 4CCJA 3KVAA 5FPUA 2GP5A 2XXZA 4D6QA 5F5CA 4D6SA 5ANQA 5A1FA 3KVBA 5A7PA 5FZEA 4CUGA 5FZLA 4D6RA 3N9OA 5FY1A 5IVEA 3NJYA 5IVVA 5FYSA 5FYMA 5A7QA 5FZHA 3RVHA 4V2WA 3PUSA 5FY9A 3PUQA 2OQ7A 3AVRA 2Q8DA 3DXTA 5FXWA 5FXZA 4BISA 4EZHA 3KV6A 4V2VA 4DO0A 4HONA 4URAA 5FP3A 3PUAA 4EZ4A 4EYUA 3PTRB 3KV9A 4CSWA 5FBJA 4GJYA 5FP9A 3N9LA 3K2OA 5F32A 5FY0A 4GAZA 5FJKA 5FY8A 5FYYA 5FY5A 2Q8EA 5IVCA 5IWFA 3LD8A 5A3PA 5FXVA 5FY7A 5F3CA 5LW9A 5FYVA 4IGPA 4QXHA 5FJHA 5FV3A 4IGOA 2OQ6A 2XMLA 3AL6A 4UF0B 5FXXA 5F3IA 3KV4A 5F37A 4LXLA 3PU8A 2OT7A 2WWJA 2OS2A 2XDVA 5FPVA 5A7NA 5IVYA 5A3NA 5LY1A 3PURA 4BXFA 5LWBA 3U78A 5FP8A 5FPBA 5FZ1A 4LIVA 5FZ7A 3OPWA 2W2IA 5LY2A 3K3OA 3DXUA 5F2SA 5FZFA 5FYBA 5FZMA 5FZ6A 5F3EA 5FY4A 3ZPOA 4Y33A 2P5BA 4UF0A 2Q8CA 5FYUA 5K4LA 3U4SA 5KR7A 5FZ0A 5FYTA 5FZCA 4CCMA 4CCLA 5FUNA 5IVBA 2YBKA 5FZBA 4Y3OA 3AL5A 3N9MA 2YU2A 4LITA 5FPAA 5F39A 4GJZA 4XDOA 3N9QA 3N9PA 5IW0A 4CCNA 5FZAA 5A1LA 5FYZA 4QXBA 5FWEA 5FYHA 4QXCA 4AI9A 5A80A 5IVFA 4LIUA 1VRBA 5F5IA 4E4HA 3N9NA 4NUBA 5FZOA 2YU1A 5FZ9A 5FZOB 5A7WB 5A7OA 5FZIA 4CCKA 4DIQA
chains in the Genus database with same CATH superfamily
1RUH3 3ZLIA 3BIWE 4JZRA 2KM2A 3LSDA 3MEPA 3SCFA 2XR4A 4DXSA 4G3YC 5LA0A 2ZXQA 2ZAAA 1OKOA 1W6QA 3OYWA 5A3WA 1LHWA 2WS91 4BB3A 1DYKA 4FVVA 4XCAA 4TZDA 4IGQA 1UYZA 4YZ3A 3DF0A 3TRSB 1QNWA 3WNOA 5KBFA 2VBDA 1PK6B 4UFIA 1DF0A 3ZYHA 5DAXA 2F4PA 1UIKA 2TBVA 2YPDA 1CR7A 4P9GA 5F5QA 3UKNA 2RMU2 2ZCWA 1ZBE3 4C0HA 4JQRA 4YW4A 2XUMA 2DVAA 2NN8A 1X8EA 1D4M2 1H6XA 1BKZA 3ZDVA 1R091 3CJIA 3C2UA 1DGRA 2F6BA 2OA2A 4OYUA 3MHZA 3RSJA 2VTXJ 1YQCA 3EB7A 2VVEA 1ULEA 1YEWA 3KF3A 2VXJA 3CJIC 2DCTA 2BPA2 1K12A 1OA3A 4CXYA 3BOPA 3WDUA 1PVC1 1U5IA 4UXAA 1DYOA 4P9IA 3IKWA 3D0SA 2ZHNA 4JGZB 2ZGMA 3NAPB 1EV11 3VBHA 2B46X 4MGSA 4WM8B 3ACIA 4P9LA 4AEMA 2E31A 3I2GA 5C3QA 4META 1SFYA 1RUG3 2YROA 3IDEA 3ILNA 4JQTA 4O7XA 4ZHNA 3O1PA 2QCSB 2UY8A 2PMWB 3MFCA 4M3CE 4HN1A 3M70A 1UCXA 2BW8A 1WD4A 2BWAA 2CAVA 1ENXA 2R6QA 4NO4A 4HBNA 4TXWA 3NV3A 5DN2A 3DGTA 3JXSA 3K2OA 1SDWA 3WDWA 2WO1A 3H50A 1ZRCA 3LD8A 4B8EA 4G9SB 3VUOA 4NJ4A 1OXCA 2V5YA 5FR3A 5FJHA 1N3OA 2CYFA 4OVEA 3HR9A 2RDRA 3PTYA 4OFGA 1MZ5A 4UF0B 3HJRA 3B00A 1JZ6A 3NNLA 2RVAA 1XE7A 2LTNA 2Y8KA 5A3NA 1UPIA 4S2DA 2IXLA 3HWJA 2X5IB 2VU9A 2QQUA 4W6WA 1QGLA 2BV4A 3J26N 5FZ1A 2JE8A 1RMU3 1CAXB 2V09A 5IK4A 2OW4A 2HWF1 2VOVA 2NP0A 1GNHA 1YXWA 4B7KA 1YRZA 4LKSA 2FD8A 3WF2A 3URFA 3LGRA 4J6GA 1HV0A 4A6OA 5I0UA 4FFIA 4L92A 4IEZA 3NV2A 4JAAA 4COYA 1RUI2 2EXKA 1O3RA 1WA6X 2BVVA 3B01A 2IVJA 3ZSMA 1QJY3 5FMCA 3FMGA 4GJZA 3ZN5A 4LHLA 1RVF1 2JIJA 2MEV1 4CVUA 2R071 1SFNA 2RM21 3WHTA 1VBA1 1AL23 4LO7A 2GNTA 2VG9A 5FYZA 3S7IA 3ZMNA 3CKHA 3I2DA 3ITQA 1VP6A 2ZX1A 2W94A 4RGGA 4XUPA 1UXZA 2DBIA 4K1YA 5DZFA 5CADA 5ABJB 4Z82A 5HV4A 5FZOA 2E32A 4LO4B 2ETEA 2JE7A 4PIZA 4LA2A 4CXWA 3WEZA 2QNKA 3WCRA 1UZ0A 2RS11 1OBNA 2WAAA 3MLJA 3LDBA 3ZSJA 4CEYC 3VZJA 1WGPA 3V0BA 4QKDA 2BBAA 1XYOA 4QKNA 3LIGA 5A1AA 4HVQA 4D7TA 3U11A 1PK6C 2CY6A 4CCDA 1CONA 2JICA 4GWJA 1HXS1 4XF9A 1S0GA 2ET7A 1E57A 4KL1A 3RYKA 1UZZA 2PHFA 4LUMA 4W6XA 5B4XA 3VKLA 5FDBA 1SZBA 1TG7A 2VL4A 2ZA9A 3S0MA 1OLQA 1OMIA 3TOJA 1GQGA 2ZX4A 2IXHA 4V1PA 1B09A 2I2SA 5A3TA 2DCZA 1V00A 4TN7A 5JPMB 3WF4A 3RPQA 1HB2A 3LA3A 5J96B 2H6BA 2WNUB 4IEOA 5C33A 4QU1A 1MEC1 1FOD1 2H0VA 4GWMA 3USSA 2Q8OA 2GP5A 5DZEA 3MIHA 1WBFA 1RGSA 2WBKA 5L19A 1LENA 1Y9MA 2DUOA 1SG3A 3MO4A 1BK1A 1RXFA 2WFF2 3FHIB 1QJZA 2VW2A 4YPJA 3RZMA 3MW3A 1XU2A 2VCMA 4N53A 4Q2FA 1LOGA 1CQ9A 2DBNA 4QGLA 1OH4A 2GSYA 1GICA 3GYDA 3I49A 2B9UA 4JGYA 1B35B 2XJTA 1OLMA 3BVCA 3RYPA 1RXGA 3LOBA 1MQTC 2D44A 1S1AA 1W0PA 2E7QA 2A73B 2UURA 4FOQA 1KXGA 4FFFA 5LZ6A 5BNQA 1GOHA 2XHKA 4LBKA 1JHJA 3B94A 2D6LX 4XJUA 2OVUA 3IT8A 3RI8A 5CYYA 4FPOB 2BNMA 4AI3A 1VMJA 4PI0A 2AH2A 4QXHA 1FX5A 2QDRA 5GLWA 3WT3A 2NPIA 2VY0A 4EJRA 2R063 2VAUA 1NA1C 4WM7A 5CFCC 1W6NA 4G4FA 4LJHA 2BTVC 3VZKA 3Q8FA 2ET1A 2C26A 2Y6KA 2JX9A 1V9U3 4GKXA 1HJGA 2A7AA 2XQRA 1PNFA 1ASJ1 5FMOL 2W1SA 3CBNA 4PLNA 4QHOA 1ZYBA 4NHLA 1FYUA 4PLMA 5BNNA 3TYJA 4MX3A 1RHI1 5C9AA 1QJY2 5C5UA 2A75A 4BWOA 5C3RA 4IV1B 5KR7A 5BNNC 4CCLA 2VQAA 4MGZE 1GP4A 2JENA 4MLOA 5C7GA 2J1VA 4FOVA 4AFCA 3MICA 5HCAA 3WNKA 3VKNA 4QDRA 4WVMB 1Q8QA 3RMYA 2P37A 3HNBM 1UO9A 2RV9A 5JZGA 3AP4A 4HSJA 1NCRC 2VOTA 3VBFB 5F8PA 3WF0A 2VW0A 1H8TC 1A78A 1V6MA 1ENRA 1AYN3 4H55A 3VBOC 1NA1A 4WM7C 3UGFA 5CFCA 2MEV2 4C0BA 1RVF2 1AF9A 1DGLA 2BFUS 2O14A 2P3KA 2X8KA 3SITA 4ES8A 4FPGA 3BODA 3MV11 5JIUA 3GJAA 4A7YA 5KC6A 3POFA 2GNMA 1KRIA 3L2HA 4Y1VA 1D2QA 1QJX2 4MXWB 2IUWA 4CCOA 4YRDA 3POIA 2VUJA 2WRAA 1O4ZA 2PFWA 1LHUA 3GF6A 2WZR1 3O14A 1AJKA 1VMHA 5IK8A 4EE2A 1T6BX 4YSFA 1RC6A 5FPLA 2Q1ZB 4Q4W1 4DUWA 4QPGA 3SLIA 3SKJE 4Q0VA 1X36A 2ERFA 2RE9A 4Q0SA 1U5ZA 1WW6A 4N9IA 1NCQA 2A5ZA 3ZFEA 2N7GA 5DMYA 4Z07A 2WYSA 1ULDA 1BQPA 3I59B 3MF6A 3PVNA 5ANQA 5L7OC 3KVBA 3NL1A 3ZFGC 2ZGOA 3KT7A 4OHYA 1OUXA 1QJX3 5JI7A 2ZX3A 3WDYA 1PGL2 1TNFA 1TZOA 2QQWA 2MNGA 3RVHA 1OOPB 1RJ7A 4V2WA 4YW6A 4E4SA 5H9RA 2PHWA 1FXZA 3LIHA 2EALA 4WBBA 4X8PA 4EZHA 4GKYA 1RUF2 3ZFFA 4B7EA 3MDPA 3SH3A 5JOYA 4JVAA 1HRV1 2HWE3 1RYYA 4KG8A 3JB4C 5FBJA 3R4UA 3ZXEA 4DB5A 1EAH1 3UV9A 2BNOA 2OIIA 3ZN6A 1MZEA 4RHV1 5EP9A 2AENA 4Z1VA 5EIYB 5JIAA 1DLCA 1XC6A 4DQAA 2GC0A 4RQPC 5DAWA 4DUVA 1YJLA 4F3JA 5KHKA 2XJQA 3JD73 1VBC1 4IE6A 4I09A 4NPLA 1YCIA 4LPLA 3A22A 2GDFA 2Y0IA 3U07A 4OUEA 5FMDA 1AR63 2XDVA 4YFWA 1OLME 3R6SA 4MZUA 5D8AB 5KHIA 3ME2A 5DUVA 3GZAA 3U78A 1W3VA 3PHMA 4FPEA 2GALA 1CZSA 3LEMA 4MGYE 1APNA 1DZQA 1QH6A 2I45A 3DXUA 2JDKA 1QJU3 3LDKA 4XFAA 5FZFA 2IFRA 1NUKA 3ES1A 3T08A 1JYWA 2QQKA 1RUH1 3HN1A 2ADEA 4FQZA 1ULPA 1OA2A 1OOPA 3WNLA 3A23A 5GJ6A 5A3UA 5F1RA 4FTSA 3JBG2 2GN7A 1YJKA 5FK8A 1ZX5A 5JI9A 5L9BA 1O91A 2C4XA 3N9MA 3N3HA 2VQ0A 5EPAA 1FT9A 4IDZA 2VQTA 1DFQA 3FLTA 3GZTB 2XLAA 2JWPA 1RB8G 5A1LA 1O59A 1HRI3 4QXCA 1F4HA 1ZBE1 2D6PA 4D0QA 3VD3A 2EXIA 1V6OA 5LB6A 2SBAA 1J3RA 3FFQA 4HANA 5FKBA 4JGYB 4CDWA 5C9AC 2ZGLA 4AQSA 2LM3A 3WW2A 1NQJA 1W9TA 3KV5A 4A7ZA 5GZCA 2BU9A 5GZEA 3J8F2 5I0DA 5FOJB 2WSUA 1AR71 5FO7B 1LR5A 4AHWA 3GNEA 1KD7A 2YDEA 3SCHA 3BKZA 3UGGA 2A6XA 4GMP0 3JCIA 4XW3A 1LESA 3VD5A 1HQWA 3OF1A 4PF5A 3K51A 1H4GA 4XDPA 3PL0A 4XXAA 5E16A 3RWKX 1YC61 3SH4A 2Y64A 4LA3A 4KGGA 4BE3A 2EAKA 3MLLA 4Q0PA 5FTTC 1RUJ1 1GOFA 3VHNA 5JSRA 1RUD2 2C5DA 4B29A 4RQPA 4CDUC 3IB3A 2TNFA 3DPRA 4IE0A 5H9SA 3MUZ1 5HI0A 3IPVA 3FHQA 4ITCA 4TWTA 3VGIA 4AEDB 5I8TA 2WNUC 2W5FA 4QX7A 3NO8A 1J3QA 2OX0A 3AMNA 3I3BA 3UJOA 5L9VA 1UX6A 2VCBA 4COVA 3T2TA 2J1RA 3MYXA 5L7OB 1Z7S1 2JDHA 2KD7A 4FAHA 1LOFC 2FQPA 3O1OA 3FLRA 1CWPA 2WS93 5F5CA 5HXMA 5EZWA 4O9EA 4OUSA 5EV7A 4LORA 5FZLA 2JG9C 4JKLA 4MUVA 1Q8VA 4DFSA 1WUVA 1XNBA 2AC1A 3KF5A 2GC2A 3NJYA 1BMV1 1C8NA 3UJQA 4E2QA 1TMF2 1VBB1 2BUKA 5A7QA 3OEAA 5CFCB 4XAAA 3CF6E 4AK3A 4R9CA 3B69A 2J1TA 3AVRA 1OSGA 5E88A 5BNPA 5IFPA 4CEYB 5FP3A 3ZR5A 1PGSA 3T3YA 2LW8A 4PIXA 4XFHA 5DUXA 1NOVA 4K20A 4AI0A 5DDJ2 5FY0A 2Q1FA 4Q4V2 3J7LA 4HSLA 4QPGC 4OUMA 3M3EA 3SH5A 4R4ZA 5D8AA 5AFEA 3HBKA 3OGVA 2JG8B 3POYA 2YB7A 3UKVA 4FSJA 2IFWA 2IWGB 2P1BA 3O0XA 3VDDA 2CV6A 1UX7A 2VMDA 4JGYC 3MFAA 1RUG1 3JB8A 1NY72 1ND2B 1VBE2 2PN5A 3J9SA 1IKPA 3LOIA 2EICA 3QD6A 4AR2A 2D6NA 3OOXA 5KXCA 1MS3A 1X82A 1V6LA 3PIGA 1SLTA 1S0FA 4TLFA 4CE8A 3POBA 3D6EA 3SQOA 1F5FA 3GHMA 4QHZA 3ZPOA 4E2SA 5FLJA 1DCSA 2Y6JA 4BIFA 1COV3 1SHWB 2XVLA 5T50A 1NAEA 1A34A 2J1AA 2GNDA 4BPZA 2D40A 2GH2A 2JJ6A 4Q5OA 4DXRA 3AL5A 5FPAA 3P3PA 3KCCA 4IEUA 3T1MA 1BBT3 3KLSA 5CAZA 1AL0G 1W06A 3IWZA 2IXIA 1XOYA 2GAUA 2BBVA 2GC1A 2K46A 3LSEA 1L7RA 4I0BA 4XHXA 1R082 2NYYA 4Q8KA 5KXDA 3GGLA 4GQ7A 4FPJA 5EJ3A 4FO9A 4NUBA 2HWF3 4ARYA 5A7WB 4B4RA 1PIV1 3VKOA 1GYKA 1JS9A 2XJRA 4MSVA 3TNQA 2QKDA 3ZM8A 4AFMA 2RJ2A 4A7KA 1J84A 4RS5B 1FOD3 2E53A 3VBSA 5T54A 2O1QA 4HPKA 4K8RB 2ZMKA 1W2TA 3WP4A 3ZYJB 5D21A 5DQ0A 1QJY1 3TEYA 1UU6A 5KHHA 4AGVA 1KGYA 4XMAA 5SV5A 1BMV2 4QQ2A 1POV1 2R073 2RM23 1W90A 2CDPA 4CDUB 1AL21 2ORXA 5FP4A 3EYPA 1LU1A 3TWIA 3EO6A 3JZVA 4BISA 2VXRA 4LR4A 1EUTA 4PBOA 1JH5A 4OQ9A 3OBAA 1I5PA 3CJIB 4N7UA 4UYBA 4NROA 5HPOA 3LEIA 3BN6A 4XETA 1LB2A 1LKNA 4Y1YA 3W9AA 1LOBA 3WDVA 2ZHKA 4CXXA 2OPKA 4MO3M 1PO13 2QQNA 2B4KA 2BOIA 3SEEA 3TEZA 1ULOA 1N1YA 1DZTA 3NW4A 1VAMA 4NHXA 4RS5A 3OSDA 5LK5A 4H2AA 4A41A 1RUD1 4LKEA 3D3AA 3HN3A 1QNYA 1FATA 2FCVA 2JD9A 5FZEA 1XNKA 4EN9B 3KCXA 1GMMA 2DU0A 4PIYA 3O1RA 2XWJB 3CU7A 3HBZA 4ASLA 4PDWC 2VOWA 4WM8A 3THTA 4CEYA 1W9FA 3B5LB 4YVSC 4CEWC 2RDNA 1FPN3 1VBD1 2VUAA 1V9U2 4NPMA 1RIRA 2AR6A 2WSVA 5FZHA 2W92A 2Q8DA 4F8AA 1FNZA 3DXTA 2DDUA 4BHPA 4BQXA 3C7GA 3EBRA 4O61A 2HWB2 3PUAA 4M0HA 2R16A 3OGRA 3PTRB 2PLV1 4D94A 3FUOA 4YZ1A 4HKWA 3VDAA 3MIDA 1U5YA 1KDMA 5A32A 3I2IA 1W6MA 1YNAA 3ZFFB 5CKQA 2WFPA 4W65A 1JU3A 2R0FA 1NCRB 3M7AA 5CG9A 1FAYA 1F31A 2YY1A 4ATFA 1QQP2 4CCEA 2CGPA 1Q8PA 2DFCA 3AL6A 1D0GA 4RSUA 1LAJA 3PNAA 1RTVA 2NLRA 1PO23 2OS2A 2FDJA 1KS4A 3BCWA 5JUVA 2VOXA 2CU5A 5CG8A 1JN2P 1O7FA 1BCXA 3ALQA 2RJKA 5IAVA 3OEBA 3U1XA 2ZGNA 5FO8B 1RINA 1OC1A 1YQ8A 1LODA 4Q27A 4QKFA 1AYN1 5CKNA 3GDBA 1QWRA 1QJEA 4IV1C 3ZFGB 4YM2A 3NJVA 1MS5A 5JXIA 3HQXA 5DPNA 5K4LA 3M1HA 4ZKTB 5G04L 3U4XA 2ZEYA 1D4VB 5IK5A 2BGOA 3AZWA 5FPXA 3VZOA 4Y1UA 2W91A 4CCNA 1UPSA 4QKBA 4CDQC 2EIEA 1C1FA 1BYHA 4HKLA 4WVZA 5GLZA 2WZR3 5LK7B 4GH4C 4CPBA 4QB2A 3FX3A 1XBFA 1F9KA 5JVVA 1W8OA 2OZJA 1DHKB 3BUCA 4XPVA 4LT5A 1HRV2 5AVAA 2BGCA 1QIQA 3GZEA 3K3NA 5F2WA 1OQDA 3CNAA 3WNMA 1COV2 1HLCA 4BMBA 1GNYA 2Z4FA 1AR93 3CIHA 2ZGTA 1BVP1 4QB6A 4AHZA 2JEMA 1C57A 2D3PA 5A7SA 4AAPA 1PGL1 4KG0A 4KBBA 4LBJA 3RZLA 3R05A 2WL1A 4NOTA 3I4IA 5H9PA 3H3LA 1G6NA 1RUF3 3I8TA 5DUWA 2XVKA 5DAQA 2RS52 2SLIA 2ZGRA 3AVSA 1IOAA 3FLPA 3O1UA 2JDNA 1PM4A 2WQZC 3POJA 4ZZ5A 2QQVA 2PHRA 2R1BA 1QOTA 2ZGUA 3MIFA 4OMCA 4ZXKA 1J1TA 1HRV3 5K9YA 5C5TA 2FDKA 1UD1A 1IPJA 2LRPA 4PQ9A 5FIXA 1IS3A 3MW4A 3SCGA 4DRRA 1HIXA 5K8SA 1HDKA 4D6QA 3KHBA 4SLIA 3BYWA 1F35A 4JV4A 1NZIA 2W1WA 4WVWA 4IV3C 5DG1A 1WMEA 3AZVA 3M3OA 4D69A 4YG6A 5FY1A 4N53B 2PHTA 1YFWA 1DQ5A 1RMU2 2HWB3 1W3XA 1WCKA 1OURA 1KFUL 1S0CA 3J7MA 1C1LA 2PELA 5FUIA 2RS53 2Y6GA 3AX4A 1SPPA 1NE6A 3J8F3 4Q4W3 3KWVA 2LUWA 2JECA 2VMGA 4XIKA 4AI2A 4XUQA 1DBNA 1VMFA 2QZ2A 1VE0A 4HFSA 3WP5A 5ABJA 3QH6A 2HEYF 1JYTA 3N9LA 4C1XA 1ULFA 4JDOA 1IG3A 4JTOA 2KA3A 4L2NA 1D0HA 3U14A 4UFMA 5FYVA 2J42A 1Y9GA 2QQJA 4Z8BA 5J09A 3ABZA 3VBSB 3AXDA 1CX1A 1GSLA 4N8MA 4X8NA 1W6OA 2XMLA 1O8SA 1US2A 5AFBA 4W8JA 5F37A 4I3PA 3ZXAC 2OT7A 2W39A 5LY1A 2ZGKA 1QF3A 4IEXA 4ZPIA 3UESA 4IV3A 2RMU1 2R49A 2ES3A 2JDPA 4PDWA 4WM8C 5KHGA 3C7OA 2ZZQA 3B02A 4BOWA 4Q4X2 5F2SA 1AYN2 1FI2A 4L9BA 2PYTA 1LECA 2DVGA 2PHUA 1ONAA 2PHDA 2QZ3A 4S2FA 5FYBA 5FZMA 3UL2A 5BNNB 2FZ1A 1X8MA 5FY4A 3ZR6A 4UF0A 3JQXA 1IPKA 2WS92 3NJXA 1H6YA 2Q8CA 1UXXX 3WY6A 5FYTA 5FRAA 5J36A 2PA7A 4BK5A 5FZBA 2WLQA 2E26A 3C7HA 2BGPA 3G6JB 3BTZA 5FMBA 1K5MA 3FWEA 2GC3A 4AF9A 3LFIA 4GB32 4QU2A 4XACA 1QJFA 2V72A 5EYYA 1SLLA 4FPHA 1CZVA 4KWUA 3GBWA 1RUJ3 4QMAA 5FYHA 1UMHA 2JB4A 2ZBJA 1GV9A 4QPIC 1SEFA 1TEIA 1MVEA 2WNVA 5T5JA 4CTEA 1LHOA 3ENRA 4COWA 3BTXA 4FPCA 1MACA 3S7EA 4H3WA 1L7LA 1UY2A 3H1MA 4CYDA 3GBGA 3I3QA 3OPTA 4O9GA 1Z7S3 3VDBA 2UWAA 4P00B 4XUTA 1BEV1 1QKQA 5A32B 4QM8A 2BQPA 1F8VA 1O3TA 1AX1A 5FZKA 2VD7A 4QX2A 4DOUA 5F3GA 3RWNA 5DXDA 4HOOA 4XIOA 3ILRA 5FYIA 1HRI1 1Y9QA 4RYDA 1URXA 2DTYA 2IXJA 1TME3 3RNSA 3UYJA 4AHXA 3D8CA 4JDNA 3V0AB 4QHBA 2FDHA 5FZ8A 1UYXA 1JOJA 3A4UA 3JD72 3VBSC 4I30A 3QOPA 5FO9B 2WN2A 1NXD1 5FPUA 4INDA 1SBEA 5LBFA 1JYCA 1MVQA 3W59A 4D6SA 1CAVA 3KHCA 1O3SA 3WG2A 4D6RA 4IETA 2O0OA 3BU7A 2ZMLA 1DQ0A 4OHXA 4XUOA 5IATA 2PHLA 5CBLA 5JR2A 3M8LA 1IS5A 4AWDA 4L11A 4FTBA 3ZIXA 4FXKB 4A44A 2VUCA 2NM1A 2E6VA 3M3QA 3ACHA 1DZRA 4P9XA 3MUY1 3VBFA 2HJIA 2V4VA 3THCA 2VQUA 3X29B 4AFAA 4MGKE 4X6QB 2MPFA 3OJBA 1AXZA 4GAZA 4M00A 2VTFA 4X6RB 5FJKA 5JXHA 3I2FA 4QXKA 2WDBA 3E5XA 3RZHA 4NIGA 4KQ7A 3GXUA 1CAVB 5EJ1B 1OD5A 2R072 2RM22 4IGOA 4QT6A 1VBC3 3WG4A 1UWWA 1ZZ8A 4QX3A 3AB0A 1OLRA 5FPVA 3WDXA 2YZ4A 5IJRA 3RQ0A 3VDDC 1SFPA 4YVWC 1WMDA 3Q8BA 4QPYA 1RUC3 1POQA 4MADA 2VNRA 1J59A 4LIVA 3WF1A 4I2OA 4MGQA 4K9SA 5AC92 2VZTA 1AL22 1ZBA3 4DPNA 4LE4A 1BZWA 2V5DA 5FZ6A 3KD4A 3LEKA 3H0OA 2ZKLA 4BQ1A 4EROA 5K0UC 3T30A 1W8FA 4BQ3A 5JMOA 2WNEA 3N7KA 3WQBA 3PIJA 3H7JA 3ZFEB 1V6NA 4AQTA 1VRH2 4BQ2A 5A3MA 2A1XA 1CJPA 1QXPA 1U5XA 3AJYA 4IXLA 4CP1A 1PIV2 4AOCA 4NAMA 1S0JA 3KZ4C 5G05L 2GMEA 5C8CB 4A42A 2ZMNA 1E5HA 1MR5A 3HQUA 1QEXA 1ZA4A 1W39A 1QDCA 1OF3A 4HMZA 4PBPA 1ZVFA 3W20A 2FDFA 5DDJ1 1N47A 3KQ4B 4NVPA 2ZEXA 2YGMA 4AVVA 4Q4X3 2VE1A 3M2MA 2Z5WA 1I6XA 2RHPA 4EN0A 2C0ZA 2RS13 4BU2A 2VCCA 1G9AA 1LGCA 1PM7A 4F83A 1HQNA 2VNOA 1RUI3 1S2KA 1YO8A 4MYEA 4TYSA 1YFYA 1BLZA 3DKWA 3HT2A 1IQDC 4ZONA 2JDZA 1ENQA 3KQRA 3H42B 4XYXA 3I97A 1MS0A 1S0EA 2YGLA 5AC91 2XBO3 4PI2A 4XEZA 4A3ZA 3C7EA 4WZCA 1WMXA 3FE5A 2XH6A 5IUQA 3QLQA 3BTYA 2AREA 1NLSA 4HVOA 4YARA 4YM0A 1DQ1A 1NY71 2CSGA 2AACA 3M4FA 1UZVA 4B4QA 2FMDA 1PVXA 3F95A 1E5IA 3AP6A 4CU7A 4PF1A 2PLV3 3EQEA 4K7JA 1R092 1WCDJ 2J1UA 2QBXA 4PQQA 2QTWB 4BXSV 2EAAA 5IAXA 5J3UA 1OVSA 3ACLA 3AMHA 4PT6A 3BI3A 1P8JA 5KXEA 3TEXA 5A7PA 2ENRA 4K1ZA 3AYCA 4CEWB 1JYVA 1JZ8A 3CZJA 2XL7A 3NSTA 1W8WA 2EF6A 5B2GB 3ZXLA 2YXSA 1R1ZA 4ONUA 2G9GA 4LO8A 4Y22A 1H2MA 1PO21 2D93A 2GMPA 4FI9A 2ZGPA 2D6OX 2E7TA 3PUSA 3OUJA 1NCQB 3PUQA 4RGAA 1YI7A 1QH7A 4NE9A 1H4HA 2OUHA 2W1QA 3J7HA 3KSCA 5BXXA 2WO3A 3ZFEC 3KV9A 4DIQA 1PO11 2C1FA 5FP9A 1IKQA 3RMXA 3ZFFC 1JU4A 3GBFA 5FY5A 2W3JA 2HWD3 4Y1XA 1W8HA 1GUIA 1MS9A 5C4WA 3VN4A 4ZZ8A 1F5JA 4E8DA 4RR3A 5FXVA 1Z7S2 1RL3A 1AR62 3WP6A 2WABA 4FFGA 4KWJA 2WO2A 2VOKA 4GIQA 2BJSA 4LMFA 3QCWA 2ZKNA 5JZGB 3OCPA 4IERA 3RRDA 4NPRA 3KV4A 2G9FA 5CFDC 4LBLA 1DGRN 1JBCA 1ZRDA 4GZ9A 5TSWA 4JHTA 1GR3A 1PGW1 3PURA 4BXFA 2C9AA 1TE1B 5I91A 1Y3TA 2WQ8A 5J37A 1ND2C 1CAXA 1RUH2 1UY3A 3T2OA 3SMHA 2X53S 1AJOA 3T0AA 4BA6A 3IPVB 4AEDA 2VULA 1RUNA 1S55A 1FV2A 2PHXA 2YFZA 1JZ7A 3NQHA 5B4NA 2DVDA 5J1XA 2B39A 1VIWB 1UU4A 1OF4A 5C8CA 4JRLA 2B45X 1IGOA 2XG3A 1CJDA 2DFBA 1WCUA 1LULA 5JOZA 1N1VA 2XOMA 1OPOA 1KDKA 1VBC2 2UWBA 3GJBA 1BBT1 4CP0A 1QU0A 4GA9A 5JAXA 3LPGA 4XFGA 4ES9A 1BHGA 1DYPA 2ARXA 4O65A 1OQEA 1JOBA 1SLIA 5FWEA 5LATA 4AI9A 3BALA 5A33B 1UMZA 5EYXA 1XB9A 1VRBA 1ZZ9A 2OKXA 1ND3C 3PLQA 5JOXA 1LOFA 3VV1A 4JGZA 4COZA 2AZ5A 3AKPA 4Q4Y1 5LRSA 3FL7A 4MGTA 1ND3A 1ZRIA 1BK0A 4HG6B 4UFLA 3LF7A 4IUGA 3LFMA 3USUA 4FTEA 4FBFA 2QE3A 3V0BB 3KB5A 1Q56A 3GALA 5E6HA 4EN8B 4URTA 1SACA 2LROA 3AZYA 3H1YA 2GP3A 2CTVA 2DWRA 1WLCA 5C3OA 4P5YA 1YI9A 1FPN2 3CJXA 3WG3A 4R52A 5JLVA 1QDOA 1I9RA 1LOEA 1O6UA 1SMVA 3IDBB 3AYAA 1NG0A 3AYDA 4XTMA 4Y5SA 2VZPA 4XFCA 4ASKA 2YBSA 4OZOA 3G7DA 1H8VA 1LOAA 2CDOA 1H1AA 3RS6A 5C6CA 1W9YA 4UW6A 3GHNA 4QWNA 4U2AA 5AVPA 2Y26A 3R4DB 3U37A 2XJPA 4QM9A 1SBFA 2VW1A 3H3UA 4BQ5A 4BK4A 2EIDA 3P6BA 4CEWA 4OI2A 1W8ZA 2B5HA 2P6HA 1PK6A 5GLVA 5A3OA 1PZ9A 2WZR2 1RUD3 2WJSA 2RS33 3K4DA 3ZKYA 4YWAA 1PX3A 1GBGA 2VZSA 1QJX1 4KMQA 3N9OA 2Y6LA 3CO2A 4QPIB 4LBQB 5FYMA 4AI8A 1RUF1 1G8WA 2VMIA 5GZGA 1G9DA 1VAVA 4PDWB 3ZSKA 2QVSB 3DCQA 1POV0 2C6SA 1Y4WA 1ULCA 2VZOA 2RMU3 4HONA 4GMP3 4YYOA 4DO0A 2HEWF 5F6KA 4DY3A 4EZ4A 3WW4A 1CAWA 2VNVA 2FCUA 3C8XA 4UW3A 3T2PA 1RUE3 1QOSA 4K3UA 4AEDC 4AQ2A 5IVCA 2BNNA 2ZEZA 3Q8AA 5A3PA 4KWKA 1AYM3 4IGPA 1K5MB 1CPMA 1DLLA 1GQPA 3MBWA 1UOGA 2JXAA 3VKMA 2W1UA 5FQ0A 1TNRA 4LK7A 3EXUA 1G9BA 4XBNA 3ZXDA 1UQXA 4ISQA 2ZGQA 4AXOA 2OQ6A 3WNXA 2A3XA 4B4PA 4LXLA 4MHUA 1JYIA 1G86A 2RS51 4CDWB 1XQNA 4TLGA 5HXVA 3HPNA 4Q4V3 3CMGA 5FP8A 1J3PA 2ARAA 5FPBA 1XNDA 2JIGA 3LDRA 3LE0A 2ZAHA 3K3OA 1QJU1 4AFBA 2WQ4A 2AEZA 1VB2A 2VPVA 3CLPA 3NAPA 3VBHB 1F2NA 4NRQA 2RDSA 4R8HA 1JZ3A 2R32A 1M06G 1VR3A 2DURA 4B1MA 1HB1A 2AGSA 5IFTA 2OUJA 2K9ZA 5FZ0A 4CCMA 5BNPB 3IAPA 2YBKA 5A33A 2VZVA 4HL0A 2X5IA 2WZPP 3AMMA 1WW7A 4OHVA 3VD7A 1NZCA 1G9FA 2C9KA 4C1WA 3J4UH 3HT1A 4WVMA 1WMFA 2V4AA 3LPFA 1LCLA 4GH4B 4B1LA 1AUYA 1ND3B 2D5HA 1AYM2 5BPXA 2A6YA 2Z42A 3I3EA 1TME1 2C24A 1KQRA 3K4ZA 4IE5A 4E2GA 3DPRC 3WQ1A 3ORJA 3DL3A 5GKAC 5BV6A 3VBOB 2VMHA 2IXCA 2YBPA 4ZU5A 4NWVA 4N90A 4M3CF 4XCBA 3WNNA 2I74A 4OQ8A 2PQSA 1ENSA 4BMEA 2WWUA 4DMIA 1OKQA 1VPHA 1RHI2 2O8OA 4I0AA 1GNZA 3TN91 4E4ZA 4FP2A 2VO5A 3E6BA 1NCRA 1ZZ7A 2WT1A 1GFF2 3ZPYA 1UF2C 2WFF1 3KCYA 2UYAA 4QDSA 3N4MA 3O5SA 1KS5A 1C8M1 2NMOA 3BOWA 3OBZA 4YLZA 1OA4A 1WZXA 4PHZA 2ZZJA 1PZ7A 1KJLA 3L2YA 4M3CA 1JMUB 2G9ZA 4GALA 2DUQA 1M4WA 4Z92B 4TTGA 4GD4A 2QQIA 1VRH3 2Q4SA 4YVWA 1W6NB 3KVAA 4XFIA 1MS4A 1ZZCA 4L97A 4Q29A 1AR83 1PMJX 2XLGA 3VL8A 3W58A 3ZXFA 1C8M2 3H1WA 5T3NA 4Y26A 1AR82 1DQ6A 1EY2A 3DEMA 2QFEA 4YGDA 3B9CA 2DVBA 4IEQA 2DYCA 3AMPA 2WZ8A 2VJXA 2ID4A 1ND2A 1XE0A 2A3YA 2YC0A 3TN92 1VBB3 3ZX7A 3NKGA 3Q8EA 5BY5A 1HN0A 2HWB1 2OXBA 1UL9A 4XJAA 1LHVA 1K5JA 1SLCA 1NX9A 2RR11 3AFKA 3OGGA 5FOBB 2XKPA 2NQYA 5I8YA 4A2UA 1JI6A 2RR12 1RUC1 4HPKB 3VD4A 1DQ2A 1D7PM 1HB3A 5EXOA 5IT6A 3DYMA 3WW3A 4LO6B 4Y22B 2XONA 3NRUA 2WUHA 4OZXA 2RS32 2BFUL 4IE7A 4PJYA 2Q8EA 3MZHA 1JXNA 1WW4A 1NLQA 3SISA 3E6CC 5F3CA 4NRPA 2YC4A 1LJ7A 5GLUA 1UYYA 3VBUC 1MS1A 1S0DA 3ZOIA 3ZSEA 3MIGA 4YVWB 4LBOA 3ZKUA 3O0WA 1DIWA 3SC7X 4XILA 4JCKA 4L8QA 4EN6B 1UKRA 4R4XA 2ARCA 2VUDA 5K7PA 1G9CA 1S2BA 4MOAA 2ARBA 5DDJ3 2DVFA 1BXHA 4BLIA 3IDCB 5I0TA 3EJKA 4Q4X1 4YM1A 2WC2A 5ACA1 3ZN4A 5JWPA 4Y33A 2E33A 4YZ4A 5CKMA 4XC9A 5FREA 1TVGA 3HNYM 3K48A 2VH9A 1XNAA 4CRQA 3Q9OA 4UWDA 3WZ1A 4FCAA 3AJZA 2G1MA 4DRVA 4BLJA 1B35C 2Q0AA 1GP6A 4IEVA 4LBNA 3WD5A 5C8CC 5I93A 3I54A 3OUIA 4Q0UA 4A4AA 1X33A 5JXJA 1LEMA 4QGMA 1TME2 2E9QA 3WSOA 2QQPA 1RUOA 1NXMA 3S30A 2ZABA 4FOYA 4LBQA 1Z78A 5C9AB 1J1LA 1VAKA 3R0RA 3T0BA 1CIWA 1R081 5E8AA 2HWD2 1EPWA 1XU1A 5D1IA 4XHBA 1W99A 1ZBA1 3OD4A 5FZOB 5A7OA 5IVVA 1KJRA 4QQHA 4CCKA 1H8TA 3WHUA 1EYBA 4JTNA 3INAA 5C8WA 3D82A 2VZ3A 4YGBA 1LNSA 3O1SA 3POSA 4A3XA 1E5SA 3J7NA 3H9AA 4KGQA 1POV3 4AG4A 3USUB 3AYEA 1WWYA 3I2KA 4IEYA 1KEXA 3JUUA 1MQTB 4E4DX 2HWF2 4QGNA 3S57A 4LEJA 4XJ9A 1Q8OA 3OPZA 2W0XA 4QDQA 5A70A 3WX5A 1HN1A 1VALA 1SLAA 1VBE1 5LCWL 3V0AA 4YGCA 2OYZA 4NN0A 3U0ZA 4Y4RA 3HAGA 3RJRA 1IS6A 3N7LA 3P3NA 2BEOA 3AKRA 4RR3B 4UAPA 5GZFA 3T1LA 2CGOA 2VZUA 5JXGA 1UY0A 2ILMA 1LOCA 1S4CA 2XXZA 2NZ9A 3IN9A 4JHZA 3ILFA 2B9VA 4BQWA 1H2NA 4ZS2A 4A45A 5KC5A 2OZ6A 4CPBD 2WWSA 4CUGA 1W8NA 3WQ7A 2BVBA 3HNMA 2TUNA 4AVAA 2TEPA 5IVEA 3KGZA 5AC93 1FPN1 1VBD3 1ZNPA 3H8XA 1J58A 3ZVXA 2DCKA 4XMIA 2JG9B 4D7YA 1CPNA 4CDXB 3LA2A 4AYUA 1EUUA 3Q8CA 3ZIWA 4K8FA 1TMF1 2J7MA 4EWEA 1WLWA 4MGIE 3AKTA 1XSRA 2R043 1WCSA 2CNAA 2Y34A 1N3QA 1XYPA 4XF1A 5FY8A 2W95A 3DYOA 5FCCA 5CVRA 2GN3A 5SV8A 2Y33A 3KGLA 4BJ0A 2W68A 4N7IA 1E5RA 2R0HA 4CP9B 1KFXL 5IK7A 1QXJA 2GU9A 2E63A 1VLNA 2VGDA 3L9JT 3OY8A 4NIIA 2XGXA 3VDDB 1HKDA 3ZXJA 5A3LA 1JZ2A 1CVNA 4BYYA 4BIOA 1D4M1 4AQ6A 4L99A 5BNOA 2XJUA 3ZYIB 2GNBA 1O3QA 2Y60A 3WDTA 2E51A 2YHJA 4EV0A 4LUKA 3POGA 2X10A 4IE4A 1UYPA 3N7MA 3WG1A 1Y43B 2BDRA 3B7MA 1V0AA 3D0JA 2ZTNA 3BIEA 1K42A 5C3SA 2P34A 5ERLA 1ACCA 1SBDA 4UOJA 3VHPA 3AKQA 3RZZA 3FBYA 5FBZA 3E1F1 4Y3OA 3PJYA 2XJSA 2FHRA 4OI1A 5HBAA 3E6DA 4DZGA 1NE4A 2D6MA 4OMDA 4FP3A 2WT2A 2ADDA 2MEV3 3N9QA 3PVEA 4Q4Y2 4YW3A 4NAOA 5CNAA 5EWSA 4LKFA 2VVFA 4CUAA 2QQOA 1H8TB 2ZGSA 3ZXGA 4AGRA 3MPPG 3VD9A 3P5BA 1YWKA 2WN3A 2YV8A 4FOWA 3MV01 1RUE2 2VBPA 5F5IA 3RJ2X 3V65A 4CP9A 2UWCA 1R64A 4OI0A 1UN1A 3OUHA 1BBT2 4HETA 3WVJA 3FZ3A 1QQP3 2RDQA 5BNOB 5GM0A 2A71A 4QQLA 3FN9A 2QQMA 3FJSA 1AR91 1GOGA 3VHOA 1UOJA 3NWKA 4PLOA 4ZU4A 3GZUC 3T4HB 4YW1A 3WW1A 4MH0E 5GLTA 3A0NA 2WT0A 1CAUB 3NMBA 4EN7B 3KT1A 5FYCA 2WINB 5T5LA 5IVJA 3FBMA 5L7OA 1JYXA 2HWE2 4JRAA 1SPPB 1C3HA 3O0VA 4XZUG 1NLRA 1Q5OA 3EMRA 2JG8C 3HQRA 4ORFA 4Z2AA 3WR0A 2D98A 1US3A 3GCXA 2QQLA 3S5AA 1LGBA 2HYKA 5FPZA 2OPWA 4IESA 4Q4Y3 5FZ4A 2B8MA 5CIRA 3THPA 3V64A 2R1DA 4BCUA 2VMFA 1GWKA 1FMD2 3OBRA 3M3CA 1MEC3 4UT5A 3T2QA 4DEVA 2EXJA 4N43B 1DGWA 2JG9A 5T5PA 3I59A 4ET7A 4JKMA 4YZ5A 4FPFA 4BH9A 1PO12 3MI8A 2D43A 2HH9A 4D8MA 4DNYA 4Y4YA 3AMQA 4IV3B 5T55A 3H8UA 4HN0A 4M0NA 5C3PA 1AX2A 4XOGA 2CAUA 3ECQA 1R1A2 4N53C 3AZXA 4YVSB 3WQ0A 4F7ZA 3VZLA 3MIBA 4V2VA 2CHHA 2JB8A 1XPWA 2WYFA 4HZFA 5BNOC 2ZHLA 3AZZA 1CAUA 2ZOEB 4FPLA 4R9DA 3WUDA 4CZSA 1I5ZA 1S2EA 1AVBA 3IAQA 3PMSA 4S2HA 4BZ4A 5F32A 1A8DA 3RGBA 4KU8A 2Z79A 1Z0HA 5IWFA 1YHFA 4JDMA 3E5UA 2EVXA 4N9HA 2VMCA 5D2AA 1O4YA 4P9WA 1RJ8A 1WKYA 5T52A 1ALYA 1FMD3 2DUPA 4J1WA 4UBHA 5D8AC 1YQ5A 4E8CA 2X5IC 4XJZA 2R061 5FAXA 4Q4W2 5A7NA 2BRTA 4Q1PA 1WCQA 4I0WB 4GULA 4KU7A 2HWC1 3CL1A 1QXRA 4AVCA 1H1MA 5E1RA 3ZDSA 2W47A 1OD3A 3OPWA 5JMCA 2XPJA 1W8UA 1W2OA 4AGGA 1H2LA 4QPIA 5GALA 1ZRFA 3SNMA 1ODNA 2HBTA 5BNPC 1RHI3 2P5BA 4I3GA 4YVSA 4QB1A 1DQ4A 5KWRA 1QHDA 5HCBA 2PAMA 3U4SA 5KHJA 2XLFA 3E5QA 4OLLA 5F7UA 1DG6A 4WVVA 4H7MA 4HLTA 1W04A 2HLEA 3TN93 3NKTA 1ST8A 4HK8A 4R9AA 1MZFA 3VBFC 5KXBA 1ZBA2 1I1EA 3DKQA 2AUYA 3ES4A 4DY5A 4Q4V1 2X09A 2X29A 3PMEA 1H1IA 2W52A 3W5MA 2D3SA 2YG0A 4NHYA 5FZ9A 1REEA 2D5FA 3D5OA 3NNJA 4XURA 3PJQA 5F6LB 2IC1A 3AK0A 4ZY9A 1UIJA 1W9WA 2ZACA 2Q30A 5CEHA 2PTMA 2XVGA 1VRH1 2VR4A 1HB4A 2QUOA 4YM3A 3KS7A 3THDA 3ZMOA 1BEV3 1LHNA 1VBB2 1IQAA 4Z2WA 4ISRA 4UW5A 3DN7A 5ACA2 4RFRB 4HXCA 2DTWA 4QX8A 3IBMA 3JQWA 4GH4A 3ASIA 1J83A 4W4ZA 3O12A 1JODA 4Q0QA 1DP0A 4YW2A 3WXPA 3RYRA 1REFA 4AVBA 4DS0A 1R093 1WLDA 1LTEA 3QH7A 2Y6HA 1C5HA 2XUEA 4GXLA 4LK6A 5M0TA 4M01A 3UGHA 2WA4A 4U36A 3WOGA 1B35A 4FT8A 1OH3A 2KR2A 5LRRA 4QX5A 3V56A 2FDGA 2WIIB 4R9BA 1EPZA 1JHNA 4P08A 5A1FA 2ZS6B 4BQ4A 4Q8LA 2RS31 1PHMA 3D4KA 2J22A 4J1XA 2O8QA 1OFSA 5FLIA 3SEPA 5FYSA 1OHFA 1VJ2A 1BEV2 5JSPA 1RITA 1GANA 1OUSA 1W6PA 2UU8A 3HOBA 4C91A 3H8OA 1N1TA 5FXWA 4XDQA 2ZX2A 1X9TA 4LOSA 4RGKA 4I02A 1IG0A 4GMP1 4Q26A 4M3CB 3DYPA 5CU1A 4CSWA 1AXKA 4XF0A 4CDXA 1I3HA 3IIAA 4H7LA 2E7AA 2P3IA 4HVRA 2NMNA 3POEA 3QACA 3RI9A 1RUE1 1LRHA 1AR81 1JYNA 4RHV3 3VHRA 5LW9A 4P02B 1ZA7A 1Q3EA 2J1EA 3BGAA 4XAEA 5HCHA 1D2SA 2H0BA 1C5IA 1MEC2 2UYBA 2YYOA 4FQ4A 4J25A 4PCRA 5EQUA 2H6CA 1HJFA 1FNYA 1LU2A 1NA1B 2ORZA 3JD71 4LQRA 3LKJA 5CB7A 4CDWC 1JZ5A 2BWCA 4LTAA 1U0AA 5EHDA 4DXTA 1T6GC 2P17A 2WWJA 3DECA 3UT0A 4MG2A 5IVYA 3JBG1 1W6PB 1R1A3 1QMJA 5LEJA 3IM0A 2DV9A 1DDLA 2D7FA 2D97A 1YLLA 3I2JA 4IEWA 5FZ7A 1HRI2 2D6KA 3I3MA 3K77A 1ODMA 3K4AA 1GP5A 3OGSA 2P3JA 3ZYRA 2VNGA 2B7YA 4AAXA 5GZDA 4K6BA 5FZCA 1L3JA 1W0OA 1PX4A 5FUNA 3RG0A 1H9WA 2FDIA 2FMYA 3N7JA 2RS12 1XYNA 3O1TA 1CESA 1RVF3 5F39A 3NJZA 2VZQA 4CDQA 2XB6C 1X50A 4XDOA 5ABJC 3N9PA 1SCSA 1MZ6A 5FZAA 2YUEA 5JSOA 4XFFA 3I2HA 4UFJA 5C4WB 3VBRB 4AHYA 3MW2A 3WINE 4B3NA 3SXWA 1NKGA 1EAH2 1QY4A 5IYYA 3SHRA 2YU1A 1W2UA 2JDYA 1IZ3A 3FC0A 4LLFA 2AYHA 1AZDA 3FUQA 1IPSA 1YFXA 3RFRA 1UNBA 2W9XA 4YW7A 1CAWB 1CD3G 1RUI1 5HCFA 5FP7A 3CEWA 1UU5A 3UK9A 5FZ3A 3I7DA 5FZGA 1C4RA 4IEPA 1XSQA 3NV4A 1WA4A 4JX0A 5JOWA 5FUPA 2CWMA 1XRUA 3BTAA 2GMMA 1S0IA 4QX0A 5K0UA 3VB9A 2XBO1 3PVOA 4QAWA 1W2AX 1QOOA 4ZS3A 5IHRA 3WP3A 3OD0A 4AVSA 2PXJA 3W21A 3TAYA 4YW5A 2MHFA 5I8SA 4GB33 2HBUA 4XQWA 1A6CA 2ATFA 1TMF3 1F4AA 4IL7A 5ISLA 4JKKA 5LA9A 4N43C 1GZWB 1O5UA 3WUCA 3C3VA 4UW4A 2W08A 4BM8A 5JCTA 2I07B 1WLTA 3DUIA 1EP0A 1L7QA 1UOBA 2YFUA 3ELNA 3LCPA 4DXZA 2BZDA 3WLUA 3T0DA 2K2SA 3JU9A 2HEVF 4YGEA 4S2GA 2XBO2 2JKBA 4Y5TA 2EA7A 1SDDB 1JOPA 1NT0A 2P2KA 1OOPC 4MXVA 1X7NA 3AP7A 3M3IA 3NAPC 3ST7A 4WV8A 3O7OA 4EWDA 1CGPA 4LOTA 2VVDA 5FY9A 2RR13 3CDZB 5CFDA 5J48A 1VBE3 5DAVA 3KV6A 4K21A 4P5HA 1YYNA 4LULA 2CWSA 2DCYA 2WR9A 1RMU1 2YPJA 4RL7A 4GJYA 2X05A 2HWD1 1UZWA 2ZX0A 4OULA 5FYYA 1OQ1A 1PVC3 3W5NA 5APAA 4IQPA 5LBCA 1PVC2 2XQXA 3BB6A 2ZEWA 3BPSA 3I3DA 2B42B 1H9PA 4MXWA 5FV3A 4AEKA 4AW7A 1EV13 5A6YA 3R4SA 2XL9A 3H7YA 4CU8A 2WA3A 3PU8A 1VBA3 4QQOA 4RA0A 4XZPA 3ZYFA 3IMMA 4D7SA 1REDA 5LWBA 2YC2A 3S5QA 2ZPXA 5DABA 4NIAA 4Y20B 4FAGA 5FQ0B 4FFHA 3WV6A 2CGNA 3GM8A 3OGJA 1ASJ2 5F3EA 3VZMA 1SCRA 4NHKA 3H3ZA 2EIGA 4KNCA 3VL9A 2ZJCA 1COV1 3OTFA 3TBDA 4BQYA 3FFZA 3ETQA 2L9LA 3VBRA 2JDAA 4LITA 4Q1RA 2YU2A 4AEJA 3UETA 2FBEA 1ZRRA 5C4WC 2DCJA 3MGUA 4CUCA 1LGNA 1GWLA 5IW0A 4DINB 3C7FA 4UFKA 1HW5A 5A6XA 3AFGA 1N1SA 1UW8A 1CIYA 5A80A 4AFDA 5IVFA 4XVHA 1GZTA 4LBMA 1W0NA 1OPMA 3F2ZA 4QPWA 2WAOA 4LHNA 3N9NA 2JE9A 3MF9A 2VCAA 3P1IA 3WF3A 4KH9A 2W46A 4WZFA 4Y20A 5J98B 4E9KA 1Q43A 1F15A 1PIV3 1BVVA 1VB4A 3EHKA 1V6IA 3HEIA 3NV1A 3LA7A 4LHSA 5CZKA 3PVBB 2RJLA 3DPRB 1UKGA 1RUC2 1V6JA 2DU1A 3ACGA 4MV2A 5F5AA 5JR7B 5LBEA 4XQ4A 1C28A 3RZKA 4NWWA 1PMHX 2J1SA 1VBD2 4NHMA 1IS4A 3ROUA 4NIHA 1MQTA 4OHWA 3LAGA 3ACFA 5ANNA 2GZWA 3UNPA 1W05A 2R30A 3AP5A 5LASA 2WNOA 4XJWA 4NIDA 2Q1MA 1PNGA 3VBOA 1PGW2 1OI6A 3WNPA 1YIPA 4EQVA 1FOD2 1W28A 4RR3C 2JG8A 2XWBB 4QPGB 1ULGA 4C8DA 1PMIA 2HKXA 3HD8B 4CCCA 3ZYPA 1QQP1 3ETPA 3PDQA 5A7WA 2CL2A 1JTZX 5T5OA 1GWMA 2LALA 2WNVC 4BDVB 3VBHC 2LS6A 1YFUA 4QQPA 2XKOA 5FKCA 3E97A 2BERA 4KI5M 5E89A 3MPBA 1MPXA 3AC0A 1W9SA 1HXS3 2EIBA 2VC9A 1HXS2 2PLV2 4YG0A 2EXHA 5LA2A 5LBBA 1WD3A 2A3WA 2A6ZA 4W6YA 4XUNA 3ON7A 4GWNA 2HWC3 1PO22 3K46A 2BOJA 2JDMA 1V9U1 4LLOA 2VECA 3O1MA 4Y1ZA 1O4TA 2JKXA 4MHRA 4EYUA 2G19A 4LKDA 2R041 3IZOA 4YFZA 3OBTA 4KBZA 3CZUA 1JUHA 1W6QB 3OYWB 3B93A 4CA9A 2WNUA 1AYM1 2Y0OA 5FY7A 5J7MA 4CP2A 2F17A 4ZU7A 3AXEA 4LBQD 1VBA2 4XJ8A 4ASMB 2Q5TA 2Y6FA 2VZRA 3LEGA 3HVDA 4M4PA 3OG2A 3RZJA 4OCTA 1W6OB 1GU3A 5FXXA 4KWLA 2GH8A 2JD4A 2Y38A 4SBVA 2A70A 2QJVA 5LA1A 4FXGB 3RDIA 5C70A 1D4M3 2WLPA 3PUIA 1GKBA 3ZYBA 4RS5C 2W87A 3H8RA 1GQHA 1ZZBA 2W2IA 3VDCA 3IDAA 1WBLA 2IXKA 1PZ8A 5L36A 1JZ4A 4YZ2A 2BYVE 2G4IA 1QJU2 3A0KA 3FHAA 3KMHA 3TB0A 3UKTA 1H2KA 1W2NA 1HV1A 4XE9A 2V73A 2HWC2 3N36A 4FPKA 1CN1A 5FYUA 3U75A 3ZYGA 4ARXA 1YQ2A 4CUBA 4XTPA 4OI4A 2R062 4RFT0 4LE3A 1Q8SA 4L0PA 3POWA 1AHSA 4AL9A 4HKOA 1TQ5A 3AM2A 4NMIA 5BYNA 2F4LA 3N35A 4QD2A 4M4RA 3GCWA 3MLKA 3AP9A 3APBA 3A7QA 1ZREA 2HYXA 1OT5A 1XNCA 2D3RA 3VBUB 1GZ9A 5JZGC 1FV3A 2P4EA 1ASJ3 1UAIA 3NNMA 3NNFA 3ATGA 3PUHA 5FK7A 1A8MA 2WNVB 3VZNA 4CDUA 5CFDB 1HQLA 1OVPA 5FZIA 4E27A 1UY4A 1YQ6A 3KM5A 5L9RA 4ATEA 1T2XA 5CA6A 3TNPB 2UY9A 3ZXKA 3IMNA 4C90A 1LEDA 3OB8A 4TSVA 1O5LA 2KXLA 4AZZA 1K3IA 4D3WA 5A6QA 4AVTA 4CU9A 5FZDA 5F9TA 1EV12 4H14A 2A6WA 4RD7A 2VTXA 2WFF3 1JUIA 4W50A 3T4VA 2BP6A 5I0SA 3LZZA 3I2OA 1Y7BA 3B3QE 3BU0A 1C8M3 3CHXA 5BUVA 1W6MB 5FWJA 3PU3A 3QBQA 4XQDA 3ZN6B 1XXNA 4K40A 3VBUA 3DV8A 2VM9A 1W03A 5K0UB 1SQ4A 2PAKA 1RUG2 1V70A 4EWAA 4MVTA 4P9JA 4HT1T 4A6SA 4YG3A 4Y24A 4DUXA 1GZCA 4OHZA 1O8PA 4CCJA 4N43A 1KITA 5LEKA 1W8TA 1GLHA 1MS8A 5FFOC 3BPZA 1UZYA 1XE8A 1GZWA 1WW5A 2WZEA 1SLBA 1G7YA 2RG4A 4UFHA 2R042 3ZFGA 5FMOS 2P6CA 1YIFA 4XF3A 3LQCA 3MIEA 2AEYA 4LNVA 2Z2SB 4Y5Z0 4YNIA 3JBG3 1JW6A 1CX4A 2OQ7A 3HMYA 5FXZA 1R1A1 1AR72 3IIIA 1DU3D 1YUDA 1IHMA 4HK9A 1K45A 4NRMA 3J8F1 3NNGA 4RN5A 4CDXC 4URAA 4CU6A 1BJQA 2VZ1A 4UI9L 1XNTA 5CISA 1AX0A 4IW3A 2PAEA 1XJAA 2DF7A 5DAPA 3SKVA 1STMA 2VBBA 2XHNA 5EFUA 4XF4A 4WM7B 2FCTA 4CDQB 1UOFA 5DUUA 3VLBB 2QDNA 4COUA 4DEQA 4LO5B 3T09A 3U10A 4AI1A 1V6KA 3CQOA 4NR1A 1FMD1 2VMEA 4LHKA 3TEWA 1U12A 3KT4A 4QX1A 5F3IA 3ZSLA 3A21A 2XJVA 1ZZ6A 3AKSA 1N3PA 1H30A 1NYWA 4P14A 2P3YA 5JDBA 5H9QA 3HIFA 5DZGA 1ZM1A 1RUJ2 4UBGA 5LY2A 3VKFC 4IV1A 2HWE1 3RZGA 3O1VA 4P9YA 4AE2A 5ACA3 4XXPA 5L73A 5FLHA 1EAH3 5JPNB 2WKKA 3NVCA 3K75B 4I01A 3WCSA 3ZO0B 2K0GA 2Z69A 1AR73 1S0BA 1NQDA 1DGWX 1AR92 1X9PA 2ZHMA 5I0RA 1UY1A 2JDUA 5IVBA 2R7EB 4ZXEA 3S6PA 4FPYA 5A6ZA 4XFBA 2IVIB 2A6VA 3B9IA 4XBLA 2IZWA 1NCQC 1AXYA 3VBRC 4XABA 1AR61 4JC1A 5DG2A 1K5MC 2PQQA 4QXBA 1CZTA 1OFNA 4RQPB 5EJZB 4JGZC 4GWIA 1ZBE2 4LIUA 4RHV2 1R083 5HV0A 2WO7A 4E4HA 5C71A 3LWCA 2YMZA 2FZ2A 3LB9A 4XBQA 1H0BA 4GB31 1HX6A 1UMIA 3OY8B 1A3KA
chains in the Genus database with same CATH topology
3KV5A 3ZLIA 5CEHA 4BU2A 3K3NA 5F2WA 3LDBA 2YBPA 3OPTA 5FP7A 5F5AA 5FZ3A 5E6HA 5FZGA 5A3WA 2GP3A 2WWUA 4AAPA 5A7SA 4XDPA 4IGQA 5FUPA 5FZKA 5FZDA 2VD7A 5IVJA 5F3GA 5FYCA 4QX8A 4CCOA 4HOOA 5FYIA 5FP4A 2YPDA 4ASKA 2YBSA 5FWJA 3PU3A 2PXJA 3AVSA 3UYJA 5FPLA 4QWNA 5A3TA 4QX7A 4C8DA 4TN7A 2OX0A 2XUEA 5FZ4A 4Y4RA 5FZ8A 5ISLA 4GD4A 5A7WA 3PDQA 4QU1A 4CCJA 3KVAA 5FPUA 2GP5A 2XXZA 4D6QA 5F5CA 4D6SA 5ANQA 5A1FA 3KVBA 5A7PA 5FZEA 4CUGA 5FZLA 4D6RA 3N9OA 5FY1A 5IVEA 3NJYA 5IVVA 5FYSA 5FYMA 5A7QA 5FZHA 3RVHA 4V2WA 3PUSA 5FY9A 3PUQA 2OQ7A 3AVRA 2Q8DA 3DXTA 5FXWA 5FXZA 4BISA 4EZHA 3KV6A 4V2VA 4DO0A 4HONA 4URAA 5FP3A 3PUAA 4EZ4A 4EYUA 3PTRB 3KV9A 4CSWA 5FBJA 4GJYA 5FP9A 3N9LA 3K2OA 5F32A 5FY0A 4GAZA 5FJKA 5FY8A 5FYYA 5FY5A 2Q8EA 5IVCA 5IWFA 3LD8A 5A3PA 5FXVA 5FY7A 5F3CA 5LW9A 5FYVA 4IGPA 4QXHA 5FJHA 5FV3A 4IGOA 2OQ6A 2XMLA 3AL6A 4UF0B 5FXXA 5F3IA 3KV4A 5F37A 4LXLA 3PU8A 2OT7A 2WWJA 2OS2A 2XDVA 5FPVA 5A7NA 5IVYA 5A3NA 5LY1A 3PURA 4BXFA 5LWBA 3U78A 5FP8A 5FPBA 5FZ1A 4LIVA 5FZ7A 3OPWA 2W2IA 5LY2A 3K3OA 3DXUA 5F2SA 5FZFA 5FYBA 5FZMA 5FZ6A 5F3EA 5FY4A 3ZPOA 4Y33A 2P5BA 4UF0A 2Q8CA 5FYUA 5K4LA 3U4SA 5KR7A 5FZ0A 5FYTA 5FZCA 4CCMA 4CCLA 5FUNA 5IVBA 2YBKA 5FZBA 4Y3OA 3AL5A 3N9MA 2YU2A 4LITA 5FPAA 5F39A 4GJZA 4XDOA 3N9QA 3N9PA 5IW0A 4CCNA 5FZAA 5A1LA 5FYZA 4QXBA 5FWEA 5FYHA 4QXCA 4AI9A 5A80A 5IVFA 4LIUA 1VRBA 5F5IA 4E4HA 3N9NA 4NUBA 5FZOA 2YU1A 5FZ9A 5FZOB 5A7WB 5A7OA 5FZIA 4CCKA 4DIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KV5 A;  3ZLI A;  5CEH A;  4BU2 A;  3K3N A;  5F2W A;  3LDB A;  2YBP A;  3OPT A;  5FP7 A;  5F5A A;  5FZ3 A;  5E6H A;  5FZG A;  5A3W A;  2GP3 A;  2WWU A;  4AAP A;  5A7S A;  4XDP A;  4IGQ A;  5FUP A;  5FZK A;  5FZD A;  2VD7 A;  5IVJ A;  5F3G A;  5FYC A;  4QX8 A;  4CCO A;  4HOO A;  5FYI A;  5FP4 A;  2YPD A;  4ASK A;  2YBS A;  5FWJ A;  3PU3 A;  2PXJ A;  3AVS A;  3UYJ A;  5FPL A;  4QWN A;  5A3T A;  4QX7 A;  4C8D A;  4TN7 A;  2OX0 A;  2XUE A;  5FZ4 A;  4Y4R A;  5FZ8 A;  5ISL A;  4GD4 A;  5A7W A;  3PDQ A;  4QU1 A;  4CCJ A;  3KVA A;  5FPU A;  2GP5 A;  2XXZ A;  4D6Q A;  5F5C A;  4D6S A;  5ANQ A;  5A1F A;  3KVB A;  5A7P A;  5FZE A;  4CUG A;  5FZL A;  4D6R A;  3N9O A;  5FY1 A;  5IVE A;  3NJY A;  5IVV A;  5FYS A;  5FYM A;  5A7Q A;  5FZH A;  3RVH A;  4V2W A;  3PUS A;  5FY9 A;  3PUQ A;  2OQ7 A;  3AVR A;  2Q8D A;  3DXT A;  5FXW A;  5FXZ A;  4BIS A;  4EZH A;  3KV6 A;  4V2V A;  4DO0 A;  4HON A;  4URA A;  5FP3 A;  3PUA A;  4EZ4 A;  4EYU A;  3PTR B;  3KV9 A;  4CSW A;  5FBJ A;  4GJY A;  5FP9 A;  3N9L A;  3K2O A;  5F32 A;  5FY0 A;  4GAZ A;  5FJK A;  5FY8 A;  5FYY A;  5FY5 A;  2Q8E A;  5IVC A;  5IWF A;  3LD8 A;  5A3P A;  5FXV A;  5FY7 A;  5F3C A;  5LW9 A;  5FYV A;  4IGP A;  4QXH A;  5FJH A;  5FV3 A;  4IGO A;  2OQ6 A;  2XML A;  3AL6 A;  4UF0 B;  5FXX A;  5F3I A;  3KV4 A;  5F37 A;  4LXL A;  3PU8 A;  2OT7 A;  2WWJ A;  2OS2 A;  2XDV A;  5FPV A;  5A7N A;  5IVY A;  5A3N A;  5LY1 A;  3PUR A;  4BXF A;  5LWB A;  3U78 A;  5FP8 A;  5FPB A;  5FZ1 A;  4LIV A;  5FZ7 A;  3OPW A;  2W2I A;  5LY2 A;  3K3O A;  3DXU A;  5F2S A;  5FZF A;  5FYB A;  5FZM A;  5FZ6 A;  5F3E A;  5FY4 A;  3ZPO A;  4Y33 A;  2P5B A;  4UF0 A;  2Q8C A;  5FYU A;  5K4L A;  3U4S A;  5KR7 A;  5FZ0 A;  5FYT A;  5FZC A;  4CCM A;  4CCL A;  5FUN A;  5IVB A;  2YBK A;  5FZB A;  4Y3O A;  3AL5 A;  3N9M A;  2YU2 A;  4LIT A;  5FPA A;  5F39 A;  4GJZ A;  4XDO A;  3N9Q A;  3N9P A;  5IW0 A;  4CCN A;  5FZA A;  5A1L A;  5FYZ A;  4QXB A;  5FWE A;  5FYH A;  4QXC A;  4AI9 A;  5A80 A;  5IVF A;  4LIU A;  1VRB A;  5F5I A;  4E4H A;  3N9N A;  4NUB A;  5FZO A;  2YU1 A;  5FZ9 A;  5FZO B;  5A7W B;  5A7O A;  5FZI A;  4CCK A;  4DIQ A; 
#chains in the Genus database with same CATH topology
 1RUH 3;  3ZLI A;  3BIW E;  4JZR A;  2KM2 A;  3LSD A;  3MEP A;  3SCF A;  2XR4 A;  4DXS A;  4G3Y C;  5LA0 A;  2ZXQ A;  2ZAA A;  1OKO A;  1W6Q A;  3OYW A;  5A3W A;  1LHW A;  2WS9 1;  4BB3 A;  1DYK A;  4FVV A;  4XCA A;  4TZD A;  4IGQ A;  1UYZ A;  4YZ3 A;  3DF0 A;  3TRS B;  1QNW A;  3WNO A;  5KBF A;  2VBD A;  1PK6 B;  4UFI A;  1DF0 A;  3ZYH A;  5DAX A;  2F4P A;  1UIK A;  2TBV A;  2YPD A;  1CR7 A;  4P9G A;  5F5Q A;  3UKN A;  2RMU 2;  2ZCW A;  1ZBE 3;  4C0H A;  4JQR A;  4YW4 A;  2XUM A;  2DVA A;  2NN8 A;  1X8E A;  1D4M 2;  1H6X A;  1BKZ A;  3ZDV A;  1R09 1;  3CJI A;  3C2U A;  1DGR A;  2F6B A;  2OA2 A;  4OYU A;  3MHZ A;  3RSJ A;  2VTX J;  1YQC A;  3EB7 A;  2VVE A;  1ULE A;  1YEW A;  3KF3 A;  2VXJ A;  3CJI C;  2DCT A;  2BPA 2;  1K12 A;  1OA3 A;  4CXY A;  3BOP A;  3WDU A;  1PVC 1;  1U5I A;  4UXA A;  1DYO A;  4P9I A;  3IKW A;  3D0S A;  2ZHN A;  4JGZ B;  2ZGM A;  3NAP B;  1EV1 1;  3VBH A;  2B46 X;  4MGS A;  4WM8 B;  3ACI A;  4P9L A;  4AEM A;  2E31 A;  3I2G A;  5C3Q A;  4MET A;  1SFY A;  1RUG 3;  2YRO A;  3IDE A;  3ILN A;  4JQT A;  4O7X A;  4ZHN A;  3O1P A;  2QCS B;  2UY8 A;  2PMW B;  3MFC A;  4M3C E;  4HN1 A;  3M70 A;  1UCX A;  2BW8 A;  1WD4 A;  2BWA A;  2CAV A;  1ENX A;  2R6Q A;  4NO4 A;  4HBN A;  4TXW A;  3NV3 A;  5DN2 A;  3DGT A;  3JXS A;  3K2O A;  1SDW A;  3WDW A;  2WO1 A;  3H50 A;  1ZRC A;  3LD8 A;  4B8E A;  4G9S B;  3VUO A;  4NJ4 A;  1OXC A;  2V5Y A;  5FR3 A;  5FJH A;  1N3O A;  2CYF A;  4OVE A;  3HR9 A;  2RDR A;  3PTY A;  4OFG A;  1MZ5 A;  4UF0 B;  3HJR A;  3B00 A;  1JZ6 A;  3NNL A;  2RVA A;  1XE7 A;  2LTN A;  2Y8K A;  5A3N A;  1UPI A;  4S2D A;  2IXL A;  3HWJ A;  2X5I B;  2VU9 A;  2QQU A;  4W6W A;  1QGL A;  2BV4 A;  3J26 N;  5FZ1 A;  2JE8 A;  1RMU 3;  1CAX B;  2V09 A;  5IK4 A;  2OW4 A;  2HWF 1;  2VOV A;  2NP0 A;  1GNH A;  1YXW A;  4B7K A;  1YRZ A;  4LKS A;  2FD8 A;  3WF2 A;  3URF A;  3LGR A;  4J6G A;  1HV0 A;  4A6O A;  5I0U A;  4FFI A;  4L92 A;  4IEZ A;  3NV2 A;  4JAA A;  4COY A;  1RUI 2;  2EXK A;  1O3R A;  1WA6 X;  2BVV A;  3B01 A;  2IVJ A;  3ZSM A;  1QJY 3;  5FMC A;  3FMG A;  4GJZ A;  3ZN5 A;  4LHL A;  1RVF 1;  2JIJ A;  2MEV 1;  4CVU A;  2R07 1;  1SFN A;  2RM2 1;  3WHT A;  1VBA 1;  1AL2 3;  4LO7 A;  2GNT A;  2VG9 A;  5FYZ A;  3S7I A;  3ZMN A;  3CKH A;  3I2D A;  3ITQ A;  1VP6 A;  2ZX1 A;  2W94 A;  4RGG A;  4XUP A;  1UXZ A;  2DBI A;  4K1Y A;  5DZF A;  5CAD A;  5ABJ B;  4Z82 A;  5HV4 A;  5FZO A;  2E32 A;  4LO4 B;  2ETE A;  2JE7 A;  4PIZ A;  4LA2 A;  4CXW A;  3WEZ A;  2QNK A;  3WCR A;  1UZ0 A;  2RS1 1;  1OBN A;  2WAA A;  3MLJ A;  3LDB A;  3ZSJ A;  4CEY C;  3VZJ A;  1WGP A;  3V0B A;  4QKD A;  2BBA A;  1XYO A;  4QKN A;  3LIG A;  5A1A A;  4HVQ A;  4D7T A;  3U11 A;  1PK6 C;  2CY6 A;  4CCD A;  1CON A;  2JIC A;  4GWJ A;  1HXS 1;  4XF9 A;  1S0G A;  2ET7 A;  1E57 A;  4KL1 A;  3RYK A;  1UZZ A;  2PHF A;  4LUM A;  4W6X A;  5B4X A;  3VKL A;  5FDB A;  1SZB A;  1TG7 A;  2VL4 A;  2ZA9 A;  3S0M A;  1OLQ A;  1OMI A;  3TOJ A;  1GQG A;  2ZX4 A;  2IXH A;  4V1P A;  1B09 A;  2I2S A;  5A3T A;  2DCZ A;  1V00 A;  4TN7 A;  5JPM B;  3WF4 A;  3RPQ A;  1HB2 A;  3LA3 A;  5J96 B;  2H6B A;  2WNU B;  4IEO A;  5C33 A;  4QU1 A;  1MEC 1;  1FOD 1;  2H0V A;  4GWM A;  3USS A;  2Q8O A;  2GP5 A;  5DZE A;  3MIH A;  1WBF A;  1RGS A;  2WBK A;  5L19 A;  1LEN A;  1Y9M A;  2DUO A;  1SG3 A;  3MO4 A;  1BK1 A;  1RXF A;  2WFF 2;  3FHI B;  1QJZ A;  2VW2 A;  4YPJ A;  3RZM A;  3MW3 A;  1XU2 A;  2VCM A;  4N53 A;  4Q2F A;  1LOG A;  1CQ9 A;  2DBN A;  4QGL A;  1OH4 A;  2GSY A;  1GIC A;  3GYD A;  3I49 A;  2B9U A;  4JGY A;  1B35 B;  2XJT A;  1OLM A;  3BVC A;  3RYP A;  1RXG A;  3LOB A;  1MQT C;  2D44 A;  1S1A A;  1W0P A;  2E7Q A;  2A73 B;  2UUR A;  4FOQ A;  1KXG A;  4FFF A;  5LZ6 A;  5BNQ A;  1GOH A;  2XHK A;  4LBK A;  1JHJ A;  3B94 A;  2D6L X;  4XJU A;  2OVU A;  3IT8 A;  3RI8 A;  5CYY A;  4FPO B;  2BNM A;  4AI3 A;  1VMJ A;  4PI0 A;  2AH2 A;  4QXH A;  1FX5 A;  2QDR A;  5GLW A;  3WT3 A;  2NPI A;  2VY0 A;  4EJR A;  2R06 3;  2VAU A;  1NA1 C;  4WM7 A;  5CFC C;  1W6N A;  4G4F A;  4LJH A;  2BTV C;  3VZK A;  3Q8F A;  2ET1 A;  2C26 A;  2Y6K A;  2JX9 A;  1V9U 3;  4GKX A;  1HJG A;  2A7A A;  2XQR A;  1PNF A;  1ASJ 1;  5FMO L;  2W1S A;  3CBN A;  4PLN A;  4QHO A;  1ZYB A;  4NHL A;  1FYU A;  4PLM A;  5BNN A;  3TYJ A;  4MX3 A;  1RHI 1;  5C9A A;  1QJY 2;  5C5U A;  2A75 A;  4BWO A;  5C3R A;  4IV1 B;  5KR7 A;  5BNN C;  4CCL A;  2VQA A;  4MGZ E;  1GP4 A;  2JEN A;  4MLO A;  5C7G A;  2J1V A;  4FOV A;  4AFC A;  3MIC A;  5HCA A;  3WNK A;  3VKN A;  4QDR A;  4WVM B;  1Q8Q A;  3RMY A;  2P37 A;  3HNB M;  1UO9 A;  2RV9 A;  5JZG A;  3AP4 A;  4HSJ A;  1NCR C;  2VOT A;  3VBF B;  5F8P A;  3WF0 A;  2VW0 A;  1H8T C;  1A78 A;  1V6M A;  1ENR A;  1AYN 3;  4H55 A;  3VBO C;  1NA1 A;  4WM7 C;  3UGF A;  5CFC A;  2MEV 2;  4C0B A;  1RVF 2;  1AF9 A;  1DGL A;  2BFU S;  2O14 A;  2P3K A;  2X8K A;  3SIT A;  4ES8 A;  4FPG A;  3BOD A;  3MV1 1;  5JIU A;  3GJA A;  4A7Y A;  5KC6 A;  3POF A;  2GNM A;  1KRI A;  3L2H A;  4Y1V A;  1D2Q A;  1QJX 2;  4MXW B;  2IUW A;  4CCO A;  4YRD A;  3POI A;  2VUJ A;  2WRA A;  1O4Z A;  2PFW A;  1LHU A;  3GF6 A;  2WZR 1;  3O14 A;  1AJK A;  1VMH A;  5IK8 A;  4EE2 A;  1T6B X;  4YSF A;  1RC6 A;  5FPL A;  2Q1Z B;  4Q4W 1;  4DUW A;  4QPG A;  3SLI A;  3SKJ E;  4Q0V A;  1X36 A;  2ERF A;  2RE9 A;  4Q0S A;  1U5Z A;  1WW6 A;  4N9I A;  1NCQ A;  2A5Z A;  3ZFE A;  2N7G A;  5DMY A;  4Z07 A;  2WYS A;  1ULD A;  1BQP A;  3I59 B;  3MF6 A;  3PVN A;  5ANQ A;  5L7O C;  3KVB A;  3NL1 A;  3ZFG C;  2ZGO A;  3KT7 A;  4OHY A;  1OUX A;  1QJX 3;  5JI7 A;  2ZX3 A;  3WDY A;  1PGL 2;  1TNF A;  1TZO A;  2QQW A;  2MNG A;  3RVH A;  1OOP B;  1RJ7 A;  4V2W A;  4YW6 A;  4E4S A;  5H9R A;  2PHW A;  1FXZ A;  3LIH A;  2EAL A;  4WBB A;  4X8P A;  4EZH A;  4GKY A;  1RUF 2;  3ZFF A;  4B7E A;  3MDP A;  3SH3 A;  5JOY A;  4JVA A;  1HRV 1;  2HWE 3;  1RYY A;  4KG8 A;  3JB4 C;  5FBJ A;  3R4U A;  3ZXE A;  4DB5 A;  1EAH 1;  3UV9 A;  2BNO A;  2OII A;  3ZN6 A;  1MZE A;  4RHV 1;  5EP9 A;  2AEN A;  4Z1V A;  5EIY B;  5JIA A;  1DLC A;  1XC6 A;  4DQA A;  2GC0 A;  4RQP C;  5DAW A;  4DUV A;  1YJL A;  4F3J A;  5KHK A;  2XJQ A;  3JD7 3;  1VBC 1;  4IE6 A;  4I09 A;  4NPL A;  1YCI A;  4LPL A;  3A22 A;  2GDF A;  2Y0I A;  3U07 A;  4OUE A;  5FMD A;  1AR6 3;  2XDV A;  4YFW A;  1OLM E;  3R6S A;  4MZU A;  5D8A B;  5KHI A;  3ME2 A;  5DUV A;  3GZA A;  3U78 A;  1W3V A;  3PHM A;  4FPE A;  2GAL A;  1CZS A;  3LEM A;  4MGY E;  1APN A;  1DZQ A;  1QH6 A;  2I45 A;  3DXU A;  2JDK A;  1QJU 3;  3LDK A;  4XFA A;  5FZF A;  2IFR A;  1NUK A;  3ES1 A;  3T08 A;  1JYW A;  2QQK A;  1RUH 1;  3HN1 A;  2ADE A;  4FQZ A;  1ULP A;  1OA2 A;  1OOP A;  3WNL A;  3A23 A;  5GJ6 A;  5A3U A;  5F1R A;  4FTS A;  3JBG 2;  2GN7 A;  1YJK A;  5FK8 A;  1ZX5 A;  5JI9 A;  5L9B A;  1O91 A;  2C4X A;  3N9M A;  3N3H A;  2VQ0 A;  5EPA A;  1FT9 A;  4IDZ A;  2VQT A;  1DFQ A;  3FLT A;  3GZT B;  2XLA A;  2JWP A;  1RB8 G;  5A1L A;  1O59 A;  1HRI 3;  4QXC A;  1F4H A;  1ZBE 1;  2D6P A;  4D0Q A;  3VD3 A;  2EXI A;  1V6O A;  5LB6 A;  2SBA A;  1J3R A;  3FFQ A;  4HAN A;  5FKB A;  4JGY B;  4CDW A;  5C9A C;  2ZGL A;  4AQS A;  2LM3 A;  3WW2 A;  1NQJ A;  1W9T A;  3KV5 A;  4A7Z A;  5GZC A;  2BU9 A;  5GZE A;  3J8F 2;  5I0D A;  5FOJ B;  2WSU A;  1AR7 1;  5FO7 B;  1LR5 A;  4AHW A;  3GNE A;  1KD7 A;  2YDE A;  3SCH A;  3BKZ A;  3UGG A;  2A6X A;  4GMP 0;  3JCI A;  4XW3 A;  1LES A;  3VD5 A;  1HQW A;  3OF1 A;  4PF5 A;  3K51 A;  1H4G A;  4XDP A;  3PL0 A;  4XXA A;  5E16 A;  3RWK X;  1YC6 1;  3SH4 A;  2Y64 A;  4LA3 A;  4KGG A;  4BE3 A;  2EAK A;  3MLL A;  4Q0P A;  5FTT C;  1RUJ 1;  1GOF A;  3VHN A;  5JSR A;  1RUD 2;  2C5D A;  4B29 A;  4RQP A;  4CDU C;  3IB3 A;  2TNF A;  3DPR A;  4IE0 A;  5H9S A;  3MUZ 1;  5HI0 A;  3IPV A;  3FHQ A;  4ITC A;  4TWT A;  3VGI A;  4AED B;  5I8T A;  2WNU C;  2W5F A;  4QX7 A;  3NO8 A;  1J3Q A;  2OX0 A;  3AMN A;  3I3B A;  3UJO A;  5L9V A;  1UX6 A;  2VCB A;  4COV A;  3T2T A;  2J1R A;  3MYX A;  5L7O B;  1Z7S 1;  2JDH A;  2KD7 A;  4FAH A;  1LOF C;  2FQP A;  3O1O A;  3FLR A;  1CWP A;  2WS9 3;  5F5C A;  5HXM A;  5EZW A;  4O9E A;  4OUS A;  5EV7 A;  4LOR A;  5FZL A;  2JG9 C;  4JKL A;  4MUV A;  1Q8V A;  4DFS A;  1WUV A;  1XNB A;  2AC1 A;  3KF5 A;  2GC2 A;  3NJY A;  1BMV 1;  1C8N A;  3UJQ A;  4E2Q A;  1TMF 2;  1VBB 1;  2BUK A;  5A7Q A;  3OEA A;  5CFC B;  4XAA A;  3CF6 E;  4AK3 A;  4R9C A;  3B69 A;  2J1T A;  3AVR A;  1OSG A;  5E88 A;  5BNP A;  5IFP A;  4CEY B;  5FP3 A;  3ZR5 A;  1PGS A;  3T3Y A;  2LW8 A;  4PIX A;  4XFH A;  5DUX A;  1NOV A;  4K20 A;  4AI0 A;  5DDJ 2;  5FY0 A;  2Q1F A;  4Q4V 2;  3J7L A;  4HSL A;  4QPG C;  4OUM A;  3M3E A;  3SH5 A;  4R4Z A;  5D8A A;  5AFE A;  3HBK A;  3OGV A;  2JG8 B;  3POY A;  2YB7 A;  3UKV A;  4FSJ A;  2IFW A;  2IWG B;  2P1B A;  3O0X A;  3VDD A;  2CV6 A;  1UX7 A;  2VMD A;  4JGY C;  3MFA A;  1RUG 1;  3JB8 A;  1NY7 2;  1ND2 B;  1VBE 2;  2PN5 A;  3J9S A;  1IKP A;  3LOI A;  2EIC A;  3QD6 A;  4AR2 A;  2D6N A;  3OOX A;  5KXC A;  1MS3 A;  1X82 A;  1V6L A;  3PIG A;  1SLT A;  1S0F A;  4TLF A;  4CE8 A;  3POB A;  3D6E A;  3SQO A;  1F5F A;  3GHM A;  4QHZ A;  3ZPO A;  4E2S A;  5FLJ A;  1DCS A;  2Y6J A;  4BIF A;  1COV 3;  1SHW B;  2XVL A;  5T50 A;  1NAE A;  1A34 A;  2J1A A;  2GND A;  4BPZ A;  2D40 A;  2GH2 A;  2JJ6 A;  4Q5O A;  4DXR A;  3AL5 A;  5FPA A;  3P3P A;  3KCC A;  4IEU A;  3T1M A;  1BBT 3;  3KLS A;  5CAZ A;  1AL0 G;  1W06 A;  3IWZ A;  2IXI A;  1XOY A;  2GAU A;  2BBV A;  2GC1 A;  2K46 A;  3LSE A;  1L7R A;  4I0B A;  4XHX A;  1R08 2;  2NYY A;  4Q8K A;  5KXD A;  3GGL A;  4GQ7 A;  4FPJ A;  5EJ3 A;  4FO9 A;  4NUB A;  2HWF 3;  4ARY A;  5A7W B;  4B4R A;  1PIV 1;  3VKO A;  1GYK A;  1JS9 A;  2XJR A;  4MSV A;  3TNQ A;  2QKD A;  3ZM8 A;  4AFM A;  2RJ2 A;  4A7K A;  1J84 A;  4RS5 B;  1FOD 3;  2E53 A;  3VBS A;  5T54 A;  2O1Q A;  4HPK A;  4K8R B;  2ZMK A;  1W2T A;  3WP4 A;  3ZYJ B;  5D21 A;  5DQ0 A;  1QJY 1;  3TEY A;  1UU6 A;  5KHH A;  4AGV A;  1KGY A;  4XMA A;  5SV5 A;  1BMV 2;  4QQ2 A;  1POV 1;  2R07 3;  2RM2 3;  1W90 A;  2CDP A;  4CDU B;  1AL2 1;  2ORX A;  5FP4 A;  3EYP A;  1LU1 A;  3TWI A;  3EO6 A;  3JZV A;  4BIS A;  2VXR A;  4LR4 A;  1EUT A;  4PBO A;  1JH5 A;  4OQ9 A;  3OBA A;  1I5P A;  3CJI B;  4N7U A;  4UYB A;  4NRO A;  5HPO A;  3LEI A;  3BN6 A;  4XET A;  1LB2 A;  1LKN A;  4Y1Y A;  3W9A A;  1LOB A;  3WDV A;  2ZHK A;  4CXX A;  2OPK A;  4MO3 M;  1PO1 3;  2QQN A;  2B4K A;  2BOI A;  3SEE A;  3TEZ A;  1ULO A;  1N1Y A;  1DZT A;  3NW4 A;  1VAM A;  4NHX A;  4RS5 A;  3OSD A;  5LK5 A;  4H2A A;  4A41 A;  1RUD 1;  4LKE A;  3D3A A;  3HN3 A;  1QNY A;  1FAT A;  2FCV A;  2JD9 A;  5FZE A;  1XNK A;  4EN9 B;  3KCX A;  1GMM A;  2DU0 A;  4PIY A;  3O1R A;  2XWJ B;  3CU7 A;  3HBZ A;  4ASL A;  4PDW C;  2VOW A;  4WM8 A;  3THT A;  4CEY A;  1W9F A;  3B5L B;  4YVS C;  4CEW C;  2RDN A;  1FPN 3;  1VBD 1;  2VUA A;  1V9U 2;  4NPM A;  1RIR A;  2AR6 A;  2WSV A;  5FZH A;  2W92 A;  2Q8D A;  4F8A A;  1FNZ A;  3DXT A;  2DDU A;  4BHP A;  4BQX A;  3C7G A;  3EBR A;  4O61 A;  2HWB 2;  3PUA A;  4M0H A;  2R16 A;  3OGR A;  3PTR B;  2PLV 1;  4D94 A;  3FUO A;  4YZ1 A;  4HKW A;  3VDA A;  3MID A;  1U5Y A;  1KDM A;  5A32 A;  3I2I A;  1W6M A;  1YNA A;  3ZFF B;  5CKQ A;  2WFP A;  4W65 A;  1JU3 A;  2R0F A;  1NCR B;  3M7A A;  5CG9 A;  1FAY A;  1F31 A;  2YY1 A;  4ATF A;  1QQP 2;  4CCE A;  2CGP A;  1Q8P A;  2DFC A;  3AL6 A;  1D0G A;  4RSU A;  1LAJ A;  3PNA A;  1RTV A;  2NLR A;  1PO2 3;  2OS2 A;  2FDJ A;  1KS4 A;  3BCW A;  5JUV A;  2VOX A;  2CU5 A;  5CG8 A;  1JN2 P;  1O7F A;  1BCX A;  3ALQ A;  2RJK A;  5IAV A;  3OEB A;  3U1X A;  2ZGN A;  5FO8 B;  1RIN A;  1OC1 A;  1YQ8 A;  1LOD A;  4Q27 A;  4QKF A;  1AYN 1;  5CKN A;  3GDB A;  1QWR A;  1QJE A;  4IV1 C;  3ZFG B;  4YM2 A;  3NJV A;  1MS5 A;  5JXI A;  3HQX A;  5DPN A;  5K4L A;  3M1H A;  4ZKT B;  5G04 L;  3U4X A;  2ZEY A;  1D4V B;  5IK5 A;  2BGO A;  3AZW A;  5FPX A;  3VZO A;  4Y1U A;  2W91 A;  4CCN A;  1UPS A;  4QKB A;  4CDQ C;  2EIE A;  1C1F A;  1BYH A;  4HKL A;  4WVZ A;  5GLZ A;  2WZR 3;  5LK7 B;  4GH4 C;  4CPB A;  4QB2 A;  3FX3 A;  1XBF A;  1F9K A;  5JVV A;  1W8O A;  2OZJ A;  1DHK B;  3BUC A;  4XPV A;  4LT5 A;  1HRV 2;  5AVA A;  2BGC A;  1QIQ A;  3GZE A;  3K3N A;  5F2W A;  1OQD A;  3CNA A;  3WNM A;  1COV 2;  1HLC A;  4BMB A;  1GNY A;  2Z4F A;  1AR9 3;  3CIH A;  2ZGT A;  1BVP 1;  4QB6 A;  4AHZ A;  2JEM A;  1C57 A;  2D3P A;  5A7S A;  4AAP A;  1PGL 1;  4KG0 A;  4KBB A;  4LBJ A;  3RZL A;  3R05 A;  2WL1 A;  4NOT A;  3I4I A;  5H9P A;  3H3L A;  1G6N A;  1RUF 3;  3I8T A;  5DUW A;  2XVK A;  5DAQ A;  2RS5 2;  2SLI A;  2ZGR A;  3AVS A;  1IOA A;  3FLP A;  3O1U A;  2JDN A;  1PM4 A;  2WQZ C;  3POJ A;  4ZZ5 A;  2QQV A;  2PHR A;  2R1B A;  1QOT A;  2ZGU A;  3MIF A;  4OMC A;  4ZXK A;  1J1T A;  1HRV 3;  5K9Y A;  5C5T A;  2FDK A;  1UD1 A;  1IPJ A;  2LRP A;  4PQ9 A;  5FIX A;  1IS3 A;  3MW4 A;  3SCG A;  4DRR A;  1HIX A;  5K8S A;  1HDK A;  4D6Q A;  3KHB A;  4SLI A;  3BYW A;  1F35 A;  4JV4 A;  1NZI A;  2W1W A;  4WVW A;  4IV3 C;  5DG1 A;  1WME A;  3AZV A;  3M3O A;  4D69 A;  4YG6 A;  5FY1 A;  4N53 B;  2PHT A;  1YFW A;  1DQ5 A;  1RMU 2;  2HWB 3;  1W3X A;  1WCK A;  1OUR A;  1KFU L;  1S0C A;  3J7M A;  1C1L A;  2PEL A;  5FUI A;  2RS5 3;  2Y6G A;  3AX4 A;  1SPP A;  1NE6 A;  3J8F 3;  4Q4W 3;  3KWV A;  2LUW A;  2JEC A;  2VMG A;  4XIK A;  4AI2 A;  4XUQ A;  1DBN A;  1VMF A;  2QZ2 A;  1VE0 A;  4HFS A;  3WP5 A;  5ABJ A;  3QH6 A;  2HEY F;  1JYT A;  3N9L A;  4C1X A;  1ULF A;  4JDO A;  1IG3 A;  4JTO A;  2KA3 A;  4L2N A;  1D0H A;  3U14 A;  4UFM A;  5FYV A;  2J42 A;  1Y9G A;  2QQJ A;  4Z8B A;  5J09 A;  3ABZ A;  3VBS B;  3AXD A;  1CX1 A;  1GSL A;  4N8M A;  4X8N A;  1W6O A;  2XML A;  1O8S A;  1US2 A;  5AFB A;  4W8J A;  5F37 A;  4I3P A;  3ZXA C;  2OT7 A;  2W39 A;  5LY1 A;  2ZGK A;  1QF3 A;  4IEX A;  4ZPI A;  3UES A;  4IV3 A;  2RMU 1;  2R49 A;  2ES3 A;  2JDP A;  4PDW A;  4WM8 C;  5KHG A;  3C7O A;  2ZZQ A;  3B02 A;  4BOW A;  4Q4X 2;  5F2S A;  1AYN 2;  1FI2 A;  4L9B A;  2PYT A;  1LEC A;  2DVG A;  2PHU A;  1ONA A;  2PHD A;  2QZ3 A;  4S2F A;  5FYB A;  5FZM A;  3UL2 A;  5BNN B;  2FZ1 A;  1X8M A;  5FY4 A;  3ZR6 A;  4UF0 A;  3JQX A;  1IPK A;  2WS9 2;  3NJX A;  1H6Y A;  2Q8C A;  1UXX X;  3WY6 A;  5FYT A;  5FRA A;  5J36 A;  2PA7 A;  4BK5 A;  5FZB A;  2WLQ A;  2E26 A;  3C7H A;  2BGP A;  3G6J B;  3BTZ A;  5FMB A;  1K5M A;  3FWE A;  2GC3 A;  4AF9 A;  3LFI A;  4GB3 2;  4QU2 A;  4XAC A;  1QJF A;  2V72 A;  5EYY A;  1SLL A;  4FPH A;  1CZV A;  4KWU A;  3GBW A;  1RUJ 3;  4QMA A;  5FYH A;  1UMH A;  2JB4 A;  2ZBJ A;  1GV9 A;  4QPI C;  1SEF A;  1TEI A;  1MVE A;  2WNV A;  5T5J A;  4CTE A;  1LHO A;  3ENR A;  4COW A;  3BTX A;  4FPC A;  1MAC A;  3S7E A;  4H3W A;  1L7L A;  1UY2 A;  3H1M A;  4CYD A;  3GBG A;  3I3Q A;  3OPT A;  4O9G A;  1Z7S 3;  3VDB A;  2UWA A;  4P00 B;  4XUT A;  1BEV 1;  1QKQ A;  5A32 B;  4QM8 A;  2BQP A;  1F8V A;  1O3T A;  1AX1 A;  5FZK A;  2VD7 A;  4QX2 A;  4DOU A;  5F3G A;  3RWN A;  5DXD A;  4HOO A;  4XIO A;  3ILR A;  5FYI A;  1HRI 1;  1Y9Q A;  4RYD A;  1URX A;  2DTY A;  2IXJ A;  1TME 3;  3RNS A;  3UYJ A;  4AHX A;  3D8C A;  4JDN A;  3V0A B;  4QHB A;  2FDH A;  5FZ8 A;  1UYX A;  1JOJ A;  3A4U A;  3JD7 2;  3VBS C;  4I30 A;  3QOP A;  5FO9 B;  2WN2 A;  1NXD 1;  5FPU A;  4IND A;  1SBE A;  5LBF A;  1JYC A;  1MVQ A;  3W59 A;  4D6S A;  1CAV A;  3KHC A;  1O3S A;  3WG2 A;  4D6R A;  4IET A;  2O0O A;  3BU7 A;  2ZML A;  1DQ0 A;  4OHX A;  4XUO A;  5IAT A;  2PHL A;  5CBL A;  5JR2 A;  3M8L A;  1IS5 A;  4AWD A;  4L11 A;  4FTB A;  3ZIX A;  4FXK B;  4A44 A;  2VUC A;  2NM1 A;  2E6V A;  3M3Q A;  3ACH A;  1DZR A;  4P9X A;  3MUY 1;  3VBF A;  2HJI A;  2V4V A;  3THC A;  2VQU A;  3X29 B;  4AFA A;  4MGK E;  4X6Q B;  2MPF A;  3OJB A;  1AXZ A;  4GAZ A;  4M00 A;  2VTF A;  4X6R B;  5FJK A;  5JXH A;  3I2F A;  4QXK A;  2WDB A;  3E5X A;  3RZH A;  4NIG A;  4KQ7 A;  3GXU A;  1CAV B;  5EJ1 B;  1OD5 A;  2R07 2;  2RM2 2;  4IGO A;  4QT6 A;  1VBC 3;  3WG4 A;  1UWW A;  1ZZ8 A;  4QX3 A;  3AB0 A;  1OLR A;  5FPV A;  3WDX A;  2YZ4 A;  5IJR A;  3RQ0 A;  3VDD C;  1SFP A;  4YVW C;  1WMD A;  3Q8B A;  4QPY A;  1RUC 3;  1POQ A;  4MAD A;  2VNR A;  1J59 A;  4LIV A;  3WF1 A;  4I2O A;  4MGQ A;  4K9S A;  5AC9 2;  2VZT A;  1AL2 2;  1ZBA 3;  4DPN A;  4LE4 A;  1BZW A;  2V5D A;  5FZ6 A;  3KD4 A;  3LEK A;  3H0O A;  2ZKL A;  4BQ1 A;  4ERO A;  5K0U C;  3T30 A;  1W8F A;  4BQ3 A;  5JMO A;  2WNE A;  3N7K A;  3WQB A;  3PIJ A;  3H7J A;  3ZFE B;  1V6N A;  4AQT A;  1VRH 2;  4BQ2 A;  5A3M A;  2A1X A;  1CJP A;  1QXP A;  1U5X A;  3AJY A;  4IXL A;  4CP1 A;  1PIV 2;  4AOC A;  4NAM A;  1S0J A;  3KZ4 C;  5G05 L;  2GME A;  5C8C B;  4A42 A;  2ZMN A;  1E5H A;  1MR5 A;  3HQU A;  1QEX A;  1ZA4 A;  1W39 A;  1QDC A;  1OF3 A;  4HMZ A;  4PBP A;  1ZVF A;  3W20 A;  2FDF A;  5DDJ 1;  1N47 A;  3KQ4 B;  4NVP A;  2ZEX A;  2YGM A;  4AVV A;  4Q4X 3;  2VE1 A;  3M2M A;  2Z5W A;  1I6X A;  2RHP A;  4EN0 A;  2C0Z A;  2RS1 3;  4BU2 A;  2VCC A;  1G9A A;  1LGC A;  1PM7 A;  4F83 A;  1HQN A;  2VNO A;  1RUI 3;  1S2K A;  1YO8 A;  4MYE A;  4TYS A;  1YFY A;  1BLZ A;  3DKW A;  3HT2 A;  1IQD C;  4ZON A;  2JDZ A;  1ENQ A;  3KQR A;  3H42 B;  4XYX A;  3I97 A;  1MS0 A;  1S0E A;  2YGL A;  5AC9 1;  2XBO 3;  4PI2 A;  4XEZ A;  4A3Z A;  3C7E A;  4WZC A;  1WMX A;  3FE5 A;  2XH6 A;  5IUQ A;  3QLQ A;  3BTY A;  2ARE A;  1NLS A;  4HVO A;  4YAR A;  4YM0 A;  1DQ1 A;  1NY7 1;  2CSG A;  2AAC A;  3M4F A;  1UZV A;  4B4Q A;  2FMD A;  1PVX A;  3F95 A;  1E5I A;  3AP6 A;  4CU7 A;  4PF1 A;  2PLV 3;  3EQE A;  4K7J A;  1R09 2;  1WCD J;  2J1U A;  2QBX A;  4PQQ A;  2QTW B;  4BXS V;  2EAA A;  5IAX A;  5J3U A;  1OVS A;  3ACL A;  3AMH A;  4PT6 A;  3BI3 A;  1P8J A;  5KXE A;  3TEX A;  5A7P A;  2ENR A;  4K1Z A;  3AYC A;  4CEW B;  1JYV A;  1JZ8 A;  3CZJ A;  2XL7 A;  3NST A;  1W8W A;  2EF6 A;  5B2G B;  3ZXL A;  2YXS A;  1R1Z A;  4ONU A;  2G9G A;  4LO8 A;  4Y22 A;  1H2M A;  1PO2 1;  2D93 A;  2GMP A;  4FI9 A;  2ZGP A;  2D6O X;  2E7T A;  3PUS A;  3OUJ A;  1NCQ B;  3PUQ A;  4RGA A;  1YI7 A;  1QH7 A;  4NE9 A;  1H4H A;  2OUH A;  2W1Q A;  3J7H A;  3KSC A;  5BXX A;  2WO3 A;  3ZFE C;  3KV9 A;  4DIQ A;  1PO1 1;  2C1F A;  5FP9 A;  1IKQ A;  3RMX A;  3ZFF C;  1JU4 A;  3GBF A;  5FY5 A;  2W3J A;  2HWD 3;  4Y1X A;  1W8H A;  1GUI A;  1MS9 A;  5C4W A;  3VN4 A;  4ZZ8 A;  1F5J A;  4E8D A;  4RR3 A;  5FXV A;  1Z7S 2;  1RL3 A;  1AR6 2;  3WP6 A;  2WAB A;  4FFG A;  4KWJ A;  2WO2 A;  2VOK A;  4GIQ A;  2BJS A;  4LMF A;  3QCW A;  2ZKN A;  5JZG B;  3OCP A;  4IER A;  3RRD A;  4NPR A;  3KV4 A;  2G9F A;  5CFD C;  4LBL A;  1DGR N;  1JBC A;  1ZRD A;  4GZ9 A;  5TSW A;  4JHT A;  1GR3 A;  1PGW 1;  3PUR A;  4BXF A;  2C9A A;  1TE1 B;  5I91 A;  1Y3T A;  2WQ8 A;  5J37 A;  1ND2 C;  1CAX A;  1RUH 2;  1UY3 A;  3T2O A;  3SMH A;  2X53 S;  1AJO A;  3T0A A;  4BA6 A;  3IPV B;  4AED A;  2VUL A;  1RUN A;  1S55 A;  1FV2 A;  2PHX A;  2YFZ A;  1JZ7 A;  3NQH A;  5B4N A;  2DVD A;  5J1X A;  2B39 A;  1VIW B;  1UU4 A;  1OF4 A;  5C8C A;  4JRL A;  2B45 X;  1IGO A;  2XG3 A;  1CJD A;  2DFB A;  1WCU A;  1LUL A;  5JOZ A;  1N1V A;  2XOM A;  1OPO A;  1KDK A;  1VBC 2;  2UWB A;  3GJB A;  1BBT 1;  4CP0 A;  1QU0 A;  4GA9 A;  5JAX A;  3LPG A;  4XFG A;  4ES9 A;  1BHG A;  1DYP A;  2ARX A;  4O65 A;  1OQE A;  1JOB A;  1SLI A;  5FWE A;  5LAT A;  4AI9 A;  3BAL A;  5A33 B;  1UMZ A;  5EYX A;  1XB9 A;  1VRB A;  1ZZ9 A;  2OKX A;  1ND3 C;  3PLQ A;  5JOX A;  1LOF A;  3VV1 A;  4JGZ A;  4COZ A;  2AZ5 A;  3AKP A;  4Q4Y 1;  5LRS A;  3FL7 A;  4MGT A;  1ND3 A;  1ZRI A;  1BK0 A;  4HG6 B;  4UFL A;  3LF7 A;  4IUG A;  3LFM A;  3USU A;  4FTE A;  4FBF A;  2QE3 A;  3V0B B;  3KB5 A;  1Q56 A;  3GAL A;  5E6H A;  4EN8 B;  4URT A;  1SAC A;  2LRO A;  3AZY A;  3H1Y A;  2GP3 A;  2CTV A;  2DWR A;  1WLC A;  5C3O A;  4P5Y A;  1YI9 A;  1FPN 2;  3CJX A;  3WG3 A;  4R52 A;  5JLV A;  1QDO A;  1I9R A;  1LOE A;  1O6U A;  1SMV A;  3IDB B;  3AYA A;  1NG0 A;  3AYD A;  4XTM A;  4Y5S A;  2VZP A;  4XFC A;  4ASK A;  2YBS A;  4OZO A;  3G7D A;  1H8V A;  1LOA A;  2CDO A;  1H1A A;  3RS6 A;  5C6C A;  1W9Y A;  4UW6 A;  3GHN A;  4QWN A;  4U2A A;  5AVP A;  2Y26 A;  3R4D B;  3U37 A;  2XJP A;  4QM9 A;  1SBF A;  2VW1 A;  3H3U A;  4BQ5 A;  4BK4 A;  2EID A;  3P6B A;  4CEW A;  4OI2 A;  1W8Z A;  2B5H A;  2P6H A;  1PK6 A;  5GLV A;  5A3O A;  1PZ9 A;  2WZR 2;  1RUD 3;  2WJS A;  2RS3 3;  3K4D A;  3ZKY A;  4YWA A;  1PX3 A;  1GBG A;  2VZS A;  1QJX 1;  4KMQ A;  3N9O A;  2Y6L A;  3CO2 A;  4QPI B;  4LBQ B;  5FYM A;  4AI8 A;  1RUF 1;  1G8W A;  2VMI A;  5GZG A;  1G9D A;  1VAV A;  4PDW B;  3ZSK A;  2QVS B;  3DCQ A;  1POV 0;  2C6S A;  1Y4W A;  1ULC A;  2VZO A;  2RMU 3;  4HON A;  4GMP 3;  4YYO A;  4DO0 A;  2HEW F;  5F6K A;  4DY3 A;  4EZ4 A;  3WW4 A;  1CAW A;  2VNV A;  2FCU A;  3C8X A;  4UW3 A;  3T2P A;  1RUE 3;  1QOS A;  4K3U A;  4AED C;  4AQ2 A;  5IVC A;  2BNN A;  2ZEZ A;  3Q8A A;  5A3P A;  4KWK A;  1AYM 3;  4IGP A;  1K5M B;  1CPM A;  1DLL A;  1GQP A;  3MBW A;  1UOG A;  2JXA A;  3VKM A;  2W1U A;  5FQ0 A;  1TNR A;  4LK7 A;  3EXU A;  1G9B A;  4XBN A;  3ZXD A;  1UQX A;  4ISQ A;  2ZGQ A;  4AXO A;  2OQ6 A;  3WNX A;  2A3X A;  4B4P A;  4LXL A;  4MHU A;  1JYI A;  1G86 A;  2RS5 1;  4CDW B;  1XQN A;  4TLG A;  5HXV A;  3HPN A;  4Q4V 3;  3CMG A;  5FP8 A;  1J3P A;  2ARA A;  5FPB A;  1XND A;  2JIG A;  3LDR A;  3LE0 A;  2ZAH A;  3K3O A;  1QJU 1;  4AFB A;  2WQ4 A;  2AEZ A;  1VB2 A;  2VPV A;  3CLP A;  3NAP A;  3VBH B;  1F2N A;  4NRQ A;  2RDS A;  4R8H A;  1JZ3 A;  2R32 A;  1M06 G;  1VR3 A;  2DUR A;  4B1M A;  1HB1 A;  2AGS A;  5IFT A;  2OUJ A;  2K9Z A;  5FZ0 A;  4CCM A;  5BNP B;  3IAP A;  2YBK A;  5A33 A;  2VZV A;  4HL0 A;  2X5I A;  2WZP P;  3AMM A;  1WW7 A;  4OHV A;  3VD7 A;  1NZC A;  1G9F A;  2C9K A;  4C1W A;  3J4U H;  3HT1 A;  4WVM A;  1WMF A;  2V4A A;  3LPF A;  1LCL A;  4GH4 B;  4B1L A;  1AUY A;  1ND3 B;  2D5H A;  1AYM 2;  5BPX A;  2A6Y A;  2Z42 A;  3I3E A;  1TME 1;  2C24 A;  1KQR A;  3K4Z A;  4IE5 A;  4E2G A;  3DPR C;  3WQ1 A;  3ORJ A;  3DL3 A;  5GKA C;  5BV6 A;  3VBO B;  2VMH A;  2IXC A;  2YBP A;  4ZU5 A;  4NWV A;  4N90 A;  4M3C F;  4XCB A;  3WNN A;  2I74 A;  4OQ8 A;  2PQS A;  1ENS A;  4BME A;  2WWU A;  4DMI A;  1OKQ A;  1VPH A;  1RHI 2;  2O8O A;  4I0A A;  1GNZ A;  3TN9 1;  4E4Z A;  4FP2 A;  2VO5 A;  3E6B A;  1NCR A;  1ZZ7 A;  2WT1 A;  1GFF 2;  3ZPY A;  1UF2 C;  2WFF 1;  3KCY A;  2UYA A;  4QDS A;  3N4M A;  3O5S A;  1KS5 A;  1C8M 1;  2NMO A;  3BOW A;  3OBZ A;  4YLZ A;  1OA4 A;  1WZX A;  4PHZ A;  2ZZJ A;  1PZ7 A;  1KJL A;  3L2Y A;  4M3C A;  1JMU B;  2G9Z A;  4GAL A;  2DUQ A;  1M4W A;  4Z92 B;  4TTG A;  4GD4 A;  2QQI A;  1VRH 3;  2Q4S A;  4YVW A;  1W6N B;  3KVA A;  4XFI A;  1MS4 A;  1ZZC A;  4L97 A;  4Q29 A;  1AR8 3;  1PMJ X;  2XLG A;  3VL8 A;  3W58 A;  3ZXF A;  1C8M 2;  3H1W A;  5T3N A;  4Y26 A;  1AR8 2;  1DQ6 A;  1EY2 A;  3DEM A;  2QFE A;  4YGD A;  3B9C A;  2DVB A;  4IEQ A;  2DYC A;  3AMP A;  2WZ8 A;  2VJX A;  2ID4 A;  1ND2 A;  1XE0 A;  2A3Y A;  2YC0 A;  3TN9 2;  1VBB 3;  3ZX7 A;  3NKG A;  3Q8E A;  5BY5 A;  1HN0 A;  2HWB 1;  2OXB A;  1UL9 A;  4XJA A;  1LHV A;  1K5J A;  1SLC A;  1NX9 A;  2RR1 1;  3AFK A;  3OGG A;  5FOB B;  2XKP A;  2NQY A;  5I8Y A;  4A2U A;  1JI6 A;  2RR1 2;  1RUC 1;  4HPK B;  3VD4 A;  1DQ2 A;  1D7P M;  1HB3 A;  5EXO A;  5IT6 A;  3DYM A;  3WW3 A;  4LO6 B;  4Y22 B;  2XON A;  3NRU A;  2WUH A;  4OZX A;  2RS3 2;  2BFU L;  4IE7 A;  4PJY A;  2Q8E A;  3MZH A;  1JXN A;  1WW4 A;  1NLQ A;  3SIS A;  3E6C C;  5F3C A;  4NRP A;  2YC4 A;  1LJ7 A;  5GLU A;  1UYY A;  3VBU C;  1MS1 A;  1S0D A;  3ZOI A;  3ZSE A;  3MIG A;  4YVW B;  4LBO A;  3ZKU A;  3O0W A;  1DIW A;  3SC7 X;  4XIL A;  4JCK A;  4L8Q A;  4EN6 B;  1UKR A;  4R4X A;  2ARC A;  2VUD A;  5K7P A;  1G9C A;  1S2B A;  4MOA A;  2ARB A;  5DDJ 3;  2DVF A;  1BXH A;  4BLI A;  3IDC B;  5I0T A;  3EJK A;  4Q4X 1;  4YM1 A;  2WC2 A;  5ACA 1;  3ZN4 A;  5JWP A;  4Y33 A;  2E33 A;  4YZ4 A;  5CKM A;  4XC9 A;  5FRE A;  1TVG A;  3HNY M;  3K48 A;  2VH9 A;  1XNA A;  4CRQ A;  3Q9O A;  4UWD A;  3WZ1 A;  4FCA A;  3AJZ A;  2G1M A;  4DRV A;  4BLJ A;  1B35 C;  2Q0A A;  1GP6 A;  4IEV A;  4LBN A;  3WD5 A;  5C8C C;  5I93 A;  3I54 A;  3OUI A;  4Q0U A;  4A4A A;  1X33 A;  5JXJ A;  1LEM A;  4QGM A;  1TME 2;  2E9Q A;  3WSO A;  2QQP A;  1RUO A;  1NXM A;  3S30 A;  2ZAB A;  4FOY A;  4LBQ A;  1Z78 A;  5C9A B;  1J1L A;  1VAK A;  3R0R A;  3T0B A;  1CIW A;  1R08 1;  5E8A A;  2HWD 2;  1EPW A;  1XU1 A;  5D1I A;  4XHB A;  1W99 A;  1ZBA 1;  3OD4 A;  5FZO B;  5A7O A;  5IVV A;  1KJR A;  4QQH A;  4CCK A;  1H8T A;  3WHU A;  1EYB A;  4JTN A;  3INA A;  5C8W A;  3D82 A;  2VZ3 A;  4YGB A;  1LNS A;  3O1S A;  3POS A;  4A3X A;  1E5S A;  3J7N A;  3H9A A;  4KGQ A;  1POV 3;  4AG4 A;  3USU B;  3AYE A;  1WWY A;  3I2K A;  4IEY A;  1KEX A;  3JUU A;  1MQT B;  4E4D X;  2HWF 2;  4QGN A;  3S57 A;  4LEJ A;  4XJ9 A;  1Q8O A;  3OPZ A;  2W0X A;  4QDQ A;  5A70 A;  3WX5 A;  1HN1 A;  1VAL A;  1SLA A;  1VBE 1;  5LCW L;  3V0A A;  4YGC A;  2OYZ A;  4NN0 A;  3U0Z A;  4Y4R A;  3HAG A;  3RJR A;  1IS6 A;  3N7L A;  3P3N A;  2BEO A;  3AKR A;  4RR3 B;  4UAP A;  5GZF A;  3T1L A;  2CGO A;  2VZU A;  5JXG A;  1UY0 A;  2ILM A;  1LOC A;  1S4C A;  2XXZ A;  2NZ9 A;  3IN9 A;  4JHZ A;  3ILF A;  2B9V A;  4BQW A;  1H2N A;  4ZS2 A;  4A45 A;  5KC5 A;  2OZ6 A;  4CPB D;  2WWS A;  4CUG A;  1W8N A;  3WQ7 A;  2BVB A;  3HNM A;  2TUN A;  4AVA A;  2TEP A;  5IVE A;  3KGZ A;  5AC9 3;  1FPN 1;  1VBD 3;  1ZNP A;  3H8X A;  1J58 A;  3ZVX A;  2DCK A;  4XMI A;  2JG9 B;  4D7Y A;  1CPN A;  4CDX B;  3LA2 A;  4AYU A;  1EUU A;  3Q8C A;  3ZIW A;  4K8F A;  1TMF 1;  2J7M A;  4EWE A;  1WLW A;  4MGI E;  3AKT A;  1XSR A;  2R04 3;  1WCS A;  2CNA A;  2Y34 A;  1N3Q A;  1XYP A;  4XF1 A;  5FY8 A;  2W95 A;  3DYO A;  5FCC A;  5CVR A;  2GN3 A;  5SV8 A;  2Y33 A;  3KGL A;  4BJ0 A;  2W68 A;  4N7I A;  1E5R A;  2R0H A;  4CP9 B;  1KFX L;  5IK7 A;  1QXJ A;  2GU9 A;  2E63 A;  1VLN A;  2VGD A;  3L9J T;  3OY8 A;  4NII A;  2XGX A;  3VDD B;  1HKD A;  3ZXJ A;  5A3L A;  1JZ2 A;  1CVN A;  4BYY A;  4BIO A;  1D4M 1;  4AQ6 A;  4L99 A;  5BNO A;  2XJU A;  3ZYI B;  2GNB A;  1O3Q A;  2Y60 A;  3WDT A;  2E51 A;  2YHJ A;  4EV0 A;  4LUK A;  3POG A;  2X10 A;  4IE4 A;  1UYP A;  3N7M A;  3WG1 A;  1Y43 B;  2BDR A;  3B7M A;  1V0A A;  3D0J A;  2ZTN A;  3BIE A;  1K42 A;  5C3S A;  2P34 A;  5ERL A;  1ACC A;  1SBD A;  4UOJ A;  3VHP A;  3AKQ A;  3RZZ A;  3FBY A;  5FBZ A;  3E1F 1;  4Y3O A;  3PJY A;  2XJS A;  2FHR A;  4OI1 A;  5HBA A;  3E6D A;  4DZG A;  1NE4 A;  2D6M A;  4OMD A;  4FP3 A;  2WT2 A;  2ADD A;  2MEV 3;  3N9Q A;  3PVE A;  4Q4Y 2;  4YW3 A;  4NAO A;  5CNA A;  5EWS A;  4LKF A;  2VVF A;  4CUA A;  2QQO A;  1H8T B;  2ZGS A;  3ZXG A;  4AGR A;  3MPP G;  3VD9 A;  3P5B A;  1YWK A;  2WN3 A;  2YV8 A;  4FOW A;  3MV0 1;  1RUE 2;  2VBP A;  5F5I A;  3RJ2 X;  3V65 A;  4CP9 A;  2UWC A;  1R64 A;  4OI0 A;  1UN1 A;  3OUH A;  1BBT 2;  4HET A;  3WVJ A;  3FZ3 A;  1QQP 3;  2RDQ A;  5BNO B;  5GM0 A;  2A71 A;  4QQL A;  3FN9 A;  2QQM A;  3FJS A;  1AR9 1;  1GOG A;  3VHO A;  1UOJ A;  3NWK A;  4PLO A;  4ZU4 A;  3GZU C;  3T4H B;  4YW1 A;  3WW1 A;  4MH0 E;  5GLT A;  3A0N A;  2WT0 A;  1CAU B;  3NMB A;  4EN7 B;  3KT1 A;  5FYC A;  2WIN B;  5T5L A;  5IVJ A;  3FBM A;  5L7O A;  1JYX A;  2HWE 2;  4JRA A;  1SPP B;  1C3H A;  3O0V A;  4XZU G;  1NLR A;  1Q5O A;  3EMR A;  2JG8 C;  3HQR A;  4ORF A;  4Z2A A;  3WR0 A;  2D98 A;  1US3 A;  3GCX A;  2QQL A;  3S5A A;  1LGB A;  2HYK A;  5FPZ A;  2OPW A;  4IES A;  4Q4Y 3;  5FZ4 A;  2B8M A;  5CIR A;  3THP A;  3V64 A;  2R1D A;  4BCU A;  2VMF A;  1GWK A;  1FMD 2;  3OBR A;  3M3C A;  1MEC 3;  4UT5 A;  3T2Q A;  4DEV A;  2EXJ A;  4N43 B;  1DGW A;  2JG9 A;  5T5P A;  3I59 A;  4ET7 A;  4JKM A;  4YZ5 A;  4FPF A;  4BH9 A;  1PO1 2;  3MI8 A;  2D43 A;  2HH9 A;  4D8M A;  4DNY A;  4Y4Y A;  3AMQ A;  4IV3 B;  5T55 A;  3H8U A;  4HN0 A;  4M0N A;  5C3P A;  1AX2 A;  4XOG A;  2CAU A;  3ECQ A;  1R1A 2;  4N53 C;  3AZX A;  4YVS B;  3WQ0 A;  4F7Z A;  3VZL A;  3MIB A;  4V2V A;  2CHH A;  2JB8 A;  1XPW A;  2WYF A;  4HZF A;  5BNO C;  2ZHL A;  3AZZ A;  1CAU A;  2ZOE B;  4FPL A;  4R9D A;  3WUD A;  4CZS A;  1I5Z A;  1S2E A;  1AVB A;  3IAQ A;  3PMS A;  4S2H A;  4BZ4 A;  5F32 A;  1A8D A;  3RGB A;  4KU8 A;  2Z79 A;  1Z0H A;  5IWF A;  1YHF A;  4JDM A;  3E5U A;  2EVX A;  4N9H A;  2VMC A;  5D2A A;  1O4Y A;  4P9W A;  1RJ8 A;  1WKY A;  5T52 A;  1ALY A;  1FMD 3;  2DUP A;  4J1W A;  4UBH A;  5D8A C;  1YQ5 A;  4E8C A;  2X5I C;  4XJZ A;  2R06 1;  5FAX A;  4Q4W 2;  5A7N A;  2BRT A;  4Q1P A;  1WCQ A;  4I0W B;  4GUL A;  4KU7 A;  2HWC 1;  3CL1 A;  1QXR A;  4AVC A;  1H1M A;  5E1R A;  3ZDS A;  2W47 A;  1OD3 A;  3OPW A;  5JMC A;  2XPJ A;  1W8U A;  1W2O A;  4AGG A;  1H2L A;  4QPI A;  5GAL A;  1ZRF A;  3SNM A;  1ODN A;  2HBT A;  5BNP C;  1RHI 3;  2P5B A;  4I3G A;  4YVS A;  4QB1 A;  1DQ4 A;  5KWR A;  1QHD A;  5HCB A;  2PAM A;  3U4S A;  5KHJ A;  2XLF A;  3E5Q A;  4OLL A;  5F7U A;  1DG6 A;  4WVV A;  4H7M A;  4HLT A;  1W04 A;  2HLE A;  3TN9 3;  3NKT A;  1ST8 A;  4HK8 A;  4R9A A;  1MZF A;  3VBF C;  5KXB A;  1ZBA 2;  1I1E A;  3DKQ A;  2AUY A;  3ES4 A;  4DY5 A;  4Q4V 1;  2X09 A;  2X29 A;  3PME A;  1H1I A;  2W52 A;  3W5M A;  2D3S A;  2YG0 A;  4NHY A;  5FZ9 A;  1REE A;  2D5F A;  3D5O A;  3NNJ A;  4XUR A;  3PJQ A;  5F6L B;  2IC1 A;  3AK0 A;  4ZY9 A;  1UIJ A;  1W9W A;  2ZAC A;  2Q30 A;  5CEH A;  2PTM A;  2XVG A;  1VRH 1;  2VR4 A;  1HB4 A;  2QUO A;  4YM3 A;  3KS7 A;  3THD A;  3ZMO A;  1BEV 3;  1LHN A;  1VBB 2;  1IQA A;  4Z2W A;  4ISR A;  4UW5 A;  3DN7 A;  5ACA 2;  4RFR B;  4HXC A;  2DTW A;  4QX8 A;  3IBM A;  3JQW A;  4GH4 A;  3ASI A;  1J83 A;  4W4Z A;  3O12 A;  1JOD A;  4Q0Q A;  1DP0 A;  4YW2 A;  3WXP A;  3RYR A;  1REF A;  4AVB A;  4DS0 A;  1R09 3;  1WLD A;  1LTE A;  3QH7 A;  2Y6H A;  1C5H A;  2XUE A;  4GXL A;  4LK6 A;  5M0T A;  4M01 A;  3UGH A;  2WA4 A;  4U36 A;  3WOG A;  1B35 A;  4FT8 A;  1OH3 A;  2KR2 A;  5LRR A;  4QX5 A;  3V56 A;  2FDG A;  2WII B;  4R9B A;  1EPZ A;  1JHN A;  4P08 A;  5A1F A;  2ZS6 B;  4BQ4 A;  4Q8L A;  2RS3 1;  1PHM A;  3D4K A;  2J22 A;  4J1X A;  2O8Q A;  1OFS A;  5FLI A;  3SEP A;  5FYS A;  1OHF A;  1VJ2 A;  1BEV 2;  5JSP A;  1RIT A;  1GAN A;  1OUS A;  1W6P A;  2UU8 A;  3HOB A;  4C91 A;  3H8O A;  1N1T A;  5FXW A;  4XDQ A;  2ZX2 A;  1X9T A;  4LOS A;  4RGK A;  4I02 A;  1IG0 A;  4GMP 1;  4Q26 A;  4M3C B;  3DYP A;  5CU1 A;  4CSW A;  1AXK A;  4XF0 A;  4CDX A;  1I3H A;  3IIA A;  4H7L A;  2E7A A;  2P3I A;  4HVR A;  2NMN A;  3POE A;  3QAC A;  3RI9 A;  1RUE 1;  1LRH A;  1AR8 1;  1JYN A;  4RHV 3;  3VHR A;  5LW9 A;  4P02 B;  1ZA7 A;  1Q3E A;  2J1E A;  3BGA A;  4XAE A;  5HCH A;  1D2S A;  2H0B A;  1C5I A;  1MEC 2;  2UYB A;  2YYO A;  4FQ4 A;  4J25 A;  4PCR A;  5EQU A;  2H6C A;  1HJF A;  1FNY A;  1LU2 A;  1NA1 B;  2ORZ A;  3JD7 1;  4LQR A;  3LKJ A;  5CB7 A;  4CDW C;  1JZ5 A;  2BWC A;  4LTA A;  1U0A A;  5EHD A;  4DXT A;  1T6G C;  2P17 A;  2WWJ A;  3DEC A;  3UT0 A;  4MG2 A;  5IVY A;  3JBG 1;  1W6P B;  1R1A 3;  1QMJ A;  5LEJ A;  3IM0 A;  2DV9 A;  1DDL A;  2D7F A;  2D97 A;  1YLL A;  3I2J A;  4IEW A;  5FZ7 A;  1HRI 2;  2D6K A;  3I3M A;  3K77 A;  1ODM A;  3K4A A;  1GP5 A;  3OGS A;  2P3J A;  3ZYR A;  2VNG A;  2B7Y A;  4AAX A;  5GZD A;  4K6B A;  5FZC A;  1L3J A;  1W0O A;  1PX4 A;  5FUN A;  3RG0 A;  1H9W A;  2FDI A;  2FMY A;  3N7J A;  2RS1 2;  1XYN A;  3O1T A;  1CES A;  1RVF 3;  5F39 A;  3NJZ A;  2VZQ A;  4CDQ A;  2XB6 C;  1X50 A;  4XDO A;  5ABJ C;  3N9P A;  1SCS A;  1MZ6 A;  5FZA A;  2YUE A;  5JSO A;  4XFF A;  3I2H A;  4UFJ A;  5C4W B;  3VBR B;  4AHY A;  3MW2 A;  3WIN E;  4B3N A;  3SXW A;  1NKG A;  1EAH 2;  1QY4 A;  5IYY A;  3SHR A;  2YU1 A;  1W2U A;  2JDY A;  1IZ3 A;  3FC0 A;  4LLF A;  2AYH A;  1AZD A;  3FUQ A;  1IPS A;  1YFX A;  3RFR A;  1UNB A;  2W9X A;  4YW7 A;  1CAW B;  1CD3 G;  1RUI 1;  5HCF A;  5FP7 A;  3CEW A;  1UU5 A;  3UK9 A;  5FZ3 A;  3I7D A;  5FZG A;  1C4R A;  4IEP A;  1XSQ A;  3NV4 A;  1WA4 A;  4JX0 A;  5JOW A;  5FUP A;  2CWM A;  1XRU A;  3BTA A;  2GMM A;  1S0I A;  4QX0 A;  5K0U A;  3VB9 A;  2XBO 1;  3PVO A;  4QAW A;  1W2A X;  1QOO A;  4ZS3 A;  5IHR A;  3WP3 A;  3OD0 A;  4AVS A;  2PXJ A;  3W21 A;  3TAY A;  4YW5 A;  2MHF A;  5I8S A;  4GB3 3;  2HBU A;  4XQW A;  1A6C A;  2ATF A;  1TMF 3;  1F4A A;  4IL7 A;  5ISL A;  4JKK A;  5LA9 A;  4N43 C;  1GZW B;  1O5U A;  3WUC A;  3C3V A;  4UW4 A;  2W08 A;  4BM8 A;  5JCT A;  2I07 B;  1WLT A;  3DUI A;  1EP0 A;  1L7Q A;  1UOB A;  2YFU A;  3ELN A;  3LCP A;  4DXZ A;  2BZD A;  3WLU A;  3T0D A;  2K2S A;  3JU9 A;  2HEV F;  4YGE A;  4S2G A;  2XBO 2;  2JKB A;  4Y5T A;  2EA7 A;  1SDD B;  1JOP A;  1NT0 A;  2P2K A;  1OOP C;  4MXV A;  1X7N A;  3AP7 A;  3M3I A;  3NAP C;  3ST7 A;  4WV8 A;  3O7O A;  4EWD A;  1CGP A;  4LOT A;  2VVD A;  5FY9 A;  2RR1 3;  3CDZ B;  5CFD A;  5J48 A;  1VBE 3;  5DAV A;  3KV6 A;  4K21 A;  4P5H A;  1YYN A;  4LUL A;  2CWS A;  2DCY A;  2WR9 A;  1RMU 1;  2YPJ A;  4RL7 A;  4GJY A;  2X05 A;  2HWD 1;  1UZW A;  2ZX0 A;  4OUL A;  5FYY A;  1OQ1 A;  1PVC 3;  3W5N A;  5APA A;  4IQP A;  5LBC A;  1PVC 2;  2XQX A;  3BB6 A;  2ZEW A;  3BPS A;  3I3D A;  2B42 B;  1H9P A;  4MXW A;  5FV3 A;  4AEK A;  4AW7 A;  1EV1 3;  5A6Y A;  3R4S A;  2XL9 A;  3H7Y A;  4CU8 A;  2WA3 A;  3PU8 A;  1VBA 3;  4QQO A;  4RA0 A;  4XZP A;  3ZYF A;  3IMM A;  4D7S A;  1RED A;  5LWB A;  2YC2 A;  3S5Q A;  2ZPX A;  5DAB A;  4NIA A;  4Y20 B;  4FAG A;  5FQ0 B;  4FFH A;  3WV6 A;  2CGN A;  3GM8 A;  3OGJ A;  1ASJ 2;  5F3E A;  3VZM A;  1SCR A;  4NHK A;  3H3Z A;  2EIG A;  4KNC A;  3VL9 A;  2ZJC A;  1COV 1;  3OTF A;  3TBD A;  4BQY A;  3FFZ A;  3ETQ A;  2L9L A;  3VBR A;  2JDA A;  4LIT A;  4Q1R A;  2YU2 A;  4AEJ A;  3UET A;  2FBE A;  1ZRR A;  5C4W C;  2DCJ A;  3MGU A;  4CUC A;  1LGN A;  1GWL A;  5IW0 A;  4DIN B;  3C7F A;  4UFK A;  1HW5 A;  5A6X A;  3AFG A;  1N1S A;  1UW8 A;  1CIY A;  5A80 A;  4AFD A;  5IVF A;  4XVH A;  1GZT A;  4LBM A;  1W0N A;  1OPM A;  3F2Z A;  4QPW A;  2WAO A;  4LHN A;  3N9N A;  2JE9 A;  3MF9 A;  2VCA A;  3P1I A;  3WF3 A;  4KH9 A;  2W46 A;  4WZF A;  4Y20 A;  5J98 B;  4E9K A;  1Q43 A;  1F15 A;  1PIV 3;  1BVV A;  1VB4 A;  3EHK A;  1V6I A;  3HEI A;  3NV1 A;  3LA7 A;  4LHS A;  5CZK A;  3PVB B;  2RJL A;  3DPR B;  1UKG A;  1RUC 2;  1V6J A;  2DU1 A;  3ACG A;  4MV2 A;  5F5A A;  5JR7 B;  5LBE A;  4XQ4 A;  1C28 A;  3RZK A;  4NWW A;  1PMH X;  2J1S A;  1VBD 2;  4NHM A;  1IS4 A;  3ROU A;  4NIH A;  1MQT A;  4OHW A;  3LAG A;  3ACF A;  5ANN A;  2GZW A;  3UNP A;  1W05 A;  2R30 A;  3AP5 A;  5LAS A;  2WNO A;  4XJW A;  4NID A;  2Q1M A;  1PNG A;  3VBO A;  1PGW 2;  1OI6 A;  3WNP A;  1YIP A;  4EQV A;  1FOD 2;  1W28 A;  4RR3 C;  2JG8 A;  2XWB B;  4QPG B;  1ULG A;  4C8D A;  1PMI A;  2HKX A;  3HD8 B;  4CCC A;  3ZYP A;  1QQP 1;  3ETP A;  3PDQ A;  5A7W A;  2CL2 A;  1JTZ X;  5T5O A;  1GWM A;  2LAL A;  2WNV C;  4BDV B;  3VBH C;  2LS6 A;  1YFU A;  4QQP A;  2XKO A;  5FKC A;  3E97 A;  2BER A;  4KI5 M;  5E89 A;  3MPB A;  1MPX A;  3AC0 A;  1W9S A;  1HXS 3;  2EIB A;  2VC9 A;  1HXS 2;  2PLV 2;  4YG0 A;  2EXH A;  5LA2 A;  5LBB A;  1WD3 A;  2A3W A;  2A6Z A;  4W6Y A;  4XUN A;  3ON7 A;  4GWN A;  2HWC 3;  1PO2 2;  3K46 A;  2BOJ A;  2JDM A;  1V9U 1;  4LLO A;  2VEC A;  3O1M A;  4Y1Z A;  1O4T A;  2JKX A;  4MHR A;  4EYU A;  2G19 A;  4LKD A;  2R04 1;  3IZO A;  4YFZ A;  3OBT A;  4KBZ A;  3CZU A;  1JUH A;  1W6Q B;  3OYW B;  3B93 A;  4CA9 A;  2WNU A;  1AYM 1;  2Y0O A;  5FY7 A;  5J7M A;  4CP2 A;  2F17 A;  4ZU7 A;  3AXE A;  4LBQ D;  1VBA 2;  4XJ8 A;  4ASM B;  2Q5T A;  2Y6F A;  2VZR A;  3LEG A;  3HVD A;  4M4P A;  3OG2 A;  3RZJ A;  4OCT A;  1W6O B;  1GU3 A;  5FXX A;  4KWL A;  2GH8 A;  2JD4 A;  2Y38 A;  4SBV A;  2A70 A;  2QJV A;  5LA1 A;  4FXG B;  3RDI A;  5C70 A;  1D4M 3;  2WLP A;  3PUI A;  1GKB A;  3ZYB A;  4RS5 C;  2W87 A;  3H8R A;  1GQH A;  1ZZB A;  2W2I A;  3VDC A;  3IDA A;  1WBL A;  2IXK A;  1PZ8 A;  5L36 A;  1JZ4 A;  4YZ2 A;  2BYV E;  2G4I A;  1QJU 2;  3A0K A;  3FHA A;  3KMH A;  3TB0 A;  3UKT A;  1H2K A;  1W2N A;  1HV1 A;  4XE9 A;  2V73 A;  2HWC 2;  3N36 A;  4FPK A;  1CN1 A;  5FYU A;  3U75 A;  3ZYG A;  4ARX A;  1YQ2 A;  4CUB A;  4XTP A;  4OI4 A;  2R06 2;  4RFT 0;  4LE3 A;  1Q8S A;  4L0P A;  3POW A;  1AHS A;  4AL9 A;  4HKO A;  1TQ5 A;  3AM2 A;  4NMI A;  5BYN A;  2F4L A;  3N35 A;  4QD2 A;  4M4R A;  3GCW A;  3MLK A;  3AP9 A;  3APB A;  3A7Q A;  1ZRE A;  2HYX A;  1OT5 A;  1XNC A;  2D3R A;  3VBU B;  1GZ9 A;  5JZG C;  1FV3 A;  2P4E A;  1ASJ 3;  1UAI A;  3NNM A;  3NNF A;  3ATG A;  3PUH A;  5FK7 A;  1A8M A;  2WNV B;  3VZN A;  4CDU A;  5CFD B;  1HQL A;  1OVP A;  5FZI A;  4E27 A;  1UY4 A;  1YQ6 A;  3KM5 A;  5L9R A;  4ATE A;  1T2X A;  5CA6 A;  3TNP B;  2UY9 A;  3ZXK A;  3IMN A;  4C90 A;  1LED A;  3OB8 A;  4TSV A;  1O5L A;  2KXL A;  4AZZ A;  1K3I A;  4D3W A;  5A6Q A;  4AVT A;  4CU9 A;  5FZD A;  5F9T A;  1EV1 2;  4H14 A;  2A6W A;  4RD7 A;  2VTX A;  2WFF 3;  1JUI A;  4W50 A;  3T4V A;  2BP6 A;  5I0S A;  3LZZ A;  3I2O A;  1Y7B A;  3B3Q E;  3BU0 A;  1C8M 3;  3CHX A;  5BUV A;  1W6M B;  5FWJ A;  3PU3 A;  3QBQ A;  4XQD A;  3ZN6 B;  1XXN A;  4K40 A;  3VBU A;  3DV8 A;  2VM9 A;  1W03 A;  5K0U B;  1SQ4 A;  2PAK A;  1RUG 2;  1V70 A;  4EWA A;  4MVT A;  4P9J A;  4HT1 T;  4A6S A;  4YG3 A;  4Y24 A;  4DUX A;  1GZC A;  4OHZ A;  1O8P A;  4CCJ A;  4N43 A;  1KIT A;  5LEK A;  1W8T A;  1GLH A;  1MS8 A;  5FFO C;  3BPZ A;  1UZY A;  1XE8 A;  1GZW A;  1WW5 A;  2WZE A;  1SLB A;  1G7Y A;  2RG4 A;  4UFH A;  2R04 2;  3ZFG A;  5FMO S;  2P6C A;  1YIF A;  4XF3 A;  3LQC A;  3MIE A;  2AEY A;  4LNV A;  2Z2S B;  4Y5Z 0;  4YNI A;  3JBG 3;  1JW6 A;  1CX4 A;  2OQ7 A;  3HMY A;  5FXZ A;  1R1A 1;  1AR7 2;  3III A;  1DU3 D;  1YUD A;  1IHM A;  4HK9 A;  1K45 A;  4NRM A;  3J8F 1;  3NNG A;  4RN5 A;  4CDX C;  4URA A;  4CU6 A;  1BJQ A;  2VZ1 A;  4UI9 L;  1XNT A;  5CIS A;  1AX0 A;  4IW3 A;  2PAE A;  1XJA A;  2DF7 A;  5DAP A;  3SKV A;  1STM A;  2VBB A;  2XHN A;  5EFU A;  4XF4 A;  4WM7 B;  2FCT A;  4CDQ B;  1UOF A;  5DUU A;  3VLB B;  2QDN A;  4COU A;  4DEQ A;  4LO5 B;  3T09 A;  3U10 A;  4AI1 A;  1V6K A;  3CQO A;  4NR1 A;  1FMD 1;  2VME A;  4LHK A;  3TEW A;  1U12 A;  3KT4 A;  4QX1 A;  5F3I A;  3ZSL A;  3A21 A;  2XJV A;  1ZZ6 A;  3AKS A;  1N3P A;  1H30 A;  1NYW A;  4P14 A;  2P3Y A;  5JDB A;  5H9Q A;  3HIF A;  5DZG A;  1ZM1 A;  1RUJ 2;  4UBG A;  5LY2 A;  3VKF C;  4IV1 A;  2HWE 1;  3RZG A;  3O1V A;  4P9Y A;  4AE2 A;  5ACA 3;  4XXP A;  5L73 A;  5FLH A;  1EAH 3;  5JPN B;  2WKK A;  3NVC A;  3K75 B;  4I01 A;  3WCS A;  3ZO0 B;  2K0G A;  2Z69 A;  1AR7 3;  1S0B A;  1NQD A;  1DGW X;  1AR9 2;  1X9P A;  2ZHM A;  5I0R A;  1UY1 A;  2JDU A;  5IVB A;  2R7E B;  4ZXE A;  3S6P A;  4FPY A;  5A6Z A;  4XFB A;  2IVI B;  2A6V A;  3B9I A;  4XBL A;  2IZW A;  1NCQ C;  1AXY A;  3VBR C;  4XAB A;  1AR6 1;  4JC1 A;  5DG2 A;  1K5M C;  2PQQ A;  4QXB A;  1CZT A;  1OFN A;  4RQP B;  5EJZ B;  4JGZ C;  4GWI A;  1ZBE 2;  4LIU A;  4RHV 2;  1R08 3;  5HV0 A;  2WO7 A;  4E4H A;  5C71 A;  3LWC A;  2YMZ A;  2FZ2 A;  3LB9 A;  4XBQ A;  1H0B A;  4GB3 1;  1HX6 A;  1UMI A;  3OY8 B;  1A3K A; 
#chains in the Genus database with same CATH homology
 3KV5 A;  3ZLI A;  5CEH A;  4BU2 A;  3K3N A;  5F2W A;  3LDB A;  2YBP A;  3OPT A;  5FP7 A;  5F5A A;  5FZ3 A;  5E6H A;  5FZG A;  5A3W A;  2GP3 A;  2WWU A;  4AAP A;  5A7S A;  4XDP A;  4IGQ A;  5FUP A;  5FZK A;  5FZD A;  2VD7 A;  5IVJ A;  5F3G A;  5FYC A;  4QX8 A;  4CCO A;  4HOO A;  5FYI A;  5FP4 A;  2YPD A;  4ASK A;  2YBS A;  5FWJ A;  3PU3 A;  2PXJ A;  3AVS A;  3UYJ A;  5FPL A;  4QWN A;  5A3T A;  4QX7 A;  4C8D A;  4TN7 A;  2OX0 A;  2XUE A;  5FZ4 A;  4Y4R A;  5FZ8 A;  5ISL A;  4GD4 A;  5A7W A;  3PDQ A;  4QU1 A;  4CCJ A;  3KVA A;  5FPU A;  2GP5 A;  2XXZ A;  4D6Q A;  5F5C A;  4D6S A;  5ANQ A;  5A1F A;  3KVB A;  5A7P A;  5FZE A;  4CUG A;  5FZL A;  4D6R A;  3N9O A;  5FY1 A;  5IVE A;  3NJY A;  5IVV A;  5FYS A;  5FYM A;  5A7Q A;  5FZH A;  3RVH A;  4V2W A;  3PUS A;  5FY9 A;  3PUQ A;  2OQ7 A;  3AVR A;  2Q8D A;  3DXT A;  5FXW A;  5FXZ A;  4BIS A;  4EZH A;  3KV6 A;  4V2V A;  4DO0 A;  4HON A;  4URA A;  5FP3 A;  3PUA A;  4EZ4 A;  4EYU A;  3PTR B;  3KV9 A;  4CSW A;  5FBJ A;  4GJY A;  5FP9 A;  3N9L A;  3K2O A;  5F32 A;  5FY0 A;  4GAZ A;  5FJK A;  5FY8 A;  5FYY A;  5FY5 A;  2Q8E A;  5IVC A;  5IWF A;  3LD8 A;  5A3P A;  5FXV A;  5FY7 A;  5F3C A;  5LW9 A;  5FYV A;  4IGP A;  4QXH A;  5FJH A;  5FV3 A;  4IGO A;  2OQ6 A;  2XML A;  3AL6 A;  4UF0 B;  5FXX A;  5F3I A;  3KV4 A;  5F37 A;  4LXL A;  3PU8 A;  2OT7 A;  2WWJ A;  2OS2 A;  2XDV A;  5FPV A;  5A7N A;  5IVY A;  5A3N A;  5LY1 A;  3PUR A;  4BXF A;  5LWB A;  3U78 A;  5FP8 A;  5FPB A;  5FZ1 A;  4LIV A;  5FZ7 A;  3OPW A;  2W2I A;  5LY2 A;  3K3O A;  3DXU A;  5F2S A;  5FZF A;  5FYB A;  5FZM A;  5FZ6 A;  5F3E A;  5FY4 A;  3ZPO A;  4Y33 A;  2P5B A;  4UF0 A;  2Q8C A;  5FYU A;  5K4L A;  3U4S A;  5KR7 A;  5FZ0 A;  5FYT A;  5FZC A;  4CCM A;  4CCL A;  5FUN A;  5IVB A;  2YBK A;  5FZB A;  4Y3O A;  3AL5 A;  3N9M A;  2YU2 A;  4LIT A;  5FPA A;  5F39 A;  4GJZ A;  4XDO A;  3N9Q A;  3N9P A;  5IW0 A;  4CCN A;  5FZA A;  5A1L A;  5FYZ A;  4QXB A;  5FWE A;  5FYH A;  4QXC A;  4AI9 A;  5A80 A;  5IVF A;  4LIU A;  1VRB A;  5F5I A;  4E4H A;  3N9N A;  4NUB A;  5FZO A;  2YU1 A;  5FZ9 A;  5FZO B;  5A7W B;  5A7O A;  5FZI A;  4CCK A;  4DIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...