4QXCA

Crystal structure of histone demethylase kdm2a-h3k36me2 with nog
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
329
structure length
329
Chain Sequence
b'RTFDLEEKLQTNKYNANFVTFMEGKDFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIEMTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPSTVDFIDWVDNMWPRHLKESQTESTNAILEMQYPKVQKYCLMSVRGCYTDFHVDFGGTSVWYHIHQGGKVFWLIPPTAHNLELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSGWIHAVYTPTDTLVFGGNFLHSFNIPMQLKIYSIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKDFQKESLSMDME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 2A
molecule tags Oxidoreductase/structural protein
source organism Mus musculus
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
total genus 109
structure length 329
sequence length 329
chains with identical sequence C
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4qxcA01
2OQ6A 3PUAA 5FYUA 2Q8CA 3PUQA 4HONA 2PXJA 4IGQA 3LD8A 5ANQA 3LDBA 5ISLA 3PU8A 4QX8A 5A1FA 3N9PA 5A7OA 2W2IA 5FY4A 5E6HA 4GJYA 3RVHA 5FYIA 5A7QA 2P5BA 3N9OA 4CCOA 5KR7A 4QU1A 5FY5A 5F39A 5FP3A 3DXTA 5FWJA 5F2WA 5F37A 3U4SA 4UF0A 5FYMA 5FPAA 5FY1A 3KVBA 2XXZA 5FV3A 5FUPA 5FY9A 4UF0B 5F3EA 5F5CA 4AI9A 5FZBA 4NUBA 3PTRB 4QXCA 3KV5A 5FZGA 5K4LA 5FZIA 5IVCA 4QXBA 5FZOB 5A3TA 4CCLA 4AAPA 5IVVA 5A3NA 5A7WB 2XMLA 4IGOA 5LWBA 5F5IA 4QX7A 5A3WA 4ASKA 5FYBA 5FZFA 2GP3A 4HOOA 4CCMA 3N9MA 4LIVA 3KV4A 4EZHA 5FZEA 2WWUA 2Q8EA 2YBSA 2OQ7A 5A7SA 2WWJA 3ZPOA 5FYCA 4LITA 2OS2A 5FZ8A 3UYJA 4V2VA 5FXZA 4EZ4A 4GJZA 5FJKA 5LY2A 5IVFA 5FXWA 2VD7A 3PURA 4Y4RA 4URAA 5FP9A 4LIUA 4QXHA 4CSWA 2XUEA 5FZCA 5A7PA 2Q8DA 5FPBA 5LY1A 4BISA 5FZOA 5F3GA 5IWFA 5IVBA 3KVAA 5F32A 5FZ9A 5FZAA 5FYVA 2YPDA 5IVYA 5FZ1A 3K2OA 4IGPA 5FXVA 3OPWA 2YBPA 5FP7A 5FYYA 3AVRA 3N9NA 5LW9A 5FY8A 3KV6A 2OT7A 3K3OA 5FZ6A 3PDQA 3PUSA 2YU2A 4D6QA 5FYSA 5FZMA 5F3IA 5FY7A 2GP5A 4Y33A 5IVEA 3K3NA 4CCJA 4D6RA 5FZ3A 5FZHA 5F3CA 2XDVA 5FPVA 5IW0A 5FYZA 5FYHA 5A7NA 4DO0A 5FBJA 3AL5A 4TN7A 3U78A 4EYUA 4GD4A 4BU2A 3NJYA 5FZDA 5FXXA 5A80A 3AL6A 5A3PA 5IVJA 4XDOA 4DIQA 2YBKA 3KV9A 4GAZA 5CEHA 5FWEA 5FPUA 2OX0A 5A7WA 3ZLIA 3OPTA 4CCNA 5FP8A 5F2SA 4LXLA 5FZ4A 1VRBA 4Y3OA 5FYTA 4BXFA 4V2WA 3DXUA 4E4HA 5FZKA 5FZ7A 5FPLA 5FZ0A 3PU3A 3N9LA 5FY0A 3AVSA 5FP4A 2YU1A 3N9QA 5FJHA 5FZLA 4CCKA 4QWNA 4XDPA 4CUGA 4D6SA 5A1LA 5F5AA 5FUNA 4C8DA
chains in the Genus database with same CATH superfamily
3PUAA 4JX0A 1OLME 1RUH1 4CU6A 2O1QA 1RUF3 2D6KA 2VQUA 3E6DA 5BNNC 1YXWA 4LKDA 3N7LA 4HONA 4IGQA 1NCQA 2IUWA 1BEV1 2PLV2 4LTAA 2UU8A 4QPIC 4QPWA 4Y1UA 5LA9A 4A2UA 3BUCA 4R9BA 1CJPA 3ZIXA 1KEXA 3DUIA 4B1LA 1JI6A 5EYXA 3C7FA 3ZFEA 1FMD2 1VBD3 1FATA 1XE8A 1GNZA 4FTEA 2XQRA 3QH7A 2W47A 4HPKB 4BQ4A 4JKLA 1LOCA 2NMNA 3QD6A 2B4KA 3PMEA 3DYMA 1RUD2 1MS8A 3RDIA 5AC92 3B3QE 5AFBA 3HNYM 1XNDA 4MGTA 5T54A 4P9WA 1OH3A 4QHZA 5JXJA 4XACA 2Y6KA 4NPLA 3CEWA 4NUBA 4AZZA 5IVCA 3JBG2 5FTTC 2RS13 2C9AA 1ZZBA 4ZZ8A 2YC2A 1FV2A 4CP9B 2O0OA 3QCWA 5A3NA 5CFCB 2PHXA 4N43B 4XJ8A 4NR1A 1FOD2 1VBB1 2HWC1 1UF2C 2YUEA 3E6BA 1UNBA 4PIXA 3VZMA 5FZFA 4RFT0 4LEJA 1KS5A 2RG4A 3DEMA 4OHZA 3M3OA 3ZSLA 3USUB 2GN3A 2UWBA 2GZWA 1SACA 1Y9GA 3MIDA 4WM7C 2PLV3 4HG6B 1J1LA 1YFYA 4GH4B 2IC1A 1LEMA 4IEYA 2VH9A 5CAZA 3V65A 1GP6A 3H7JA 4GALA 4R9AA 2UY8A 4Y4RA 3I97A 3ZXGA 1RUI1 4JAAA 5IFPA 4OMDA 1QMJA 5CFCC 4AVSA 3I59A 5F32A 4NPRA 4PLMA 1HIXA 1PVC3 3A22A 1MZEA 1U5IA 4Q4X2 4QPGA 4YGDA 3WF2A 1ULDA 4B3NA 3JD72 4QM9A 2PFWA 2D3PA 3TYJA 1PM4A 4E4ZA 3K3OA 4AK3A 5GLTA 1A8MA 2OPWA 2WZR1 1PK6C 2DVGA 4WVMB 3WP5A 4H7MA 3B9CA 3M8LA 2GMEA 2MHFA 4WVMA 1XNCA 3DECA 1VBA2 4YGEA 5A3UA 2RMU1 5GJ6A 2WNVC 2Z2SB 1IGOA 2CY6A 1S0FA 3I3DA 1W9FA 4QQPA 4R9DA 5F7UA 4X6QB 4LA2A 1Q3EA 1AZDA 4NHLA 1KDMA 1GQGA 1MACA 4H14A 1BYHA 4JGZA 4LO7A 4P00B 5FMDA 5C4WC 3ZXFA 2CDPA 4ZXKA 3QH6A 4DRVA 1EPZA 2P17A 3HT2A 1UYYA 3DXUA 3RI9A 1ONAA 2GU9A 4RN5A 3H8RA 2HWB1 4Y22B 3QACA 5FUIA 3T2TA 5JSOA 1W2UA 3POIA 4XFBA 1ZBE3 3OY8B 1OLQA 4K3UA 5C8CB 4S2DA 5F5AA 4A7KA 2FDHA 1G6NA 4MGQA 4CUGA 5FMBA 4AYUA 5C8CA 3S6PA 1X9TA 1LODA 3GHMA 3KMHA 5D8AC 3PUQA 2VQAA 1ENXA 2PXJA 3N36A 4HETA 3WVJA 5IYYA 2FZ2A 2JB4A 1SLCA 2DV9A 3PUIA 4HBNA 1ULEA 3ZFFA 3KD4A 3KM5A 1ZBA2 4LO4B 1GZWA 1OKQA 4Q0PA 4QPGB 2AEYA 3VDAA 1HRI1 5A7QA 4EN6B 2P5BA 4CEYC 1EP0A 3LIGA 4OI4A 3FUQA 1S0CA 1AXKA 1K3IA 2AYHA 2R042 3OD0A 5FV3A 4XJWA 3GGLA 3T1MA 4JGYB 2YDEA 1KRIA 1T2XA 1JYTA 4FPGA 1DGRN 1SDDB 2J1UA 1UU6A 1NE6A 3H3UA 3HNMA 5JAXA 5LEKA 4MO3M 5T5PA 5FZOB 4NAOA 4CCLA 5JVVA 2R043 4AVVA 4D69A 3OGRA 1VRH3 2QBXA 4AQTA 3VL9A 3ZYJB 1H1MA 1QGLA 1W28A 2ARCA 5A33B 1FOD3 1WD4A 4D94A 1BCXA 4LBKA 1E5IA 2XL9A 4HOOA 4KI5M 2R49A 4LBQB 4XETA 2H0BA 5CNAA 2YFUA 1NXD1 4KWKA 3QBQA 1DU3D 2RJKA 1ZBE2 5DQ0A 4ATEA 4EV0A 1CZVA 4HMZA 3KF5A 3VDBA 1QJY1 2RMU3 2VZRA 3J8F3 3NJXA 4HKWA 3U14A 2VBBA 4FPEA 2GC0A 4URAA 3WF1A 3GZAA 1U12A 1DQ1A 4XOGA 2KR2A 1OQEA 4EROA 2HWF1 2R062 4OHXA 3WNLA 5KHKA 4K20A 5BNOC 3VLBB 1RUE2 4B4QA 4HVQA 5FYVA 2J1EA 4WVWA 2BGOA 5FZ1A 3O1SA 2Y34A 1OQ1A 3WXPA 3WINE 4R9CA 1MS1A 4QM8A 3KV6A 4N9HA 4CDQB 2E31A 2R0FA 3NL1A 4CEYA 5JZGA 3POFA 4TSVA 4CDQA 4UFHA 1TG7A 1O91A 5L7OC 3DN7A 4ARXA 4B4PA 2D6MA 2G1MA 2X5IC 2RVAA 5C9AA 5J09A 4L8QA 4KL1A 2Q1ZB 2XDVA 5F3CA 2HWE3 3BPZA 3VHNA 1LHUA 4JC1A 3MW4A 2C5DA 5AVPA 2YC4A 2JDZA 2LM3A 3J9SA 3MDPA 4OUEA 4A6OA 1N1VA 1VMHA 3E5QA 3LA3A 2F4PA 2JECA 2WNUB 2X5IA 1TME1 4P14A 1CZTA 2Y6FA 4AQSA 3CL1A 4MG2A 1WLDA 2OXBA 2VOVA 4XURA 1GLHA 1QJFA 5IK8A 2ILMA 4AI3A 1SMVA 3HN3A 1SLBA 3VBOC 1WLCA 2IWGB 2QZ2A 1LGBA 4BXFA 4EN9B 5C33A 4M4RA 4RHV1 4P9IA 4UT5A 3USSA 3WNNA 1AR61 4KGGA 1O3RA 4QGLA 3OUJA 2HWE2 3VKOA 1SQ4A 5G04L 3SKJE 5A6YA 5FJHA 3MV01 4D6SA 5BNPA 5KC6A 4J6GA 2D40A 4HXCA 2E32A 3ACHA 4P9GA 3MZHA 1HRI3 1LU1A 2ATFA 2ZXQA 1VALA 3WDUA 2C24A 4AFDA 2ZHLA 3K51A 3AJYA 1PO11 1GBGA 4NHXA 1R083 4DXRA 4IV3C 4URTA 3J7LA 1IKQA 4AI1A 4Q4Y2 2W2IA 2A7AA 1AX2A 3KS7A 4LO6B 1EV12 4OYUA 5DG1A 2JDKA 1O5UA 2KXLA 3O1OA 4JTOA 4JDMA 1AL0G 1VBA3 3BYWA 1RVF1 4Y20B 5FQ0B 3T4VA 2I2SA 2JKBA 1WW7A 4IEOA 2RM22 3T0BA 4YZ1A 2HEYF 1P8JA 3ZVXA 4SLIA 1SLTA 3OF1A 3R4SA 5AC93 3ACIA 3CU7A 4QMAA 3IDEA 4AVCA 1DZTA 1ZYBA 2K46A 3FHQA 2RE9A 5K4LA 1JZ8A 4TTGA 3WP3A 1L3JA 2ZHKA 3POYA 4UW5A 1OPOA 4E8CA 4XFHA 1PVC2 4COUA 5JLVA 2QDNA 4XE9A 1OOPA 1ND2C 3MYXA 3T2OA 3S0MA 3VBFB 1EAH2 1HKDA 1VRH2 2VL4A 3DPRB 1WMFA 2LW8A 4L11A 4WM7A 2XJVA 3B93A 5J98B 1POV1 1QNWA 3AJZA 4RL7A 2BPA2 3MF6A 4IERA 5FZEA 4FVVA 4P9XA 1DGRA 2WWJA 3I2FA 1MPXA 2WZR3 3UYJA 3PJQA 5FK7A 3CO2A 3KF3A 3EHKA 5H9RA 4A4AA 4AQ6A 1RUNA 1UXZA 2DWRA 4K40A 4GH4C 2Q4SA 1URXA 1GFF2 1XYPA 3LIHA 4MHUA 1OF4A 5LASA 4OLLA 4CSWA 1A3KA 3ES1A 4UBHA 5LY1A 5DUUA 1AR71 5IVBA 2YGLA 4FQ4A 4RR3B 5C5TA 3R4UA 3BI3A 5LZ6A 1OT5A 3OYWA 5L7OA 1UAIA 4HZFA 3FL7A 1GQPA 1MS0A 2HEVF 5JMOA 4H55A 1K5MB 1LKNA 2Q0AA 5IAXA 2Y60A 4YZ4A 3ZIWA 2JENA 3D8CA 5FY7A 1QQP2 4P9YA 5T50A 1OD3A 5FAXA 3VBSC 4XW3A 3ZPYA 2EIEA 1XNKA 4AHYA 2XJQA 5SV8A 2GDFA 2TBVA 4Y22A 3AL5A 3GYDA 3M3CA 1F4AA 4F7ZA 3HN1A 1NCQC 3MLKA 1UOJA 2VMGA 1YO8A 2PQSA 4X6RB 2YB7A 2IZWA 4LQRA 3S5AA 1J3QA 3KV9A 2QQUA 3LSEA 4XF0A 2P6HA 2GC3A 3AB0A 1K42A 4GIQA 1QDCA 4QX1A 1W8TA 4QGMA 5GLVA 5ABJC 1X8MA 3DV8A 4QDQA 3URFA 3WDTA 4RYDA 4DRRA 1W2AX 4SBVA 2YGMA 1W9TA 2RS51 1TMF1 3NJVA 1W39A 2YU1A 2XVGA 3MPBA 3MIBA 3RJ2X 2VMFA 4XDPA 5FKCA 1YFWA 1XSRA 4YARA 2ZAAA 2WO1A 2UURA 2QUOA 2D7FA 4XYXA 4DUVA 1DYPA 1SPPA 3LFIA 4LUMA 3BIEA 2P4EA 3BTZA 3O0WA 1SPPB 1BK1A 1UZZA 5FY4A 2WN2A 1CX4A 1US3A 2FQPA 3HEIA 3W5NA 4YRDA 3BGAA 2VZ3A 2XONA 4R4XA 4TZDA 5F5QA 3RYPA 4CCEA 4A7ZA 5FP3A 1KS4A 3AM2A 3W58A 5FYMA 3WF0A 4OHYA 3WEZA 5T52A 3ZXDA 1XU1A 3VD5A 1EV13 1QJX1 5E16A 3A21A 2QQMA 1OC1A 3M3EA 3LDKA 2XBO3 3IMMA 1OPMA 4HK8A 3RFRA 2ZGPA 1ZRDA 2CGPA 1OD5A 2ZEWA 4W4ZA 3LCPA 5D8AA 1A8DA 1PIV1 4BQ1A 2CYFA 1GANA 1BZWA 2PHRA 2WO3A 4JGZB 4QX5A 1K5MC 2XKPA 1MVQA 1QEXA 1XC6A 4YGBA 3G7DA 1JOJA 4ASKA 2BYVE 3WNMA 3OY8A 1YYNA 3N9MA 2QQNA 1RUH2 3AP9A 4Q4V3 4IESA 4NN0A 4ZU4A 3AC0A 1S2EA 2G9GA 5LRSA 2QJVA 1V6KA 3UKVA 1D2QA 4GH4A 4LITA 3UGHA 4W65A 3AKRA 2IXCA 4MXWA 3VDDC 1G9CA 1T6BX 4N90A 4YWAA 4OI0A 4EJRA 1POV3 2C9KA 3AMPA 4YGCA 5F8PA 4BMBA 2QKDA 1UQXA 4CRQA 1H8VA 4AF9A 3JXSA 4YM3A 1KQRA 3ZXLA 1GZCA 1TZOA 2VW1A 4DQAA 1G8WA 2WS92 2VNGA 1AXYA 2ZS6B 3TWIA 4BQ2A 1CAUA 3NAPA 2QQJA 3TEZA 4IGPA 2PQQA 1ULOA 1B35A 2WC2A 3JBG1 3ZO0B 1BVVA 2ZGNA 3BPSA 3D6EA 4UFJA 4JDOA 1AX1A 1VAVA 1WCQA 1LAJA 1NA1C 5FK8A 4XDQA 3WDVA 4LULA 4CDUA 5JSRA 2D5HA 2RS33 5JI7A 1HXS3 4MX3A 5FYZA 2WNUA 1SLAA 2W91A 3H3ZA 1BVP1 1AX0A 2GNDA 2XHNA 5FBJA 2VMDA 4GD4A 4UOJA 3RI8A 1AL21 3WCRA 3WF3A 1NE4A 2C6SA 5FZDA 3IDCB 1JZ6A 3OGGA 1D0GA 1NA1B 4QQHA 2TUNA 2LUWA 4EWDA 5GZGA 4M00A 4XQ4A 4EQVA 4I2OA 5FP8A 4YW5A 1DQ2A 5JOXA 1V0AA 2OA2A 5F2SA 4AGRA 1HQWA 1WMXA 2VTXA 1ZX5A 2K0GA 3CJIA 4Y26A 4R4ZA 1GZTA 2BGPA 5LBBA 5J36A 2XVKA 2HYKA 4GB33 4LUKA 4BK4A 3OEAA 4BHPA 3PU3A 1D2SA 1RUI2 2OW4A 4UXAA 2DBIA 5FP4A 1AYN2 3B94A 4AEKA 4MXWB 2C1FA 3G6JB 1GKBA 1R082 5L9RA 5FZCA 4Y20A 1W6PA 2BDRA 1DYOA 3O5SA 1W6MB 3JD71 4IEVA 3MPPG 1LB2A 1W6PB 3M3QA 1W2TA 3I3EA 3IZOA 3J7HA 3VD7A 1F8VA 4AEDB 2XJRA 3W5MA 3KSCA 5BV6A 1SLIA 3I2GA 5ISLA 2VCMA 4LBNA 1MVEA 2H0VA 4AEDA 2JDUA 2AREA 2UYBA 1O7FA 5LK7B 2W3JA 3NV2A 4GJYA 4YFWA 4UFIA 4CPBA 3A0NA 4META 5EV7A 2XJPA 5DABA 2O14A 2QCSB 4JVAA 4NIHA 3Q8AA 3VD3A 4FO9A 1IS6A 1NCRA 1A78A 2DFBA 3NSTA 5C3RA 3UKTA 1Y4WA 3WCSA 3T0DA 1NKGA 1L7RA 1UZVA 4AI9A 3KQ4B 1YHFA 4QX0A 3LOIA 4O9GA 1YRZA 4G4FA 3S7IA 1OH4A 5LRRA 4XBQA 3WQ7A 1H8TC 1NY72 1E5HA 3JUUA 4P9LA 2VZUA 1NQDA 3LGRA 4OCTA 2WYFA 2ZKLA 4ASLA 2OZ6A 4FOWA 1GZ9A 5A3WA 3ZYGA 5L36A 3R0RA 1H2KA 1JN2P 2ERFA 2GP3A 1KD7A 1R1ZA 2JKXA 4LBMA 3PVOA 1W90A 3GBGA 4P08A 3I7DA 4XHXA 5I0UA 3WG1A 3ZDSA 3T08A 2ZEZA 5FYCA 3KQRA 3SEPA 1F35A 1SFYA 4PQQA 4AHXA 1QJU3 5FJKA 1WKYA 5JOYA 1NQJA 2G9ZA 2ARBA 2QVSB 5LY2A 1O4TA 4LNVA 5A6ZA 2VR4A 3PURA 4D7SA 3U0ZA 1XU2A 5L73A 1CESA 2WFPA 3JB4C 3CJIC 1JW6A 3MLJA 2QFEA 1LGNA 1NT0A 2VAUA 4M0HA 2P37A 4BISA 3ILFA 3H50A 2W1QA 1MEC1 1UPIA 2R041 3JQXA 3EJKA 3KVAA 4MSVA 3HVDA 4Q4W1 4XTMA 5IVYA 1SG3A 3WT3A 2V5DA 3MUY1 2EICA 2D3RA 4EN7B 3ACLA 3S5QA 2WNEA 2FDIA 4CDWB 2A70A 5LW9A 2R30A 4MYEA 3QLQA 3PUSA 4DY3A 5BY5A 3NNFA 2HWD3 1SFPA 2QQPA 1R093 4COZA 1AR82 4LORA 2B39A 2H6CA 1OOPB 5FPVA 3UL2A 1HB2A 1H1AA 5A7NA 4DO0A 3MW2A 3H1WA 3POGA 2ZMLA 4PBOA 4Q1PA 3AP5A 2PAMA 5FXXA 2QQOA 3AKPA 4W6WA 1XNTA 3FE5A 3WUCA 1R091 2ZGLA 4LOSA 1JYVA 1W9WA 2HWD1 2VE1A 2WFF2 4Q26A 5F6KA 4M3CF 2ZGRA 1HLCA 1PM7A 3POJA 2B8MA 2IXIA 5FZ7A 1LOGA 1VBE3 4GZ9A 1ZBA3 1VMFA 3GBFA 2Q1MA 5DAWA 1AVBA 1RINA 3C7HA 2DCJA 4Z82A 3SNMA 3VDDA 1LOFA 4CEWC 3ELNA 4IEUA 1DFQA 1S4CA 4QB2A 3N7MA 4QPYA 3WQBA 2R1BA 3SCGA 4O61A 3LDBA 4CDXA 1CIYA 3KCCA 3KLSA 4WVZA 4RR3A 4QAWA 4XJ9A 3N9PA 1COV3 4KWLA 3J7NA 4EN0A 4KGQA 1KDKA 4YG6A 4QB1A 3GJAA 1WZXA 3MEPA 2B46X 3ZMNA 4XAAA 3ZM8A 3LAGA 3OSDA 2JD9A 5EHDA 3WUDA 5A33A 1TEIA 2D6LX 4GKYA 3GF6A 4NWVA 1HV0A 1TME2 2P2KA 5TSWA 1IG3A 1UKGA 2R072 1VBD2 4DXTA 1CPNA 5C3OA 1WW4A 3I2HA 2G9FA 2WSVA 5HBAA 2WA4A 2PHLA 1DGWA 2WUHA 3INAA 5FZIA 4BQ3A 3VUOA 1JZ5A 3PVBB 1GP5A 4P5HA 1WW5A 4UFKA 5A3TA 1RUJ3 4WM8C 1AR62 2NP0A 4HN1A 4K1YA 1DDLA 2WR9A 3GCWA 3MI8A 1BMV2 4DY5A 2ET7A 5EJZB 4HN0A 3ST7A 3V0AB 3VBRA 5C4WA 2A6VA 1F15A 4K1ZA 1RMU3 4CCMA 3SITA 1QQP3 1S0JA 2AH2A 4YW3A 2L9LA 1GZWB 4A6SA 3AXEA 2WWUA 1D4M2 2Q8EA 5B2GB 1SDWA 1RB8G 2VU9A 1X9PA 3OGVA 4AW7A 2WL1A 1LNSA 5A32B 5K8SA 4XF1A 3WP6A 1PX3A 2X8KA 5KHJA 1UYPA 3P3NA 4TWTA 1VB4A 1JU3A 5K7PA 1Q56A 2JE9A 1HB4A 1PMIA 3AMMA 2DUQA 2YYOA 5FZOA 5EQUA 3WDXA 5I8TA 2QZ3A 1V6JA 3VBOA 2VO5A 2VZ1A 4LBLA 5CZKA 2PHFA 3OPWA 2YBPA 2B9UA 1UCXA 2ZGMA 3VBOB 1SBEA 3IAQA 1V6MA 2OT7A 3LWCA 4LOTA 4GA9A 5I8SA 2BQPA 4N43C 4YZ5A 2ZX2A 3C7GA 5FYSA 3U4XA 2K9ZA 2Z4FA 1R1A1 3NVCA 2EVXA 2NM1A 1RUE3 3RQ0A 5I8YA 2BJSA 2KM2A 1YJKA 3K3NA 4XUTA 1IZ3A 1GMMA 2W46A 3JZVA 3NV3A 1AL23 2EXHA 3MO4A 3O0VA 2D44A 3FLRA 2Y6LA 1DQ4A 4Q8LA 3AZYA 1HXS1 2DUPA 1CZSA 2VZTA 4NRQA 1DGLA 2CL2A 2WN3A 4JQTA 5GZDA 1R64A 3FN9A 5DAXA 2VC9A 5L19A 1DCSA 2FMDA 3OG2A 4XUOA 4FPJA 1QXPA 2LALA 1Z78A 3U10A 4E4HA 3TBDA 2DTWA 1I6XA 5FZ0A 2V09A 3JCIA 1JZ4A 1Q8SA 1PGW2 3I3MA 2RDRA 4NO4A 3W59A 4C1WA 1W6MA 4CCKA 1FMD1 4QWNA 3KWVA 1CJDA 3R4DB 3PNAA 1X82A 3J26N 1W2NA 2VZOA 4NE9A 4QKFA 4XBLA 4J25A 5H9SA 4CVUA 1ZA7A 3LOBA 1I3HA 4IE7A 1RUF2 1Q43A 2VNOA 2DVAA 2PHWA 2G19A 3FC0A 3I4IA 3ZXKA 4Q8KA 5AC91 4OHWA 5T5JA 1CX1A 3SEEA 1C8M3 5EYYA 4CYDA 1V9U3 1WW6A 5D1IA 4CE8A 3ZOIA 5FR3A 2RR11 2AR6A 2VUAA 3UJOA 4IXLA 2ARAA 4QPIA 4CEWB 1HRV1 2ZTNA 4RA0A 4U36A 4YM1A 2Q5TA 3GHNA 5JZGC 5M0TA 1ULFA 4W6YA 2UY9A 3RZJA 5J96B 2BVVA 4JGYA 5DMYA 3U4SA 4Z07A 2HWC2 1PIV3 4XIOA 4CDUB 1PO13 4BQWA 1US2A 5FFOC 1NA1A 3T30A 2EA7A 4BCUA 2VW0A 3VBHA 1RUG2 4QB6A 1UY0A 4BM8A 3GDBA 3MLLA 4QGNA 1QY4A 3THCA 3MIGA 5DUXA 2OYZA 3GBWA 3KHBA 2B5HA 4J1WA 3UKNA 4JGZC 3SH4A 2H6BA 4K8FA 3T2PA 3ABZA 4ZKTB 2A75A 2EALA 2CGOA 2I74A 4GQ7A 4IV3A 2W9XA 4NWWA 5HV4A 2VBPA 3CHXA 5I91A 3RZLA 1VMJA 3ZFFC 2VZSA 2NZ9A 3SQOA 5GZFA 3C7OA 2J1SA 4I01A 4I3PA 2IFWA 3O7OA 4IEQA 5L7OB 1LOEA 4OULA 2CAVA 3BODA 4LKFA 4Q4X1 2NPIA 4V2VA 3O12A 4B1MA 2XLFA 4EZ4A 3VN4A 3PLQA 1G9AA 4DEQA 1RMU1 3LPFA 1GOFA 3ME2A 1Y3TA 3MIFA 3OJBA 4IE0A 2XVLA 4KWUA 1UZYA 4BLIA 1L7QA 3E5XA 5FOBB 1T6GC 3PJYA 3RG0A 3NAPB 3RZHA 2VGDA 2J42A 4CDWA 2BRTA 5BNNB 2CV6A 4Z1VA 1EUUA 1F9KA 5JDBA 2R7EB 1VLNA 3THTA 2LRPA 3K2OA 1W6OB 3E1F1 5FXVA 5K0UC 4FPOB 2VNVA 5DPNA 4DNYA 4RS5C 1DZRA 2XJTA 2Z5WA 1YI9A 4AHZA 4F3JA 1JYXA 1RXGA 1J3PA 1YUDA 2JEMA 1RL3A 1PIV2 2WNVA 3CNAA 4HT1T 1WLWA 3VBRC 1CQ9A 4N8MA 4DXSA 1PO23 2JDYA 2X10A 2Q30A 2WNVB 4LLFA 5ERLA 1Z0HA 5HXVA 1F5FA 1PZ8A 1IPJA 2DFCA 3WP4A 4RSUA 2HEWF 3WSOA 4XF4A 1PK6A 3K77A 2FCTA 3BVCA 3I2OA 4O9EA 2HKXA 3DKWA 2DVBA 5IVJA 2YBKA 1BJQA 2NYYA 1YWKA 1ZZ9A 4PBPA 2D43A 1YQ6A 2O8QA 1LHOA 1LOAA 4MZUA 3I2IA 3GZUC 3WNKA 3IBMA 3AKTA 3OD4A 2VUDA 4PF5A 4V2WA 4CUCA 1JHNA 2EIBA 3DGTA 3ENRA 2BVBA 5FZKA 1UU4A 1NCRC 1CAXA 1ZRCA 1BHGA 2EF6A 2OVUA 2YXSA 5BXXA 4NJ4A 3SLIA 4DUWA 4Z2WA 4QU2A 3SCFA 5IJRA 1ZBA1 4YW6A 1VBE1 5AFEA 1GOGA 2XL7A 1OSGA 2C0ZA 1O4YA 5GZEA 4CXWA 1W8UA 3WG2A 5JMCA 3K4ZA 4E27A 3ZYBA 5BNOA 4JCKA 1BBT2 1UIKA 3TN91 1ODNA 5FO8B 3AZXA 3W21A 3PU8A 5FBZA 3O14A 3ZFGC 2V73A 2ZEXA 1W8HA 4CXXA 1N3OA 3M7AA 2FDJA 4FT8A 4TXWA 1AL22 4ZS2A 3B69A 4PQ9A 1GWMA 5FY5A 1X8EA 1PGSA 2J7MA 3DXTA 1OI6A 3H1MA 1VAKA 4XTPA 3I2JA 2R073 4FPYA 1NX9A 1HDKA 3CQOA 4IUGA 1ODMA 5FUPA 4QD2A 3GXUA 2VZVA 4NOTA 3E5UA 4UF0B 1UD1A 2SBAA 5C5UA 3POEA 5JXHA 3EQEA 5LBEA 4ZU7A 3EB7A 4LHNA 3GJBA 5EZWA 1ZBE1 4QDSA 3DKQA 1ZZ8A 4A45A 1Z7S3 1RHI2 1O8PA 3ZXJA 4IE6A 4NRMA 2E26A 1QJY2 4QX3A 5FMOL 1AYN1 4D3WA 1VJ2A 4KMQA 3VZLA 5LWBA 1S2KA 2BWAA 2F6BA 5IAVA 2UWCA 1PGL1 4NPMA 5BNPB 3I59B 5ANNA 5A6XA 2A3YA 3FMGA 3ZDVA 2HWF2 3BOPA 1J3RA 1GNYA 1RUE1 4YSFA 2XOMA 5KHGA 5FZ8A 4AFBA 1JH5A 3A23A 1OUSA 3FLTA 2WO2A 3VKLA 4AI0A 4FP3A 2JG8B 2GMPA 2YMZA 5CG9A 1NZCA 2ZACA 3OCPA 1G7YA 3I2KA 1JMUB 4PCRA 4BMEA 4LK6A 4F83A 5FREA 2V72A 5KHIA 3LZZA 4OFGA 4BJ0A 3I54A 1LENA 1PZ7A 4LPLA 1GWLA 2MEV2 4E4SA 2WYSA 4PIYA 4YYOA 3THPA 3K48A 2D6PA 5FZ6A 1NUKA 4E2GA 3PDQA 1DGWX 2NN8A 1W8WA 4ISRA 5F3IA 2XHKA 3ROUA 3H7YA 1IPSA 1V6IA 3PL0A 4XCBA 5D21A 1CAWB 1RUI3 3KT1A 5EJ1B 4NIAA 4JZRA 3ITQA 4AFMA 4RHV2 3VZNA 5J7MA 1JYNA 1OLMA 5T55A 2D5FA 2GH8A 5L9VA 2JIGA 3GALA 4I0WB 2HWE1 4AAXA 1CGPA 2A6YA 2VY0A 4LE4A 2AGSA 5A3PA 2WLPA 1AR93 3D4KA 3WX5A 3D5OA 5DAVA 1RUJ1 3SH3A 3VKFC 4XHBA 5JOWA 2ZGTA 5T3NA 4Y5SA 2YFZA 2CAUA 5C8WA 1HN1A 5I0RA 1UX6A 3C3VA 2JE8A 2HWC3 5A1AA 4QQOA 4MGSA 4FPLA 4HKLA 4Q4Y1 1ND2B 1MQTB 1SHWB 2FCUA 4BE3A 1WUVA 1IS3A 1Y9QA 1GICA 1MEC2 1XNBA 3WHUA 5A1LA 1ND2A 2ZKNA 4GB31 1ZREA 4RGAA 4CXYA 5FUNA 2KD7A 1MZ5A 1ENSA 3WDWA 5KXEA 5FYUA 3ZN6A 4JKKA 1SBFA 5CKQA 3ZYRA 4LBQD 2CNAA 3H8OA 2BZDA 1COV1 4CP0A 4Z8BA 4IQPA 3CZJA 4QX8A 5A1FA 3VHOA 2VTXJ 2TNFA 1AR81 3B02A 3EBRA 1AHSA 4L97A 4BPZA 4LHLA 1G86A 4EWAA 4RS5B 4XAEA 5I0DA 5GLWA 2WRAA 2OKXA 3ILRA 3ZSMA 2MEV3 2XGXA 4Y5TA 1B35C 4DOUA 4KBBA 5IFTA 2WZ8A 3AZWA 3N9OA 4P02B 4BQ5A 5KR7A 4H3WA 4A41A 2OIIA 3CLPA 4Y1YA 3K46A 1JU4A 1AUYA 1VRH1 2V4AA 3FFQA 3J8F2 4IV3B 5F2WA 4COVA 1NLRA 1VB2A 3OBTA 1R092 1BEV3 2EXIA 4XFCA 2CDOA 2VCBA 4G9SB 4ES8A 4ZS3A 4NHYA 4TLGA 2WABA 2Y38A 1ZRRA 1JZ2A 2GNTA 3TAYA 3Q8BA 1FPN1 2VQ0A 1GWKA 3ZFGB 3POWA 5DDJ1 1ZA4A 2VW2A 2W95A 1UOBA 3SMHA 2WT2A 3Q8FA 1NLQA 5F5IA 3OOXA 4RGKA 3O1UA 4QX7A 2YV8A 2JDHA 2J1AA 5FCCA 3WD5A 3CZUA 2RV9A 1PHMA 1W8OA 1LJ7A 4FCAA 1H9PA 1CPMA 3IN9A 3WW3A 1PMJX 3L2HA 1AR72 5A3MA 3VBUC 4EN8B 2YBSA 1I9RA 1U0AA 2VXRA 5DAQA 5CVRA 1JS9A 3ZR5A 4AGGA 4GMP0 3ZKUA 4HANA 3SC7X 1JYCA 4CEYB 1DQ0A 2VXJA 4KH9A 5IVFA 1UL9A 1U5YA 5FXWA 3DCQA 4XF3A 1MS5A 2B9VA 4INDA 3AYEA 1ZZ7A 1UOFA 2X5IB 3TNQA 4YPJA 2EAAA 4KU8A 4MGZE 4CUAA 4PT6A 5C3SA 5LA1A 4WM8B 2WT1A 2YY1A 4LA3A 3RYKA 3AXDA 4FFIA 5FZAA 2YPDA 4XUPA 5FIXA 3AYAA 5BUVA 4MADA 1VBC3 2EIGA 3IPVA 2C4XA 2XJSA 2W1WA 2CU5A 2IFRA 1XOYA 4FI9A 3NW4A 5FP7A 1S0BA 5CKNA 1QJU1 1C1LA 1UXXX 4AVAA 5HCHA 5DUVA 4JRAA 3L2YA 5FZMA 3FHAA 4Y33A 3U07A 2EAKA 4K7JA 4CCJA 4D6RA 1BMV1 1RHI3 4AR2A 2PHDA 2BP6A 1CN1A 1CAXB 1ST8A 1W03A 1HQNA 1YIFA 5FDBA 1DLCA 3AFGA 2RS52 2BFUS 2W1SA 2ZCWA 3IKWA 3KZ4C 3WLUA 5SV5A 1QH6A 3MV11 3AL6A 1N1YA 2XH6A 1RJ7A 3KGZA 1D4M1 2F4LA 4FQZA 3TOJA 4BXSV 3N3HA 1QKQA 3BCWA 1ENRA 2IXKA 3OPTA 3MGUA 4CCNA 4ES9A 1W06A 2PAEA 4CDXB 5FZ4A 4PJYA 3PTYA 5LB6A 4HPKA 4UYBA 4BZ4A 4C91A 1LOBA 3VL8A 4XFFA 1APNA 1IQAA 4UAPA 3OBAA 3N9LA 3J7MA 2VG9A 1REEA 2DURA 1LULA 1SFNA 1W6NA 1GOHA 4AE2A 1BBT3 4KQ7A 1SCSA 1JHJA 2D98A 4AVTA 2Q8CA 1QOOA 5FMCA 5CFCA 3B7MA 1XPWA 1H9WA 2ZPXA 4BIFA 4GMP1 4LMFA 1UW8A 4YM2A 1R1A2 1OURA 1OA2A 5F1RA 1OXCA 1A6CA 2ETEA 4FFGA 2VNRA 4P9JA 3JD73 3DYOA 4XBNA 1CAVA 3VBFA 5FMOS 4PDWC 4D7YA 1ZZCA 1X7NA 2ZGOA 4WM7B 5F39A 1VR3A 1GR3A 4GMP3 3ACFA 1RIRA 4Q0VA 1VAMA 3HWJA 4FPHA 5L9BA 1IS5A 2XWBB 1XQNA 3J4UH 2ADDA 1O3TA 3RZMA 2ZZJA 3BIWE 4IV1C 5FZBA 2E9QA 4HSLA 5G05L 4I3GA 4ZY9A 4QXBA 4LJHA 1PNGA 2D6OX 4FXKB 5HCFA 4LK7A 1U5XA 1NAEA 1H0BA 5C6CA 1PGW1 1W3VA 2ORZA 4XXAA 5KXDA 3LDRA 1V6NA 2DUOA 1YFUA 2PTMA 3VHPA 3OYWB 4TLFA 1WMDA 4ZPIA 5EFUA 3NNMA 5C70A 5FYBA 3IWZA 3SCHA 2RS12 3K4AA 4YFZA 5LATA 2RS31 5A6QA 4YNIA 3ZPOA 5J1XA 2OQ7A 2ZGQA 3B9IA 4ZU5A 2DCYA 3ASIA 1H30A 2FDKA 1YLLA 2UYAA 4I30A 2DCZA 3FWEA 1RUH3 1V6OA 4Y1VA 5BNPC 3HT1A 2RR12 3OTFA 1XE7A 4D8MA 5JIUA 1HRV2 1XE0A 4XILA 4EE2A 2VECA 1AJOA 4YG0A 2C26A 5BNNA 1UMHA 1V6LA 3RRDA 1PX4A 3FJSA 4S2FA 5BNQA 2AUYA 5BPXA 3T09A 4QQ2A 4UI9L 4M3CB 1TVGA 1I5PA 4H7LA 4AHWA 1Q8VA 1RUG1 3H8UA 4CA9A 2ZBJA 2ZHNA 4N9IA 1VBC1 1U5ZA 4WV8A 1UY2A 1C8M2 2JG9A 1N1SA 2WT0A 2W5FA 4G3YC 4ARYA 1M06G 4Q4V1 3MBWA 5FPZA 1IOAA 2I45A 3U78A 3PMSA 4IEXA 5DZFA 3IIIA 3OB8A 1W9SA 2JX9A 2J1RA 3C8XA 4XMIA 3N7KA 1XRUA 1MQTA 3OUIA 4M01A 4WBBA 4YM0A 2FD8A 2LROA 5KXCA 1R081 1OLRA 2BWCA 2DVFA 4AEDC 2OX0A 1O3QA 4JQRA 4ZZ5A 4E2QA 1KITA 2XBO1 4Y3OA 5FYTA 1RMU2 3AK0A 1B09A 2PHUA 4PI2A 4ITCA 3ZYFA 1QJX3 4BWOA 1QDOA 3CF6E 1DYKA 4X8PA 2VTFA 1ZVFA 5JPNB 5CBLA 3O1VA 2ET1A 3ZN6B 5FLJA 4IEZA 3NRUA 1NOVA 3MFCA 4NIDA 2DF7A 1DLLA 1LRHA 2Y6JA 1UOGA 5T5OA 2OQ6A 2P3JA 4ZHNA 4CP9A 1IPKA 1OQDA 4BOWA 4C0BA 3U75A 3O1TA 1YQCA 1H4HA 3LA7A 5A7OA 2G4IA 4PLNA 4W6XA 1FYUA 1UY1A 4IDZA 1S2BA 4CDWC 3TB0A 3UNPA 1AJKA 1DQ6A 1YCIA 3LQCA 5EPAA 1NY71 2W92A 4LR4A 3U1XA 4CDXC 1S0DA 4XQDA 4Y1XA 5J3UA 1ULGA 1LESA 1YEWA 2FDGA 4BDVB 1WCKA 3VBRB 4UF0A 2RJLA 1XJAA 1TMF3 1GV9A 5FY1A 3ZN4A 4AQ2A 4FPCA 1ASJ1 1BEV2 1FV3A 3MUZ1 2GH2A 2GSYA 3KV5A 5C3QA 4ZXEA 1PZ9A 3VHRA 3T4HB 3KGLA 1HB1A 3BOWA 1S0IA 5C4WB 1DQ5A 1LECA 2HWF3 3AKSA 1V00A 5A70A 3NAPC 1QXJA 4AFCA 3AX4A 3PIGA 2HBUA 1DP0A 1QIQA 2BOJA 5DZGA 2DDUA 2DVDA 4MXVA 2BW8A 3WZ1A 1QOTA 3HR9A 1XSQA 4Y1ZA 1IG0A 1RITA 4KG0A 4Q4W2 5C9AB 1X33A 1W6QB 4HL0A 2VOTA 4QDRA 5FXZA 4YW1A 4RQPB 2ZGSA 2JDAA 2YZ4A 4QKNA 3U11A 2D3SA 2R32A 2VD7A 1FOD1 1VBB2 4JGYC 1QWRA 1UY4A 5IK7A 5CFDA 2V5YA 1RUC3 4O65A 1EYBA 4QXHA 5FKBA 3RMYA 1WWYA 1N47A 3WDYA 4HVRA 3TEXA 3F95A 3W20A 4YLZA 4FXGB 1UMZA 3LEGA 5I93A 2PHTA 3OBZA 5CB7A 4HFSA 2VM9A 3GZTB 4FTBA 1O5LA 1QJEA 1OVPA 3NMBA 3ETQA 5FYYA 2GAUA 2ZJCA 3IDAA 3LFMA 4NAMA 1OOPC 2R1DA 1W3XA 5EP9A 2CGNA 2HWD2 2VPVA 2X09A 3M1HA 5T5LA 4CTEA 1W0OA 4WZCA 4OZXA 2X29A 1JUIA 2BFUL 2EXJA 4CU7A 5HV0A 5F9TA 2DU0A 5CIRA 1W8FA 2WWSA 3LSDA 2VULA 3VZJA 5FYHA 4FAGA 3AZZA 5KXBA 5HCAA 1Q5OA 3ZFGA 1KFUL 4F8AA 4WVVA 2W08A 2EIDA 4PIZA 3VZOA 1H2MA 4XDOA 1TNRA 4NIIA 1UMIA 3U37A 3ECQA 4MVTA 2AZ5A 4BLJA 3POBA 4S2GA 1W99A 1WCSA 2WZR2 4YVSB 1JBCA 3MFAA 5IT6A 4QXKA 5CA6A 4L0PA 1S0GA 4HK9A 2BUKA 4I0BA 4AGVA 4C90A 4YVSA 3NV4A 4V1PA 2HJIA 1DBNA 5FPLA 3O1MA 4Q4W3 2W0XA 3ZSEA 1RVF3 4IETA 3R6SA 4RQPA 1MZ6A 4BU2A 1HN0A 2MEV1 4C8DA 3BU0A 4YW2A 4M0NA 4ATFA 5KC5A 3KT4A 1F31A 1Q8OA 1UYZA 1S1AA 2WQ8A 2R071 1SLLA 1FXZA 3M70A 1PK6B 2ZHMA 4XIKA 5J48A 2R0HA 3UETA 1GQHA 3HJRA 4K9SA 4XJUA 4OQ9A 3APBA 3VGIA 3RVHA 4LBQA 1G9DA 2WBKA 1XB9A 5LBFA 1JZ7A 5I0TA 4QU1A 2ZGUA 4AVBA 2BNMA 5FWJA 5FO7B 3AP6A 5F37A 2ZZQA 4Q4Y3 2NMOA 3AZVA 3UGGA 3FLPA 1D0HA 4BK5A 2XXZA 1AR63 1RUJ2 1UO9A 3BALA 4MGYE 4E9KA 5CYYA 4I09A 4RHV3 5KHHA 3KT7A 5F5CA 1MR5A 2PELA 4N7IA 1HB3A 4XQWA 2VOKA 2FDFA 2BBVA 4PHZA 4FPFA 2WZPP 3C2UA 3HPNA 1HRI2 3NQHA 1GU3A 1Y43B 4B29A 1JTZX 5IVVA 1ZNPA 4QQLA 1AR91 4QX2A 1H2LA 1UPSA 2HYXA 2JG9C 2XMLA 1UZ0A 1RUC1 5IK5A 2IVJA 1OFNA 4PDWB 4Y24A 2Q8OA 5ABJA 4CZSA 1BKZA 2V4VA 1W6NB 4NHKA 4Q2FA 1ZM1A 4DFSA 2DCTA 3KV4A 4N43A 3NNGA 3L9JT 4JTNA 1D7PM 4CCDA 4QT6A 4Z2AA 2Y0IA 3ETPA 1EY2A 3D0SA 3ZN5A 1D4VB 3I2DA 4ET7A 1NCRB 3WG3A 3HQXA 1J59A 1OF3A 2GNMA 3B00A 2Z42A 4DPNA 4FTSA 3IB3A 5DN2A 1YQ2A 2BU9A 1A34A 1ND3B 3WQ0A 4BQYA 1LGCA 2W87A 1VBB3 3DPRC 3EMRA 2XUEA 3HMYA 1WBFA 4LT5A 4XJAA 2WKKA 1C8NA 4KWJA 5FZ9A 2ZX1A 3WF4A 3USUA 3PVEA 2ADEA 3DPRA 3A7QA 3GM8A 3H9AA 3RYRA 2Y6GA 3VKMA 1UYXA 4CP1A 4IE5A 5JUVA 4M3CE 4AFAA 5DDJ2 4K6BA 2W68A 3FFZA 3PIJA 2ZABA 2EXKA 1REFA 3WNXA 4B7KA 1NZIA 3A4UA 1BQPA 1RYYA 5EXOA 5IUQA 5FZ3A 1W9YA 2GN7A 1AF9A 1CONA 1FNZA 1XNAA 2R061 4MGKE 5DG2A 4AI2A 2JB8A 1KFXL 2BNOA 3I3BA 1SCRA 5K0UB 3D82A 3NJYA 2WS93 2JIJA 5A80A 1SZBA 2VVFA 5KBFA 2QNKA 3Q8CA 4Q4X3 2XWJB 5FLHA 2P3KA 1STMA 1Z7S1 3MIHA 5A7WA 1LR5A 4FOQA 2BV4A 3WW4A 1H4GA 4NROA 1RUF1 2JDMA 1K5MA 1TQ5A 5ACA2 4YVWC 4PDWA 3ZKYA 5ABJB 3IMNA 4AOCA 2BTVC 1E57A 3V56A 4WZFA 1ZRFA 3E6CC 4AL9A 4Q5OA 3GZEA 4Q27A 4R52A 1WA6X 4RS5A 1LU2A 4Q0SA 3AVSA 3BTYA 4AG4A 4A7YA 3N9QA 3I49A 4EWEA 1RGSA 1ULCA 3FX3A 1RXFA 2WDBA 2QQWA 2WO7A 1K5JA 2JD4A 2VMHA 4LE3A 4MLOA 2QQKA 2SLIA 1GYKA 4XFIA 2A5ZA 1C1FA 3LEKA 3POSA 4YW4A 3VBSB 5A3LA 2PA7A 1AYM1 1YNAA 2YHJA 3NKGA 4O7XA 3ZXAC 1LOFC 4FAHA 3SKVA 3JU9A 2JJ6A 4XF9A 4I0AA 1ULPA 2WZEA 2XUMA 3N7JA 1HRV3 1LEDA 3LPGA 5E6HA 3VZKA 1J58A 4QPGC 1F5JA 5IK4A 2Y26A 4RGGA 2JG9B 3TNPB 1MS3A 4ISQA 4FPKA 1RUOA 5LA0A 1POQA 2QQVA 2J1TA 4L9BA 2HBTA 2WQ4A 3GNEA 2FCVA 1OMIA 1PO12 2W1UA 5DXDA 5FPAA 5C9AC 4LKSA 4UW3A 1O4ZA 2HWB3 2GNBA 4CDQC 2VMEA 2DBNA 2WSUA 4B7EA 1C5HA 1PMHX 1W2OA 1W0PA 4JHTA 3PTRB 1XXNA 5FZGA 3UV9A 2PN5A 3ATGA 1EV11 5E8AA 1CD3G 2K2SA 3P6BA 3RPQA 3ZYHA 3S30A 2JG8A 2WLQA 2A1XA 5LBCA 1ACCA 4ONUA 1B35B 3AMHA 1V9U2 1YFXA 2QDRA 4Z92B 4ASMB 1PO21 4J1XA 2ZGKA 3IPVB 1XBFA 3CIHA 4RFRB 2OS2A 3NV1A 4U2AA 3TEWA 4LBJA 3CJXA 3ZSJA 1HX6A 4LLOA 4OI1A 1S55A 4GWNA 4CU9A 1W0NA 2E6VA 3ZYPA 2JXAA 2NQYA 4H2AA 5FP9A 4BQXA 4Q0QA 2Q8DA 2VVEA 1R1A3 3SH5A 2RS53 1IQDC 1LTEA 1MS9A 2OUJA 2RDQA 3KHCA 1W04A 2XLAA 4DMIA 3WR0A 3OUHA 5CFDC 1LHVA 3PUHA 3ZFEC 3AVRA 5FY8A 1J84A 3P1IA 2PLV1 4GWMA 1UWWA 1BK0A 2WA3A 1OA4A 5H9PA 4AEJA 3BTAA 1CWPA 1RUD3 2Z69A 1X36A 3VDCA 2WAAA 1O6UA 4MH0E 5JCTA 5F6LB 2D97A 2B42B 4IV1B 4UBGA 1FAYA 3FHIB 3HIFA 1JUHA 2CHHA 1UKRA 2A3XA 3H3LA 1VIWB 2W94A 3ORJA 3ACGA 4RR3C 4FFFA 2D93A 4D7TA 1VBE2 2FHRA 1RUD1 2LS6A 4N53B 2E7TA 1F4HA 2NLRA 3A0KA 5C71A 5JZGB 3FBYA 4RD7A 1QQP1 4K8RB 1CR7A 2BNNA 3ZMOA 4FBFA 3E97A 3CMGA 3KB5A 5FOJB 1BBT1 3TN92 1O3SA 1CIWA 3CKHA 3T0AA 5C8CC 2E7QA 1AR73 5FY0A 1VPHA 1EAH3 2I07B 1POV0 1CVNA 1J1TA 2VCCA 2A6XA 4BB3A 3HOBA 1GP4A 4CP2A 3IAPA 4B8EA 3WHTA 3IM0A 1UIJA 1DZQA 1LCLA 3T1LA 3O0XA 2ZA9A 2Y8KA 3QOPA 3MHZA 4MUVA 2JG8C 3EYPA 2VUCA 3OPZA 3NNLA 4Q29A 2RR13 2BBAA 2F17A 1E5RA 2MNGA 4UW6A 3V64A 5CFDB 1VBC2 3WNOA 1WBLA 5HPOA 1E5SA 3ZYIB 4XFGA 1BXHA 1DHKB 1QH7A 3VBFC 1FNYA 1C8M1 1NLSA 2JDNA 4BIOA 2VCAA 3HQUA 1C28A 2RM23 4TYSA 1IHMA 3SXWA 1TMF2 4KBZA 4Q4V2 3LA2A 4D0QA 2DCKA 2OZJA 1CAWA 2ID4A 1RHI1 4CCOA 2VOXA 4KU7A 3C7EA 1JYWA 1WGPA 3Q9OA 2QQIA 3LE0A 2XQXA 4LO8A 4QKBA 4XABA 5EJ3A 4QHBA 4PI0A 5HI0A 4FFHA 1PGL2 1W05A 5FY9A 4DB5A 3LEMA 3ZX7A 1O8SA 5JI9A 2XBO2 1WCDJ 2VJXA 4XUNA 2X05A 3VD9A 3HBKA 2AACA 3CBNA 4I02A 4AI8A 2E33A 4ZONA 3MICA 4AEMA 2ORXA 4UW4A 3O1PA 2OUHA 4A3ZA 1QU0A 3N35A 2CWMA 3BB6A 4IGOA 1ND3A 5FLIA 3RMXA 1VBA1 4A42A 2E7AA 3TEYA 3DYPA 2RMU2 2ZX0A 1QJX2 2ES3A 3B5LB 3PHMA 1YC61 2YG0A 5EIYB 5A7SA 1AYM3 4L2NA 3WV6A 4HVOA 5I0SA 2A3WA 5JPMB 5DZEA 1YQ5A 3VD4A 2HWB2 4DZGA 2Z79A 3AMNA 3CDZB 4JV4A 4XEZA 2GC2A 2WIIB 3WG4A 3WOGA 2IXJA 1H8TA 5F3GA 5IWFA 4FOYA 3UK9A 3LB9A 5DDJ3 4FOVA 1ASJ2 5C7GA 5FPXA 4MV2A 4YW7A 1FPN3 3R05A 3ZFEB 4ORFA 2PAKA 4FP2A 3P5BA 3N9NA 5E89A 4XPVA 4RQPC 2XLGA 4JDNA 2GC1A 2D6NA 1C57A 1FT9A 4MOAA 4CCCA 1TME3 2WNOA 5K0UA 4GULA 3RZGA 4UFLA 1YIPA 5FZHA 5H9QA 2N7GA 5AVAA 2WS91 2Y64A 2PYTA 2XKOA 3HQRA 4YVWB 3VBUA 2R063 5BYNA 2Q1FA 1AR83 3M2MA 5BNOB 1QF3A 4DUXA 2E53A 5CADA 3VKNA 3N4MA 1HW5A 4GB32 4XXPA 1OFSA 2CTVA 5JXIA 1JOBA 1KXGA 3ZLIA 2DTYA 4OQ8A 2P6CA 4L92A 4BH9A 2TEPA 2VZQA 3DL3A 1Y7BA 3AYDA 4LXLA 4IW3A 4X8NA 1EPWA 3SHRA 1TE1B 5ACA3 1OUXA 2QTWB 1COV2 5IHRA 1NXMA 1JODA 1N3PA 1W8ZA 1JZ3A 1F2NA 1VE0A 1W6OA 2VBDA 1M4WA 3NJZA 3NWKA 2P3YA 2RJ2A 1I5ZA 1IS4A 5HCBA 2YROA 3V0BB 4C1XA 1UX7A 5E1RA 4PF1A 5GKAC 3VBSA 5J37A 3V0BA 2W39A 1QJY3 3J8F1 1REDA 1XYOA 1QJZA 1N1TA 1V70A 3LD8A 1MQTC 1K12A 2O8OA 3AYCA 3V0AA 2Y6HA 1H8TB 3VB9A 1X50A 3BTXA 2Y0OA 2X53S 3M4FA 1FPN2 1NCQB 2FMYA 3RJRA 2DU1A 5FYIA 1GNHA 3ZFFB 2WFF3 4LHSA 2AEZA 4XJZA 3MIEA 3RNSA 2J1VA 3S57A 3BU7A 5JSPA 2WJSA 3FZ3A 4NHMA 3M3IA 5A32A 3AMQA 4R8HA 5HXMA 4S2HA 5E88A 2OPKA 5F3EA 1N3QA 5GLZA 4COYA 3WW2A 2LTNA 1XYNA 4LKEA 3BN6A 5B4NA 3IDBB 2HH9A 1RJ8A 4A3XA 4XZPA 1UU5A 3HAGA 4N53C 4NVPA 2XPJA 2HLEA 5FRAA 5A7WB 3UT0A 4CUBA 3FUOA 2AC1A 1GSLA 3OEBA 2BGCA 1SBDA 1H6YA 2ZMNA 5D8AB 4E8DA 1ZZ6A 3OBRA 2XR4A 1JXNA 2BOIA 2VZPA 1ALYA 2ZX3A 3I3QA 4EZHA 5CU1A 1H1IA 2E63A 2IXHA 2QE3A 5JR2A 3F2ZA 3WW1A 1WMEA 2VMCA 3T3YA 1G9FA 1MS4A 3K75B 3CJIB 3ON7A 4BYYA 4GJZA 1QNYA 1O59A 1QJU2 4LHKA 4AWDA 1HQLA 4JRLA 1DIWA 3AP4A 1Q8PA 3JQWA 4E2SA 5CISA 5K9YA 2RDSA 4Q1RA 2A6ZA 4HKOA 1AYN3 1MEC3 1IKPA 4M3CA 1H2NA 2FZ1A 4OHVA 5FPBA 5A7PA 3X29B 4BA6A 4DS0A 1I1EA 2Y33A 2UWAA 4UFMA 2MPFA 4XUQA 4XVHA 4QKDA 4YZ3A 1RUG3 3AFKA 2E51A 4N53A 4C0HA 4K21A 5GLUA 1W8NA 2YU2A 2VMIA 2VVDA 1UZWA 5JOZA 2A73B 2GP5A 5D2AA 3GCXA 5DUWA 1AR92 5JXGA 1RUC2 4QHOA 4MGIE 3H8XA 4TN7A 5DAPA 4EYUA 1CAUB 3RGBA 3UESA 1LHNA 1RVF2 1HJGA 1J83A 3D3AA 1H6XA 4NMIA 2RM21 2WINB 2P34A 3TN93 1C4RA 5FWEA 2RHPA 4KNCA 3ZSKA 5FPUA 3TRSB 1C5IA 2ZX4A 5B4XA 1WA4A 4OUMA 3LF7A 2P3IA 5LA2A 3LKJA 4XZUG 3LEIA 1PVC1 3AP7A 3B01A 3DF0A 1KJRA 1LHWA 1Q8QA 1FI2A 4HSJA 2CSGA 1EAH1 1QOSA 1PVXA 2IXLA 2ZAHA 3OGJA 1WD3A 3KCXA 2IVIB 4AXOA 1L7LA 1ZRIA 2WFF1 4GWIA 2J22A 4OUSA 3RS6A 3RZKA 2JE7A 4GXLA 3HNBM 4XFAA 5ANQA 4Y5Z0 1KGYA 1FX5A 1EUTA 1NYWA 4DXZA 2WNUC 3S7EA 2VQTA 1ENQA 2BEOA 5LK5A 3WY6A 4JHZA 1G9BA 2B7YA 2QQLA 3D0JA 3P3PA 1RTVA 4IEPA 2YC0A 5LCWL 4PLOA 3HBZA 5GM0A 1QHDA 5C3PA 4MHRA 3WQ1A 4IV1A 4UWDA 4OMCA 1JOPA 3RWKX 2BERA 3KVBA 1Z7S2 2JDPA 1HJFA 3BKZA 1GUIA 1SEFA 2RS11 1MZFA 2RS32 4CPBD 4XMAA 2XG3A 5JR7B 4QXCA 3WNPA 5ACA1 5CKMA 1KJLA 1W6QA 2JWPA 3ZR6A 1Y9MA 1YI7A 1ASJ3 2DYCA 2FBEA 3NKTA 4AAPA 3NNJA 1YJLA 3K4DA 1PNFA 3HD8B 2KA3A 4GWJA 4QPIB 3THDA 4CEWA 3ILNA 4COWA 4M4PA 4DEVA 1AXZA 4P5YA 1HV1A 4N7UA 3H1YA 3KCYA 3RSJA 1VBD1 2P1BA 4WM8A 4LIVA 1CAVB 4YVSC 2R16A 2A6WA 1DF0A 2JICA 3OGSA 3VBHB 4E4DX 4JKMA 2ZOEB 3NO8A 5JIAA 3W9AA 1D4M3 2ARXA 5CG8A 1AYM2 3H0OA 1UN1A 3JBG3 2RDNA 4HLTA 1OHFA 4GKXA 5JWPA 2GALA 1WCUA 3H42B 1JYIA 2GMMA 4YZ2A 4W50A 2R6QA 4A44A 3I8TA 3IIAA 4LIUA 5APAA 4XC9A 2WAOA 3ZXEA 1DG6A 2B45X 2PMWB 3VDDB 4IL7A 4LBOA 2W52A 3FBMA 2YPJA 1BLZA 3EXUA 1YQ8A 4YVWA 5GZCA 4KG8A 4B4RA 4DINB 1ND3C 3IT8A 3ALQA 5EWSA 5GALA 2AENA 3Q8EA 1K45A 1WLTA 2WQZC 2VUJA 3VV1A 4D6QA 5FQ0A 3MF9A 1S0EA 2VOWA 4Q0UA 5IVEA 3T2QA 3VBUB 1C3HA 1RC6A 4Y4YA 4NRPA 2ENRA 3ES4A 3UGFA 3EO6A 5IW0A 1TNFA 4W8JA 3AKQA 4CU8A 5FO9B 1V9U1 1OA3A 2A71A 3JB8A 1PO22 3RZZA 3SISA 4CDUC 4DIQA 3O1RA 5CEHA 4GAZA 4L99A 4OVEA 1VP6A 3PVNA 1NG0A 5A3OA 4XCAA 2ZEYA 4IEWA 2ZMKA 1VRBA 4IE4A 3RWNA 4FSJA 1OBNA 4OI2A 2XJUA 2XB6C 5KWRA 3MW3A 1FMD3 4YG3A 3UJQA 1OKOA 1HXS2 1OVSA 1QXRA 2CWSA 4NIGA 1UY3A 5FZLA 3VBHC 5IATA 5LEJA 4OZOA 4LO5B
chains in the Genus database with same CATH topology
2OQ6A 3PUAA 5FYUA 2Q8CA 3PUQA 4HONA 2PXJA 4IGQA 3LD8A 5ANQA 3LDBA 5ISLA 3PU8A 4QX8A 5A1FA 3N9PA 5A7OA 2W2IA 5FY4A 5E6HA 4GJYA 3RVHA 5FYIA 5A7QA 2P5BA 3N9OA 4CCOA 5KR7A 4QU1A 5FY5A 5F39A 5FP3A 3DXTA 5FWJA 5F2WA 5F37A 3U4SA 4UF0A 5FYMA 5FPAA 5FY1A 3KVBA 2XXZA 5FV3A 5FUPA 5FY9A 4UF0B 5F3EA 5F5CA 4AI9A 5FZBA 4NUBA 3PTRB 4QXCA 3KV5A 5FZGA 5K4LA 5FZIA 5IVCA 4QXBA 5FZOB 5A3TA 4CCLA 4AAPA 5IVVA 5A3NA 5A7WB 2XMLA 4IGOA 5LWBA 5F5IA 4QX7A 5A3WA 4ASKA 5FYBA 5FZFA 2GP3A 4HOOA 4CCMA 3N9MA 4LIVA 3KV4A 4EZHA 5FZEA 2WWUA 2Q8EA 2YBSA 2OQ7A 5A7SA 2WWJA 3ZPOA 5FYCA 4LITA 2OS2A 5FZ8A 3UYJA 4V2VA 5FXZA 4EZ4A 4GJZA 5FJKA 5LY2A 5IVFA 5FXWA 2VD7A 3PURA 4Y4RA 4URAA 5FP9A 4LIUA 4QXHA 4CSWA 2XUEA 5FZCA 5A7PA 2Q8DA 5FPBA 5LY1A 4BISA 5FZOA 5F3GA 5IWFA 5IVBA 3KVAA 5F32A 5FZ9A 5FZAA 5FYVA 2YPDA 5IVYA 5FZ1A 3K2OA 4IGPA 5FXVA 3OPWA 2YBPA 5FP7A 5FYYA 3AVRA 3N9NA 5LW9A 5FY8A 3KV6A 2OT7A 3K3OA 5FZ6A 3PDQA 3PUSA 2YU2A 4D6QA 5FYSA 5FZMA 5F3IA 5FY7A 2GP5A 4Y33A 5IVEA 3K3NA 4CCJA 4D6RA 5FZ3A 5FZHA 5F3CA 2XDVA 5FPVA 5IW0A 5FYZA 5FYHA 5A7NA 4DO0A 5FBJA 3AL5A 4TN7A 3U78A 4EYUA 4GD4A 4BU2A 3NJYA 5FZDA 5FXXA 5A80A 3AL6A 5A3PA 5IVJA 4XDOA 4DIQA 2YBKA 3KV9A 4GAZA 5CEHA 5FWEA 5FPUA 2OX0A 5A7WA 3ZLIA 3OPTA 4CCNA 5FP8A 5F2SA 4LXLA 5FZ4A 1VRBA 4Y3OA 5FYTA 4BXFA 4V2WA 3DXUA 4E4HA 5FZKA 5FZ7A 5FPLA 5FZ0A 3PU3A 3N9LA 5FY0A 3AVSA 5FP4A 2YU1A 3N9QA 5FJHA 5FZLA 4CCKA 4QWNA 4XDPA 4CUGA 4D6SA 5A1LA 5F5AA 5FUNA 4C8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OQ6 A;  3PUA A;  5FYU A;  2Q8C A;  3PUQ A;  4HON A;  2PXJ A;  4IGQ A;  3LD8 A;  5ANQ A;  3LDB A;  5ISL A;  3PU8 A;  4QX8 A;  5A1F A;  3N9P A;  5A7O A;  2W2I A;  5FY4 A;  5E6H A;  4GJY A;  3RVH A;  5FYI A;  5A7Q A;  2P5B A;  3N9O A;  4CCO A;  5KR7 A;  4QU1 A;  5FY5 A;  5F39 A;  5FP3 A;  3DXT A;  5FWJ A;  5F2W A;  5F37 A;  3U4S A;  4UF0 A;  5FYM A;  5FPA A;  5FY1 A;  3KVB A;  2XXZ A;  5FV3 A;  5FUP A;  5FY9 A;  4UF0 B;  5F3E A;  5F5C A;  4AI9 A;  5FZB A;  4NUB A;  3PTR B;  4QXC A;  3KV5 A;  5FZG A;  5K4L A;  5FZI A;  5IVC A;  4QXB A;  5FZO B;  5A3T A;  4CCL A;  4AAP A;  5IVV A;  5A3N A;  5A7W B;  2XML A;  4IGO A;  5LWB A;  5F5I A;  4QX7 A;  5A3W A;  4ASK A;  5FYB A;  5FZF A;  2GP3 A;  4HOO A;  4CCM A;  3N9M A;  4LIV A;  3KV4 A;  4EZH A;  5FZE A;  2WWU A;  2Q8E A;  2YBS A;  2OQ7 A;  5A7S A;  2WWJ A;  3ZPO A;  5FYC A;  4LIT A;  2OS2 A;  5FZ8 A;  3UYJ A;  4V2V A;  5FXZ A;  4EZ4 A;  4GJZ A;  5FJK A;  5LY2 A;  5IVF A;  5FXW A;  2VD7 A;  3PUR A;  4Y4R A;  4URA A;  5FP9 A;  4LIU A;  4QXH A;  4CSW A;  2XUE A;  5FZC A;  5A7P A;  2Q8D A;  5FPB A;  5LY1 A;  4BIS A;  5FZO A;  5F3G A;  5IWF A;  5IVB A;  3KVA A;  5F32 A;  5FZ9 A;  5FZA A;  5FYV A;  2YPD A;  5IVY A;  5FZ1 A;  3K2O A;  4IGP A;  5FXV A;  3OPW A;  2YBP A;  5FP7 A;  5FYY A;  3AVR A;  3N9N A;  5LW9 A;  5FY8 A;  3KV6 A;  2OT7 A;  3K3O A;  5FZ6 A;  3PDQ A;  3PUS A;  2YU2 A;  4D6Q A;  5FYS A;  5FZM A;  5F3I A;  5FY7 A;  2GP5 A;  4Y33 A;  5IVE A;  3K3N A;  4CCJ A;  4D6R A;  5FZ3 A;  5FZH A;  5F3C A;  2XDV A;  5FPV A;  5IW0 A;  5FYZ A;  5FYH A;  5A7N A;  4DO0 A;  5FBJ A;  3AL5 A;  4TN7 A;  3U78 A;  4EYU A;  4GD4 A;  4BU2 A;  3NJY A;  5FZD A;  5FXX A;  5A80 A;  3AL6 A;  5A3P A;  5IVJ A;  4XDO A;  4DIQ A;  2YBK A;  3KV9 A;  4GAZ A;  5CEH A;  5FWE A;  5FPU A;  2OX0 A;  5A7W A;  3ZLI A;  3OPT A;  4CCN A;  5FP8 A;  5F2S A;  4LXL A;  5FZ4 A;  1VRB A;  4Y3O A;  5FYT A;  4BXF A;  4V2W A;  3DXU A;  4E4H A;  5FZK A;  5FZ7 A;  5FPL A;  5FZ0 A;  3PU3 A;  3N9L A;  5FY0 A;  3AVS A;  5FP4 A;  2YU1 A;  3N9Q A;  5FJH A;  5FZL A;  4CCK A;  4QWN A;  4XDP A;  4CUG A;  4D6S A;  5A1L A;  5F5A A;  5FUN A;  4C8D A; 
#chains in the Genus database with same CATH topology
 3PUA A;  4JX0 A;  1OLM E;  1RUH 1;  4CU6 A;  2O1Q A;  1RUF 3;  2D6K A;  2VQU A;  3E6D A;  5BNN C;  1YXW A;  4LKD A;  3N7L A;  4HON A;  4IGQ A;  1NCQ A;  2IUW A;  1BEV 1;  2PLV 2;  4LTA A;  2UU8 A;  4QPI C;  4QPW A;  4Y1U A;  5LA9 A;  4A2U A;  3BUC A;  4R9B A;  1CJP A;  3ZIX A;  1KEX A;  3DUI A;  4B1L A;  1JI6 A;  5EYX A;  3C7F A;  3ZFE A;  1FMD 2;  1VBD 3;  1FAT A;  1XE8 A;  1GNZ A;  4FTE A;  2XQR A;  3QH7 A;  2W47 A;  4HPK B;  4BQ4 A;  4JKL A;  1LOC A;  2NMN A;  3QD6 A;  2B4K A;  3PME A;  3DYM A;  1RUD 2;  1MS8 A;  3RDI A;  5AC9 2;  3B3Q E;  5AFB A;  3HNY M;  1XND A;  4MGT A;  5T54 A;  4P9W A;  1OH3 A;  4QHZ A;  5JXJ A;  4XAC A;  2Y6K A;  4NPL A;  3CEW A;  4NUB A;  4AZZ A;  5IVC A;  3JBG 2;  5FTT C;  2RS1 3;  2C9A A;  1ZZB A;  4ZZ8 A;  2YC2 A;  1FV2 A;  4CP9 B;  2O0O A;  3QCW A;  5A3N A;  5CFC B;  2PHX A;  4N43 B;  4XJ8 A;  4NR1 A;  1FOD 2;  1VBB 1;  2HWC 1;  1UF2 C;  2YUE A;  3E6B A;  1UNB A;  4PIX A;  3VZM A;  5FZF A;  4RFT 0;  4LEJ A;  1KS5 A;  2RG4 A;  3DEM A;  4OHZ A;  3M3O A;  3ZSL A;  3USU B;  2GN3 A;  2UWB A;  2GZW A;  1SAC A;  1Y9G A;  3MID A;  4WM7 C;  2PLV 3;  4HG6 B;  1J1L A;  1YFY A;  4GH4 B;  2IC1 A;  1LEM A;  4IEY A;  2VH9 A;  5CAZ A;  3V65 A;  1GP6 A;  3H7J A;  4GAL A;  4R9A A;  2UY8 A;  4Y4R A;  3I97 A;  3ZXG A;  1RUI 1;  4JAA A;  5IFP A;  4OMD A;  1QMJ A;  5CFC C;  4AVS A;  3I59 A;  5F32 A;  4NPR A;  4PLM A;  1HIX A;  1PVC 3;  3A22 A;  1MZE A;  1U5I A;  4Q4X 2;  4QPG A;  4YGD A;  3WF2 A;  1ULD A;  4B3N A;  3JD7 2;  4QM9 A;  2PFW A;  2D3P A;  3TYJ A;  1PM4 A;  4E4Z A;  3K3O A;  4AK3 A;  5GLT A;  1A8M A;  2OPW A;  2WZR 1;  1PK6 C;  2DVG A;  4WVM B;  3WP5 A;  4H7M A;  3B9C A;  3M8L A;  2GME A;  2MHF A;  4WVM A;  1XNC A;  3DEC A;  1VBA 2;  4YGE A;  5A3U A;  2RMU 1;  5GJ6 A;  2WNV C;  2Z2S B;  1IGO A;  2CY6 A;  1S0F A;  3I3D A;  1W9F A;  4QQP A;  4R9D A;  5F7U A;  4X6Q B;  4LA2 A;  1Q3E A;  1AZD A;  4NHL A;  1KDM A;  1GQG A;  1MAC A;  4H14 A;  1BYH A;  4JGZ A;  4LO7 A;  4P00 B;  5FMD A;  5C4W C;  3ZXF A;  2CDP A;  4ZXK A;  3QH6 A;  4DRV A;  1EPZ A;  2P17 A;  3HT2 A;  1UYY A;  3DXU A;  3RI9 A;  1ONA A;  2GU9 A;  4RN5 A;  3H8R A;  2HWB 1;  4Y22 B;  3QAC A;  5FUI A;  3T2T A;  5JSO A;  1W2U A;  3POI A;  4XFB A;  1ZBE 3;  3OY8 B;  1OLQ A;  4K3U A;  5C8C B;  4S2D A;  5F5A A;  4A7K A;  2FDH A;  1G6N A;  4MGQ A;  4CUG A;  5FMB A;  4AYU A;  5C8C A;  3S6P A;  1X9T A;  1LOD A;  3GHM A;  3KMH A;  5D8A C;  3PUQ A;  2VQA A;  1ENX A;  2PXJ A;  3N36 A;  4HET A;  3WVJ A;  5IYY A;  2FZ2 A;  2JB4 A;  1SLC A;  2DV9 A;  3PUI A;  4HBN A;  1ULE A;  3ZFF A;  3KD4 A;  3KM5 A;  1ZBA 2;  4LO4 B;  1GZW A;  1OKQ A;  4Q0P A;  4QPG B;  2AEY A;  3VDA A;  1HRI 1;  5A7Q A;  4EN6 B;  2P5B A;  4CEY C;  1EP0 A;  3LIG A;  4OI4 A;  3FUQ A;  1S0C A;  1AXK A;  1K3I A;  2AYH A;  2R04 2;  3OD0 A;  5FV3 A;  4XJW A;  3GGL A;  3T1M A;  4JGY B;  2YDE A;  1KRI A;  1T2X A;  1JYT A;  4FPG A;  1DGR N;  1SDD B;  2J1U A;  1UU6 A;  1NE6 A;  3H3U A;  3HNM A;  5JAX A;  5LEK A;  4MO3 M;  5T5P A;  5FZO B;  4NAO A;  4CCL A;  5JVV A;  2R04 3;  4AVV A;  4D69 A;  3OGR A;  1VRH 3;  2QBX A;  4AQT A;  3VL9 A;  3ZYJ B;  1H1M A;  1QGL A;  1W28 A;  2ARC A;  5A33 B;  1FOD 3;  1WD4 A;  4D94 A;  1BCX A;  4LBK A;  1E5I A;  2XL9 A;  4HOO A;  4KI5 M;  2R49 A;  4LBQ B;  4XET A;  2H0B A;  5CNA A;  2YFU A;  1NXD 1;  4KWK A;  3QBQ A;  1DU3 D;  2RJK A;  1ZBE 2;  5DQ0 A;  4ATE A;  4EV0 A;  1CZV A;  4HMZ A;  3KF5 A;  3VDB A;  1QJY 1;  2RMU 3;  2VZR A;  3J8F 3;  3NJX A;  4HKW A;  3U14 A;  2VBB A;  4FPE A;  2GC0 A;  4URA A;  3WF1 A;  3GZA A;  1U12 A;  1DQ1 A;  4XOG A;  2KR2 A;  1OQE A;  4ERO A;  2HWF 1;  2R06 2;  4OHX A;  3WNL A;  5KHK A;  4K20 A;  5BNO C;  3VLB B;  1RUE 2;  4B4Q A;  4HVQ A;  5FYV A;  2J1E A;  4WVW A;  2BGO A;  5FZ1 A;  3O1S A;  2Y34 A;  1OQ1 A;  3WXP A;  3WIN E;  4R9C A;  1MS1 A;  4QM8 A;  3KV6 A;  4N9H A;  4CDQ B;  2E31 A;  2R0F A;  3NL1 A;  4CEY A;  5JZG A;  3POF A;  4TSV A;  4CDQ A;  4UFH A;  1TG7 A;  1O91 A;  5L7O C;  3DN7 A;  4ARX A;  4B4P A;  2D6M A;  2G1M A;  2X5I C;  2RVA A;  5C9A A;  5J09 A;  4L8Q A;  4KL1 A;  2Q1Z B;  2XDV A;  5F3C A;  2HWE 3;  3BPZ A;  3VHN A;  1LHU A;  4JC1 A;  3MW4 A;  2C5D A;  5AVP A;  2YC4 A;  2JDZ A;  2LM3 A;  3J9S A;  3MDP A;  4OUE A;  4A6O A;  1N1V A;  1VMH A;  3E5Q A;  3LA3 A;  2F4P A;  2JEC A;  2WNU B;  2X5I A;  1TME 1;  4P14 A;  1CZT A;  2Y6F A;  4AQS A;  3CL1 A;  4MG2 A;  1WLD A;  2OXB A;  2VOV A;  4XUR A;  1GLH A;  1QJF A;  5IK8 A;  2ILM A;  4AI3 A;  1SMV A;  3HN3 A;  1SLB A;  3VBO C;  1WLC A;  2IWG B;  2QZ2 A;  1LGB A;  4BXF A;  4EN9 B;  5C33 A;  4M4R A;  4RHV 1;  4P9I A;  4UT5 A;  3USS A;  3WNN A;  1AR6 1;  4KGG A;  1O3R A;  4QGL A;  3OUJ A;  2HWE 2;  3VKO A;  1SQ4 A;  5G04 L;  3SKJ E;  5A6Y A;  5FJH A;  3MV0 1;  4D6S A;  5BNP A;  5KC6 A;  4J6G A;  2D40 A;  4HXC A;  2E32 A;  3ACH A;  4P9G A;  3MZH A;  1HRI 3;  1LU1 A;  2ATF A;  2ZXQ A;  1VAL A;  3WDU A;  2C24 A;  4AFD A;  2ZHL A;  3K51 A;  3AJY A;  1PO1 1;  1GBG A;  4NHX A;  1R08 3;  4DXR A;  4IV3 C;  4URT A;  3J7L A;  1IKQ A;  4AI1 A;  4Q4Y 2;  2W2I A;  2A7A A;  1AX2 A;  3KS7 A;  4LO6 B;  1EV1 2;  4OYU A;  5DG1 A;  2JDK A;  1O5U A;  2KXL A;  3O1O A;  4JTO A;  4JDM A;  1AL0 G;  1VBA 3;  3BYW A;  1RVF 1;  4Y20 B;  5FQ0 B;  3T4V A;  2I2S A;  2JKB A;  1WW7 A;  4IEO A;  2RM2 2;  3T0B A;  4YZ1 A;  2HEY F;  1P8J A;  3ZVX A;  4SLI A;  1SLT A;  3OF1 A;  3R4S A;  5AC9 3;  3ACI A;  3CU7 A;  4QMA A;  3IDE A;  4AVC A;  1DZT A;  1ZYB A;  2K46 A;  3FHQ A;  2RE9 A;  5K4L A;  1JZ8 A;  4TTG A;  3WP3 A;  1L3J A;  2ZHK A;  3POY A;  4UW5 A;  1OPO A;  4E8C A;  4XFH A;  1PVC 2;  4COU A;  5JLV A;  2QDN A;  4XE9 A;  1OOP A;  1ND2 C;  3MYX A;  3T2O A;  3S0M A;  3VBF B;  1EAH 2;  1HKD A;  1VRH 2;  2VL4 A;  3DPR B;  1WMF A;  2LW8 A;  4L11 A;  4WM7 A;  2XJV A;  3B93 A;  5J98 B;  1POV 1;  1QNW A;  3AJZ A;  4RL7 A;  2BPA 2;  3MF6 A;  4IER A;  5FZE A;  4FVV A;  4P9X A;  1DGR A;  2WWJ A;  3I2F A;  1MPX A;  2WZR 3;  3UYJ A;  3PJQ A;  5FK7 A;  3CO2 A;  3KF3 A;  3EHK A;  5H9R A;  4A4A A;  4AQ6 A;  1RUN A;  1UXZ A;  2DWR A;  4K40 A;  4GH4 C;  2Q4S A;  1URX A;  1GFF 2;  1XYP A;  3LIH A;  4MHU A;  1OF4 A;  5LAS A;  4OLL A;  4CSW A;  1A3K A;  3ES1 A;  4UBH A;  5LY1 A;  5DUU A;  1AR7 1;  5IVB A;  2YGL A;  4FQ4 A;  4RR3 B;  5C5T A;  3R4U A;  3BI3 A;  5LZ6 A;  1OT5 A;  3OYW A;  5L7O A;  1UAI A;  4HZF A;  3FL7 A;  1GQP A;  1MS0 A;  2HEV F;  5JMO A;  4H55 A;  1K5M B;  1LKN A;  2Q0A A;  5IAX A;  2Y60 A;  4YZ4 A;  3ZIW A;  2JEN A;  3D8C A;  5FY7 A;  1QQP 2;  4P9Y A;  5T50 A;  1OD3 A;  5FAX A;  3VBS C;  4XW3 A;  3ZPY A;  2EIE A;  1XNK A;  4AHY A;  2XJQ A;  5SV8 A;  2GDF A;  2TBV A;  4Y22 A;  3AL5 A;  3GYD A;  3M3C A;  1F4A A;  4F7Z A;  3HN1 A;  1NCQ C;  3MLK A;  1UOJ A;  2VMG A;  1YO8 A;  2PQS A;  4X6R B;  2YB7 A;  2IZW A;  4LQR A;  3S5A A;  1J3Q A;  3KV9 A;  2QQU A;  3LSE A;  4XF0 A;  2P6H A;  2GC3 A;  3AB0 A;  1K42 A;  4GIQ A;  1QDC A;  4QX1 A;  1W8T A;  4QGM A;  5GLV A;  5ABJ C;  1X8M A;  3DV8 A;  4QDQ A;  3URF A;  3WDT A;  4RYD A;  4DRR A;  1W2A X;  4SBV A;  2YGM A;  1W9T A;  2RS5 1;  1TMF 1;  3NJV A;  1W39 A;  2YU1 A;  2XVG A;  3MPB A;  3MIB A;  3RJ2 X;  2VMF A;  4XDP A;  5FKC A;  1YFW A;  1XSR A;  4YAR A;  2ZAA A;  2WO1 A;  2UUR A;  2QUO A;  2D7F A;  4XYX A;  4DUV A;  1DYP A;  1SPP A;  3LFI A;  4LUM A;  3BIE A;  2P4E A;  3BTZ A;  3O0W A;  1SPP B;  1BK1 A;  1UZZ A;  5FY4 A;  2WN2 A;  1CX4 A;  1US3 A;  2FQP A;  3HEI A;  3W5N A;  4YRD A;  3BGA A;  2VZ3 A;  2XON A;  4R4X A;  4TZD A;  5F5Q A;  3RYP A;  4CCE A;  4A7Z A;  5FP3 A;  1KS4 A;  3AM2 A;  3W58 A;  5FYM A;  3WF0 A;  4OHY A;  3WEZ A;  5T52 A;  3ZXD A;  1XU1 A;  3VD5 A;  1EV1 3;  1QJX 1;  5E16 A;  3A21 A;  2QQM A;  1OC1 A;  3M3E A;  3LDK A;  2XBO 3;  3IMM A;  1OPM A;  4HK8 A;  3RFR A;  2ZGP A;  1ZRD A;  2CGP A;  1OD5 A;  2ZEW A;  4W4Z A;  3LCP A;  5D8A A;  1A8D A;  1PIV 1;  4BQ1 A;  2CYF A;  1GAN A;  1BZW A;  2PHR A;  2WO3 A;  4JGZ B;  4QX5 A;  1K5M C;  2XKP A;  1MVQ A;  1QEX A;  1XC6 A;  4YGB A;  3G7D A;  1JOJ A;  4ASK A;  2BYV E;  3WNM A;  3OY8 A;  1YYN A;  3N9M A;  2QQN A;  1RUH 2;  3AP9 A;  4Q4V 3;  4IES A;  4NN0 A;  4ZU4 A;  3AC0 A;  1S2E A;  2G9G A;  5LRS A;  2QJV A;  1V6K A;  3UKV A;  1D2Q A;  4GH4 A;  4LIT A;  3UGH A;  4W65 A;  3AKR A;  2IXC A;  4MXW A;  3VDD C;  1G9C A;  1T6B X;  4N90 A;  4YWA A;  4OI0 A;  4EJR A;  1POV 3;  2C9K A;  3AMP A;  4YGC A;  5F8P A;  4BMB A;  2QKD A;  1UQX A;  4CRQ A;  1H8V A;  4AF9 A;  3JXS A;  4YM3 A;  1KQR A;  3ZXL A;  1GZC A;  1TZO A;  2VW1 A;  4DQA A;  1G8W A;  2WS9 2;  2VNG A;  1AXY A;  2ZS6 B;  3TWI A;  4BQ2 A;  1CAU A;  3NAP A;  2QQJ A;  3TEZ A;  4IGP A;  2PQQ A;  1ULO A;  1B35 A;  2WC2 A;  3JBG 1;  3ZO0 B;  1BVV A;  2ZGN A;  3BPS A;  3D6E A;  4UFJ A;  4JDO A;  1AX1 A;  1VAV A;  1WCQ A;  1LAJ A;  1NA1 C;  5FK8 A;  4XDQ A;  3WDV A;  4LUL A;  4CDU A;  5JSR A;  2D5H A;  2RS3 3;  5JI7 A;  1HXS 3;  4MX3 A;  5FYZ A;  2WNU A;  1SLA A;  2W91 A;  3H3Z A;  1BVP 1;  1AX0 A;  2GND A;  2XHN A;  5FBJ A;  2VMD A;  4GD4 A;  4UOJ A;  3RI8 A;  1AL2 1;  3WCR A;  3WF3 A;  1NE4 A;  2C6S A;  5FZD A;  3IDC B;  1JZ6 A;  3OGG A;  1D0G A;  1NA1 B;  4QQH A;  2TUN A;  2LUW A;  4EWD A;  5GZG A;  4M00 A;  4XQ4 A;  4EQV A;  4I2O A;  5FP8 A;  4YW5 A;  1DQ2 A;  5JOX A;  1V0A A;  2OA2 A;  5F2S A;  4AGR A;  1HQW A;  1WMX A;  2VTX A;  1ZX5 A;  2K0G A;  3CJI A;  4Y26 A;  4R4Z A;  1GZT A;  2BGP A;  5LBB A;  5J36 A;  2XVK A;  2HYK A;  4GB3 3;  4LUK A;  4BK4 A;  3OEA A;  4BHP A;  3PU3 A;  1D2S A;  1RUI 2;  2OW4 A;  4UXA A;  2DBI A;  5FP4 A;  1AYN 2;  3B94 A;  4AEK A;  4MXW B;  2C1F A;  3G6J B;  1GKB A;  1R08 2;  5L9R A;  5FZC A;  4Y20 A;  1W6P A;  2BDR A;  1DYO A;  3O5S A;  1W6M B;  3JD7 1;  4IEV A;  3MPP G;  1LB2 A;  1W6P B;  3M3Q A;  1W2T A;  3I3E A;  3IZO A;  3J7H A;  3VD7 A;  1F8V A;  4AED B;  2XJR A;  3W5M A;  3KSC A;  5BV6 A;  1SLI A;  3I2G A;  5ISL A;  2VCM A;  4LBN A;  1MVE A;  2H0V A;  4AED A;  2JDU A;  2ARE A;  2UYB A;  1O7F A;  5LK7 B;  2W3J A;  3NV2 A;  4GJY A;  4YFW A;  4UFI A;  4CPB A;  3A0N A;  4MET A;  5EV7 A;  2XJP A;  5DAB A;  2O14 A;  2QCS B;  4JVA A;  4NIH A;  3Q8A A;  3VD3 A;  4FO9 A;  1IS6 A;  1NCR A;  1A78 A;  2DFB A;  3NST A;  5C3R A;  3UKT A;  1Y4W A;  3WCS A;  3T0D A;  1NKG A;  1L7R A;  1UZV A;  4AI9 A;  3KQ4 B;  1YHF A;  4QX0 A;  3LOI A;  4O9G A;  1YRZ A;  4G4F A;  3S7I A;  1OH4 A;  5LRR A;  4XBQ A;  3WQ7 A;  1H8T C;  1NY7 2;  1E5H A;  3JUU A;  4P9L A;  2VZU A;  1NQD A;  3LGR A;  4OCT A;  2WYF A;  2ZKL A;  4ASL A;  2OZ6 A;  4FOW A;  1GZ9 A;  5A3W A;  3ZYG A;  5L36 A;  3R0R A;  1H2K A;  1JN2 P;  2ERF A;  2GP3 A;  1KD7 A;  1R1Z A;  2JKX A;  4LBM A;  3PVO A;  1W90 A;  3GBG A;  4P08 A;  3I7D A;  4XHX A;  5I0U A;  3WG1 A;  3ZDS A;  3T08 A;  2ZEZ A;  5FYC A;  3KQR A;  3SEP A;  1F35 A;  1SFY A;  4PQQ A;  4AHX A;  1QJU 3;  5FJK A;  1WKY A;  5JOY A;  1NQJ A;  2G9Z A;  2ARB A;  2QVS B;  5LY2 A;  1O4T A;  4LNV A;  5A6Z A;  2VR4 A;  3PUR A;  4D7S A;  3U0Z A;  1XU2 A;  5L73 A;  1CES A;  2WFP A;  3JB4 C;  3CJI C;  1JW6 A;  3MLJ A;  2QFE A;  1LGN A;  1NT0 A;  2VAU A;  4M0H A;  2P37 A;  4BIS A;  3ILF A;  3H50 A;  2W1Q A;  1MEC 1;  1UPI A;  2R04 1;  3JQX A;  3EJK A;  3KVA A;  4MSV A;  3HVD A;  4Q4W 1;  4XTM A;  5IVY A;  1SG3 A;  3WT3 A;  2V5D A;  3MUY 1;  2EIC A;  2D3R A;  4EN7 B;  3ACL A;  3S5Q A;  2WNE A;  2FDI A;  4CDW B;  2A70 A;  5LW9 A;  2R30 A;  4MYE A;  3QLQ A;  3PUS A;  4DY3 A;  5BY5 A;  3NNF A;  2HWD 3;  1SFP A;  2QQP A;  1R09 3;  4COZ A;  1AR8 2;  4LOR A;  2B39 A;  2H6C A;  1OOP B;  5FPV A;  3UL2 A;  1HB2 A;  1H1A A;  5A7N A;  4DO0 A;  3MW2 A;  3H1W A;  3POG A;  2ZML A;  4PBO A;  4Q1P A;  3AP5 A;  2PAM A;  5FXX A;  2QQO A;  3AKP A;  4W6W A;  1XNT A;  3FE5 A;  3WUC A;  1R09 1;  2ZGL A;  4LOS A;  1JYV A;  1W9W A;  2HWD 1;  2VE1 A;  2WFF 2;  4Q26 A;  5F6K A;  4M3C F;  2ZGR A;  1HLC A;  1PM7 A;  3POJ A;  2B8M A;  2IXI A;  5FZ7 A;  1LOG A;  1VBE 3;  4GZ9 A;  1ZBA 3;  1VMF A;  3GBF A;  2Q1M A;  5DAW A;  1AVB A;  1RIN A;  3C7H A;  2DCJ A;  4Z82 A;  3SNM A;  3VDD A;  1LOF A;  4CEW C;  3ELN A;  4IEU A;  1DFQ A;  1S4C A;  4QB2 A;  3N7M A;  4QPY A;  3WQB A;  2R1B A;  3SCG A;  4O61 A;  3LDB A;  4CDX A;  1CIY A;  3KCC A;  3KLS A;  4WVZ A;  4RR3 A;  4QAW A;  4XJ9 A;  3N9P A;  1COV 3;  4KWL A;  3J7N A;  4EN0 A;  4KGQ A;  1KDK A;  4YG6 A;  4QB1 A;  3GJA A;  1WZX A;  3MEP A;  2B46 X;  3ZMN A;  4XAA A;  3ZM8 A;  3LAG A;  3OSD A;  2JD9 A;  5EHD A;  3WUD A;  5A33 A;  1TEI A;  2D6L X;  4GKY A;  3GF6 A;  4NWV A;  1HV0 A;  1TME 2;  2P2K A;  5TSW A;  1IG3 A;  1UKG A;  2R07 2;  1VBD 2;  4DXT A;  1CPN A;  5C3O A;  1WW4 A;  3I2H A;  2G9F A;  2WSV A;  5HBA A;  2WA4 A;  2PHL A;  1DGW A;  2WUH A;  3INA A;  5FZI A;  4BQ3 A;  3VUO A;  1JZ5 A;  3PVB B;  1GP5 A;  4P5H A;  1WW5 A;  4UFK A;  5A3T A;  1RUJ 3;  4WM8 C;  1AR6 2;  2NP0 A;  4HN1 A;  4K1Y A;  1DDL A;  2WR9 A;  3GCW A;  3MI8 A;  1BMV 2;  4DY5 A;  2ET7 A;  5EJZ B;  4HN0 A;  3ST7 A;  3V0A B;  3VBR A;  5C4W A;  2A6V A;  1F15 A;  4K1Z A;  1RMU 3;  4CCM A;  3SIT A;  1QQP 3;  1S0J A;  2AH2 A;  4YW3 A;  2L9L A;  1GZW B;  4A6S A;  3AXE A;  2WWU A;  1D4M 2;  2Q8E A;  5B2G B;  1SDW A;  1RB8 G;  2VU9 A;  1X9P A;  3OGV A;  4AW7 A;  2WL1 A;  1LNS A;  5A32 B;  5K8S A;  4XF1 A;  3WP6 A;  1PX3 A;  2X8K A;  5KHJ A;  1UYP A;  3P3N A;  4TWT A;  1VB4 A;  1JU3 A;  5K7P A;  1Q56 A;  2JE9 A;  1HB4 A;  1PMI A;  3AMM A;  2DUQ A;  2YYO A;  5FZO A;  5EQU A;  3WDX A;  5I8T A;  2QZ3 A;  1V6J A;  3VBO A;  2VO5 A;  2VZ1 A;  4LBL A;  5CZK A;  2PHF A;  3OPW A;  2YBP A;  2B9U A;  1UCX A;  2ZGM A;  3VBO B;  1SBE A;  3IAQ A;  1V6M A;  2OT7 A;  3LWC A;  4LOT A;  4GA9 A;  5I8S A;  2BQP A;  4N43 C;  4YZ5 A;  2ZX2 A;  3C7G A;  5FYS A;  3U4X A;  2K9Z A;  2Z4F A;  1R1A 1;  3NVC A;  2EVX A;  2NM1 A;  1RUE 3;  3RQ0 A;  5I8Y A;  2BJS A;  2KM2 A;  1YJK A;  3K3N A;  4XUT A;  1IZ3 A;  1GMM A;  2W46 A;  3JZV A;  3NV3 A;  1AL2 3;  2EXH A;  3MO4 A;  3O0V A;  2D44 A;  3FLR A;  2Y6L A;  1DQ4 A;  4Q8L A;  3AZY A;  1HXS 1;  2DUP A;  1CZS A;  2VZT A;  4NRQ A;  1DGL A;  2CL2 A;  2WN3 A;  4JQT A;  5GZD A;  1R64 A;  3FN9 A;  5DAX A;  2VC9 A;  5L19 A;  1DCS A;  2FMD A;  3OG2 A;  4XUO A;  4FPJ A;  1QXP A;  2LAL A;  1Z78 A;  3U10 A;  4E4H A;  3TBD A;  2DTW A;  1I6X A;  5FZ0 A;  2V09 A;  3JCI A;  1JZ4 A;  1Q8S A;  1PGW 2;  3I3M A;  2RDR A;  4NO4 A;  3W59 A;  4C1W A;  1W6M A;  4CCK A;  1FMD 1;  4QWN A;  3KWV A;  1CJD A;  3R4D B;  3PNA A;  1X82 A;  3J26 N;  1W2N A;  2VZO A;  4NE9 A;  4QKF A;  4XBL A;  4J25 A;  5H9S A;  4CVU A;  1ZA7 A;  3LOB A;  1I3H A;  4IE7 A;  1RUF 2;  1Q43 A;  2VNO A;  2DVA A;  2PHW A;  2G19 A;  3FC0 A;  3I4I A;  3ZXK A;  4Q8K A;  5AC9 1;  4OHW A;  5T5J A;  1CX1 A;  3SEE A;  1C8M 3;  5EYY A;  4CYD A;  1V9U 3;  1WW6 A;  5D1I A;  4CE8 A;  3ZOI A;  5FR3 A;  2RR1 1;  2AR6 A;  2VUA A;  3UJO A;  4IXL A;  2ARA A;  4QPI A;  4CEW B;  1HRV 1;  2ZTN A;  4RA0 A;  4U36 A;  4YM1 A;  2Q5T A;  3GHN A;  5JZG C;  5M0T A;  1ULF A;  4W6Y A;  2UY9 A;  3RZJ A;  5J96 B;  2BVV A;  4JGY A;  5DMY A;  3U4S A;  4Z07 A;  2HWC 2;  1PIV 3;  4XIO A;  4CDU B;  1PO1 3;  4BQW A;  1US2 A;  5FFO C;  1NA1 A;  3T30 A;  2EA7 A;  4BCU A;  2VW0 A;  3VBH A;  1RUG 2;  4QB6 A;  1UY0 A;  4BM8 A;  3GDB A;  3MLL A;  4QGN A;  1QY4 A;  3THC A;  3MIG A;  5DUX A;  2OYZ A;  3GBW A;  3KHB A;  2B5H A;  4J1W A;  3UKN A;  4JGZ C;  3SH4 A;  2H6B A;  4K8F A;  3T2P A;  3ABZ A;  4ZKT B;  2A75 A;  2EAL A;  2CGO A;  2I74 A;  4GQ7 A;  4IV3 A;  2W9X A;  4NWW A;  5HV4 A;  2VBP A;  3CHX A;  5I91 A;  3RZL A;  1VMJ A;  3ZFF C;  2VZS A;  2NZ9 A;  3SQO A;  5GZF A;  3C7O A;  2J1S A;  4I01 A;  4I3P A;  2IFW A;  3O7O A;  4IEQ A;  5L7O B;  1LOE A;  4OUL A;  2CAV A;  3BOD A;  4LKF A;  4Q4X 1;  2NPI A;  4V2V A;  3O12 A;  4B1M A;  2XLF A;  4EZ4 A;  3VN4 A;  3PLQ A;  1G9A A;  4DEQ A;  1RMU 1;  3LPF A;  1GOF A;  3ME2 A;  1Y3T A;  3MIF A;  3OJB A;  4IE0 A;  2XVL A;  4KWU A;  1UZY A;  4BLI A;  1L7Q A;  3E5X A;  5FOB B;  1T6G C;  3PJY A;  3RG0 A;  3NAP B;  3RZH A;  2VGD A;  2J42 A;  4CDW A;  2BRT A;  5BNN B;  2CV6 A;  4Z1V A;  1EUU A;  1F9K A;  5JDB A;  2R7E B;  1VLN A;  3THT A;  2LRP A;  3K2O A;  1W6O B;  3E1F 1;  5FXV A;  5K0U C;  4FPO B;  2VNV A;  5DPN A;  4DNY A;  4RS5 C;  1DZR A;  2XJT A;  2Z5W A;  1YI9 A;  4AHZ A;  4F3J A;  1JYX A;  1RXG A;  1J3P A;  1YUD A;  2JEM A;  1RL3 A;  1PIV 2;  2WNV A;  3CNA A;  4HT1 T;  1WLW A;  3VBR C;  1CQ9 A;  4N8M A;  4DXS A;  1PO2 3;  2JDY A;  2X10 A;  2Q30 A;  2WNV B;  4LLF A;  5ERL A;  1Z0H A;  5HXV A;  1F5F A;  1PZ8 A;  1IPJ A;  2DFC A;  3WP4 A;  4RSU A;  2HEW F;  3WSO A;  4XF4 A;  1PK6 A;  3K77 A;  2FCT A;  3BVC A;  3I2O A;  4O9E A;  2HKX A;  3DKW A;  2DVB A;  5IVJ A;  2YBK A;  1BJQ A;  2NYY A;  1YWK A;  1ZZ9 A;  4PBP A;  2D43 A;  1YQ6 A;  2O8Q A;  1LHO A;  1LOA A;  4MZU A;  3I2I A;  3GZU C;  3WNK A;  3IBM A;  3AKT A;  3OD4 A;  2VUD A;  4PF5 A;  4V2W A;  4CUC A;  1JHN A;  2EIB A;  3DGT A;  3ENR A;  2BVB A;  5FZK A;  1UU4 A;  1NCR C;  1CAX A;  1ZRC A;  1BHG A;  2EF6 A;  2OVU A;  2YXS A;  5BXX A;  4NJ4 A;  3SLI A;  4DUW A;  4Z2W A;  4QU2 A;  3SCF A;  5IJR A;  1ZBA 1;  4YW6 A;  1VBE 1;  5AFE A;  1GOG A;  2XL7 A;  1OSG A;  2C0Z A;  1O4Y A;  5GZE A;  4CXW A;  1W8U A;  3WG2 A;  5JMC A;  3K4Z A;  4E27 A;  3ZYB A;  5BNO A;  4JCK A;  1BBT 2;  1UIK A;  3TN9 1;  1ODN A;  5FO8 B;  3AZX A;  3W21 A;  3PU8 A;  5FBZ A;  3O14 A;  3ZFG C;  2V73 A;  2ZEX A;  1W8H A;  4CXX A;  1N3O A;  3M7A A;  2FDJ A;  4FT8 A;  4TXW A;  1AL2 2;  4ZS2 A;  3B69 A;  4PQ9 A;  1GWM A;  5FY5 A;  1X8E A;  1PGS A;  2J7M A;  3DXT A;  1OI6 A;  3H1M A;  1VAK A;  4XTP A;  3I2J A;  2R07 3;  4FPY A;  1NX9 A;  1HDK A;  3CQO A;  4IUG A;  1ODM A;  5FUP A;  4QD2 A;  3GXU A;  2VZV A;  4NOT A;  3E5U A;  4UF0 B;  1UD1 A;  2SBA A;  5C5U A;  3POE A;  5JXH A;  3EQE A;  5LBE A;  4ZU7 A;  3EB7 A;  4LHN A;  3GJB A;  5EZW A;  1ZBE 1;  4QDS A;  3DKQ A;  1ZZ8 A;  4A45 A;  1Z7S 3;  1RHI 2;  1O8P A;  3ZXJ A;  4IE6 A;  4NRM A;  2E26 A;  1QJY 2;  4QX3 A;  5FMO L;  1AYN 1;  4D3W A;  1VJ2 A;  4KMQ A;  3VZL A;  5LWB A;  1S2K A;  2BWA A;  2F6B A;  5IAV A;  2UWC A;  1PGL 1;  4NPM A;  5BNP B;  3I59 B;  5ANN A;  5A6X A;  2A3Y A;  3FMG A;  3ZDV A;  2HWF 2;  3BOP A;  1J3R A;  1GNY A;  1RUE 1;  4YSF A;  2XOM A;  5KHG A;  5FZ8 A;  4AFB A;  1JH5 A;  3A23 A;  1OUS A;  3FLT A;  2WO2 A;  3VKL A;  4AI0 A;  4FP3 A;  2JG8 B;  2GMP A;  2YMZ A;  5CG9 A;  1NZC A;  2ZAC A;  3OCP A;  1G7Y A;  3I2K A;  1JMU B;  4PCR A;  4BME A;  4LK6 A;  4F83 A;  5FRE A;  2V72 A;  5KHI A;  3LZZ A;  4OFG A;  4BJ0 A;  3I54 A;  1LEN A;  1PZ7 A;  4LPL A;  1GWL A;  2MEV 2;  4E4S A;  2WYS A;  4PIY A;  4YYO A;  3THP A;  3K48 A;  2D6P A;  5FZ6 A;  1NUK A;  4E2G A;  3PDQ A;  1DGW X;  2NN8 A;  1W8W A;  4ISR A;  5F3I A;  2XHK A;  3ROU A;  3H7Y A;  1IPS A;  1V6I A;  3PL0 A;  4XCB A;  5D21 A;  1CAW B;  1RUI 3;  3KT1 A;  5EJ1 B;  4NIA A;  4JZR A;  3ITQ A;  4AFM A;  4RHV 2;  3VZN A;  5J7M A;  1JYN A;  1OLM A;  5T55 A;  2D5F A;  2GH8 A;  5L9V A;  2JIG A;  3GAL A;  4I0W B;  2HWE 1;  4AAX A;  1CGP A;  2A6Y A;  2VY0 A;  4LE4 A;  2AGS A;  5A3P A;  2WLP A;  1AR9 3;  3D4K A;  3WX5 A;  3D5O A;  5DAV A;  1RUJ 1;  3SH3 A;  3VKF C;  4XHB A;  5JOW A;  2ZGT A;  5T3N A;  4Y5S A;  2YFZ A;  2CAU A;  5C8W A;  1HN1 A;  5I0R A;  1UX6 A;  3C3V A;  2JE8 A;  2HWC 3;  5A1A A;  4QQO A;  4MGS A;  4FPL A;  4HKL A;  4Q4Y 1;  1ND2 B;  1MQT B;  1SHW B;  2FCU A;  4BE3 A;  1WUV A;  1IS3 A;  1Y9Q A;  1GIC A;  1MEC 2;  1XNB A;  3WHU A;  5A1L A;  1ND2 A;  2ZKN A;  4GB3 1;  1ZRE A;  4RGA A;  4CXY A;  5FUN A;  2KD7 A;  1MZ5 A;  1ENS A;  3WDW A;  5KXE A;  5FYU A;  3ZN6 A;  4JKK A;  1SBF A;  5CKQ A;  3ZYR A;  4LBQ D;  2CNA A;  3H8O A;  2BZD A;  1COV 1;  4CP0 A;  4Z8B A;  4IQP A;  3CZJ A;  4QX8 A;  5A1F A;  3VHO A;  2VTX J;  2TNF A;  1AR8 1;  3B02 A;  3EBR A;  1AHS A;  4L97 A;  4BPZ A;  4LHL A;  1G86 A;  4EWA A;  4RS5 B;  4XAE A;  5I0D A;  5GLW A;  2WRA A;  2OKX A;  3ILR A;  3ZSM A;  2MEV 3;  2XGX A;  4Y5T A;  1B35 C;  4DOU A;  4KBB A;  5IFT A;  2WZ8 A;  3AZW A;  3N9O A;  4P02 B;  4BQ5 A;  5KR7 A;  4H3W A;  4A41 A;  2OII A;  3CLP A;  4Y1Y A;  3K46 A;  1JU4 A;  1AUY A;  1VRH 1;  2V4A A;  3FFQ A;  3J8F 2;  4IV3 B;  5F2W A;  4COV A;  1NLR A;  1VB2 A;  3OBT A;  1R09 2;  1BEV 3;  2EXI A;  4XFC A;  2CDO A;  2VCB A;  4G9S B;  4ES8 A;  4ZS3 A;  4NHY A;  4TLG A;  2WAB A;  2Y38 A;  1ZRR A;  1JZ2 A;  2GNT A;  3TAY A;  3Q8B A;  1FPN 1;  2VQ0 A;  1GWK A;  3ZFG B;  3POW A;  5DDJ 1;  1ZA4 A;  2VW2 A;  2W95 A;  1UOB A;  3SMH A;  2WT2 A;  3Q8F A;  1NLQ A;  5F5I A;  3OOX A;  4RGK A;  3O1U A;  4QX7 A;  2YV8 A;  2JDH A;  2J1A A;  5FCC A;  3WD5 A;  3CZU A;  2RV9 A;  1PHM A;  1W8O A;  1LJ7 A;  4FCA A;  1H9P A;  1CPM A;  3IN9 A;  3WW3 A;  1PMJ X;  3L2H A;  1AR7 2;  5A3M A;  3VBU C;  4EN8 B;  2YBS A;  1I9R A;  1U0A A;  2VXR A;  5DAQ A;  5CVR A;  1JS9 A;  3ZR5 A;  4AGG A;  4GMP 0;  3ZKU A;  4HAN A;  3SC7 X;  1JYC A;  4CEY B;  1DQ0 A;  2VXJ A;  4KH9 A;  5IVF A;  1UL9 A;  1U5Y A;  5FXW A;  3DCQ A;  4XF3 A;  1MS5 A;  2B9V A;  4IND A;  3AYE A;  1ZZ7 A;  1UOF A;  2X5I B;  3TNQ A;  4YPJ A;  2EAA A;  4KU8 A;  4MGZ E;  4CUA A;  4PT6 A;  5C3S A;  5LA1 A;  4WM8 B;  2WT1 A;  2YY1 A;  4LA3 A;  3RYK A;  3AXD A;  4FFI A;  5FZA A;  2YPD A;  4XUP A;  5FIX A;  3AYA A;  5BUV A;  4MAD A;  1VBC 3;  2EIG A;  3IPV A;  2C4X A;  2XJS A;  2W1W A;  2CU5 A;  2IFR A;  1XOY A;  4FI9 A;  3NW4 A;  5FP7 A;  1S0B A;  5CKN A;  1QJU 1;  1C1L A;  1UXX X;  4AVA A;  5HCH A;  5DUV A;  4JRA A;  3L2Y A;  5FZM A;  3FHA A;  4Y33 A;  3U07 A;  2EAK A;  4K7J A;  4CCJ A;  4D6R A;  1BMV 1;  1RHI 3;  4AR2 A;  2PHD A;  2BP6 A;  1CN1 A;  1CAX B;  1ST8 A;  1W03 A;  1HQN A;  1YIF A;  5FDB A;  1DLC A;  3AFG A;  2RS5 2;  2BFU S;  2W1S A;  2ZCW A;  3IKW A;  3KZ4 C;  3WLU A;  5SV5 A;  1QH6 A;  3MV1 1;  3AL6 A;  1N1Y A;  2XH6 A;  1RJ7 A;  3KGZ A;  1D4M 1;  2F4L A;  4FQZ A;  3TOJ A;  4BXS V;  3N3H A;  1QKQ A;  3BCW A;  1ENR A;  2IXK A;  3OPT A;  3MGU A;  4CCN A;  4ES9 A;  1W06 A;  2PAE A;  4CDX B;  5FZ4 A;  4PJY A;  3PTY A;  5LB6 A;  4HPK A;  4UYB A;  4BZ4 A;  4C91 A;  1LOB A;  3VL8 A;  4XFF A;  1APN A;  1IQA A;  4UAP A;  3OBA A;  3N9L A;  3J7M A;  2VG9 A;  1REE A;  2DUR A;  1LUL A;  1SFN A;  1W6N A;  1GOH A;  4AE2 A;  1BBT 3;  4KQ7 A;  1SCS A;  1JHJ A;  2D98 A;  4AVT A;  2Q8C A;  1QOO A;  5FMC A;  5CFC A;  3B7M A;  1XPW A;  1H9W A;  2ZPX A;  4BIF A;  4GMP 1;  4LMF A;  1UW8 A;  4YM2 A;  1R1A 2;  1OUR A;  1OA2 A;  5F1R A;  1OXC A;  1A6C A;  2ETE A;  4FFG A;  2VNR A;  4P9J A;  3JD7 3;  3DYO A;  4XBN A;  1CAV A;  3VBF A;  5FMO S;  4PDW C;  4D7Y A;  1ZZC A;  1X7N A;  2ZGO A;  4WM7 B;  5F39 A;  1VR3 A;  1GR3 A;  4GMP 3;  3ACF A;  1RIR A;  4Q0V A;  1VAM A;  3HWJ A;  4FPH A;  5L9B A;  1IS5 A;  2XWB B;  1XQN A;  3J4U H;  2ADD A;  1O3T A;  3RZM A;  2ZZJ A;  3BIW E;  4IV1 C;  5FZB A;  2E9Q A;  4HSL A;  5G05 L;  4I3G A;  4ZY9 A;  4QXB A;  4LJH A;  1PNG A;  2D6O X;  4FXK B;  5HCF A;  4LK7 A;  1U5X A;  1NAE A;  1H0B A;  5C6C A;  1PGW 1;  1W3V A;  2ORZ A;  4XXA A;  5KXD A;  3LDR A;  1V6N A;  2DUO A;  1YFU A;  2PTM A;  3VHP A;  3OYW B;  4TLF A;  1WMD A;  4ZPI A;  5EFU A;  3NNM A;  5C70 A;  5FYB A;  3IWZ A;  3SCH A;  2RS1 2;  3K4A A;  4YFZ A;  5LAT A;  2RS3 1;  5A6Q A;  4YNI A;  3ZPO A;  5J1X A;  2OQ7 A;  2ZGQ A;  3B9I A;  4ZU5 A;  2DCY A;  3ASI A;  1H30 A;  2FDK A;  1YLL A;  2UYA A;  4I30 A;  2DCZ A;  3FWE A;  1RUH 3;  1V6O A;  4Y1V A;  5BNP C;  3HT1 A;  2RR1 2;  3OTF A;  1XE7 A;  4D8M A;  5JIU A;  1HRV 2;  1XE0 A;  4XIL A;  4EE2 A;  2VEC A;  1AJO A;  4YG0 A;  2C26 A;  5BNN A;  1UMH A;  1V6L A;  3RRD A;  1PX4 A;  3FJS A;  4S2F A;  5BNQ A;  2AUY A;  5BPX A;  3T09 A;  4QQ2 A;  4UI9 L;  4M3C B;  1TVG A;  1I5P A;  4H7L A;  4AHW A;  1Q8V A;  1RUG 1;  3H8U A;  4CA9 A;  2ZBJ A;  2ZHN A;  4N9I A;  1VBC 1;  1U5Z A;  4WV8 A;  1UY2 A;  1C8M 2;  2JG9 A;  1N1S A;  2WT0 A;  2W5F A;  4G3Y C;  4ARY A;  1M06 G;  4Q4V 1;  3MBW A;  5FPZ A;  1IOA A;  2I45 A;  3U78 A;  3PMS A;  4IEX A;  5DZF A;  3III A;  3OB8 A;  1W9S A;  2JX9 A;  2J1R A;  3C8X A;  4XMI A;  3N7K A;  1XRU A;  1MQT A;  3OUI A;  4M01 A;  4WBB A;  4YM0 A;  2FD8 A;  2LRO A;  5KXC A;  1R08 1;  1OLR A;  2BWC A;  2DVF A;  4AED C;  2OX0 A;  1O3Q A;  4JQR A;  4ZZ5 A;  4E2Q A;  1KIT A;  2XBO 1;  4Y3O A;  5FYT A;  1RMU 2;  3AK0 A;  1B09 A;  2PHU A;  4PI2 A;  4ITC A;  3ZYF A;  1QJX 3;  4BWO A;  1QDO A;  3CF6 E;  1DYK A;  4X8P A;  2VTF A;  1ZVF A;  5JPN B;  5CBL A;  3O1V A;  2ET1 A;  3ZN6 B;  5FLJ A;  4IEZ A;  3NRU A;  1NOV A;  3MFC A;  4NID A;  2DF7 A;  1DLL A;  1LRH A;  2Y6J A;  1UOG A;  5T5O A;  2OQ6 A;  2P3J A;  4ZHN A;  4CP9 A;  1IPK A;  1OQD A;  4BOW A;  4C0B A;  3U75 A;  3O1T A;  1YQC A;  1H4H A;  3LA7 A;  5A7O A;  2G4I A;  4PLN A;  4W6X A;  1FYU A;  1UY1 A;  4IDZ A;  1S2B A;  4CDW C;  3TB0 A;  3UNP A;  1AJK A;  1DQ6 A;  1YCI A;  3LQC A;  5EPA A;  1NY7 1;  2W92 A;  4LR4 A;  3U1X A;  4CDX C;  1S0D A;  4XQD A;  4Y1X A;  5J3U A;  1ULG A;  1LES A;  1YEW A;  2FDG A;  4BDV B;  1WCK A;  3VBR B;  4UF0 A;  2RJL A;  1XJA A;  1TMF 3;  1GV9 A;  5FY1 A;  3ZN4 A;  4AQ2 A;  4FPC A;  1ASJ 1;  1BEV 2;  1FV3 A;  3MUZ 1;  2GH2 A;  2GSY A;  3KV5 A;  5C3Q A;  4ZXE A;  1PZ9 A;  3VHR A;  3T4H B;  3KGL A;  1HB1 A;  3BOW A;  1S0I A;  5C4W B;  1DQ5 A;  1LEC A;  2HWF 3;  3AKS A;  1V00 A;  5A70 A;  3NAP C;  1QXJ A;  4AFC A;  3AX4 A;  3PIG A;  2HBU A;  1DP0 A;  1QIQ A;  2BOJ A;  5DZG A;  2DDU A;  2DVD A;  4MXV A;  2BW8 A;  3WZ1 A;  1QOT A;  3HR9 A;  1XSQ A;  4Y1Z A;  1IG0 A;  1RIT A;  4KG0 A;  4Q4W 2;  5C9A B;  1X33 A;  1W6Q B;  4HL0 A;  2VOT A;  4QDR A;  5FXZ A;  4YW1 A;  4RQP B;  2ZGS A;  2JDA A;  2YZ4 A;  4QKN A;  3U11 A;  2D3S A;  2R32 A;  2VD7 A;  1FOD 1;  1VBB 2;  4JGY C;  1QWR A;  1UY4 A;  5IK7 A;  5CFD A;  2V5Y A;  1RUC 3;  4O65 A;  1EYB A;  4QXH A;  5FKB A;  3RMY A;  1WWY A;  1N47 A;  3WDY A;  4HVR A;  3TEX A;  3F95 A;  3W20 A;  4YLZ A;  4FXG B;  1UMZ A;  3LEG A;  5I93 A;  2PHT A;  3OBZ A;  5CB7 A;  4HFS A;  2VM9 A;  3GZT B;  4FTB A;  1O5L A;  1QJE A;  1OVP A;  3NMB A;  3ETQ A;  5FYY A;  2GAU A;  2ZJC A;  3IDA A;  3LFM A;  4NAM A;  1OOP C;  2R1D A;  1W3X A;  5EP9 A;  2CGN A;  2HWD 2;  2VPV A;  2X09 A;  3M1H A;  5T5L A;  4CTE A;  1W0O A;  4WZC A;  4OZX A;  2X29 A;  1JUI A;  2BFU L;  2EXJ A;  4CU7 A;  5HV0 A;  5F9T A;  2DU0 A;  5CIR A;  1W8F A;  2WWS A;  3LSD A;  2VUL A;  3VZJ A;  5FYH A;  4FAG A;  3AZZ A;  5KXB A;  5HCA A;  1Q5O A;  3ZFG A;  1KFU L;  4F8A A;  4WVV A;  2W08 A;  2EID A;  4PIZ A;  3VZO A;  1H2M A;  4XDO A;  1TNR A;  4NII A;  1UMI A;  3U37 A;  3ECQ A;  4MVT A;  2AZ5 A;  4BLJ A;  3POB A;  4S2G A;  1W99 A;  1WCS A;  2WZR 2;  4YVS B;  1JBC A;  3MFA A;  5IT6 A;  4QXK A;  5CA6 A;  4L0P A;  1S0G A;  4HK9 A;  2BUK A;  4I0B A;  4AGV A;  4C90 A;  4YVS A;  3NV4 A;  4V1P A;  2HJI A;  1DBN A;  5FPL A;  3O1M A;  4Q4W 3;  2W0X A;  3ZSE A;  1RVF 3;  4IET A;  3R6S A;  4RQP A;  1MZ6 A;  4BU2 A;  1HN0 A;  2MEV 1;  4C8D A;  3BU0 A;  4YW2 A;  4M0N A;  4ATF A;  5KC5 A;  3KT4 A;  1F31 A;  1Q8O A;  1UYZ A;  1S1A A;  2WQ8 A;  2R07 1;  1SLL A;  1FXZ A;  3M70 A;  1PK6 B;  2ZHM A;  4XIK A;  5J48 A;  2R0H A;  3UET A;  1GQH A;  3HJR A;  4K9S A;  4XJU A;  4OQ9 A;  3APB A;  3VGI A;  3RVH A;  4LBQ A;  1G9D A;  2WBK A;  1XB9 A;  5LBF A;  1JZ7 A;  5I0T A;  4QU1 A;  2ZGU A;  4AVB A;  2BNM A;  5FWJ A;  5FO7 B;  3AP6 A;  5F37 A;  2ZZQ A;  4Q4Y 3;  2NMO A;  3AZV A;  3UGG A;  3FLP A;  1D0H A;  4BK5 A;  2XXZ A;  1AR6 3;  1RUJ 2;  1UO9 A;  3BAL A;  4MGY E;  4E9K A;  5CYY A;  4I09 A;  4RHV 3;  5KHH A;  3KT7 A;  5F5C A;  1MR5 A;  2PEL A;  4N7I A;  1HB3 A;  4XQW A;  2VOK A;  2FDF A;  2BBV A;  4PHZ A;  4FPF A;  2WZP P;  3C2U A;  3HPN A;  1HRI 2;  3NQH A;  1GU3 A;  1Y43 B;  4B29 A;  1JTZ X;  5IVV A;  1ZNP A;  4QQL A;  1AR9 1;  4QX2 A;  1H2L A;  1UPS A;  2HYX A;  2JG9 C;  2XML A;  1UZ0 A;  1RUC 1;  5IK5 A;  2IVJ A;  1OFN A;  4PDW B;  4Y24 A;  2Q8O A;  5ABJ A;  4CZS A;  1BKZ A;  2V4V A;  1W6N B;  4NHK A;  4Q2F A;  1ZM1 A;  4DFS A;  2DCT A;  3KV4 A;  4N43 A;  3NNG A;  3L9J T;  4JTN A;  1D7P M;  4CCD A;  4QT6 A;  4Z2A A;  2Y0I A;  3ETP A;  1EY2 A;  3D0S A;  3ZN5 A;  1D4V B;  3I2D A;  4ET7 A;  1NCR B;  3WG3 A;  3HQX A;  1J59 A;  1OF3 A;  2GNM A;  3B00 A;  2Z42 A;  4DPN A;  4FTS A;  3IB3 A;  5DN2 A;  1YQ2 A;  2BU9 A;  1A34 A;  1ND3 B;  3WQ0 A;  4BQY A;  1LGC A;  2W87 A;  1VBB 3;  3DPR C;  3EMR A;  2XUE A;  3HMY A;  1WBF A;  4LT5 A;  4XJA A;  2WKK A;  1C8N A;  4KWJ A;  5FZ9 A;  2ZX1 A;  3WF4 A;  3USU A;  3PVE A;  2ADE A;  3DPR A;  3A7Q A;  3GM8 A;  3H9A A;  3RYR A;  2Y6G A;  3VKM A;  1UYX A;  4CP1 A;  4IE5 A;  5JUV A;  4M3C E;  4AFA A;  5DDJ 2;  4K6B A;  2W68 A;  3FFZ A;  3PIJ A;  2ZAB A;  2EXK A;  1REF A;  3WNX A;  4B7K A;  1NZI A;  3A4U A;  1BQP A;  1RYY A;  5EXO A;  5IUQ A;  5FZ3 A;  1W9Y A;  2GN7 A;  1AF9 A;  1CON A;  1FNZ A;  1XNA A;  2R06 1;  4MGK E;  5DG2 A;  4AI2 A;  2JB8 A;  1KFX L;  2BNO A;  3I3B A;  1SCR A;  5K0U B;  3D82 A;  3NJY A;  2WS9 3;  2JIJ A;  5A80 A;  1SZB A;  2VVF A;  5KBF A;  2QNK A;  3Q8C A;  4Q4X 3;  2XWJ B;  5FLH A;  2P3K A;  1STM A;  1Z7S 1;  3MIH A;  5A7W A;  1LR5 A;  4FOQ A;  2BV4 A;  3WW4 A;  1H4G A;  4NRO A;  1RUF 1;  2JDM A;  1K5M A;  1TQ5 A;  5ACA 2;  4YVW C;  4PDW A;  3ZKY A;  5ABJ B;  3IMN A;  4AOC A;  2BTV C;  1E57 A;  3V56 A;  4WZF A;  1ZRF A;  3E6C C;  4AL9 A;  4Q5O A;  3GZE A;  4Q27 A;  4R52 A;  1WA6 X;  4RS5 A;  1LU2 A;  4Q0S A;  3AVS A;  3BTY A;  4AG4 A;  4A7Y A;  3N9Q A;  3I49 A;  4EWE A;  1RGS A;  1ULC A;  3FX3 A;  1RXF A;  2WDB A;  2QQW A;  2WO7 A;  1K5J A;  2JD4 A;  2VMH A;  4LE3 A;  4MLO A;  2QQK A;  2SLI A;  1GYK A;  4XFI A;  2A5Z A;  1C1F A;  3LEK A;  3POS A;  4YW4 A;  3VBS B;  5A3L A;  2PA7 A;  1AYM 1;  1YNA A;  2YHJ A;  3NKG A;  4O7X A;  3ZXA C;  1LOF C;  4FAH A;  3SKV A;  3JU9 A;  2JJ6 A;  4XF9 A;  4I0A A;  1ULP A;  2WZE A;  2XUM A;  3N7J A;  1HRV 3;  1LED A;  3LPG A;  5E6H A;  3VZK A;  1J58 A;  4QPG C;  1F5J A;  5IK4 A;  2Y26 A;  4RGG A;  2JG9 B;  3TNP B;  1MS3 A;  4ISQ A;  4FPK A;  1RUO A;  5LA0 A;  1POQ A;  2QQV A;  2J1T A;  4L9B A;  2HBT A;  2WQ4 A;  3GNE A;  2FCV A;  1OMI A;  1PO1 2;  2W1U A;  5DXD A;  5FPA A;  5C9A C;  4LKS A;  4UW3 A;  1O4Z A;  2HWB 3;  2GNB A;  4CDQ C;  2VME A;  2DBN A;  2WSU A;  4B7E A;  1C5H A;  1PMH X;  1W2O A;  1W0P A;  4JHT A;  3PTR B;  1XXN A;  5FZG A;  3UV9 A;  2PN5 A;  3ATG A;  1EV1 1;  5E8A A;  1CD3 G;  2K2S A;  3P6B A;  3RPQ A;  3ZYH A;  3S30 A;  2JG8 A;  2WLQ A;  2A1X A;  5LBC A;  1ACC A;  4ONU A;  1B35 B;  3AMH A;  1V9U 2;  1YFX A;  2QDR A;  4Z92 B;  4ASM B;  1PO2 1;  4J1X A;  2ZGK A;  3IPV B;  1XBF A;  3CIH A;  4RFR B;  2OS2 A;  3NV1 A;  4U2A A;  3TEW A;  4LBJ A;  3CJX A;  3ZSJ A;  1HX6 A;  4LLO A;  4OI1 A;  1S55 A;  4GWN A;  4CU9 A;  1W0N A;  2E6V A;  3ZYP A;  2JXA A;  2NQY A;  4H2A A;  5FP9 A;  4BQX A;  4Q0Q A;  2Q8D A;  2VVE A;  1R1A 3;  3SH5 A;  2RS5 3;  1IQD C;  1LTE A;  1MS9 A;  2OUJ A;  2RDQ A;  3KHC A;  1W04 A;  2XLA A;  4DMI A;  3WR0 A;  3OUH A;  5CFD C;  1LHV A;  3PUH A;  3ZFE C;  3AVR A;  5FY8 A;  1J84 A;  3P1I A;  2PLV 1;  4GWM A;  1UWW A;  1BK0 A;  2WA3 A;  1OA4 A;  5H9P A;  4AEJ A;  3BTA A;  1CWP A;  1RUD 3;  2Z69 A;  1X36 A;  3VDC A;  2WAA A;  1O6U A;  4MH0 E;  5JCT A;  5F6L B;  2D97 A;  2B42 B;  4IV1 B;  4UBG A;  1FAY A;  3FHI B;  3HIF A;  1JUH A;  2CHH A;  1UKR A;  2A3X A;  3H3L A;  1VIW B;  2W94 A;  3ORJ A;  3ACG A;  4RR3 C;  4FFF A;  2D93 A;  4D7T A;  1VBE 2;  2FHR A;  1RUD 1;  2LS6 A;  4N53 B;  2E7T A;  1F4H A;  2NLR A;  3A0K A;  5C71 A;  5JZG B;  3FBY A;  4RD7 A;  1QQP 1;  4K8R B;  1CR7 A;  2BNN A;  3ZMO A;  4FBF A;  3E97 A;  3CMG A;  3KB5 A;  5FOJ B;  1BBT 1;  3TN9 2;  1O3S A;  1CIW A;  3CKH A;  3T0A A;  5C8C C;  2E7Q A;  1AR7 3;  5FY0 A;  1VPH A;  1EAH 3;  2I07 B;  1POV 0;  1CVN A;  1J1T A;  2VCC A;  2A6X A;  4BB3 A;  3HOB A;  1GP4 A;  4CP2 A;  3IAP A;  4B8E A;  3WHT A;  3IM0 A;  1UIJ A;  1DZQ A;  1LCL A;  3T1L A;  3O0X A;  2ZA9 A;  2Y8K A;  3QOP A;  3MHZ A;  4MUV A;  2JG8 C;  3EYP A;  2VUC A;  3OPZ A;  3NNL A;  4Q29 A;  2RR1 3;  2BBA A;  2F17 A;  1E5R A;  2MNG A;  4UW6 A;  3V64 A;  5CFD B;  1VBC 2;  3WNO A;  1WBL A;  5HPO A;  1E5S A;  3ZYI B;  4XFG A;  1BXH A;  1DHK B;  1QH7 A;  3VBF C;  1FNY A;  1C8M 1;  1NLS A;  2JDN A;  4BIO A;  2VCA A;  3HQU A;  1C28 A;  2RM2 3;  4TYS A;  1IHM A;  3SXW A;  1TMF 2;  4KBZ A;  4Q4V 2;  3LA2 A;  4D0Q A;  2DCK A;  2OZJ A;  1CAW A;  2ID4 A;  1RHI 1;  4CCO A;  2VOX A;  4KU7 A;  3C7E A;  1JYW A;  1WGP A;  3Q9O A;  2QQI A;  3LE0 A;  2XQX A;  4LO8 A;  4QKB A;  4XAB A;  5EJ3 A;  4QHB A;  4PI0 A;  5HI0 A;  4FFH A;  1PGL 2;  1W05 A;  5FY9 A;  4DB5 A;  3LEM A;  3ZX7 A;  1O8S A;  5JI9 A;  2XBO 2;  1WCD J;  2VJX A;  4XUN A;  2X05 A;  3VD9 A;  3HBK A;  2AAC A;  3CBN A;  4I02 A;  4AI8 A;  2E33 A;  4ZON A;  3MIC A;  4AEM A;  2ORX A;  4UW4 A;  3O1P A;  2OUH A;  4A3Z A;  1QU0 A;  3N35 A;  2CWM A;  3BB6 A;  4IGO A;  1ND3 A;  5FLI A;  3RMX A;  1VBA 1;  4A42 A;  2E7A A;  3TEY A;  3DYP A;  2RMU 2;  2ZX0 A;  1QJX 2;  2ES3 A;  3B5L B;  3PHM A;  1YC6 1;  2YG0 A;  5EIY B;  5A7S A;  1AYM 3;  4L2N A;  3WV6 A;  4HVO A;  5I0S A;  2A3W A;  5JPM B;  5DZE A;  1YQ5 A;  3VD4 A;  2HWB 2;  4DZG A;  2Z79 A;  3AMN A;  3CDZ B;  4JV4 A;  4XEZ A;  2GC2 A;  2WII B;  3WG4 A;  3WOG A;  2IXJ A;  1H8T A;  5F3G A;  5IWF A;  4FOY A;  3UK9 A;  3LB9 A;  5DDJ 3;  4FOV A;  1ASJ 2;  5C7G A;  5FPX A;  4MV2 A;  4YW7 A;  1FPN 3;  3R05 A;  3ZFE B;  4ORF A;  2PAK A;  4FP2 A;  3P5B A;  3N9N A;  5E89 A;  4XPV A;  4RQP C;  2XLG A;  4JDN A;  2GC1 A;  2D6N A;  1C57 A;  1FT9 A;  4MOA A;  4CCC A;  1TME 3;  2WNO A;  5K0U A;  4GUL A;  3RZG A;  4UFL A;  1YIP A;  5FZH A;  5H9Q A;  2N7G A;  5AVA A;  2WS9 1;  2Y64 A;  2PYT A;  2XKO A;  3HQR A;  4YVW B;  3VBU A;  2R06 3;  5BYN A;  2Q1F A;  1AR8 3;  3M2M A;  5BNO B;  1QF3 A;  4DUX A;  2E53 A;  5CAD A;  3VKN A;  3N4M A;  1HW5 A;  4GB3 2;  4XXP A;  1OFS A;  2CTV A;  5JXI A;  1JOB A;  1KXG A;  3ZLI A;  2DTY A;  4OQ8 A;  2P6C A;  4L92 A;  4BH9 A;  2TEP A;  2VZQ A;  3DL3 A;  1Y7B A;  3AYD A;  4LXL A;  4IW3 A;  4X8N A;  1EPW A;  3SHR A;  1TE1 B;  5ACA 3;  1OUX A;  2QTW B;  1COV 2;  5IHR A;  1NXM A;  1JOD A;  1N3P A;  1W8Z A;  1JZ3 A;  1F2N A;  1VE0 A;  1W6O A;  2VBD A;  1M4W A;  3NJZ A;  3NWK A;  2P3Y A;  2RJ2 A;  1I5Z A;  1IS4 A;  5HCB A;  2YRO A;  3V0B B;  4C1X A;  1UX7 A;  5E1R A;  4PF1 A;  5GKA C;  3VBS A;  5J37 A;  3V0B A;  2W39 A;  1QJY 3;  3J8F 1;  1RED A;  1XYO A;  1QJZ A;  1N1T A;  1V70 A;  3LD8 A;  1MQT C;  1K12 A;  2O8O A;  3AYC A;  3V0A A;  2Y6H A;  1H8T B;  3VB9 A;  1X50 A;  3BTX A;  2Y0O A;  2X53 S;  3M4F A;  1FPN 2;  1NCQ B;  2FMY A;  3RJR A;  2DU1 A;  5FYI A;  1GNH A;  3ZFF B;  2WFF 3;  4LHS A;  2AEZ A;  4XJZ A;  3MIE A;  3RNS A;  2J1V A;  3S57 A;  3BU7 A;  5JSP A;  2WJS A;  3FZ3 A;  4NHM A;  3M3I A;  5A32 A;  3AMQ A;  4R8H A;  5HXM A;  4S2H A;  5E88 A;  2OPK A;  5F3E A;  1N3Q A;  5GLZ A;  4COY A;  3WW2 A;  2LTN A;  1XYN A;  4LKE A;  3BN6 A;  5B4N A;  3IDB B;  2HH9 A;  1RJ8 A;  4A3X A;  4XZP A;  1UU5 A;  3HAG A;  4N53 C;  4NVP A;  2XPJ A;  2HLE A;  5FRA A;  5A7W B;  3UT0 A;  4CUB A;  3FUO A;  2AC1 A;  1GSL A;  3OEB A;  2BGC A;  1SBD A;  1H6Y A;  2ZMN A;  5D8A B;  4E8D A;  1ZZ6 A;  3OBR A;  2XR4 A;  1JXN A;  2BOI A;  2VZP A;  1ALY A;  2ZX3 A;  3I3Q A;  4EZH A;  5CU1 A;  1H1I A;  2E63 A;  2IXH A;  2QE3 A;  5JR2 A;  3F2Z A;  3WW1 A;  1WME A;  2VMC A;  3T3Y A;  1G9F A;  1MS4 A;  3K75 B;  3CJI B;  3ON7 A;  4BYY A;  4GJZ A;  1QNY A;  1O59 A;  1QJU 2;  4LHK A;  4AWD A;  1HQL A;  4JRL A;  1DIW A;  3AP4 A;  1Q8P A;  3JQW A;  4E2S A;  5CIS A;  5K9Y A;  2RDS A;  4Q1R A;  2A6Z A;  4HKO A;  1AYN 3;  1MEC 3;  1IKP A;  4M3C A;  1H2N A;  2FZ1 A;  4OHV A;  5FPB A;  5A7P A;  3X29 B;  4BA6 A;  4DS0 A;  1I1E A;  2Y33 A;  2UWA A;  4UFM A;  2MPF A;  4XUQ A;  4XVH A;  4QKD A;  4YZ3 A;  1RUG 3;  3AFK A;  2E51 A;  4N53 A;  4C0H A;  4K21 A;  5GLU A;  1W8N A;  2YU2 A;  2VMI A;  2VVD A;  1UZW A;  5JOZ A;  2A73 B;  2GP5 A;  5D2A A;  3GCX A;  5DUW A;  1AR9 2;  5JXG A;  1RUC 2;  4QHO A;  4MGI E;  3H8X A;  4TN7 A;  5DAP A;  4EYU A;  1CAU B;  3RGB A;  3UES A;  1LHN A;  1RVF 2;  1HJG A;  1J83 A;  3D3A A;  1H6X A;  4NMI A;  2RM2 1;  2WIN B;  2P34 A;  3TN9 3;  1C4R A;  5FWE A;  2RHP A;  4KNC A;  3ZSK A;  5FPU A;  3TRS B;  1C5I A;  2ZX4 A;  5B4X A;  1WA4 A;  4OUM A;  3LF7 A;  2P3I A;  5LA2 A;  3LKJ A;  4XZU G;  3LEI A;  1PVC 1;  3AP7 A;  3B01 A;  3DF0 A;  1KJR A;  1LHW A;  1Q8Q A;  1FI2 A;  4HSJ A;  2CSG A;  1EAH 1;  1QOS A;  1PVX A;  2IXL A;  2ZAH A;  3OGJ A;  1WD3 A;  3KCX A;  2IVI B;  4AXO A;  1L7L A;  1ZRI A;  2WFF 1;  4GWI A;  2J22 A;  4OUS A;  3RS6 A;  3RZK A;  2JE7 A;  4GXL A;  3HNB M;  4XFA A;  5ANQ A;  4Y5Z 0;  1KGY A;  1FX5 A;  1EUT A;  1NYW A;  4DXZ A;  2WNU C;  3S7E A;  2VQT A;  1ENQ A;  2BEO A;  5LK5 A;  3WY6 A;  4JHZ A;  1G9B A;  2B7Y A;  2QQL A;  3D0J A;  3P3P A;  1RTV A;  4IEP A;  2YC0 A;  5LCW L;  4PLO A;  3HBZ A;  5GM0 A;  1QHD A;  5C3P A;  4MHR A;  3WQ1 A;  4IV1 A;  4UWD A;  4OMC A;  1JOP A;  3RWK X;  2BER A;  3KVB A;  1Z7S 2;  2JDP A;  1HJF A;  3BKZ A;  1GUI A;  1SEF A;  2RS1 1;  1MZF A;  2RS3 2;  4CPB D;  4XMA A;  2XG3 A;  5JR7 B;  4QXC A;  3WNP A;  5ACA 1;  5CKM A;  1KJL A;  1W6Q A;  2JWP A;  3ZR6 A;  1Y9M A;  1YI7 A;  1ASJ 3;  2DYC A;  2FBE A;  3NKT A;  4AAP A;  3NNJ A;  1YJL A;  3K4D A;  1PNF A;  3HD8 B;  2KA3 A;  4GWJ A;  4QPI B;  3THD A;  4CEW A;  3ILN A;  4COW A;  4M4P A;  4DEV A;  1AXZ A;  4P5Y A;  1HV1 A;  4N7U A;  3H1Y A;  3KCY A;  3RSJ A;  1VBD 1;  2P1B A;  4WM8 A;  4LIV A;  1CAV B;  4YVS C;  2R16 A;  2A6W A;  1DF0 A;  2JIC A;  3OGS A;  3VBH B;  4E4D X;  4JKM A;  2ZOE B;  3NO8 A;  5JIA A;  3W9A A;  1D4M 3;  2ARX A;  5CG8 A;  1AYM 2;  3H0O A;  1UN1 A;  3JBG 3;  2RDN A;  4HLT A;  1OHF A;  4GKX A;  5JWP A;  2GAL A;  1WCU A;  3H42 B;  1JYI A;  2GMM A;  4YZ2 A;  4W50 A;  2R6Q A;  4A44 A;  3I8T A;  3IIA A;  4LIU A;  5APA A;  4XC9 A;  2WAO A;  3ZXE A;  1DG6 A;  2B45 X;  2PMW B;  3VDD B;  4IL7 A;  4LBO A;  2W52 A;  3FBM A;  2YPJ A;  1BLZ A;  3EXU A;  1YQ8 A;  4YVW A;  5GZC A;  4KG8 A;  4B4R A;  4DIN B;  1ND3 C;  3IT8 A;  3ALQ A;  5EWS A;  5GAL A;  2AEN A;  3Q8E A;  1K45 A;  1WLT A;  2WQZ C;  2VUJ A;  3VV1 A;  4D6Q A;  5FQ0 A;  3MF9 A;  1S0E A;  2VOW A;  4Q0U A;  5IVE A;  3T2Q A;  3VBU B;  1C3H A;  1RC6 A;  4Y4Y A;  4NRP A;  2ENR A;  3ES4 A;  3UGF A;  3EO6 A;  5IW0 A;  1TNF A;  4W8J A;  3AKQ A;  4CU8 A;  5FO9 B;  1V9U 1;  1OA3 A;  2A71 A;  3JB8 A;  1PO2 2;  3RZZ A;  3SIS A;  4CDU C;  4DIQ A;  3O1R A;  5CEH A;  4GAZ A;  4L99 A;  4OVE A;  1VP6 A;  3PVN A;  1NG0 A;  5A3O A;  4XCA A;  2ZEY A;  4IEW A;  2ZMK A;  1VRB A;  4IE4 A;  3RWN A;  4FSJ A;  1OBN A;  4OI2 A;  2XJU A;  2XB6 C;  5KWR A;  3MW3 A;  1FMD 3;  4YG3 A;  3UJQ A;  1OKO A;  1HXS 2;  1OVS A;  1QXR A;  2CWS A;  4NIG A;  1UY3 A;  5FZL A;  3VBH C;  5IAT A;  5LEJ A;  4OZO A;  4LO5 B; 
#chains in the Genus database with same CATH homology
 2OQ6 A;  3PUA A;  5FYU A;  2Q8C A;  3PUQ A;  4HON A;  2PXJ A;  4IGQ A;  3LD8 A;  5ANQ A;  3LDB A;  5ISL A;  3PU8 A;  4QX8 A;  5A1F A;  3N9P A;  5A7O A;  2W2I A;  5FY4 A;  5E6H A;  4GJY A;  3RVH A;  5FYI A;  5A7Q A;  2P5B A;  3N9O A;  4CCO A;  5KR7 A;  4QU1 A;  5FY5 A;  5F39 A;  5FP3 A;  3DXT A;  5FWJ A;  5F2W A;  5F37 A;  3U4S A;  4UF0 A;  5FYM A;  5FPA A;  5FY1 A;  3KVB A;  2XXZ A;  5FV3 A;  5FUP A;  5FY9 A;  4UF0 B;  5F3E A;  5F5C A;  4AI9 A;  5FZB A;  4NUB A;  3PTR B;  4QXC A;  3KV5 A;  5FZG A;  5K4L A;  5FZI A;  5IVC A;  4QXB A;  5FZO B;  5A3T A;  4CCL A;  4AAP A;  5IVV A;  5A3N A;  5A7W B;  2XML A;  4IGO A;  5LWB A;  5F5I A;  4QX7 A;  5A3W A;  4ASK A;  5FYB A;  5FZF A;  2GP3 A;  4HOO A;  4CCM A;  3N9M A;  4LIV A;  3KV4 A;  4EZH A;  5FZE A;  2WWU A;  2Q8E A;  2YBS A;  2OQ7 A;  5A7S A;  2WWJ A;  3ZPO A;  5FYC A;  4LIT A;  2OS2 A;  5FZ8 A;  3UYJ A;  4V2V A;  5FXZ A;  4EZ4 A;  4GJZ A;  5FJK A;  5LY2 A;  5IVF A;  5FXW A;  2VD7 A;  3PUR A;  4Y4R A;  4URA A;  5FP9 A;  4LIU A;  4QXH A;  4CSW A;  2XUE A;  5FZC A;  5A7P A;  2Q8D A;  5FPB A;  5LY1 A;  4BIS A;  5FZO A;  5F3G A;  5IWF A;  5IVB A;  3KVA A;  5F32 A;  5FZ9 A;  5FZA A;  5FYV A;  2YPD A;  5IVY A;  5FZ1 A;  3K2O A;  4IGP A;  5FXV A;  3OPW A;  2YBP A;  5FP7 A;  5FYY A;  3AVR A;  3N9N A;  5LW9 A;  5FY8 A;  3KV6 A;  2OT7 A;  3K3O A;  5FZ6 A;  3PDQ A;  3PUS A;  2YU2 A;  4D6Q A;  5FYS A;  5FZM A;  5F3I A;  5FY7 A;  2GP5 A;  4Y33 A;  5IVE A;  3K3N A;  4CCJ A;  4D6R A;  5FZ3 A;  5FZH A;  5F3C A;  2XDV A;  5FPV A;  5IW0 A;  5FYZ A;  5FYH A;  5A7N A;  4DO0 A;  5FBJ A;  3AL5 A;  4TN7 A;  3U78 A;  4EYU A;  4GD4 A;  4BU2 A;  3NJY A;  5FZD A;  5FXX A;  5A80 A;  3AL6 A;  5A3P A;  5IVJ A;  4XDO A;  4DIQ A;  2YBK A;  3KV9 A;  4GAZ A;  5CEH A;  5FWE A;  5FPU A;  2OX0 A;  5A7W A;  3ZLI A;  3OPT A;  4CCN A;  5FP8 A;  5F2S A;  4LXL A;  5FZ4 A;  1VRB A;  4Y3O A;  5FYT A;  4BXF A;  4V2W A;  3DXU A;  4E4H A;  5FZK A;  5FZ7 A;  5FPL A;  5FZ0 A;  3PU3 A;  3N9L A;  5FY0 A;  3AVS A;  5FP4 A;  2YU1 A;  3N9Q A;  5FJH A;  5FZL A;  4CCK A;  4QWN A;  4XDP A;  4CUG A;  4D6S A;  5A1L A;  5F5A A;  5FUN A;  4C8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...