4QXGH

Antigen binding fragment of an anti ifnar1 antibody
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
218
structure length
218
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYIFTNYWIAWVRQMPGKGLESMGIIYPGDSDIRYSPSFQGQVTISADKSITTAYLQWSSLKASDTAMYYCARHDIEGFDYWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for antagonistic activity of anifrolumab, an anti-interferon-alpha receptor 1 antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Fab, heavy chain, IgG1
total genus 42
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2014-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qxgH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qxgH01
4Q6IC 2HFEA 2W9EL 2F54A 1TQBC 5E1AB 1XIWB 3ES6B 1G7HA 3MV11 4POZD 2VERN 3GSVA 4NKIL 4PJFB 1RUAH 4PB0H 1P4IL 2A2QT 1DBKH 4XT1C 3V4VH 3UTZA 5JDSB 3ARZA 4ZUTA 3VWJC 3IFLL 5JW3L 4LSRL 2WBJC 1RUKL 5HYJA 2G75A 1WISA 3Q3GB 2ICWA 1I3GL 1CDBA 4KUZH 2OJZL 1FG9C 3TGXA 4I48A 1MCJA 4W6WB 1T03L 4AM0A 2J1KA 4EI5C 2ADFL 4XNZB 1JZ8A 3LEXA 1GC1L 1ZT1B 2Z35A 4WW2A 3RBGA 4JFED 1FVDB 3MLVL 4NFDA 5J12B 1A6UL 3O6FA 1NCNA 3KPSB 2PR4L 4PGDA 1CD8A 5HHPB 2LABA 2IGFH 4OFDA 3MJ7A 4AT6B 2AK4D 5F1OB 2R0KL 4NN6C 1EX0A 4RA0C 4UOW1 4Z7UE 4QXGL 2H2SC 4OF8A 3HUJF 4R97B 4HKZA 4GXVH 1LEGB 2FL5B 4WFGE 5AD0A 2C3HA 3QUKA 2XTJD 5MEOA 1MCCA 4K23L 2ZUQB 2N7BA 5I76B 5DD0H 1OP3H 5DRNA 1FLTX 1T04A 2AJUH 5KS9A 2R0KH 1T5WB 1PEZA 1INEL 3P0YH 1LNUB 5EA0H 3AMKA 3MLRH 3SKMA 2K9UA 5IFJB 3HG1D 3BGFB 3RIFK 3TO2B 1BJ1H 5CILL 4XMKH 5JHDD 1WEJH 3LQZA 1I7ZB 2OMNA 1NCWH 3HC4H 3RRQA 4YDVB 3FFDB 3F12A 3MRHB 2J8OA 2IH3A 3IJSA 3RGVC 1HI6B 5CSZA 1RZKL 1BFSA 4QXTA 2GQHA 4PJAA 3EZ8A 3D18A 5JW3H 2FD6L 5GGUA 5ESAA 4NJ9H 4OIBA 1VFBA 2E9WA 4PJ9C 4XZUB 5TE6H 2Y7QA 4YDKL 4PG2A 5C08D 2VLKE 2YPKB 3ULVE 4GRMB 2P48B 4WHTA 4F7MA 3AGVA 3ZTJG 5IESL 5CBAA 2VLLB 3EJJX 4U0RC 2LU7A 5HDQH 3PV6B 5AZEL 1XR8B 15C8L 3FRPG 3P11L 1OGAA 3W11C 2MSPA 3D3VD 5A16A 1HHGB 3KPMA 4Y16D 5GS0H 4HCRA 4NNYB 1S9WA 4NRZA 2CKNA 4BKLA 1Q9WA 4HGKC 3BPNC 1G0YR 1BAFL 4UNVA 5I1GH 3WFDL 2OSLB 5DVKA 1PYWA 1OTSC 1N5AB 1UXWA 1MCWM 1LO4L 2F54E 3H3PH 3R8BB 1JPST 5MEQB 4MDIA 3WNKA 4HBCL 3N50A 3GRWL 4NKOA 4V1DB 1XF1A 2ZCHH 3TCLA 5DF0A 1S7RA 5T3XE 4PRHE 3AS3A 3INUL 5D7JA 3TBVA 1GGBL 3H9HB 5TJWK 2MKWA 2A9NH 3HLAA 4F9LC 3DUUA 4FNLH 1NCDL 4XAWH 4X6DA 2FJFB 2EDXA 3GRWA 4OBRA 4IDJL 5D7KE 3QHZH 3DMMC 3V5HA 5FKAA 5L2KD 3D9AL 1ZMYA 4P4RA 1XR9A 5I0ZA 4ODWA 4F33A 4YO0B 2O26U 4G8IA 2X4QB 4PGBB 3WLBA 3S98A 3T65A 2G60H 4HJJL 5IV2B 3QXUA 4OSUL 4JFHD 1BECA 3BOVA 4HJGB 2PO6D 3O6LH 1X7QB 1A9EB 5T5NF 4JHWH 2VSCA 3KLHD 4ODXA 3MYJA 4P23D 3EJYD 4PJ8C 3GJFH 3MLUH 1ADQH 1MUJA 3ARBD 1PYWB 1B0WA 5ESQB 2DWDA 4MS8C 4JZNB 1FP5A 3CH1A 3O4LD 2QBWA 3ARVA 2Y7QB 1S7RB 3VXPA 4M1CC 4JHZA 3OMZA 4RIRB 5FYLE 3VD3A 43CAB 4Z7QF 5HVGB 4GMSH 2HT2D 4ZS7L 3WFBH 4L3EB 3QWRD 1DLFL 4G8FB 5E6IA 5HYQA 3V5KB 2A6IB 1CDGA 1MREL 3V52L 3KPRE 5DURD 3TZVB 3MCLL 3NPZB 1WAAE 1X7QA 1XMWA 1AE6H 1XF5B 4CN1A 5IVNA 2HT2C 3MJ8A 3DTXB 2VQUA 4BKLB 3S6CA 3SDDA 5K9QG 1C1EH 2NXZB 3WXVL 1DQDL 4Z7UF 3VXUB 3G5VA 1OWWA 2QKIA 3WLBB 5EFIB 3O3AB 3SE3C 4JPWH 1KNOB 2HKFL 1CTOA 4YK4B 1I85C 5TE7L 3EOAA 4F9LA 5ALCH 3VU2A 1KLUA 1KEMH 1U8KB 5JHDE 3QO1B 5IEKB 4RGNC 1B4JL 3IFOB 3RQ3A 3T2PA 2YPKA 1YY9C 3QIBA 5FGCE 2NY3C 4P23C 5LGJA 1RY7B 2Z93A 3LVEA 1CFSB 3S5LB 3F7QA 2SEBB 4Z8FL 5SWZB 2PYFA 3IAPA 1MPAH 4I5BB 5GJSH 1TTGA 2R0LH 1JGVL 2AKRA 4Y1AE 3IJHB 2NY4C 4KRPC 3MNZA 1P4BL 2OL3B 5K59F 4LGRB 1NEUA 3DVGB 4PJEB 1H5BA 2J5LC 1XZ0A 3WNPA 4EDWL 4TVPH 4TTDC 3T77B 3MREA 1U36A 1NGQL 1NC4A 3EAKA 2BK8A 4JY5H 4Y4HB 5IB2B 5EBGA 2KKQA 4C54A 5CJXC 3GEWB 4PV9B 3WKMH 2CK0H 4HKJB 1R3KB 1U8IB 1KJ2A 1VPOL 2PTUA 1RUMH 3TBVB 1YEKL 1S7XA 2L0DA 3N1QC 4P99A 1M7IB 3QPQC 4KV5E 2VQ1A 3OKKB 2H26A 2YOCA 4NRXB 3RTQD 1FZMB 3NH7H 1I9RH 4KRNA 4YNYB 1XIWA 5LAXA 1JF6A 3O45B 4GJTB 5D93B 2J3SA 5T1MB 2WINA 1SJVA 3D25A 4PJFA 2B5IB 1TNNA 3BKML 3G6JF 1U0QA 1U6AL 3LEVL 1FLRH 4N0FB 2Z8SA 4GS7B 5MENA 3RDTA 2QADB 5J13B 3WIHA 4M5YL 4NO2B 4TTDD 2PF6A 1D5XA 5DEFA 4HKXA 3KYOB 3V6ZA 3PE9A 2ZUVA 4OZFH 2DM7A 2VDLL 1Y0LA 1CZ8L 5H35B 1G7JB 3PHOA 4Y4HD 2FJHB 2EH8L 5SWZD 3SY0B 2VLRE 4KKAD 1I9IH 4NZJA 5I74C 1GC1H 1VENA 4U31A 4NN7B 2NYYC 1LK2A 5KSBB 2UWEE 3VXQA 5EOQL 5SX5H 4OV5A 1WBZB 3HNSH 3B5HA 2XA3A 5DJZA 1WLHA 3H9SB 1P4LA 3FN0L 2DMCA 3CSYA 5DD3L 5CBEA 4D0BB 2HAZA 3NCYS 4IRSC 1RUKH 1FBIL 5DD5L 3UTZB 1ZLUK 5B39B 1FNGB 12E8L 1A6WH 4H0HB 5HTSA 1V7NH 5CEZD 2D2OA 5C07B 4UMGA 3I9GH 4HPYH 1DBKL 4DJMA 2C3GA 5DJ8B 4GW4A 3SKOB 2CXKA 3VH8B 3C6SB 1Z9LA 1DN0B 2XZAH 3IU4H 1KJVA 5LJYH 2D9QB 4DQOH 1AH1A 2F53B 4NO0A 1MSPA 5I8OL 3QHFL 2V6HA 2NY2B 4Z77A 4LF3B 4LKXA 4WI2A 3L5XH 3FRPA 5ILTH 3MV7E 1Y18A 4XXDA 4PJ5E 1ZVHA 3DPBA 4LLMB 5GRZA 1SMAA 1KIQA 1R3IL 3FO9B 3IT8D 5ANMA 5ETUB 1JGVH 2L7UA 5FUOH 3CSYB 3BUYB 1I8KA 1L0XA 3CFBA 1H3VA 1RULH 2FEEL 4JPKL 5IBLD 4MQ7B 1DQQA 1Z2KA 2QTEA 4Y0GA 3CMGA 1S7UB 1K6QL 3LS5L 3VGGA 1IGJB 3MLXH 1EMTL 4W6XB 4RMVA 4RSVA 3VDCA 3HE7C 3MMEA 1M05A 2VAJA 4Q9BA 3S8WA 1KTDB 4G6MH 4OZHE 3LEYL 5L0QB 2XWTA 2X6MA 1RHFA 4XMPL 1EO8L 1FAKT 3O6KL 4PJ5A 4AM0B 3MOBL 4GW5B 5ISZD 4Z0BH 4UT9H 4WENB 3W39A 3O2DL 3KWWB 2ORBL 3MV9D 5EZOH 2JJUA 3IS1X 5E8OA 3NABH 2L7JA 4YGVB 3X14A 3SDXF 4PJHB 3VGAB 4NO2A 1IQWL 2ICWB 5HHQB 4AQOA 5A2JH 3MACL 3GSOB 1EHLL 4L8CB 4JRYB 2NY2C 3F8UB 2P7TA 4NGHH 2WQRA 2V5RA 3FB6B 3MJ6A 4NWUH 5ITFB 2QHRH 5IOPB 1HSAA 2EEAA 1RUQH 4YXLL 3S4SA 3RU8H 1OF2B 5FGBA 3QUXB 4C56D 4EQ2A 1AGBA 1XGYH 2ATPA 5CMAA 2VB5A 1LK2B 3ZKXC 1I7TA 4K3DL 1IGIL 2G5BA 3NACL 2YD4A 2MTPA 4GMTL 3VG0H 4RMSA 4PJ7B 4RAUA 5JOPD 1L4IA 3TYGH 2HJLB 3G04A 2OTWB 4N0CC 3HZVA 1CD9B 2VDQL 3TO4A 4JFFD 2N4IA 1RK1B 3O3UN 2UY7A 3ARGB 3GMPA 3KYOA 2FYYA 2XI9A 4GW4B 1EFXB 3PGFH 3VGDA 3X12A 2XWTB 4M6MH 5C0IA 2VDOH 3W9DA 1FO0A 4CL7A 2LVCA 3P2TA 5CMAB 2A9MH 1E0OB 4MA7H 3OHXA 4FXGA 1FAIL 4OZIF 4Y4KC 3EYOB 1CVSC 2BC4A 5EUOE 1WAAA 4GS7C 4IRZL 1YQVH 5IKCA 3B9EA 1G7PA 1I7RA 5DD0L 1CLCA 1R24B 4GRWH 2KUTA 2XRAH 3S88L 3PWVA 4RGMC 2PO6C 4F7EA 4XVSH 1QSEE 2VLKB 1UCTA 4W68A 1I1AD 3ALPA 3KS0H 3MXVH 1KPRB 3KYMB 4S2SB 4R96A 4YHKL 4YGAB 3BH9B 4KKNA 2QQNL 4RZCB 2NR6D 3QQ3B 4U6HB 5GRWA 1UH3A 2C1PA 1EHXA 4DFHA 4C56E 1WFOA 1TLKA 2ADFH 3ZDZE 1UKSA 3D0VA 3PP4H 1M6OA 4RGOH 1T03H 1AKJD 3DVNB 2WAHA 4KJYB 4V1DE 1BLNB 1BVLA 4OKVB 5KN5A 4Y19E 2EYRB 4UI2A 1X5IA 5E4EC 4FFVC 2XTJB 2ARJQ 1JPGA 5ICYA 4QRSB 2D0FA 3H7LA 2VIRB 4GAJL 1D5IL 1MCEA 5CP7B 1E4WH 2VLME 1L9MA 3SDDD 2VDPL 4JKPH 4MJ6A 2YPVL 4MNGA 4UAOC 3MRFB 4KC3B 3WO4C 4H1LB 4JRYD 1T7XA 4JB9L 5ID1B 3QEQB 2P5EE 2H9GB 1QOKA 3WKNA 1ACZA 4O9HH 1EA9C 4PJGB 3WE6B 4AEFA 3S5LG 5C07A 4ZFFB 1E28A 3MRNB 3TIEB 2GSGA 1L9NA 5F9OL 2AKRB 4ZFOL 2HFGH 3STLA 2IBZY 1N5YL 1FV1B 4NN7C 2R1WA 3UBXB 2AV1A 3NIDE 2QQKL 1SVCP 4RRPG 4PLNC 2GK0A 2DQEH 2DLFL 1JGEA 4ZAKB 2MCPH 3JSSA 4X83A 1VB9A 5KOVC 4DOHB 4WFHD 5I9QC 4OCRL 1Z0MA 3GMQA 1H3GA 2A74B 3LMJL 4I3SH 1U8KA 5TDPA 3CPLB 4OGYL 43C9B 3U0WL 3BQUC 1ZGLB 4XGZB 3DGGA 2APXA 4R6UA 4KK9D 4ETQA 2AEQH 2YKLH 1VGEL 5FUZL 1ZA6B 4B7IA 1LO5B 1O7SA 1UYWH 2IAND 4IRSD 4PJCA 4U1HA 3D48R 1JNNL 3T0XA 4POYA 2M2DA 4OGXL 2GJZB 4X98B 5ENWA 4XH2B 1LEKA 1PJ9A 3K7UA 1F6LL 5DZLA 1WZLA 3CFKA 2VL5B 4MA1C 1ZA3B 4FTVB 5T3XH 4KDTA 2J12B 1G1YA 2J88L 3EO9L 2AK1L 1L7TL 1QEWA 2X05A 1CWVA 3VD5A 3LKPB 1UWXH 1CE1L 4LU5L 2R29H 5GGRY 1CFNA 2A9ML 3V52H 1S7VA 1PY9A 2IBGA 5JXAL 1QFWI 2PCPB 4XCFH 5SWZE 2HLFD 4YIQA 3QO1A 3BP6B 1BLNA 3ZKNC 4YAQB 4HH8A 4U1MA 4MXQC 5CJOH 4MA3B 1OTTC 1FH5H 3O3AA 4X6DE 4I0PC 1N5AA 4XVJH 4D3CH 5JW4R 3MRBA 4WHCA 1D5ZA 1NAKL 4LRIA 4U3XA 1T4KB 3R4DA 5TDPB 4ODWB 1IGIH 3NACH 3A0OA 4TSBH 3SPVA 4M8QB 3BSZH 4G6FB 4N0FA 5MENB 4E41E 4M93B 4EQ3A 2GY5A 3HPJB 1QLRA 2R1YA 3D3VA 3IDYB 2APFA 4YDVA 2PYFB 1YEDB 2QADD 4DKEH 3NBNA 3QUML 5H94B 4E42A 1NBYB 1FJ1B 1S7TA 4PY7B 2LAGB 3BP6A 1XCTA 3SKJL 1MCBA 2NY2D 3OAYK 4NQDA 3V5HB 4LVOC 3RAJL 1T89C 4TSCH 3DX6B 3MACH 3C6LC 3J8F7 1KC5H 5IGXH 4EXKA 3RI5K 4IM8A 4NBXB 3EHBC 5DLMH 5F97E 1DSFL 1UZ8A 4OF6A 3TFKD 3IDXL 5IWLC 2XKSA 1HHKA 4NSKB 4HDIB 1I3RA 1P1ZA 1KACB 4GKSA 4XHJD 5BVPH 4KAQL 4MMZC 5GS0C 4M1DH 4OZGA 2NY5C 3HI6H 3S36L 3S35X 4EVNA 1YNLL 4MNHB 2E7LA 5EU6E 4UINL 3F7YB 1Z5LB 5ECJE 4WNQB 2VN7A 5JR1L 1OSPL 5C0BD 4FQJH 4JFDD 4Y4KA 2FR4B 2MFNA 2AVGA 3JV5A 5I17B 2EYTB 3GBNH 5K93A 4HWBA 2IH1B 2X42A 1UKTA 3D69B 2VXUL 3L5XL 2R23A 1INDL 1OB1A 3ILPA 4NCC1 1NUGA 2VAAA 3VFPA 4DQOL 4D8PA 4ZTPL 4ERSH 3DO7B 1S5IH 3MBXH 4I0PD 2R2EA 3Q5YA 2I26N 5FECB 2D9CA 2X2YA 4Y4FA 4GSDL 2VOTA 5I73C 4LRIC 4BSVA 4XBEH 5TE6L 3VXTA 1A3QA 2B20A 1KULA 1HDMA 3HZMA 4PJAB 3O3BB 4TSAH 1CLOL 3MRJA 1NCTA 4X98A 3CDYA 3DSFH 1FL3B 3BE1L 3R06A 3MRBB 3NIDF 3RTQB 3G6DL 1JHKL 2D3VA 4Z7WE 4LIQE 4JHBA 1BZ9A 3CFEA 4S0TD 4KVCL 5DXWA 1TETH 4BH8B 2K7QA 5J3HD 1MCLA 4JDTH 5CKGA 3KPLA 5DQDL 4ZUUB 2AERT 4PJ7E 4YDIH 4U6TA 3PL6A 4L3ED 3HNVH 2PCPA 1CR9L 1IC4L 3WIHL 3BN9D 3ULVH 1A7PH 3CFJA 3X12B 4XWGH 3ZT6A 4G80B 3FO9A 4JRXE 3P0YL 1MFAH 4LK4A 3QZWG 5FDWB 2D31A 4XRCB 5IIEA 5IOPA 1F3RB 3ULUH 5FGBC 2Y4SA 4KK9C 5GS2H 3VGHA 3QI9A 3HAEA 4Z7NE 1RFDH 2LTQC 1I7UA 3GMRB 5IVXA 3S4SG 1WC7A 2AEPL 4D9RD 3EYVB 4MQTB 5E6ID 5F3BB 3BZFA 3M45A 4IDLA 2NXYD 3MLYH 1P2CB 3TIDA 4MNQB 3BGAA 3MRFA 1DBJH 3X3FH 2X7LA 5GS1C 5D7LD 4M7LH 4LPVA 3U46A 2VISA 3NCBB 4JR9L 4N0YH 5J6GA 3VG9C 5E2VH 5DJXB 2WZPD 4YHIB 2PYEB 4QNPF 1HHHB 1KCRL 1AQKL 4RGMB 1N26A 2Q6WB 5EZJA 4MVBD 1JE6A 5DD6B 3RA7L 4LSRH 4WV1A 2XZQL 3D39B 4PB0L 3S36X 1EFQA 3T1FA 3DRTA 5SWSA 3IU3A 4N8VA 1PG7X 2F9BT 1YECH 2C4FT 2ESVE 4HMCA 3RWJA 5IFAL 4X6CA 5C0BA 3K1KC 5EH1A 2BSSA 1KJ2H 4EOWL 4Z7OE 2WK2A 2HFFA 3KLDA 3MV8E 2AK4A 3SOBH 3FT2B 2BERA 5EU7C 4GAGH 1I7UB 3QIUA 1GHFH 2CKBL 4ALAH 2DBLH 4YXLH 1F4XH 2BSRA 3OX8B 1QTYT 1U8PB 1SJHA 1WT5A 3VRIA 5FB8A 4KKLC 2VH5H 2CIIA 1P4LB 3IAQA 4X7CC 1G7MB 4U1IA 5IHUH 1R5IB 4HK0A 4YXKL 4LKXB 4K3HA 1HSBB 5KSAB 3O2DH 1EO7A 4D9QE 1IKNC 2Z8VC 1DQDH 3RUGF 3ZE2E 4KHXL 4PJGE 3E8UL 3O6FB 4LNRB 4PV9A 1E4JA 5DDHA 4XC1L 1F45A 1OL0A 3C5ZD 1CU4L 2AABL 4OLYH 4GAFB 1BHGA 4TYUA 4OCSL 1U42A 5FHBL 3C5JA 4JZJB 4LOUC 3QUZC 3NOIA 4XVTL 4DUVA 5FHAL 4JFPB 4OLVH 3VCLA 3LSOB 3QT2A 5HHOE 4HLJA 4QRPA 4R4FL 4WVRA 4XBGA 1DJSA 2FX9L 3DXAA 5I1DA 2VUOA 4X6CE 5I8KL 4OKDA 1JPTL 3TVMC 2BVOB 1C08A 1FZKB 1UB6A 4ZO8A 3TO2A 3WCYA 2EDHA 3WUWB 5DR5H 1ORQB 4N8CH 2J8UE 5MI0C 2VDOL 2EYSB 4DN3H 5FCUL 2NY1C 5F1SA 4AMKH 1QQDB 1U8PA 1YDPA 1ED3A 3B2UD 3A67H 4LHQB 1CT8B 2C1PB 5EWIL 3DIFA 4CVZB 1NJ9B 3G6JA 3MUGA 5B8CB 1VSCA 4X6BA 1FVCB 3KWWA 3TNNB 2Z31A 5CJOL 5ICZB 3STZB 5L9DL 2ARJB 2XTLA 4OLXH 4JZOA 2WP3O 4N8VB 2JJSA 4TPRL 3PWPD 1RIVH 3TH2T 2B8OT 1F4YH 3S35L 3QH3B 1WT5C 1J12A 2JB6A 4I18A 2R69H 2DIAA 1S7XB 4AEHL 4KDTC 4PIRF 5KVDL 2N56A 3REWB 1WCQA 3T0ED 3KXFD 3K4AA 2OI9B 2DIJA 1FNAA 5HYJB 5HJ3B 1HE7A 1QRNB 4Z7NF 5HBBA 2VL4A 1H8SA 3VRIB 5FB8B 4G43B 5FYKU 5I17A 3GRWH 2ADIB 5D1XC 1GIGH 1BGXL 1E27A 3I84A 5EN2A 5EO1B 5HDLA 2GW5A 3DVIA 4I2XE 5M94B 3EUUA 5SX4I 2ESVA 4DGVL 5BXFB 2XWBB 5TQ0H 1ND0B 2LTQB 1ZLVK 3B8YA 5INCA 2Z92A 5AYQA 4X5WB 3ARGA 3UXFA 5CFHA 1H5BC 5I1JL 3EFFB 4HH9B 3UZEA 1NMCC 1QO3A 2DL2A 5CEZL 3MXWL 2QSCL 4G6JH 1KXQE 1JVKA 4LLWA 4OTXH 4QOKE 3LD8B 2YXFA 4KJQD 3P11H 1Y6NR 3MGOA 3OXSB 4JPKH 1J11A 1HCVA 3QXAA 4ZSOB 1MCPL 4X7TB 4G3YH 4L8BB 1QFWH 3OKLA 3SE3A 2BP3A 1Q8MA 4BSWA 4NPYA 4QRPE 3C87A 1ZHNA 4Z0XB 5IW1B 4MJIA 1BM3L 1M7XA 1YMMB 4WU5B 4X6DB 4QOKB 3QDJB 5BRZA 2WWKO 2Y07H 3VWKB 3HRZA 4MXQD 2FEEI 1MCOL 4OZ4A 3BZEA 3PL6B 1JZ2A 2Y9RT 5HDBE 3AU1B 4JQVC 4NO3B 4OD1L 3TBYB 1PSKH 3I3EA 4O02L 1AQKH 4O2CA 1EV2E 3L1OH 3IFPB 1A7RH 1NAML 2FECL 4FHBD 5FYLL 5IM7A 4GAJH 3SY0A 2V9RA 1XZ0B 4OLUH 5F7MC 1VEMA 3MRIB 5IVXB 1W0VA 1OGAE 1ETZA 1D5ZB 3IRZA 4HZLA 4NSKA 5J89A 4MD5B 2R2EB 4KKCD 1H8NA 2OL3H 2H32H 2IAMC 5F9JA 1UT9A 4ZMAT 4ZTOH 4ONFH 2YD2A 3V6OE 1BQHB 3QRFM 3X13A 1N0XH 3NFSL 4N5ED 3UPAA 5LGJB 3U9UB 2ILLA 2DM3A 4GRLD 4ODVL 5HPMB 5BZDA 1ZVSB 1KYOJ 4RFNB 3QIWD 4BK4A 2JJWA 4ZPVA 4QKXB 1AXSA 3O3EB 5IHLB 5MENE 1QFHA 3KPSE 4YHMH 2EDBA 4FFWD 3ULVL 3MFFA 1QLRB 2R1YB 3ARGC 1DBBL 2OZ4H 4YC2B 5KVDH 4NQCE 2WSKA 4P49A 3OGCB 2AEWA 3ARBC 3ABZA 4MDIB 4NZUL 3BKMH 4QHMA 3HE6B 4KRPD 1REIA 4XPBH 3KPNA 1DQLL 1XF5A 1DVFC 5TFSH 3SGJA 2FATL 1TVDA 3TP4A 3HUJE 4ENED 1DE4A 4KUZL 1KCUL 3AXLB 4OCMC 5IW6B 5I71C 1AD9B 5BOPA 2IADB 3KPOB 3REVB 3VFSB 2BOCB 2UUDH 1CLOH 4OZFB 5DEZA 1HNFA 3QEQE 4EZMA 4JVWA 2EZ0D 4PUBH 2JTDA 4XBEL 4GRLB 2XN9E 4X8JB 1CL7H 1MJ8H 5GZND 4G8GB 5TQ2L 2NQCA 2BVYA 1MWAB 5C6PB 4HUNB 5HHXL 3V5DB 4JAMA 1NGPH 3GKZA 4ZPTA 2W0KA 2V2XA 5D2LA 3B9KC 3NCEB 1INDH 3U0PB 5HYIA 4TN9A 1VERA 4WEMB 1X4YA 2VLJE 1BQHG 3LKNA 3MNWA 1N7ML 1R3HB 3ARED 2VUYA 2I27N 3NPSC 1H15A 1CXHA 3W2DL 5ELIA 5JR1H 2GUOA 5GRYA 4J8RB 3V4PL 5IB3A 4L4VD 3DX7B 4QWWD 1OAUH 1LD9B 1X3DA 3OXRB 5E8PA 1I75A 3O9WC 5L88H 5KAQF 2VDNH 3RZCC 3EOTL 2E6QA 1KB5B 1BBDH 1FL6A 1IAMA 1RJZB 3O9WB 3STBA 1XGUA 1AP2B 1ZE3C 4U1MB 3DUUB 4FQ1L 4PJAF 3BISA 1P9MC 2KH2B 3KPOA 4JCLA 3REVA 1QHOA 3VFSA 3WO4B 1EFXD 1YMMA 4WU5A 1IE5A 1NGZA 5HHVH 1MVFA 2VQTA 4OF3A 3GSWB 3FO2A 2X4UA 3VRJA 2G2RA 3RAJH 1RJYA 2VDNL 5ACLA 4WTXA 3RFZC 3GSUA 1RIHL 5DK0B 3SGJC 4R4BA 3RUGE 1T1WB 3ZE2F 4EIGB 5E5UB 1RUPL 2XG5A 1F8TH 3BT2L 2GJ6E 1U3HC 3HAEG 4IOSD 3N1MC 3DV4A 2QQLH 3MA7B 5DJ2A 3UTTB 3TPUB 43C9A 2C1OB 5AEAA 1ZGLA 5KJRH 1C12A 5A3IC 1XT5A 3EFFA 3ARQA 3FONA 1FFQA 4KK6D 3SQOL 2AP2A 4CMMA 4JDVB 2BNUA 4X7FC 5AD0B 4P3CL 1A0QH 4NNXB 1AFVH 3SDAD 3EFDH 1J05B 4YR6B 2ICEB 4HV8A 4K94C 5C0BE 4ZNEE 5E8DH 4U1JA 4LVHC 1Q94A 4GRLA 1VHPA 3EO0A 5DUBA 2FLBT 1UVQA 1L7IH 4PJDB 4HIEB 5BV7B 3QUYC 4Q2ZB 3I02A 1ZK9A 1S7SA 4UOJA 2BZDA 2HTLC 3SE9L 4OF5A 3IDIA 2H9GA 1IMHC 3LKSB 5E8OB 3MLPA 2V7HB 2NY7L 5D1QC 3OGCA 3G5ZB 1KLGA 3BP4B 2F58H 1UEMA 1RZJL 3CD4A 5C09A 2NTFB 4LSSL 4V2CB 3CK0H 4K71C 4LARH 1UC6A 3U82B 5DS8B 1L6XA 3D9AH 5F71A 5EPMB 5EOQH 2CLRA 5J13C 2GJ6A 4HBQA 3MRQA 4Q9QH 2FSEA 4J6RL 2ZJSH 1Q9LB 4KMQA 5IVZA 2EECA 2WBWB 1R5WA 3CLEL 3NAAL 4OCXL 2NY4D 3FQUA 2OZ4L 4MWFB 1MHPH 4LAQH 1T5WA 1U92A 4L9LA 3HUJB 4JQVA 3QDJE 3IDUA 4L8BA 2EDYA 5J56B 3NTCL 2IGFL 1B4RA 2WBJD 2ZUYA 3L3KB 2V17L 1BBJA 2R2HB 3KDMA 3TBTB 5I2IB 3WUWG 4YC2C 3O11B 2MCPL 2A0LC 2PYEE 2WWKT 4KY1H 1I1AC 1YN7A 4LLUB 4JRXA 1TJHH 3CAFA 1KB5L 2FRGP 1N5YH 2KPNA 2AI0L 1RZGB 4R26H 2FEDD 1GAFL 4RZCA 1U8OA 3ARFB 2Q86A 4CN4A 1DVFA 3H9SD 1OCWH 3FMGL 4I8DA 3M07A 4PBWD 1RVFL 5L2JB 3F65A 1YECL 4MQXD 4EEEA 2V5YA 2VLLA 4OM1H 4JFZH 2PW2A 4YHOH 5ESVB 5KTEH 4KZEL 5DJ0A 5EU6B 3FMGH 2NPLX 1DL7H 1MQ8A 1JZ7A 4K7FA 3T3PF 4R8WH 3S96B 1NCCH 2H2SD 1P7QD 4LCYB 1UJ3C 5I1DB 1UQSB 2I07A 2N1KA 5DRNB 4G3YL 1RZGA 1MFBL 1C08B 1W0YT 3KYMA 2ZCLL 1XAUA 4MNQA 1Q9OB 4KTEH 4KGLA 1UWGL 4MS8D 5E2VL 1UXWB 1YUHB 5H2BB 3NCJH 1DVFB 4BUHA 1MIEH 2E6PA 2H8PA 3GSQA 4LCWB 5B8CA 3G04B 5JIKA 2YUXA 4KQ4H 5JIPA 4GBXC 2CDFA 5IQ7L 5I15L 4CMHC 4G6AC 3VJ6A 4XP5H 4NYLA 3BMVA 1ED3B 5L8LB 3RY6A 5I1JH 1MEXL 4E5XA 1AY1L 4OZHA 2JJVA 1WIUA 1F4HA 2Q6WA 5TQ0L 2R39A 2P5WA 4HWZB 1R24A 4JN2B 5I66A 1FG2B 1N8ZB 3I75B 1A22B 3N06B 3QG7H 5DVMA 5ERWB 1JHTB 4PG9B 3QUXD 4YK4C 5I19L 1FZJA 4R90L 5BS0A 4A6YH 2AJVL 1A6UH 3P4MB 5F96L 4LP5A 3OJ2C 1DANU 5FOBB 3VG9B 3FOLB 4RFOH 4AEHH 4O5LH 1AGEA 4APQB 4PRHB 5HHOD 5B3JE 3ULUC 5SV3A 4MXVF 5HHQA 3JZ7A 2BVPA 5EBMB 3RNKB 4LFHD 4AEEA 2NY3D 3K46A 5A40E 3IXTA 4NC0B 3DOSA 3C5JB 4JZJA 1UA6L 3T3MF 3BD3A 2WBJA 4POZC 4PJIF 4X6BB 1MCIA 4LFHG 1T21A 3KR3L 1F6AA 4JO2L 1MI5A 2HKHL 1X5HA 4OJFL 3A67L 2VZUA 4GMTH 4IMLA 3RVWD 3QUYB 5GISL 4TULL 1KPVA 4AEIH 4P9HL 1QYGH 1ULVA 2FO1A 2X4PB 1IEBB 1YJDL 4BQ8A 3LH2H 1UEYA 5DR5L 3QO0B 2EEBA 5E8EA 4BFIB 2H45A 1KUMA 5IB4B 1NEZA 2BVTA 3MRCA 4M3KB 5KVFL 3TEUA 3GMOB 1FCGA 3C6SA 1OM3L 3PG2A 3QZWA 5I19H 3RWFB 5F7LB 1BPVA 1BJMA 4JANB 5C0CD 1LE9B 1PX3A 4JRWA 4PRIE 3ARBA 3L5HA 4AIXA 1FDLH 5HYQB 5IW3A 5JO5B 4AH2B 5JNYB 2OP4L 4ZFZB 4PJBE 1F11A 1YEFL 2Q7NA 1DFBL 2YPLB 3LKQA 3H3BC 5GGSB 5BVPL 4Z78A 1JYXA 1YYLL 4Y5VB 3V6OA 4RFNC 1OLLA 3DUSA 3MV7A 3QULA 5DHVH 4G6ML 5L88L 5FO9A 4NFBA 1HXYB 2JCCB 1H3PH 2MQ0A 2EDWA 3KLHC 5IQ7H 3ARDC 4L1HA 1AI1H 4HWZA 1LO4H 3LCYA 4FQXD 4JG0H 3U1SH 1VACA 1KC5L 3L5WB 1KNOA 3CUPB 1JZ6A 4DUWA 3ZKMC 3B3IB 3TC9A 3KLSA 2DDQL 1ZGLM 1MLBB 4UQ2A 2VR4A 3LS4H 1H3UA 1XEDA 3P0VH 1F4XL 2C3WA 5J6HA 3SDXE 4AENA 1UZ6F 3VFRB 1GHFL 2XY1A 3QDGE 1KGCD 1X5ZA 3DROA 4XP9H 4FQQB 4A2LA 5DRXA 3TH3T 3VXRE 1YN7B 5FO8B 4UV7H 4HC1L 2VWEE 1EAJA 5D1ZB 5GISH 1MCWW 5ID0B 1YEGH 1BQSA 4JKPL 4NRYA 1TQCC 3V95A 3PABA 4QRTB 4FZEL 2IFFL 1Q9LA 5AZ2H 2P46B 4H0GA 4WI5A 2IG2H 1J86A 1B3JA 3V8OA 2C1OA 4XXCC 3H0TA 5F3HA 4ODUB 2A1WH 3B6SA 4P2RB 5BQ7B 1KB5H 1NUNB 3TCLB 1FL6B 1RJZA 4N1HB 3HNSL 5GRJL 5JHDA 3UTSE 1WJ3A 3MRDB 4HPOL 3BPLB 3WFHA 3JWOL 4HKJA 4ZD3L 1J8HB 2DQFA 2ESVD 4Q0XH 3L9RB 4ZOAA 2C7UB 2VZ1A 3V0WL 3ROOB 3LQAH 4PLKD 5DHVA 2V17H 1MCFA 3G5XB 2JELH 3RTQA 1OW0C 1Y0LB 1HWGB 3PF2A 1HZHH 5CEYB 4JRXB 4HEPG 3WO3B 3RWEB 2OK0L 2XWJA 4QRQB 4O2FB 4IJ3B 5TF0A 1EJOH 3B5GA 4Y4FD 3P9LA 3WL9B 2E27L 4MCYB 1UYWL 2BNQA 1CCZA 1M71A 3FO0L 5IMOB 3B2VL 3ARGD 1XCTB 3T0EA 1EVUA 1C5BH 1JTTA 4MNQE 5I1HL 5L2KB 1XGUB 1IC4H 1WFNA 1I9RL 3PP3K 4IS6B 3V0WH 3LPFA 4OZFA 1DLHA 3K80A 4Y1AD 4M48H 1QLEL 5T3ZH 2GAZA 3OKEB 5HHMB 3UZQA 4U6VL 1W0WA 3ARUA 3T3ME 1Z5LA 3MYZA 3HG1A 4OD3L 2G2RB 3PXHA 4Z5RB 4DGYL 4PTTB 5I30L 5BV7H 2IANB 5F9OH 1EEYB 1HQRA 1IGTA 3DX9A 3BP7B 1CDHA 5LCVH 3ZT5A 4DCQB 1S5HA 4J3WA 4TSAL 1U8JB 3VE0B 1WIOA 5F1NB 4PJIA 1H0DA 3HS0A 2YMXL 4Z9KB 4I5BA 5LGKA 4D8PB 1OT1A 2VDPH 3Q48A 3WJJC 4QWWC 1C16A 3EYSH 4MDJA 4Y16B 3NVQA 5EC1B 1LO2L 3RWEA 2FX7H 2ZG3A 3IXAB 2GKIA 5KANI 3G5YA 4JRXD 5B39G 4F9PA 3UTPE 4EN3B 4WEUD 3RL2B 4WU7A 2RGSA 4K3JL 3TJEL 4MAYD 3QXTA 1TCMA 3I50H 4ONOA 1Z6JT 5ALCL 4PJBF 1OGTA 1U91A 2Q3AA 2W38A 3MRDA 3P4NA 1K2DB 2AJZA 4JQXA 5C7XH 1N6QH 2A6IA 3TYFA 1R3HA 4I3GA 1T22A 2C3VB 4NNYA 3IGAB 1VCAA 1AHWA 4O2CB 4NOBA 4XCCL 4JN1L 2OQJB 3CVHB 3LZFH 5ITBH 4HF5L 3LEYH 1FGNH 4JFXA 3MO1A 3WS3A 1DSFH 4F7TA 4K9EC 4JAMB 4YXHH 1S7VB 4M7ZB 1N59A 4PB9H 1MREH 1ZHBB 4WRLA 2CKBA 1U3HA 4K7PY 3FB8B 4PYGA 2AK4E 3MV9E 3KLAA 1JK8A 3W2DH 3CK0L 4LARL 1CG9B 1OM3H 1JYWA 3EDKA 3RJQB 1A4KB 4HGMA 2ZUTA 2FBOJ 2BCKA 1I1FB 4LEOA 3QWOB 3H9HA 5SWSD 4OD2A 3D18B 25C8H 2GJZA 4DEPB 4FFWC 4LBEB 1LK3L 1M1SA 3QQ4A 3CFKB 5D1ZC 2AEIT 3O0RH 1NL0L 3EYUH 4O4YL 4PRNB 4YLQT 1XR9B 1W8NA 5E8DL 5DMGC 5FM5M 4RIRA 2A83A 4MXVE 3O8XC 4G7VH 3RWCA 2X09A 3V6FB 4XVJL 1LK3H 4D3CL 5TF1L 4OSUH 5A2IH 1DEEA 1IAOB 5J57B 3WLWC 2VKWA 4KJYA 4JO1H 5JMOC 5FAAA 2PTVA 3D85D 3O41B 1Y6MR 4NN5C 2V5TA 4Y5VA 4NCC2 4OQ1A 3DUSB 1G9NC 3KJ6H 2QQLL 4AJ0A 3BZDA 2YK1H 2AJ3A 2HG5B 1HKFA 5GGUB 4RWHA 3EO1A 5AYUL 1ZT7A 3OG4B 1S7QB 1ZLSH 3P73B 2AJVH 1T83C 1FORL 1SY6H 2DJ4A 4GBXB 4LIQL 4UTAL 2AK1H 3QWRA 5T3XL 3S37L 1CGVA 3MTRA 1I8LA 2PUQT 3C60A 3LY6A 4U1NB 5TGBA 3E8UH 1IEBA 3UAJC 1UB5A 3PL6C 1KENH 1N6VA 1MFDH 3GUTA 3OKMA 1WF5A 3D87B 2W60B 2VLRA 4ZYKB 1GGYA 1NEZB 1FLRL 3BZEB 1OPGL 4OKVA 4XXCA 3UBXA 4MA1B 3IF1B 2VDMH 1FRGL 4G43A 5FYKL 3ZKQD 3TESA 3RJDA 4Y5YB 3T4AB 2X4NB 2Z8RA 2C26A 3KPRB 4JKLA 4QRTA 3QDMB 1CK0H 1K4CB 4S1RL 4GAGL 4HIXH 2W92A 3ULVF 1NANH 4LRNL 5T5FH 3MZGB 1QP1A 1KPUA 3HFML 1JHLL 2BRQA 1BZ7B 4EI5D 2RB8A 5BO1L 3MA9L 1NLBH 1QKZL 2AK4B 5D1XD 2GIYA 1GXEA 1J8HA 3QPQD 3MV8B 3GNML 3KPMB 2VABA 3ARTA 4F37K 5IMLA 1JV5A 1MJ8L 1JHLH 3LKOB 3HFMH 1BEYL 2VLJB 1FVEA 1WBXB 2Z91A 3D39E 4MJIB 2DKUA 2XACC 12E8H 1A6WL 4M48L 1KELH 1JUFA 1H3TA 4R2GD 5HD8C 1K85A 5DJDA 5T3XD 4BQCA 1J0IA 2BOBA 4XXDB 2R0WL 5GGSA 1XGRB 1FE8L 2XQYK 3TZVD 2FATH 3QQNA 5I1HH 5H35A 4M03A 2HP4A 5GSVB 3MBEA 4U1KA 1PFCA 4XNQA 3PWPB 4CVXB 3MROA 4X6DF 4O51B 2A6DB 2GTZB 3QEGH 4Y89A 1UQSA 2I07B 1A6AB 2Y1VA 4HQQL 5C07D 4XCYB 5FK9B 2EXWD 4W6YB 3FQTA 1B6DA 4UQ2B 1T7VA 5T1MA 5IROC 4PRAA 3UJJL 3LHPH 1A7PL 1F4WH 5K33A 1MHPL 3I6KA 4OCYL 1QA9B 3VFMA 3ZLQC 3LQAL 4XVSL 1ZLSL 4YDIL 4J2XA 2XRAL 2DI8A 4NT6A 5DSCA 2ZG1A 4U1GB 4ZUTB 1N3NB 5F9AC 4PJAE 4ZTOL 3RVUC 3Q5TA 4R3SB 5BMFL 1GL4B 4Y8DC 4YH6A 4L8CA 5T1DL 1XGTB 2HVKB 4HWEH 3BWAB 1JV5B 1FIEA 1RZ7H 1BREA 2IWGA 5DYOB 4RMRA 1S7WB 3HNTH 4F7CB 4R0LC 4QHUB 1Y18B 2YPLD 1A6AA 5D2NA 1RUAL 3KNBB 3QPXH 4XNMA 1S9VA 1PG7H 1I1CA 5DI8A 4EXPX 2VXTH 3CVHL 5IHZA 2Y07L 1J18A 4L9DA 3RGVD 3O11A 1S8DB 4NQVB 1A0QL 1C5CH 4HUXA 5F89B 1TDQA 3A6CH 2XPGA 1IT9L 1VADA 2PO6A 3P0VL 5IFHH 1NGZB 4NQEE 3LS4L 4K3DH 4S10A 2Y5EA 3OAUL 4M61A 5LWYL 1GRWA 1MPAL 4U2YA 3WYRA 1TVBB 4K7PL 3EKCA 1CGWA 2JF1A 1CIDA 4WFGD 2ZSWA 1EHAA 4PB9L 2LQRA 3N1FC 5D5MB 2Z0BA 4PBXA 4UILH 1RAMA 1AO7B 2O5XL 4WHDA 4X7SH 4BJLA 1YMMD 1K5NA 2YWYA 4K55A 5JQ6L 3PHOB 2B39A 3ZSSA 4OIIL 2FIRT 4D0CB 3L3HA 1S78D 4MD0B 1BZ7A 2FNBA 5CHNB 1P7QB 2P47B 3PHQB 3DETD 4CU6A 1BGXH 3F6LA 1GIGL 3F7VB 2D03L 4XPTH 4HUMB 5CJ5A 2AW2A 3ELAT 4FQHA 5C0EB 1BAFH 4HDIA 3VXPB 4Z7WF 5DUBB 1GOHA 1P84J 4ZPTB 4D0DA 5D5ME 1KJ3H 5DO2C 3CH8A 3LS5H 1XGPA 4EJ1C 3MRLA 4R7NB 5TPWL 1HIMH 5F7DB 2G9HA 3VXNA 1KJ2L 1MFCH 2Q8BL 1NC4B 4WI6A 1CE6A 5IB2A 4BFBD 2F8OA 2JB5L 2YA1A 1JWMA 3MCKB 4HS3A 4RGND 1BVZA 1AD9A 4NQDD 4F9PC 4JO2H 1PG7W 1N64L 1KOAA 1CBVL 3RVXC 4OAWB 2NXYB 4IIQA 4J1UB 3U7YL 4P2OB 2J6EL 5TQ2H 1A4KA 4LKCB 4PJXF 4GKSB 1NL0H 3ARSA 2WIIA 4V1DD 1I8IB 3H2WA 1HN1A 4U6VH 1G7QA 2BVQA 1QLEH 5A1AA 5IEHB 1FBIH 1RPQA 2YS4A 5DD5H 5C0JB 4YHNB 2ICEA 1QNZH 3PDDA 5CILH 4KVNH 2HMID 4HX1A 3O8XD 4A6YL 5E99L 1JZ5A 3QFJD 3MCG1 5KSUB 5IMLB 4LEXL 4JFXB 3NMEA 1DQLH 2IPTL 1EPFA 1RZ8B 3ZZ1A 4PRDB 4GOSA 3RDTD 4XC3L 4NHCL 2MQ3A 3K3QA 1JCKA 2E27H 3D3VB 1IAOA 5IB3B 2FWOA 4NDMB 3P9MB 2HVJA 2XY2A 3AREB 4HJGA 1U93B 4FABL 3MRRB 3LHPL 2HN7A 5C3TA 4J4PD 4PJDF 3CCHA 3LRSA 1AC6A 3DTXA 1KLFA 4LEOB 3MCKA 3EOYG 4MCZA 1J5OH 4OCRH 4UU9B 3S5LA 5C7XL 1EZVY 4ZD3H 4GQPH 1OSZA 4XTRD 5DUPH 4OZIE 5CEXA 1J1XL 4X0KA 4UDTB 4D2NA 3VH8G 5I16A 1A7QL 1AXSB 5CJ8A 4M02A 3CX5K 4K3GA 3VXSD 3W0WD 3S3JA 1BIHA 5E08H 1G9MH 3N85L 4XX1G 3DSFL 1EK3A 2FB4H 5BRZD 2W07A 3KPLB 1ZHBA 1DL7L 4PJIB 2NTSP 2V7NA 4HGWA 4MHHG 3IJYB 1U8NA 4JY5L 4MHHI 2VZ3A 4NBYB 2OSLA 1LO0H 5F7WC 3MLTB 3OKYA 5BVJB 1M4KA 3DVGA 3SCMD 4Y2DD 2X44D 3BW9B 2YZ8A 2GJ6D 3MRMA 4WJ5A 1AGCB 2OXHA 3KLAB 3LRGA 4U0QB 4R4ND 3HC0B 3VXRA 1OQOA 4DGYH 1QLFA 4WIQA 2RCSL 3CPLA 4WTZG 2XN9A 4XGZA 5GJSL 4BSWB 4QEGA 5CBAB 5AG8A 4OLWL 3UTTE 3FHQA 5EIIA 1YMHA 4JG0L 1F90H 2HTKD 2CRYA 4JFEB 1HINH 3QUKB 2VDRH 4R0LA 2FJFA 2XKNA 2NZIA 1U8QA 3QXWA 3U48A 1DBJL 5CSBA 1ACYL 2P42B 3SDAB 3U7AA 3IAGC 4MJ2A 1KEML 3HR5B 4AY0A 1KBGL 5TE7H 3BQUB 1SEQL 3SDCA 2YPLE 1XF2B 5CJXA 1BJ8A 1VFOA 2YD8A 3MRIA 1NMAH 3T65B 1YZZA 4KK6C 1W0VB 4AIOA 4U3CA 4NDMA 3QIUD 3HC3L 4X7EC 1YNTA 1JWSA 3VGAC 2V5MA 4Q6YA 5JHDB 4XWGL 5C0CE 5C70A 3VW3H 2F5BL 4PRPA 4HK3J 3QULB 1CR9H 2XQBH 1WIPA 4LVNB 1AXIB 3MLVH 1NGXB 3MCLH 4S1DC 3DWTA 5IP4A 4PJ5D 5AYUH 3QIUC 4N0UB 3VFVA 3HLAB 5DHYA 4LVNC 3ZKXB 4E0RA 1MRDL 3ROLB 1LVEA 3M8OH 3I75A 3WFBL 5HI5D 5C0JA 1B6UA 4Y4FC 4JFYA 5E1HB 3V0AC 1FO0L 3L3GA 5L7XH 1CDCA 5FO7A 1F6FB 3PXJA 3CVHA 3K2MC 3NA9L 4F15B 3I6KB 1LDSA 1ES0B 4ELKB 3DI3B 3QFJA 1A1MA 1GSMA 1N0LA 1WSST 2NY0B 4ZFFA 5I1KL 2CDFB 3MNVA 4R97C 2BJMH 5CD3B 3MLSH 3P9MA 2WUCL 1NSNH 2DWEA 4IMKC 2XT1B 3MBXL 1Q9WB 5D6DA 4UV7L 1K5NB 3MJ7B 1FFOA 4YHPA 3MRKA 3ZYJA 4LCWE 5MERA 1FO0H 4N0RA 5BRZE 2EZ0C 2LVEA 3FAWA 1DDHB 3CDGB 2VLJD 2A74A 1QFOA 3T0BA 2P5WD 2W0PA 1A7NL 2G5BB 4LCCB 2FZ3A 2X9XA 2NW2A 4HS6B 2XNAB 4NQTA 1UJTA 1SYVA 4P5TB 1I4FA 4R4FH 4UV4H 4YEFA 4G42B 1YC7A 3C60C 1JZ3A 5DK2A 5FHAH 5C0AE 4JHAL 3GMNB 1JNNH 5EG6C 3C2AL 4FQIH 3SDCC 4M7JL 4K7PX 2DQTH 5K9KB 2DLHA 5JHLL 1BBDL 2W91A 1EEUA 3SCMB 1ZAGA 3RWFA 4I3SL 2IPUK 4NJAH 7FABH 1GGIL 3T8XB 1OLZA 3O81A 4OGAD 4OZFG 3MRPB 4M9OA 1OAUL 4QHUA 5EO0B 4JHAH 2K3TA 3WD5H 5HSFA 5KSAA 2DLFH 2E9JA 5D5MA 3NCJL 1QBAA 5BXFA 3EYOA 3T1FB 3SJVD 4KTEL 4H5SA 2P45B 5DRZA 2B4CL 1MFBH 5ERWA 2IPKA 5JTWA 4GKOA 4KKCC 4OZHB 4CMHB 2EEDA 4NM4L 3VDAA 1WZMA 1SBSH 2X9WA 3MGTB 3W0WB 3U9UA 1OGAB 3SOBL 4HUXB 1R5VA 4U6YA 3ZE0E 4EOWH 3GSNH 3KPQA 1NCAL 3U30B 4P9HH 4PJHE 5C2UB 4PRAB 2ZKHH 5MI0B 1VEOA 3RVTC 3W9DB 1Q9OA 3T8XA 2W0FA 3ARFA 1FFNB 1X5AA 2VXSL 2XZQH 1ZT1A 3BHBA 4APQA 2FB4L 1HYRC 5C8JB 1WV7T 32C2A 1AIFB 1C7TA 4HS8L 4HWEL 5T33H 3WUZA 4CAGA 2GFBB 4KI5F 1NBQA 3KXFB 1MRDH 4F7CA 5I6XC 1YNKL 1WEJL 4PJBB 5ACZA 2DD8H 5J1SC 1UADC 1DQML 3WEXA 4L9LB 1Z9OA 3EYQD 3S34H 3TA3C 2OR9H 1A14L 1SJHB 4KRLB 3FQRB 3MXVL 4J3VA 4JM4L 2F74B 1D5MB 3NAAH 3VMOA 3NFSH 4GXUN 5HYSG 2BY0A 4XC3H 3M17B 5F6HI 1DUZA 3RWDA 4LHUD 4Q58C 1AY1H 4OI9A 1J0KA 3LMJH 2D31B 4CDHA 4GLRH 3V0VA 2JELL 1DQMH 4WI8A 4XNUH 1MHHA 3TT1L 1A7BA 5F70A 5DJAB 3K8MA 4IRSA 4IIQC 4FTVD 1ZSDB 4MWFA 1WICA 4PJEE 2ZCKH 4N9GA 3JWOH 4XP1H 3JWDL 5EU4B 1PD6A 1U3HB 4DWHA 4TNWK 4JJ5A 3UTSB 2GI7A 4HS8H 1CF8L 5BS0B 3JTSA 4MNGE 1I8KB 4R7DA 4WFEE 2X10A 1X5FA 3Q6FA 4FZEH 3WNOA 1BM3H 1FNFA 1T6VN 5D70H 2PW1B 3TYFB 4JZJC 5DZNA 3MOAH 4Z95H 1JNLL 5CUSH 1OOAA 3SDYH 3QZWB 4HC1H 5F7EL 3V0VB 3FB7B 5DFVC 1F4AA 1KJVB 3UC0L 1HXMA 4DW2L 2P5WE 1H5BB 1OCWL 5DEGA 1GZQA 2P43B 4NQSB 1OB1B 1YPZE 3SGKA 3D39A 4QNPE 2EICA 3MNVB 4JM2F 3JUZA 4TUKH 3VXSA 5CJQH 5GGQH 2VDML 5ABDE 2H6PA 3TH4T 1NAMA 2E9BA 4ORGA 5C92A 4MDJB 2CRZA 3GIZL 3KYNA 4P2QD 2DOCA 5D71L 3ZTNH 3R0NA 5LGHH 1M7IA 2DQGL 3S96A 3RIFF 5IJKA 2AV7A 5JXEC 3MUY1 3BFOA 1NFDF 2YC1B 5I1EH 3QNYB 5T1KD 5E0QA 4QXUL 3WIIL 5KS9E 4YHKH 5FGCB 3SE4A 3ZYZA 1CVRA 2R4SH 2XA8L 1MCNA 2EIBA 4MB3A 1ZLWK 4NHUA 3GI8L 4JY4B 4PJ9B 3G6AA 2Z4QA 3HPJA 1MJUH 4HXBL 1A1OA 3NFNB 1K2DA 2AJZB 3X3GL 1AGEB 4JG1H 5TDOB 4RFEB 1JP5A 4J6RH 3B8SA 3GZKA 3UPRA 1J0YA 1HILB 2VAAB 4L8SA 4WTWA 1I3VA 5DDHB 3MNZB 5FYKE 3DX6A 4OUUB 5HGHA 2F58L 1YC8A 5FM5O 5TE4H 3MLWL 3BD4A 2BMKA 4M7KH 5TF1H 1EUTA 2VZSA 3EOAB 3BSZL 3CVHH 4GG8B 4ETYA 3VXQB 4GG6A 1PKQE 3IFOA 1DUYB 2XZAL 1TTUA 2X4RA 3SPVB 4HFWA 4JHWL 4MCZB 3GDBA 4Q6IA 2ENSA 5B38G 4LHUB 4NQDE 3VXME 4MB4A 1FPTH 1CXLA 1HNGA 1LE5B 3K2UH 3V8CA 4OF7A 4WY7H 5F1NA 3RWHA 3T4YA 4I2XB 5DMIL 4FFZL 3OWEA 4HFUH 2JB5H 4F33B 3ZT7A 3SCMA 4PRDA 1IKFH 5I1IL 2KZWA 2F8XC 5D7SL 4H26A 4HWBH 5GJTL 4L4TA 3TJHD 1F8TL 3BT2H 4RFOL 1A6TA 4YDJA 2CKBB 1RIHH 3WIFB 35C8L 2I5YL 3D39D 5FHBH 5H94A 5I9QB 5JMRA 1BQUA 4S11A 1WBZA 5ALBL 4OQTH 2KZ1B 2W9DH 3U4EB 4BA8A 3C8KA 4NQDB 1WZKA 1Z9SA 5KVMC 5ESQA 2J8UF 4Z7UA 5I1LA 4A2MA 4HQQH 5GXBB 1JI2A 4JFEE 4YHNA 4F80A 3T3PE 4OZGE 1LD9A 3QUYD 4IRJA 2PXYC 2OMBA 4Y16C 3QQ4B 4G7YH 3O2VL 1V7MH 1MCHA 4GBXA 1KIRB 2C4FU 2OL3L 3DRQB 1UENA 4ZOCA 1LO3L 1T0MA 3RY4A 1LDPH 5H37G 4GKNB 2ZSVB 5HXMA 1Q1JH 4OLWH 1JPSL 5BW7C 3OSKA 3WS6A 5HDQL 3VMNA 3AU1A 5J4MA 3NN8A 3PP3H 3TWCH 4NRZB 5FO9B 4WI4A 5CP3A 1IAIM 2EXYC 3KG5A 5C09D 3TCXA 4DKDC 5D70L 5EFIA 1BFOB 3IXAA 3VXMD 2FIKA 2IQ9H 1JGEB 3ZKMD 5CIPA 4O9HL 4G9FA 3U2SB 3UPCA 4E0RB 4XVUC 2VXTL 4D9LL 3OXRA 3AMLA 5E8PB 5AAMA 1HOCA 2VZTA 1F3JA 1BZ9B 4W4NA 2ZNWA 1B88A 3RZWA 5EUOA 2Q1EA 4GG6F 1UZ6E 2Y6SD 3RWIA 1EERB 1BF8A 5T5FL 2XQYG 3IDGB 3I9GL 2X4OA 2I9LB 1II4E 1F2QA 3BVNA 1Q1JL 4FXLA 2NNAB 5ENWB 5D8JL 4IEFB 4XH2A 3VWKA 1T5XB 5B3JF 1P7KB 1IAKB 1KTRL 1T7ZA 2HRPH 2IH3B 3IJHA 1U8NB 2ZPKH 3HCVA 3X3FL 5IK3A 3EO0B 4WO4B 4WUKL 2J4WL 1W72H 4P23A 3QJHB 2YRLA 5KSAC 3DURA 5AUMA 4G9FB 3U2SA 1I9JH 2AEPH 2GITB 1QBLH 5IMOA 4ZOBA 1MFDL 3VI4E 4Y2DC 1C1EL 4FXGB 4XPHL 3H7BA 1SJXA 4H1LG 4YPJA 1RHHB 4F58L 1BP3B 3FN9A 1C12B 4UIKL 5F9JB 2JE8A 1MRCL 2RIKA 2XV6B 5CEZE 2QJDA 3E1F1 1QBLL 4OCXH 4X5XB 3N9GH 5KG9A 2ZJSL 3KXFE 3QDMD 2DMBA 3LDBC 2DL9A 4WW1A 3BXNA 3P9WB 1YQVL 5FA4B 4WUKH 5CEYA 3RWHB 5AAWA 3BP5B 4ZODA 1KIRA 2OJZH 2OZ4A 4MVBC 1J0JA 3RWIB 4JY4A 4N9OB 4PJ9A 1IAIL 5SX5K 3TO4D 3HRZB 4P4KC 5D5MF 5D96C 1P4IH 3QFJE 4G5ZH 1M6OB 4RMUA 3KPRD 4OFKA 1WUNT 3QNZA 3QUYA 4OFVA 5CGTA 1CFBA 5D1QA 2FGWL 3PGFL 1NCUA 4GBXD 3BWAA 1ADQA 2NMSA 4KJPC 4PJEF 3EYUL 4Y88A 3QP3A 4NQCA 4OFYD 2CRIA 3O2DA 2WBJB 2XYCA 3AUVA 3VXMA 4L4VE 4MX7B 3WFEH 1HH6A 4IOIA 5E6YA 5ACMA 3SQOH 5I0DA 4WHYH 3BPLC 4LMQE 4P2OA 5KJRL 4XP4L 3VGEA 4GW5A 4HIXL 5EU3A 5IV2A 1WWAX 1AHWC 4OLVL 1FFNA 1LMKA 3U0PA 3B5TA 4LPXA 5I18H 1NC2A 2E8YA 5D7IF 5DMYA 1CLZH 1Z3GH 3IVKA 1B0GA 2Z31D 4ZPVB 4GW1A 4KAQH 4P3DA 3RPIA 4LSPH 4WWKC 1SEBB 5HHOA 1T66C 1EHLH 4F2MA 4FP8H 4LOUD 5J1TC 3N0PB 4NN6B 3UJIH 3OV6A 4ZUSA 2EDFA 1KN2L 5J7CC 5DMGD 3MGOB 5JNYA 1QFUL 3NA4A 3OQ3B 4RBPH 3K4ZA 1OAYH 4XZUA 2E7MA 2A73A 1FSKB 4PGDB 1QRNE 3JWOC 4XCYA 3ZTJH 3CIQA 5EOCJ 2AQ1A 4LKCA 5J6HB 3CDCA 2X40A 1U8MB 3ZE1F 3QEQA 3MROB 5KSBF 4U1LB 3HZVB 4YHZH 4DKAA 1N4XL 1JMZA 2V9TA 2YK1L 3P40A 1A3LH 4UTBH 4MJ6B 1UKQA 4ZUWA 5FKPB 5IVOA 3UC0H 4S1SH 4ZFOA 4JKMA 1LNUA 1TZGH 3QCTH 4AZ8A 3ME0A 2IANE 3C08L 4F3FB 1K8IB 3MV01 4YHLH 4Z95L 2NXZD 1L0YA 1QSFB 2UY6A 3T4AA 2VSDA 3MLSL 3PWJB 3T0EC 1TITA 2AXFA 4JO3L 1AGDB 5E95B 1VDGA 3KR3H 4JQIH 3UO1H 4TOYL 4PGJA 2BOBB 3MJ9L 4HIJB 1LGVA 2GY7B 5ANMB 4Q7DA 5BV7L 4LPCA 1CF8H 5ADPH 4U49A 4X8XA 3BRGC 3L3HB 4AG4H 3JWDH 2VLKD 1RI8A 4O51A 4Z7QE 4JR9H 3V4UH 4M7LL 2Z31B 1T0NA 5E4EB 5BW7A 1BOGB 2P4AB 1T3FA 5HGAB 1SVZA 3QUXC 3LN9A 3I6LD 4OGAC 4JJHA 4JZOB 1J8HD 3H9SA 5DWUH 5IG7B 4KU1A 1I85A 2KQMA 5EO1A 4WWKA 2JIXA 5FIEA 4EN3D 4JG1L 4U2ZA 1EJOL 2CSPA 1A1NB 1RK0A 1UM4L 1P5UA 4F58H 2ZCHL 1MEXH 2A38A 2VDLH 1EGJH 4YX2L 1ACYH 3OZ9L 4Z7VA 1JIBA 1HZHL 5IBLC 1HHIA 2DYPA 1GPOL 1MQKH 3LN4A 4UT6L 3W11D 2DQGH 2YRZA 4MJIE 1Q9KA 4Z77B 2GTZA 2DQEL 3VDBA 5F88B 3EYVA 2C5DC 2QQKH 2VH5L 5ICZA 1TVHB 4N0UE 3RHWK 2RCSH 4FQCH 4UBDC 1I3GH 1UB5B 3DSNA 5J9PA 1X5JA 2IG2L 1BZQK 4H8WL 2OJEB 3U79A 2X4OB 1QD0A 4X6FA 2VQ1B 3OKKA 4UT7H 5ACZB 1CFTB 1NAMH 1NGYB 1D9KC 3ALXA 4OM1L 5M7QA 4Y2DA 5F7EH 1T0PB 2R2BB 4NQED 1JNLH 3MOAL 1SM3H 3ZDYE 4F7TB 1NCAH 1ZS8A 2RHEA 2YSSA 4MAYB 2EXWC 4ZUUA 3DV6A 5H8DA 1TZHB 1X5GA 3VJ6B 1F13A 5DRZB 1Q0YH 3E6HA 4ZNCD 5E7BA 5DS8A 3CSBA 4HIIA 4QHNA 2NY5H 3BRDA 4Q9CA 4EUPG 1WGOA 2X89A 4UZGA 4CMMB 4XNQB 3RVWC 3MRKB 3PP4L 3V6OC 3U1SL 3HE7B 4HC1A 1U8MA 4JPIA 4FQPA 2FHFA 2BNRB 1AI1L 4W4OA 3JVGC 5HI4D 3KPQB 4XMKL 1H3PL 1HH6B 4IOIB 1GPOH 4P46B 1R0AL 3P77B 3WDJA 3FO2B 2CR6A 1KIPB 3EGSA 5D1ZD 4G8GD 3PWNB 2YA2A 1DZBA 1OPGH 1NMBH 1JFQL 2WINB 1JL8A 1WBXA 2Z91B 5DJYA 1AGFB 4JPWL 1G6RL 4UNTA 1JF1A 3GJFB 1FDLL 2ATKB 5CLWA 3OR6B 3S88H 3H42L 5JDJA 3FOMB 2V9QA 4PY7A 3SO3C 5LQBH 1SYSA 3JVGA 4OQTL 3PWUB 1QSED 1U58A 2PR4H 1M7DA 2CLRB 3MODL 3WIHH 1G7JA 2OL3A 5GGVY 5BS0E 3C9NA 5IVZB 3V4UL 1EDQA 5D93C 5E94A 1D7FA 3PGDA 3MRJB 1UZ8B 4KHTL 4PR5A 1NFIA 4JFFE 4PJFE 3F5WA 4YBLB 5C0DB 1IVLA 1DTUA 1JTPA 2Y23A 4Y4FB 4TULH 4AEIL 4BSVB 3RKPA 1D9KA 1DR9A 3NCCB 3UYPA 2DMKA 4FQXC 3RL1A 4ENEC 4D0BA 3VWKC 3IDIB 5EIIB 4G8FA 1GZPB 4PBVC 5CAYB 1CFSA 3V4VL 3W0WE 3LKNB 1F00I 1FN4A 1ZANH 2GT9B 3CSPA 4ODSL 5L8KB 5DT1L 4CU8A 1W2KT 4WO4D 1PKOA 1IZKA 1CQKA 3D2UB 3NFPB 3W5MA 4AMKL 1MHCB 1VFAB 1K8IA 4EI6B 4JPVH 3V5DA 3ET9F 1I9EA 3M8OL 4DCQA 4M7KL 1DBAH 3MLTA 1G0DA 4YHZL 3FQXA 1MF2L 3RIAK 1J1PH 2MQCA 1U93A 4LU5H 3KPNB 4FQJL 3NIGF 5I8KH 1NUDA 3C60B 4U1NA 3CCHB 3LRSB 2F53D 3ZMRA 3FQWB 3AXLA 4IDJH 3HAEB 1YY8A 5T3ZE 5HY9B 5E9DA 3C9NB 3RY5A 1RQ5A 3WJLC 3GSRB 4H88H 1TJGH 2CUMA 4QXWA 5B39A 4H20L 3HTLX 4IRJB 2CO7B 5I8EB 3U83A 1ZT7B 2C9AA 4KKAC 4NJAL 1SEQH 1HOCB 7FABL 4DZ8B 5I8CB 2IJ0C 4F8QA 1KJMB 3QEUA 3C5ZC 4XC1H 4M5ZH 4WFED 4GG6B 4G8GA 1U3JA 1SYVB 5EU6D 1U8LA 5I74B 4NPYB 4WDIB 4H26B 1CGYA 5ISZE 3L6FB 1IBGL 2XFXA 2AGJL 4H20H 1A9BA 1RZJC 4CRPA 4O2FA 4NZDA 5J6GB 5KZCB 1GZPA 3M1BA 3TPUA 2QL1A 5DRXB 1A9EA 2DQJL 3HCVB 4QLRA 1KTLA 1KTKE 4CNIA 4KMLB 2NYYD 3FQWA 3RIAF 3QUMH 1EBPA 4P48A 4HUUB 5GGRB 3WFEL 3P0GB 3I6GA 5GRUL 4PRHD 1KXTB 3A6BH 3ARRA 3KPTA 3QA3A 1CYGA 1LO2H 4KJQC 3QIBC 1ETZB 1JTOA 1BF2A 1F3JB 1W0WB 3R1GH 4PJXA 3H0TB 4UIMA 3NGBC 3O45A 1I8LC 4YDKH 4POUB 4HUWA 3QCUH 4LMQI 3WFHB 1NAKH 1A9BB 2EE3A 2H1PH 4L3EE 3C09C 3ZDYF 2Y5TA 2BY1A 2R56L 2VC2L 5D1QD 5F7DA 1SJEB 1FQ9C 3QAZC 3F6IA 4E42B 1WVZA 4KXZH 5JW4N 1RZKH 1WQVT 3KGRA 3VMPA 3BGMB 4DZ8A 5I8CA 2NLJA 4WO4A 4X80L 4YFDB 4TVSa 5D9SB 1EHNA 1QEWB 1EAPB 4NRYB 3NPSB 3SHSA 2XWJB 3VXUA 2E7LC 3WMSA 5MEQA 2FX8L 3AY4A 3SKNB 1AKJA 1I7ZA 4XCEB 1YQ2A 2R29L 3ARFC 4YQXH 3UJTL 4FFYH 1BMGA 4J4PA 3L3IA 4R90H 4UIKH 3E2HB 3ZL4L 5I75B 3F12B 1CFVL 4ODTH 4NFCA 3MLZH 3RZCB 8FABA 2NXYC 4LLQA 3H42H 4GRLC 1G7PB 1A47A 4K3EL 1DLHB 2Z93B 4N5EC 3FFCB 1W72A 3O3DA 1OSZB 5IUSA 4L4TD 5HPMA 3ULUL 5D7IA 1CFVH 4ODTL 1I8MA 4XB8A 2F53E 4LSSH 2ZPKL 4NKMA 5IMMB 3I6LE 5I15H 2FBJH 5F8RC 5D8JH 1MI5D 4YE4H 1YNKH 3J7HA 1INQA 5HI5C 2EDEA 4JDTL 4EBQL 3KYAA 4RAHA 4NQSA 4QTHB 5FYLH 4MGXA 4JM2B 1TETL 4RX4D 3UPRB 4QHMB 2BDNL 2FYYB 1HILA 1K8DB 5GZOD 1KN4L 4AT6A 3MJ8B 2NR6C 4D94A 5GGTH 3FQNA 5DI8B 3DVFA 1Q0YL 1UJ3A 1T20A 2D7TH 1QPXA 4TOYH 3PQYA 5J1AB 3RKDC 4KZEH 1NCBL 3R0MA 3DX8A 4LLDA 2NY0C 5FKAB 5KVGH 5E56A 4JKKA 1QBMH 2BC4B 2DF3A 2Y6SC 2VO5A 5DTFA 1QR1A 2R0LL 2LE9A 3VD7A 5CZVL 4PREA 4WEBL 1PZ5B 1QSZA 5JDSA 2ZWLT 2J8HA 4X5LA 2HT4D 5B4MD 1RK1A 3K1DA 3IETB 1K3ZA 5F89A 1FN4B 1GAFH 5BZWA 4ZFOB 2QHRL 2HTKC 5HGBB 1FRGH 5FYKH 4HUVB 3SKUD 3I3DA 3TLRA 1EFXA 5BCAA 4R96B 4L4VB 1FV1A 2EO9A 1ORSA 3VWJA 5DGRA 4LASL 5DUPL 4OUUA 1UM5H 4HAFA 3BHBB 3D3VE 4R4NC 4LHJB 4DKFL 1HEZA 3LEXB 4V2BA 1P9MA 1MQKL 1QFWM 1T89A 3TPKA 2E9IA 4KQ3H 1BX2B 5D2NB 1BOGA 1MLBA 1JGLL 3AM8A 1NDMB 4OT1L 4DK6A 3EOTH 2DQTL 4M7ZC 4YBQD 1FORH 2ZUUA 3IDXH 3JV6A 1VFMA 1OAZL 1F02I 2GJJA 3HI1B 5CGYC 5F7UA 2VITA 3X13B 3H9YA 1B0RA 3MRLB 3O4OB 4R7NA 2VIRA 4NHCH 3D85A 4K7FB 4TQEL 5DJXA 3V4PH 1NGYA 3C6LD 3CZJA 4PRBA 1RIVL 4P3DB 1NKOA 3EGSB 3L5JA 3RPIB 5C3LD 1YEJH 4JANA 4N8PA 5JXEA 4ZS6C 2VJXA 5DJYB 1ROWA 4O58H 4G8GE 1KEGL 1U3HD 3PWJA 1FC1A 4DKEL 1IC5H 1H3WM 5TDOA 3TNNA 4OAWA 3Q6GL 1BX2A 1VKXB 1GOGA 2NXZC 3F62A 1G7LA 4E41B 4WFFE 1G6VK 5ADPL 3GB7A 4Y5XB 4UOW0 4HH9A 1JPFB 2EE9A 5GSVA 3QPXL 3OG6B 4U1KB 3TV3H 1VGKA 3PIQA 4BFIA 3EO1B 1V7NL 4NO5B 3GSNA 4MD4A 1R5VB 25C8L 1IM9B 1KEGH 1D9KD 1JPTH 3VFWB 1I1YA 5EO9B 1J7VR 3T0EE 3T2OA 5EBLA 2JIXB 4XMLL 5DVNA 1QA9A 4XCFL 2CRMA 3VFMB 4Z76B 1S8DA 4LVEA 1CN4A 1NCDH 1I9IL 1G7LB 1MJJA 1RUQL 4K94L 3T77A 2XQBL 3QIWA 1AIFA 3GI8H 4JRYE 2DQUL 4I0PB 4HIHB 3MC0A 2R4SL 1CS6A 4N1CA 2Q8AH 4CVZA 1QFUH 1EIBA 3G08B 4Y4HC 1CL7I 1KN2H 1K4CA 1MCRA 1NFDB 4MX7A 1MH5B 3RUGB 4LGPB 1S7QA 2H41A 4FQ1H 1EO8H 4YNYA 5FGSA 1A7OL 3BUTA 2W65A 5DJZB 5IR1A 2BY3A 3QDJD 4KZDH 4X7SL 5IB1A 1KPVB 4UILL 1YMHB 3NH7L 3TF7C 4KQ4L 2CKBH 1T80A 1ORQA 4KROC 3IDNA 4KK5C 3B9DA 5DEFB 3V6ZB 4DZBA 4XHJC 4PGZA 4B5EA 2FJGB 4PPTA 2H3NB 3VFUA 3MRGA 1Q72H 2XOTA 3MUJA 2BSRB 1HCFX 3MOQA 4PJ5B 2Q7YA 1CGXA 4I18C 3GSUB 1ORSB 4Z7OF 2AJSL 1UCBL 3MZTA 4HXAL 4LCWA 1Q9KB 3RX7A 3NIFE 5IBUG 3RA7H 2OLDA 4YWGH 4X4YB 4EUPA 3VFPB 4P57B 1YA5A 5D1XA 1UM6L 1KT2B 2KBGA 2PTTB 3T2NH 1EZVX 1OF2A 2ADGB 3BIBX 3W0WA 1C8PA 4P2QE 3GM0A 2Q76B 1VGKB 3PIQB 3HNTL 4BSJA 3B83A 4QGYA 4YE4L 2WV3A 2UVFA 4UUJA 3FRUB 4G6JL 3MV8A 1HKLH 1D3CA 4TVPD 4L8DB 5CEZH 2AI0H 5C0CB 2HT3D 4X0KB 3RWGA 2XKUA 2UWEB 4PP2B 1OTSD 3C5SB 5FA3B 2A83B 3SGKC 2EE6A 4M8QA 1XF2A 4MQSB 2ITCA 5JLZB 4Y19D 1U8JA 4HJ0C 5E24E 3TBSA 4UAOB 3TA3D 5E8NB 4I3RL 2DJSA 4PGCB 3OJDA 4XX1E 3DRTB 5ANME 1AR2A 1VEPA 3F7YA 1OWRM 2EH8H 1MCDA 3RI5F 3VRJB 5F7KC 1UACL 4YX2H 2UZIL 3CMOH 2ARWA 3HPLB 5ALBH 4LCUA 2BCKB 4R4BB 3UJTH 4XRCA 5IIEB 4OD2B 4NQXB 2AJ3B 2HG5A 3H8NA 4NQCB 4I3RH 4M5YH 4URTB 3MQIA 2H26B 3L3DA 2R23B 2FX8H 2NY0D 4EN3A 5F7FA 3PDOA 3VXMB 4JFYB 3L95B 5FO7B 1F4YL 4I9WD 4MJ5B 5CS7A 2J4WH 4WJ5B 4KVCH 2AS5M 4WW2C 1KGCE 2B0SL 4OLXL 5TGBB 1FE8H 1QR1B 8FABB 4HFUL 3RZCA 1AP2A 4ZG1A 1RV6X 3ULVC 3HI1A 3RWCB 5EORL 2YD6A 4KPHL 2A6JA 2R56H 2VC2H 4OB5L 5E6ZA 2C3VA 3VRLE 1GGTA 2DWEB 1UM6H 4P0DA 5TH2B 5KOMC 1YEGL 4MQXC 1MAMH 3DRQA 3U6RA 2D7QA 1KTLB 4CNIB 5HYJD 5MERB 3D6GA 2ERJB 3SN6N 1EAPA 1ZTXL 3U36A 4GKNA 5LKNA 4BZ1L 4JQIL 4UBDD 3LKSA 4FTVE 3RNQA 4WV1B 1HK6A 5KSBE 3M1BB 4P2CG 2G60L 3T04D 5IMKB 1NMCB 3GMRA 1P4BH 4YEEA 2VZOA 3DO7A 3V2AR 3HI5L 3U4EA 1Q72L 1KB5A 4S1SL 4PRPE 5IEKA 3B9KD 1EUUA 3BRFA 3ILQD 1JPSH 4XB7A 2EIZB 3MV7D 3RVVC 1DN2A 1CDYA 1FC2D 4HSQA 5JIHA 3PDOB 2P5ED 3X3GH 2NX5A 4CUCA 3MRMB 1IGFL 3QBTB 3U6RB 2EDDA 4S1QH 5ITBL 1PX4A 1YYML 1A2YB 2R9HD 2X41A 1S7SB 2IANA 4KHXH 3TFKC 4M7JH 4PRID 1D9KB 5E2WH 4EDXB 1U91B 2AJXH 1TJIL 1RMFH 1OT2A 4NZRL 5CCKL 1G6RA 3ZTNL 9CGTA 4PGCA 2FWOB 5IGXL 3BGMA 3GMNA 1Q0XH 1U3ZA 3ILPB 3CZFB 3ULSB 1AO7A 2OBGA 1RIUL 1PEWA 4JFFB 4DTGH 2DQUH 4S1QL 4LPYA 4K3JH 1SY6L 4LIQH 4UTAH 2O5XH 1CLZL 1Z3GL 4ZAKA 4K94H 5FOJA 5JORA 1NFDE 2DBLL 5D2LF 4BH7B 4Y5YC 4KFZC 3GMQB 4YHYC 1UXSB 3Q1SH 4IIQB 4J1UA 5CEXB 4BZYA 4NUGH 4AK1A 1SY6A 2X1WL 1U9KA 5CKAA 4KUCD 1IQDB 3GI9H 1Z9MA 4HUWB 3O6FD 4HKZB 1OP5H 4Z6AT 5JW5A 2VWEC 4ODSH 3L3OB 1OARH 3BD5A 4RX4A 5JUEH 1BFVH 1LEKB 4ZO6A 4OUOA 4Y5VC 5E9DB 4MNHA 1J10A 1R6VA 2ICWJ 2JJSC 2GSGB 5AWNL 4KDVA 2IBZX 3WDHA 2VLKA 3G5XA 1H15B 4ISVA 1UG9A 3P30H 5TH2A 1M7DB 3ARWA 2FGWH 2QSVA 3WNNA 3UBXG 4DOHE 3MV9B 3O3EA 1KN4H 3N1GC 4HMEA 5JORB 4H25A 2D7PA 1U8LB 5ICYB 3D69A 2MMXA 3RZCD 1T1XA 4HJJH 1UXSA 1AD0B 1A5FH 4KKBD 3MJGX 2UZXB 4UQ3B 3CC5A 4K8RC 5CZXD 5GIRA 1QLFB 4H0IA 5BMFH 3RL1B 5A2FA 5E5MA 1I8IA 2EYRA 2PN5A 1X4ZA 1EJ6A 1ERNA 3CNKA 3QDGB 4QHLB 1NDGB 2OJEA 1F2XK 4PJGA 4Y5XC 3WE6A 2ZOLB 1RZFL 1T1YA 3BDBA 4E41D 3GMPB 2Q20A 3T4YB 4ONGL 5FF6A 3INUH 1CU4H 3EJZD 1JFQH 2ADJB 3MRGB 2XXCB 3BEWB 4N1EA 4HHAA 2MWCA 4PP2A 3WNMA 4XCNB 5EC2B 3D0LA 3VXSE 1RU9H 5GZNC 2X5PA 4F57L 1E27B 4DKFH 5J11C 1MJJB 3QG6A 5GS2D 1U6AH 2HVJB 2BHYA 2K1MA 1UWGH 5GQBA 5T33L 1QPPA 3JTSB 3QDAA 1SYSB 2FHCA 1A02N 5GGQL 1CFQA 1JHKH 4ZUVA 5D7JB 1HHIB 1J88A 5IHZB 4OZGF 4NM8L 2XZCH 1V3LA 1KELL 2G5RA 2P8PA 1A4JA 3EDFA 1MI5B 3OJMB 5DJAA 4IMKA 2XTJC 4F7PA 5C0FB 5KTEL 1FHGA 4QRPB 4NKIH 3L3JB 3F5WB 2Q3ZA 4YUEH 3L7FB 5HHPA 4KRMB 1HXMB 1RVFH 1A1OB 3LQAC 5FOBA 1E4WL 1F97A 4ETQB 5TDNA 5D2NC 4AENB 3QO0A 3L9RA 1TQCB 2NY6C 5B3NA 5E8NA 3WNLA 1GJIA 4PRHA 2AJSH 2IMNA 1VA9A 3QDJA 2GTWA 1ZHKA 3GBNL 2PKDA 2YD3A 5C71A 4NO3A 3TBYA 3DJ9A 3SKMB 4YBLC 1AO7D 2DQJH 1KG0A 5FV1L 3JV4B 4L1DA 3KPRA 1CFNB 5J3HC 5D7LE 1PDKA 3VXRD 4FG6D 1E4KC 5I66B 2BNQB 3HI6L 3S36H 4RMWA 4HWUA 1ZSDA 1LO3H 3CFCL 5IVXE 2W65B 5GRVL 4Y5XA 4QT5B 3BKCL 3JTTB 3BKYH 2VXQL 4MJID 3LB6C 4ZSOE 1G7IA 3BJ91 2BFVH 4LSDA 4LAQL 3V7MA 4DGVH 3KXFA 1ZWIB 3VD4A 2XXMB 2ZOKB 2JJTC 3IKCA 1ZV5A 2HJLA 3L5WA 1TZIA 3KJ4C 2A6DA 1FL5A 1LP9B 4HD9A 1CDUA 1KTDA 5K9KA 1UH4A 3O4LA 5IBUB 2ID5A 4JE4B 5DYOA 3FFCE 4M1GH 4Z76A 2VLJA 2W0FB 4NQEA 2NY7H 3GJFA 3ORJA 3OAYH 1AGDA 4C56A 4ZFZA 3UYOD 3HKFA 5DVLA 3V9FA 1JUFB 1IKFL 5I1IH 3RDTC 3D0VB 4X4YA 4DAGL 3CJJA 4LLMA 2PXYA 5GZOC 5IR1B 3ZKSD 4Z7VF 1FCCA 2E7HA 1KT2A 1IILE 5F21B 3HMWL 4I0CC 5DC0A 4I9WE 5DT1H 5I1KH 5AWNH 3IFLH 4I18B 2JB6B 3E2HC 3IS0X 4JO3H 2FSEB 4M7LT 2X1XR 3UTOA 5I75C 1AFVL 3RX5A 1E6JL 5EIQA 2M26A 5IBTL 4QT5A 4B7LA 5K59E 4U33A 1L0QA 1KPRA 1S9XA 5H2BA 4H1LH 3K8LA 1FIGH 2ITCB 3KPPA 1B2WH 1U2HA 5GRUH 2FJGA 4M3JA 5B38A 4J7RA 2V2TB 1WFUA 5F96H 1TZHA 3OBAA 2E6JA 5D1QB 3S97C 3THMH 1QQDA 3I3BA 1GYAA 1A64A 3BIAX 5DD6A 3IF1A 1ZS8B 3FT3B 2R4RH 1I3UA 2P5WB 1IQWH 1J05A 5F7HA 3PDGA 3S4SB 4NO5A 1DDHA 1FNSL 3VFTB 3PNWA 4WFHE 3P4LA 5GHWL 5C0AA 1ZHLA 2CPCA 3STZA 1CDJA 3RGHA 3QEHB 2YBRA 1AR1D 1WCBB 2UYLB 4X6CB 1YYMH 5EBWA 1E4XI 4GT7A 3BESR 1XH3A 2B1AH 3QRGH 3VWJD 3P4NB 1QZ1A 4LLAA 4U1LA 3MLXL 3BP4A 5LGHL 4ZXBD 5IHUL 3AM8C 2R4RL 4HKXB 2H3NA 3VFUB 4WWID 5J8OA 2R0ZL 4HV8B 3CFJB 2CH8A 1P53A 5J0BA 1A1NA 1RK0B 4CJ0A 1DBMH 2NY5L 3FT3A 5HYSA 4K07A 2VR5A 5GS0L 5KVFH 4H8WC 1A1MB 1R5WB 2H32B 5B4MC 1NCCL 1KG0B 2GCYA 4L4TE 1ODAA 4YPGB 5C08E 3JV4A 3SE8L 5DC4B 2LV4A 4IRSB 3BWUC 2IAMA 3QHFH 1PVHA 1U92B 5DJDB 2B5IC 5I73B 3VA6A 5MHSD 1LHZA 3GBML 5F6IB 5IBTH 3V6BR 4QRUB 3U30C 4Y19B 5C6TL 3FQNB 1KJ2B 1E6OL 3CGTA 4OJFH 1NCBH 4NJ9L 4XVUD 3PQYB 4AQ1B 2QEJA 4KPHH 4OIAA 3BQUD 3T0VA 2A77H 5IJKC 3QEHA 3CFIC 1AJ7L 3TT3L 3D25B 2B0SH 3HZYA 3QUMB 2WQ8A 5EZJB 5I6XB 1DCLA 4G6FD 5TFSL 1IGCH 2B1HH 5DK2B 4KHTH 5IVXF 3WS3B 3HC4L 4NZUH 1BD2D 2P49B 3UTQB 2Y5TB 1V3KA 1BIIB 1PZ5A 4Y2OA 1E4XL 1U95B 4ZAKC 1RU9L 3IGAA 3ZHLA 2XG4A 2V2TA 1F4WL 4PV8B 3U4BL 1LP9E 4P59H 2IALB 1UACH 4PRPB 4Y5YA 2DYPD 4NZTL 3FONB 3WFCL 1IZJA 2GUOB 3FO0H 1MCQA 5T5NG 2GJ6B 2MPAH 3GMMA 3LN5B 3ETBF 3FTGA 4TNWF 4TVPE 1PAMA 1I9JL 5BV7C 1RZIA 4NO0D 5DZOA 3BKJL 3UTTA 3ESUF 2VXVH 5CLTA 4P59L 5GGSY 3MRRA 2OTUA 3AY4C 3BKCH 2XTJE 5E99H 1OHQA 3FB5B 4KVNL 1ES0A 4ELKA 5B22A 1E4XH 5TDNB 5HGGS 4JGMA 1QRKA 2OS7A 5D72L 1MNUH 3QNZB 1VPOH 3IJYA 2ZCLH 3KS0J 1EVTC 4JFFA 5FYKD 4MYWB 2BY2A 1VFAA 2YN5A 3CFEB 2J5LB 4BYHA 3CVIL 1FNHA 4HLZG 1ITCA 3DMMD 2B7DT 2IQ9L 3BDYH 4HXAH 3G5ZA 2YD1A 1YNTB 3VG0L 5DD1H 3NN8B 3C08H 4PS4H 4PLOB 4YUEL 2HYMA 3GI9L 2J7LA 4ZOEA 3TWCL 2HN7B 1P1ZB 5FECA 4MSWB 1FYTB 1MFCL 4KWUA 1I1AB 1G9NL 3L3OA 2C7UA 3FTGB 3N85H 4FQLL 1WC7B 3RU8L 2DS4A 4YR6A 1MAJA 1RUPH 3KPSD 4M6OH 2OXGA 5MHSE 1TTFA 4KK8D 1QR4A 4ZXBA 5IF0B 1TJHL 1MRFH 1EEZA 2CGRH 4NKMB 4WUUA 4Y4KB 3UAJD 5IMMA 5DA4A 2R8SH 2KDGA 1CICB 3TA3A 5FUCC 2F8VA 2VLRD 1DEEB 2DQCL 4LSVH 4NZRH 4U6XA 1OD7A 1M71B 2AJXL 4KTYA 1F3DJ 3WXVH 1IAKA 4CVUA 3U7WL 4PGEA 5E03A 1IFHL 1G84A 1ZEAH 4YFLI 2E8ZA 2W9DL 4ODXB 2ICES 5EPMA 4P2OD 3MJ9A 3WN5C 3VXTB 1YY8B 5JA9A 4CN6A 3WS6C 5CHNA 2X4TB 4NN5B 1EMTH 4LBEA 5JIIA 1AKJB 3EDDA 3QI9C 5HVFB 5CP7A 2OM5A 3HG1B 4GMSL 3GMOA 4ZS7H 1WZ1H 4YDLB 4IHOB 2WLYA 1OGTB 1RZJH 5A43C 5GGVH 4OQTA 5GRXG 4TNVK 1MF2H 5I1CL 3LIZH 1B2WL 7CGTA 4JFDE 4HZAA 2BXZA 1X5LA 4PJIE 3FHAA 1EH9A 3NGBB 5A16B 1U95A