4QXGH

Antigen binding fragment of an anti ifnar1 antibody
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
218
structure length
218
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYIFTNYWIAWVRQMPGKGLESMGIIYPGDSDIRYSPSFQGQVTISADKSITTAYLQWSSLKASDTAMYYCARHDIEGFDYWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab, heavy chain, IgG1
publication title Molecular basis for antagonistic activity of anifrolumab, an anti-interferon-alpha receptor 1 antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2014-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qxgH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qxgH01
3MA9H 4DQOH 5DWUL 2B5IB 1XF4B 1ZVSA 2Q3ZA 2R0LH 4YGVA 3U4BL 2R8SH 2KZWA 1XZ0A 4GW4A 1EBAA 4IOSD 5IKCA 4OV5B 1UACH 4YWGL 4XP1H 4KI5E 4ZXBD 4CJ0A 4WI2A 4M3JA 4QY8B 3O0RL 3DETC 3S3JA 2NXYB 4DN3L 2O61B 2Y23A 3RWEB 4KGJA 2E27L 2V17L 1XR9B 2OSLB 2GTWB 4NJAH 5TDPB 4EEEA 4IEFB 4OF6A 3GK8H 2GIYA 2I27N 4JJ5A 4YUEH 4TUKL 4ZYKB 4P2RE 3UPRB 2Y72A 1Z3GL 3VXNB 3I84A 2ADIB 5B38B 1C8PA 1ONQB 5I1CH 1H0DB 2ZZUT 4NUJB 4FQXB 1V7NH 5DXWA 3R1GH 1KN2H 2QJDA 2XTLA 1PKQA 4MD4A 1BZ7B 3EO1A 1ZS8B 4KKBC 3QDJB 3RVWD 5T3XE 3FB7B 1PKOA 2IAND 5DK0A 1FPTH 3MCKA 1V7MH 3HKFA 5D7KE 4MSWA 2X4SA 4FOMA 4MD5B 3MR9A 1FH5H 4H0HB 4NP4H 4MWFB 3ABZA 3N06B 3KDMB 4KQ4L 1UWXH 5EORH 1SEQH 4PGZA 1ORQB 5DRXB 2B20A 5J12C 1DEEB 4C83B 1R3KA 3TN0C 3CLEL 4A6YB 2XWJA 4AK1A 1NAMB 2M2DA 3MV11 2XYCA 3TO4C 4Y5VC 1UM5L 4JQVA 4Y4FA 2P4AB 3L3KB 3VI4F 1E4JA 4PJAA 1G6RL 4Z8FL 1CFTA 1EMTL 4W6XB 3KWWB 1OD7A 4HFWB 3X17A 5IHZA 5DEGA 1ZHBB 4GJTB 3SGEH 3L3HB 3MMEA 1WJ3A 1G7QA 1DVFA 3U0TB 1XF2A 4OM1H 4UT6L 2D4FA 3H6JA 4KKNA 3ULUL 1OF2A 2B1HL 1NC4B 3FQXB 3QQ4B 2Q7NA 3KLHC 5DC4B 3C2AH 3O2DH 1MHEA 2VZSA 3BZDA 2GJJA 3ARDD 1S78D 1YNKL 4WI9A 4ZAKB 3ES6B 3SDXB 4Q58C 3J7HA 1ACYL 1G7IB 5GJTH 2VXQH 1JGUH 4P2QA 4ZTPL 3SKNB 4I0PA 3QDJE 2FHFA 1MAML 3HG1A 3PJSA 2C5DC 1J9CT 1HDMB 3OKLA 5IMKA 3CFDA 5GS0C 4NPYB 5BW7A 3MBXH 3FQNB 5AAMA 3GSQB 1CLYH 5I1LA 1IQDA 3V5DB 1INDL 3EDDA 4PJEB 3WE6A 1BGXH 4R26H 5K9KB 5D2NB 3TV3L 4GMTL 3RDTB 4OLYH 32C2A 3UPCA 3BH8B 3MLRL 5A16B 5FGSA 4JPWH 4PLKD 5E5UB 4KZEL 4JPKH 1L9NA 2OTPA 3GIZH 4PB0L 1KEML 3BESR 3DHJA 1I8KB 4NRZB 5DJZB 5DRZB 1XCQB 5IG7A 2A0LC 3I6GB 3BP4A 3PNWA 1QOKA 2FBJL 3C5JB 4HDIB 4KHXH 4YBQC 3E8UH 2FATL 4OLZH 2CO7B 5IHUH 5JZ7D 4XVTL 2FWOA 4PJBB 1UM4L 2VUOA 4NKIH 4WW2B 3AS2A 1FE8H 1XF5A 1RUPL 12E8H 4PRPB 4U6VL 3EAKA 4LSTH 3ZKXB 5IQ7L 4M5ZH 3T3ME 2UV3A 1CXEA 4EQ3A 1BVKA 5T3ZD 1IZJA 2F54B 1UC6A 4WVRA 1R24B 4PJ8A 3SDDD 3LQAC 2D7QA 5HYIA 2J2ZA 5FDYA 3V7AG 4NNXB 3SDXE 2OM5A 4Y4FD 15C8L 2IPTH 3MZTA 3ORJA 5GZOD 5BMFL 3MYZA 4OI9A 3SGDI 3DV4A 2ZUYA 4P5MB 1DVFD 4MA7H 3D25A 2NX5A 4PJEE 5HVHC 4NT6B 4PJFF 5D2NE 1RK1B 3BZEA 1BPVA 5ETUB 3W9DB 4UT9H 4GRMB 5GRXG 1UWXK 4YDIL 3MUGA 4HSQA 3BGFB 4BQ6A 2SEBB 3BEWA 2Y4SA 1CR9H 4NKDA 5C2UB 1ZVYA 3QB7C 4UBDD 3ZSSA 3B9DA 5T1LB 4HJGA 3BP6B 4BFGA 4P2QD 1JN6A 3L1OH 4L1DA 1X5JA 4I0PD 4Y4HC 4EI5B 4F37F 3HG1D 5HYJA 4G6ML 3C8HA 1KIPA 1V05A 3FO9B 2H3NA 4TSBL 4KHTL 5F88A 4PJBE 4LRIA 5JW4N 2IQ9H 4M93C 3BKML 4PRPE 3QQNA 1E4KA 2H26A 1HHHB 4F58H 4YFLI 5CIPA 1EGJH 3WNPA 4OQTL 5BV7H 4P23C 4MXVE 2F54E 3UTPE 4NIKB 4X6DA 5DO2C 3WS6C 4QTIH 4K9EC 3BWAA 4NKOB 4C55A 3OKKB 3U1SH 3UTZB 4H5SB 3D1MC 1UQSB 4PRBB 1U8PB 3EUUA 5ESVB 5E4IA 1A1NB 4XNQA 2P43B 3NFNA 4P2OB 1MELA 1WIOA 4JKMA 4OFVA 3RWJA 3RY6A 2ADFH 3S98A 5CD3B 4LSVH 1FL6B 4LSSH 5ADPH 4X4ME 5IB1B 3U7YH 5KW9L 3SQBA 4MHHG 1QBLH 2GKIA 4JHZA 4U1GB 1W0VA 4X9HA 5DJ6A 4DAGL 3L6FA 4AEHH 1I1AB 3BT2L 5IB3B 3V5HB 4D0DB 4B7LA 2J8UB 4RNRA 2VSDA 4PJ8D 4J8RA 4BUGA 5H37H 1CLCA 4M6NH 4GAJH 4KTEH 3TH2T 4KROC 4AQOA 1XCTB 4I13B 4LHUB 4PS4L 1JRHI 1CVRA 5CZXD 2W9DL 5IGXL 1AR1D 1P84J 1QVOA 5DURB 2WIMA 5J1AB 3JV6B 2YR3A 5ALCL 3MV9A 8FABB 3MLTA 2NY3D 4WY7H 4ONHB 3WLBA 2X4OB 4HIIB 2K7QA 2I5YL 2NX5D 3L5XL 4XCYB 5CJ8A 4UQ3B 3HC3H 2BVPB 2X9WA 1XIWC 3QI9B 2Q6WA 3CFJA 2FLRT 2JIXB 4X5XB 3UDWC 3T0ED 3LEXB 3HZYB 4PJIB 3WS3B 1JYNA 1R3IL 2OQJB 4NFCA 4U6YA 1BF2A 3RWFA 2MNUA 5IB5A 7FABH 4UMGA 4HS8H 4ZPVB 1MPAL 2UY7A 1KTKE 1RZ8A 4TRPL 2PO6B 2WK2A 4HCRL 3KPPA 4JO2L 5I75B 1AD9B 1EH9A 3MRGB 1H5BA 3GMMA 3MACL 1A2YB 2XZZA 2F53B 4OSUL 5HYJD 4R96A 1GAFH 3OKYA 3AY4C 3SO3B 2Q1EA 4GO6B 5GS2H 2CDEB 3K4DA 1GGCH 3Q2CA 2QQKL 3BP7A 5KSBB 1NANI 3BIAX 5T1DL 1VFAB 4RGMB 4TSAH 1A22B 2RCSL 5C6TH 2YUVA 4NQVB 1A7QH 3UJIH 5CGMA 5HD8C 3FL7A 1UKTA 3OAUH 2J8UE 1A6PA 4DEPB 4NJ9H 3MUZ1 3V8CA 3JV4A 4IOFD 3AREB 3NAAH 5EZIL 4LLYB 3BKJL 3ESVF 3SDCA 3TFKD 4UU9B 1MFEL 3SO5A 1NGPH 3NTCL 1IT9H 4KKCC 1XF3A 4UIKH 4M1CD 5I8EA 1JZ5A 5DJXA 4OGXH 1CFSB 3KVQA 3EOTL 1P53A 4V1DA 3BZ4A 3O6KH 4X6FB 3RPIA 3BKCL 4S11A 1I1YB 1YMHA 5DD6A 4QHNB 4HKZB 1IGTA 2P7TA 4HFUH 4I18A 3FT3A 3IDYC 4BZ2L 4HLZG 3WBDA 1RZFL 4HUNB 4FQ1L 3ARPA 2VAJA 2DS4A 4P48A 4WHDA 1GZQB 4PJIE 4OCYH 1XGTA 3EDJA 2GHWB 4RQQA 4BZ1L 2EO1A 3VWJA 4C56A 2AXFB 4ETQB 3HMXH 1NL0H 3H3KA 1KBGL 3V52H 4P5TC 2APBA 1FHGA 4YPJA 4OF7A 3MRIA 1FL3A 5JPMA 1NEZB 3TPKA 1OTSC 4TSCH 2F53E 1BHGA 3PHQA 5GGTH 5E94B 3K2MC 3MV9D 1QLFA 3C60C 5EO1B 5GQBA 1S7XA 3FOMB 3K3QA 5HHPB 3A0OA 4QHLA 5KSBE 1NGWA 3L5WA 2AJSH 3TA3A 5GIRA 2EYTA 1OHQA 5TH2B 3S96A 4XPBL 4X6CA 4R6UA 1TETL 1CGSH 2AABL 4WWID 3LSOB 2DD8L 3FO2A 3JWOL 3QDGB 3SE4C 5KANG 1WCBA 3HMWL 2CLZB 2ED8A 2EDOA 3C5ZC 1BD2A 4O51A 5MP6H 3QHTC 2JJUA 4Y5YB 4ORGB 1IL1A 2WINA 4U1KA 4CMMB 2DIAA 5FYJD 5E6IB 4MDIB 5E8DL 3TCLB 1E6OL 5F8RC 4Y5XA 3QEHB 4TVPE 1I3VA 1MI5D 4PJ9C 5JLZB 5D7IF 3G6DH 4NDMB 3STLB 1R0AH 4OIIL 1KC5H 2VH5H 1RY7B 3NCJH 3OKMA 3QFJA 4Y16D 5KJRL 1HH6A 2EIZA 1UB6B 3RKPA 1VEPA 4XXDA 2EDDA 4Z7QF 5IK3A 2FX7H 2EDFA 3LKOB 3V6OA 3IAPA 5IOPB 4PUBL 4TYUA 3SDCD 2P49B 2EDHA 1T5XA 3T1WA 4U7MA 2BMKB 4JY4B 4CU8A 5BZDB 4Q6YA 3IDNB 2FZ3A 1X5GA 4XRCB 3NCYP 2ESVA 4V1DD 5IBTH 2BY3A 4IOIB 4S1SL 2ARWA 1FGVH 1X5IA 2VXTL 2BOBA 3ZO0A 5FUOH 2J4WL 1A3LL 2BC4B 4LHQB 2QQQA 2D7OA 5AG9A 3SQOL 1I1CA 5GHWL 4DN4H 4RAVA 4Z7UA 3JVGA 5C09B 3PF2A 3PHOA 5GS1B 2MKWA 4LMQI 2CKBL 4P5KA 1PG7L 2R2EA 3OQ3B 5E2VL 4AIXA 3QDGE 3C6LC 1M05B 4CVZB 4K3JH 4L8CA 3F7YA 4MJ6A 4C56D 1FLTX 1L6ZA 1UJTA 1LE9A 3Q1SL 4OZIF 4X80H 1GGBL 3ARBA 3ZSTA 3DRQA 4JM2F 4LBEA 1CGYA 4WTWA 5FYKL 4HX1B 4L4TA 3P9WB 3EYFA 4HUVA 4M7KL 3MOAL 4JFPB 3FONB 3VD5A 1LEKB 1DQJA 2KDGA 1BECA 3TA3D 3L7FA 5DJDA 4ZOCA 3G6AB 4G8GA 4PJCF 4KVNH 3MV7B 2FJHB 1CL7L 4M02A 3E6HB 2PYFA 1T0MB 4AMKH 4DUXA 1KTLA 1CLZH 5HPMA 1BD2D 4U6XA 4FS0A 5ITBL 5D1QC 1RIUL 2YC1B 4OLEA 3EOAB 4HH8A 3VGGA 3K2UH 4RA3A 4RBPH 1BQSA 5JOFB 4HXAL 2BJML 1KTDA 2XXMB 2YKLH 3EFFA 4RDQF 2IJ0C 5EU4B 1YEKL 2D9QB 2PXYA 5KSVB 3O8XC 2NNAA 5BV7C 5C09E 3AXLB 5DD0H 4HUWA 2Y6SC 5E2TH 2QL1A 3QFDA 3B9KA 5F7LB 4PJ5B 3QFJD 1BZ9A 4S1RL 4W70A 2I26N 1C16B 3DX6A 4NZUL 4X83A 2GFBB 4NYLB 3VWKB 3KPNB 3LKNA 3V0WH 2VLKD 5L2JA 1PZ5B 4LSRH 1B3JA 3MLWH 4LLMB 4WFGE 5I1GH 4PRIA 3O3EA 3ZE2E 4G6JH 4M6MH 4EIGB 4XZUA 1IAKB 1X5AA 5D1ZB 5CJQH 2IADA 3I2CH 2OK0H 3H9SD 3OXRB 3SGJC 3EYSL 4JZOA 3KPMA 1RVFH 1JHTB 4NNPH 4UNVA 2DF3A 1IGYA 4N9OB 5I1AB 4F2MB 4LLUA 5HGDB 2DKUA 2O5YL 4G42B 3IJHB 3MV7E 4WW1B 5I73C 2G75A 5EIQA 3MODH 1J1OL 1XH3B 2D03H 1HOCA 2VAAB 3OPZL 4OUUB 5CEZL 2FHCA 3ARBD 1S9KC 1IGFH 1V3MA 3AS1A 5DQ9B 4IJ3C 4L4TD 1V3JA 4I48A 4UB0L 5I6XC 1XR8A 4O02L 2IH3A 5F9AC 1DUZB 4R4ND 2ATPA 5F7WC 4HWZB 3INUL 4KY1L 1ZV5A 2G9HA 4PR5B 3T3PE 4HIXL 4HIJA 5B39A 4QRSB 4ONOA 1C12B 3B2UD 1J8HA 3K4AA 3IFNH 4G8GD 1HYSD 5MERA 4S1QH 4PJ5E 3WEXB 1NMAH 2AJ3A 3LZFL 1IBGL 1D5XA 2Y1VA 5D6CB 1KB5H 2D31A 2IGFH 5A2JH 4CBPA 3QXWA 4X4XA 3RAJL 1TZHA 4RAUA 4LOUD 4Z0XB 4XP5H 4UIMA 4XVJL 4QHKI 4HF5L 2P46B 3PIQA 2VQTA 4WU7B 1TCMA 2LU3A 2V2WB 2QEJA 3EHBD 4LKXB 3QWOB 4IRZL 4UDUA 3KS0H 2PXYD 3VE0A 4JR9L 1YECH 4OZGB 2VDNL 4QXTB 1DANU 4NC1C 1UB5A 4Z0BH 4OCXL 4YX2L 3NH7L 4JRYD 3ZHKA 2GK2A 3RVUD 5L2KA 3IFPA 5FYLH 3GMPA 1LNUA 1T04B 2DICA 2V9TA 1MRDH 3E0GA 4U3HA 1YYLL 3K4ZA 5FHAL 1ZWIA 1UG9A 4EN3B 2CUHA 1LO3H 2YS4A 2J8HA 2Y5TB 4PRID 5I8OH 1YPZA 1BLNB 1KSRA 1XGYL 2ZUXA 5KG9B 3IDJB 5JHDA 4M5YL 4UV7H 4I77L 1U3HA 2FD6L 4ODWB 4MA3A 3RWIA 3GHEH 4DGVL 5FB8A 1AD0B 3VMNA 3VFGH 1CIDA 5GGRA 1EEYA 3HA0A 5GRUL 3CUPB 5I1DA 3ECBB 2XWTA 4Q7DA 3EYOB 1HSAA 4HUXA 2MHAB 4HKJB 4FN0A 3VRIA 1KJ2H 1FFPA 1CDGA 1DTUA 2EE9A 2PTVA 3IKCB 5GRVK 1E6JL 3BDYL 5EFIB 4N9GB 1OM3L 1EDQA 4DTGH 1I4FB 2W0PA 4QRTB 4X7EC 5D9SA 1NLDH 1RURL 4GKNB 4NWTL 4PJGA 4Z95L 2EDWA 4JVUA 4I5BB 2HFEB 1WBZA 4YHYB 4GUPB 1W72B 2A1WL 3D18B 5DEZA 5LGJB 4N0CD 4TOYL 1SM3H 3MLXH 4QXWA 4G7YH 3TJHC 4OZGE 1J8HD 3TBWA 4JQXC 4IDLA 5H35B 3ZDYE 2YPVL 1YC8A 4O4YL 5TPWH 1U8IB 4MXWL 4Z77B 3A6BH 2IFFH 3MPCA 4EXKA 4GRWH 2WIIB 5K9QG 5IM7A 3RBGA 3G6JA 3BQUA 4ZXBB 4BKLA 1KCKA 1VKXA 3QQ3A 4IS6A 2AJYL 4LK4A 2VL5B 1KT2B 3CCHB 1JI1A 1UA6L 4HBQA 4GS7C 5T33H 3X3GL 4ZUSA 1MFNA 3MRLB 1BVLA 3NABL 5F3HB 1AJ7L 3VXTB 3RKDC 3SPVB 4MJ5B 5JXEC 4QTHB 3VFSA 1KIRA 3JTSB 5IMOB 5B39G 4Y2DD 5CWSB 4PRNA 4LVNC 1KXVC 4M61B 2NY5L 4GQ9H 2FR4B 2HWZH 1CWVA 1ZGLA 1A7OH 5CAYB 2OP4H 1RIVH 2P8MB 4YLQT 4JJHA 5L2KD 5DGRA 2IANB 3QHFL 5TGBA 3DSFL 4CGTA 3CMOL 3PWPA 5T5NF 1UYWL 1WFNA 4KTDL 1MHPH 2AEWA 4LEXL 4NSKA 4MQ7A 3ULVH 2DL9A 5KVEL 4ZS6D 2IF7A 5JNYA 5MEND 1F3JB 1F45A 4FMFA 4QXGL 5JHDD 1U3HD 4WFFD 3SY0A 3BH9B 4P57A 4XCNA 5ESAA 5CZVH 3RI5F 2AXGA 4H8WH 3MRHB 1FQ9C 5I8KL 1AGBB 2I9TA 3ULUF 5EIIB 4J1UA 4JFQA 1XGUA 4ODTH 5AEAA 3VI3E 2JJTC 4KK8C 5ADOH 3BPOB 1BQLH 3O4LB 4OZFA 5D70H 1ZLSL 4X7CC 3P4MA 3T0XA 1MHHA 4YXKL 4JKPL 3S4SG 3EJYC 4JFDA 4K3DH 5IVXA 4JCMA 1HHGA 2AV7A 3BEVA 3DHMA 3OGOE 3FB5A 1JNHA 2CRYA 1ROWA 5CJBA 2X5PA 3JWDH 4XNMB 3HUJB 4P49A 1FIGH 2DI9A 4LCIL 4XNYH 4OAWA 2CMRL 1U91A 3MX0A 1ZVSB 1SY6H 3ARDB 1K4DA 1N4XL 2COQA 4YGVB 5EZLA 5TF1H 3CFBB 4GW4B 3MXWL 1NJ9B 3I75B 2Q8BL 5IKCB 2O5ZL 4ZFGH 3SGEI 2IANE 3BQUD 4OF0A 1YA5A 5EDXA 4YBHA 1JV5A 3LVEA 4AM0B 3OF6D 5H94B 4F8TA 4YXHL 3R06B 3ARWA 4DJMA 5ACLA 4WO4A 1F02I 1DSFL 5IHLB 3VGAB 1JHKH 2BVOB 1G9MH 4QT5B 1ADQH 3L3GA 1BP3B 1JF1A 4K3HA 2UZIH 3QQ9D 5K9OA 4JJ5B 3KPSD 1TITA 4JREC 1EUTA 3E2HB 3ALXA 1WQVT 2Y06H 1LD9A 3B9VA 1OQOA 5E5MA 3GNMH 4IDJH 5EUKA 5EO9A 4F7EA 1PKQB 4MD4B 2NY4D 3EO1B 4R3SA 1UCBL 5DJCB 2D7TL 5DK0B 2ITCA 3PWPD 2YN3A 3EZJB 1JPTH 4F7TA 3GEWB 5KVGL 1YEEL 1T83A 1OGTB 2WBKA 5ABDE 5EG6C 3CFEA 1X7QA 2YPKA 5FOJA 3MR9B 5DVKA 3TO4A 1L0XA 1Z2KA 2WSKA 3MA7A 4Y5VA 1NGQH 4J6RH 4OIBA 4B0MM 1YEFH 3HUJE 2QADD 4N8PA 4WI8A 2JB5H 2VISA 3L3IB 5HHOA 5FCUH 5TJWK 1RQ5A 5DQDH 3SDDB 4J3OC 3V4UL 1FYTA 2XWJB 3DGGA 1R3HA 4GH7B 1TPXC 4YHOH 3RGVD 4ZTOH 4Y4FB 4LSQH 4LQ1A 4PJAB 3BO8A 1CFTB 1QZ1A 3RVVC 4DK6A 4OFYA 5DEGB 4AEIL 1O5DT 4QWWD 3MMEB 4JFDD 3IDIA 4L4VD 1DQTA 1G7QB 1DVFB 2R0KL 1DE4A 2ADJA 1XF2B 3MJ6A 5HHXL 1FNLA 5DD3L 4X99B 1AC0A 4NCC1 3EYVA 5CD5C 4GXVL 5SX4I 3B3IB 1QLEH 5FA3A 1MHEB 4QO1A 5C9KA 3SE3C 3HPLA 4FQLH 2GY7B 4GW5B 3VCLA 4FG6C 4NRXA 4WCYL 3V7AE 5D1XC 3ZYJA 3ALWA 3DURB 1DFBH 5TE7H 3CFKB 1HHJB 4LIQL 3RNKA 5I16A 1PKQE 4P2QB 2QHRH 4X7TA 3HG1B 4NGHL 4HAGA 4OZFG 4DGYL 2DMCA 3OKLB 2NY2C 5IMKB 3KHQA 2ZOKB 1OT1A 4GAYA 4JFFA 3WJJA 1IQDB 1F4WH 3EYQC 4WO4D 3VD3A 3WE6B 5C9JA 2R2CA 2WWKO 4KI5F 1FZOA 4DVRH 5T3ZE 4KKBD 4GG8A 5JW3H 2XA8L 3T4YA 1RIHH 3QAZC 2HRLA 1NFIA 4HC1H 4BH7A 3GIVA 1URLA 1FNAA 2HKFL 1QTYT 5LCVH 1FAIH 2X05A 1AIFB 4NM4H 3PDOA 4G6KH 1T20A 3CSYA 3IFLH 4LGSB 4PJAE 4XWOD 1RV6X 4MQXC 4ELMB 2OLDA 3IDXH 2X44D 3BP4B 2EIDA 3LV3A 4M7LH 2E7HA 2O5XH 1F6AA 4ZD3H 1LP9F 3BPLB 3LQMA 3FFCA 5ACMA 1D9KC 3OB0H 2XKSA 1Z6JT 2I60H 2FWOB 1PW3A 3MLUH 4I3GA 2FEDC 1XF5B 1CICC 3TO4D 5T1KA 2Y7QA 1LGVA 1WBXA 1EK3A 2V2TA 2AEPL 5HHOD 4XXCC 4PJ8B 1U6AL 1FYTD 2XIDA 5LG1A 1UCTA 2LFGA 3M07A 3QSKB 3SE9H 5D7IA 2BVEA 5SV4A 5I1KH 4P2QE 2F5AL 5MHSD 1RJCA 4XTRC 1SMOA 1HZHH 1Y6NR 3HG1E 2BK8A 1FVDA 3ZE1E 4LVOB 3KLHD 4OFYD 1N6UA 1UJ3C 1MCWW 4HK3J 4LEOB 1YJDL 2NY3B 4ZOBA 3Q5OA 3BWUC 1X5FA 2CUIA 3PWUB 2NX5B 2VLMD 5IJVB 3QG7H 4JHWH 2DLFH 3QUMH 1MHCA 1OLZA 4MNQD 3T0EB 4JQIH 1O7SA 1OD9A 2I9LB 5E2WH 3MUGB 5DT1H 1OSPL 5I71B 2H9GA 2QSTA 3I50H 3KJ6H 4KI1A 5L9DL 5GS0D 2EYRA 3V95A 4KJQC 3BAEH 2MTPA 4HJGB 2Z35A 4B41A 2G5RA 4ELME 1I75A 1EAPA 1DQDH 5TQ2L 3JXAA 5HYJB 1X5XA 3HAEH 3MLPA 1KIPB 1WEJL 2H3NB 4Z18A 5C0EA 3WS6A 5JMOC 2E7BA 5F88B 4R97B 2P45B 3Q6FB 5EU7C 4XP9H 4XWGH 2VDOH 2YPLA 5C0JA 4U1LA 4EOWH 3VDBA 4H26A 5D93B 3LEYH 4GLRH 3FMGH 4X6DB 3V6FA 3O4OB 4KJWD 2JJSC 3BWAB 4YBQD 3M17A 4MCZB 5D71H 3KPRB 2ADGA 5IJKA 5D4QA 1OSZA 1N8ZA 2FEEI 4H20L 4ODVH 3NFNB 3ULVC 2NMSA 5DWUH 3SOBH 4XPHL 5J56B 3FFCD 2BZDA 1OAQL 4NKQB 2NX5E 2P47B 3CMGA 1K85A 5F70A 1GZPA 3RTQA 5T1KD 2J88L 2FL5A 4H8WC 1W0VB 5M7QA 5DJ6B 3T0EE 4FTVB 4YWGH 4G80A 4BK5A 4U6TA 1MWAA 1BMGA 4J8RB 3G5XB 3OR7A 43C9A 4M48H 4O2FB 2V2XA 3HC4L 4JHAL 2IAMA 4APQA 4EQ2A 4YZFE 3GMNB 2CR3A 4G8FA 3T3MF 2E27H 1MRFH 4JN1L 4DKDC 2V17H 3IU3A 3QRFM 3V9FA 1XIWA 2CIKA 1QVOB 4P9HH 5HYJE 3UDWA 5ID1A 3MV9B 2DM4A 4TUKH 2EE3A 3MLTB 3SDXF 1I9IL 5GSRA 3F58L 5SWSA 3WLBB 1Z3GH 2HTLC 1ZA3B 1NLBL 4WFED 4XP6H 4ODSH 3FCTA 3OZ9L 5GXBB 1M71B 2ZG1A 5GGQH 3VW3L 3OB0K 4YO0A 2Q6WB 3CFJB 2W59A 1T2XA 2XRAH 3RL1A 4X6DE 4Y4HD 4U6YB 5IB5B 4ZUWA 1RK0B 4CN4A 1ZTXH 1KJVA 4PJEF 3KPRE 4WNQA 2E8YA 2N1KA 1RZ8B 3KPPB 1NMCC 1H5BB 2DQTL 3GMMB 4KQ4H 4JY6A 1BVZA 3F6IA 4Q9RL 4R96B 2ICEA 3W5NA 1CDBA 1X3DA 4PBVC 1SYSA 2W38A 4HK0A 1C5BL 4K7PY 1MI5B 1G9MC 3RA7L 4XCEA 1UM5H 2R2HB 1CG9A 2QKIB 1G6RH 1WTLA 4Z8FH 1EMTH 3VJ6B 4Y16B 2OZ4L 5F9WC 3EJZD 2VZ3A 2GCYA 4PJBF 4WW2F 3JV4B 3FO0L 3NA9L 2DWDB 2HAZA 3QCTL 2AI0L 1VERA 3SDCB 5T1MA 2AXJA 1S7QA 4UT6H 5CILL 1XF3B 4MXVF 3CPLA 2WWKT 4JN2A 5DJXB 4QGYA 6CGTA 3EKCA 3BZ4B 4V1DB 3RPIB 1YMHB 5DD6B 3MV9E 5MI0C 4UAOC 3LOWA 1IGTB 2P7TB 1YNKH 5F1NA 4AENA 3FT3B 3FRPA 1IM3A 5KAQF 3RTQD 4YC2B 2HT2C 4WFHD 5LJYH 1BREA 1MQKH 3KYOA 2R29L 1MAMH 1XGTB 4RQQB 3UTSA 5L8KB 3GKWL 3DX8A 4C56B 3F7VA 2UUDH 1L7IL 4ERSL 3UBXA 3X12A 4APQD 5F89A 1INDH 3MJGX 3MRIB 1FL3B 3VG9C 4MLSA 2AJXH 5FYJE 3TV3H 1PJ9A 3O2DA 1XIWD 4XMKL 4PTTA 2B39A 3IVKA 2X09A 3PHQB 3MLRH 3QULA 3HI6L 4LCYA 1S7XB 4OBRA 5SWSD 2BSTB 1P7KA 5DLML 4KZEH 1MI5E 3ME0A 4POYA 3SE4A 2BXYA 4QHLB 4N5UA 3L5WB 3TA3B 4PB0H 3RX8A 5GIRB 3C5ZA 1HHIA 1KEMH 4IRSA 2EYTB 1A4JA 5EULV 4NO3A 2Z31B 4HGWA 2PUQT 2VXUL 1FLRL 1F4HA 4RFNB 3U79A 2XV6B 5B8CC 2FBJH 3FO2B 2ZUWA 2QSVA 2FATH 4ODHL 4RDQG 3C08L 1WCBB 3E6FB 3UO1L 3VFTB 3U83A 3H8NA 1UM4H 4OD3L 4PJ9A 1IL1B 1RUPH 2WINB 4U1KB 4U6VH 5IQ7H 2RIKA 3GJEA 2CJUH 4V1DE 4YNYA 1QUNA 4ZOAA 5KS9B 4LLWA 5AD0A 1P6FA 2CRZA 2D0GA 4I8DA 2FIKA 2LAAA 2NY6C 3I3BA 4PLNC 4EDXA 3D0VB 3PHSA 1I3RB 3LKSA 5C6WH 4PV8A 5F9JA 5D7JC 1GYAA 3N0PB 4KKCD 3QFJB 1U8HA 5BMFH 1NGYB 2X42A 3V79C 4XXDB 2J5LB 4YFDB 2ORBL 4C56E 4Q0XH 3TZVC 4YHIA 4N0YL 4OCSL 4CU6A 2VLKB 1KJMA 1NCDL 2LU7A 1J5OL 3WFBH 2KPNA 2AK1H 1ZANH 2LV4A 3VH8B 1T5XB 4LLVA 1IFHL 2FZ3B 2J8UF 5L0QC 4EUPG 4K7PL 3O3DA 1I9EA 3VD7A 2J1KA 4YDIH 1FNSL 1EZVX 2BOBB 2UVEA 3H9SB 3C6LA 4FQCL 1U3YA 5DVLA 1RPQA 4KXZH 2UZYB 4RAVB 4Z7UB 4YR6A 2A73A 5DRNB 4NQED 3NCMA 1XGPA 5ISZB 3HR6A 1OTSD 3UZQA 4P5KB 3TPUA 4G6MH 2CRIA 4JO1L 3CH1B 4L8CB 4G9FA 2X70A 3B8YA 3BYYA 4TSBH 4KHTH 5CEXA 1JFQL 3C60D 1QFPA 3HI5L 1LE9B 3LH2L 1WITA 3ARBB 3BKMH 4PJIF 3QISA 2XZCL 1BF8A 3DRQB 1N6VA 4LBEB 3RI5K 1FZJB 4L4TB 4LP4A 4M6OL 4AQ1B 3FO1A 4F9PA 5BVJA 1I85C 1S9YA 4PIRF 3T2PA 4Z78A 3VFUB 3FRPG 1TZIA 1FIEA 3HI1A 3C5ZD 3MBEC 5DJDB 3EYUL 3U4EA 4G8GB 3QFJE 1IE5A 1F11A 1AXSA 2BSED 1MAKA 5KSBF 3V6OE 2VLKE 5HPMB 1LK2A 4U6XB 3L3JA 3UBXG 2YXMA 4MX7A 5KW9H 4PJ9D 3HB3C 3W39A 1EGJA 5C0IB 1I1RA 3LQZA 4ENED 4KU1A 5E08L 4DAGH 1VB9A 1SHMA 3THML 5CCKL 3EFFB 2VDQL 4AIZA 3H9SE 3FQWB 4J23A 2PXYB 1G7JB 2MFNA 2NNAB 4Z7UE 1SQ2N 4PS4H 3DTXB 2DOCA 1D5BB 4HUWB 1I7RB 3QFDB 5ISZE 5IGXH 3KPLA 5BOZG 1BZ9B 1DQML 3QPQC 5ALCH 4XB8A 3DX6B 4L9DA 2OL3B 4JRYB 1TZGH 3WFCL 4HS3A 3LKNB 3MRPB 3SGJA 3L5XH 4X4YB 1EXUB 2FH6A 1T7YA 4PRIB 3O3EB 4L4TE 1T89A 4ONFL 4PRAA 4XZUB 1R3IH 1E4XI 4XVUD 1LO2H 2IADB 3C6LD 1JGDB 2A9ML 4JZOB 3KPMB 1MPAH 1IGYB 1U8MA 3AGVA 4ACPA 5LQBL 4LLUB 4G8GE 2CR6A 3DPBA 3MGOA 3MACH 1I9RL 4ZSOA 3MRQA 2G75B 4OSUH 4OCNC 1P7HL 5E70A 4WV1C 3C8DA 4JZJC 1S9XA 2VR9A 1HOCB 1QQDB 1BWWA 1OTUC 2HJKB 1QFWH 3RZCC 2RCSH 3QUYC 1OARL 2EDTA 1NPUA 3BKYL 1WT5C 4I48B 4D9RD 1XR8B 2G2RB 1GOGA 2YMXL 3NZHL 2ATPB 1JF6A 3ETBF 5EZIH 25C8H 3IDMA 3RL2B 3CZJA 3X14B 5DJ8A 5B39B 2CGRL 3NTCH 3IT8D 1J8HB 5MERB 3KAAA 3EOTH 2AJ3B 2VABA 3PGDA 3H3PL 3BKCH 2D31B 4JRYE 1MCDA 3ROOA 4YJZL 3RVTC 1FVCA 4DGIL 1IKFL 3B2VL 4X4XB 4XAKD 1TZHB 4BZ2H 3QG6A 1RZFH 4RAUB 2QTEA 4FQ1H 4NWUL 1JPSL 1I8LC 2XXCB 4PRIE 3S8WA 4HQQL 1K3ZA 3MNVA 1D6VL 1BBDL 2EH8L 2Y6SD 3I6KA 3PIQB 4HGMA 5C71A 4MMXC 4KUZL 1HWHB 5CSBA 3ZE0E 4O2EA 1KCUL 3SKUD 5BRZA 1S5IL 3FQUA 4UDUB 4KDTA 4FFYL 3QPXL 4HT1L 1UXWB 5JR1L 4M00A 4Y2DB 4Z5RA 3MREA 4LVHC 3DX7B 3BXNA 1KPRA 3DMMB 4JM4L 2UYLA 3PWLB 5KZCD 1JZ2A 3GMPB 4D0BA 3ULUC 1LNUB 4UQ2A 4AYFA 5E4EB 3LMJH 4XPBH 1YPZB 1K8DA 1EUUA 2BNRA 5F7MC 2MPAL 5MENB 3BPCB 1TETH 2GJZB 2AABH 3HMXA 2RGSA 2DD8H 1U3HB 3JWOH 4MA3B 5FB8B 1T0NA 4LRNL 3HMWH 1IEHA 1EEYB 1A1MA 5EBWA 2QQNL 2XWTB 3ZE2F 2VXVL 1HSAB 1J8HE 2M26A 4E41D 1E28A 5GGTA 1NCWH 1PQZB 2F5BL 4KC3B 5E8DH 2Z93A 1FFPB 1E6OH 1RI8A 2AJZA 4LLDA 3GO1L 1WZLA 5K9JL 3HZKA 1OCWL 1DBJL 5DQJB 1JYXA 4RMRA 1RHHA 4FFZL 5IFHH 2A74A 1JZ4A 4PJGB 3HNVH 1BBJA 4AH2B 3LN5B 5H37G 5KJRH 1WBZB 3Q6GL 4JQXA 3O6FA 3RJDA 1Q9OA 2EXYC 3EO9L 1I7UA 4CRPA 1U42A 5CHNA 1NBYA 1LP9A 1T22A 4PUBH 4MNGB 4YHNA 1U8OA 2NCMA 4ORZC 2ZG3A 3TBWB 2NW3A 1N7MH 2VQ1B 5GS2D 2WANA 2DLIA 1NBVL 5GGVY 4S1SH 3O45B 4JGMA 4I0CC 4OLWH 3ARTA 5FK9A 2VXTH 1P4BL 5L2KE 5IM7B 3T3PF 3G6JB 3BQUB 2J4WH 5JXEA 3MLZL 1A3LH 4BKLB 4JRXA 3QQ3B 1VKXB 4IS6B 5SWZD 4ZS7L 3SQOH 1J0YA 3UAJC 3LN4A 4MQTB 4NNYA 1YPZE 5CBAA 3WXWL 4H0GA 3G08A 5JW4R 1A6WL 5MENE 1IC4L 2EO9A 2CKBH 1C5CL 1XF4A 5E2VH 4WFFE 1WK0A 3D85A 3ZKNC 3KPSB 1AGEB 1VGKA 1GC1L 4Q74A 3Q1SH 4NQTA 3ZKMC 3WFEL 4PGBA 1A0QL 5FYKH 4D9LL 2VWEE 3K8LA 2NY4B 4M7KH 4ZFFB 2ED9A 3S37L 3BUYA 4OLXL 4N0UB 2O61A 3PWPB 2I07A 2VR4A 4NSKB 4MQ7B 1JIBA 4PJGE 2FLBT 5TDPA 1N2RB 3U0WL 1II4E 3W2DL 3P2TA 2B7DT 1CL7H 3ILPB 5C0FA 1RUKL 4HD9A 1TTFA 3QIWC 4NZRL 2QADB 3SY0B 3UPRA 4P57B 4XCNB 1CDUA 2OCFD 2ADIA 1GJIA 1ONQA 2AXGB 3IDGA 4MNGE 3X11A 5ITBH 3FT2B 1RIUH 4J1UB 3RGVB 1BZ7A 2B4CH 3MJ8A 2OXGA 4G5ZL 4F15B 1XGUB 3QDJA 1QSVA 4MAUL 3CSBA 2MCPH 2B1AL 2V7HA 2MMXA 2EEAA 3G6JE 4XH2B 4H88L 4OZFB 3TWCH 1YEKH 2YRZA 1MHHB 4MD5A 1NFDB 4JFDB 5IVXB 3ARFC 3P0VL 5EC1B 4IIQC 4L4VB 1HHGB 5CLTA 4B7IA 3TJHD 1J0HA 3BEVB 5DRXA 3FB5B 4S1RH 2C3GA 1DEEA 2FEEL 3PL6A 3W9EA 1MIEL 4NZUH 5LKNA 3D3VA 1Q1JL 2XI9A 1GHFL 4KAQH 4OAWB 3KPSE 5IFJB 1U91B 2D2OA 1JPST 4OJFL 1OVZA 3ARRA 1QA9A 3EO0A 5DYOA 1FDLH 5T3XD 3EOYG 1VGEL 4HFWA 1GPOL 1ZHBA 4H25A 2X1WL 4N0UE 5JXED 3GSXA 4DK3A 3PWPE 2ZKHH 4JRXD 3I9GH 4OZGF 5F8QC 4LDLB 5DJ0A 2XFXA 2BY0A 3ZDYF 1M1SA 5TE4L 2O5YH 4YHMH 3L95A 1NC4A 1QLRA 3FQXA 1WCQA 3QQ4A 2WNGA 4WO4B 1ZLWK 5H8DA 3D85D 2BP3A 4L9LC 1RUMH 1J1OH 4L3ED 5K9OB 3ES6A 3ARGC 4QRPA 3OPZH 1QBAA 5CEZH 3IETA 2AGJH 2W1NA 3TF7C 1FN4B 3DVNA 3MJ7A 2WV3A 4UB0H 1BX2A 5EO9B 4F7EB 1HDMA 3BE1L 4O02H 1ETZA 2ARJQ 4P46C 1EHLL 4NPYA 2BOCB 3RVXC 2E9WA 3FQNA 3TNNB 1TTGA 3INUH 3V5DA 5J12B 1NFDE 4JFDE 4HIXH 5IVXE 4F7TB 5GISL 3TN0B 4L4VE 5D2NA 2B5IC 3CFEB 1X7QB 4BFEA 3RDTA 2YPKB 5J1SC 3TO4B 2PW1B 1RJZA 3MA7B 5DDHB 3LZFH 4Y5VB 1IBGH 3DNKA 1P5VA 1YQVL 1OGAA 2VDPL 5HHOB 2V5SA 1X44A 4KK8D 4MNHA 5C07A 3O3BB 5CINL 3DGGB 1CXIA 3GJFH 4XVJH 1R3HB 5DRZA 4ZG1A 4H0IA 3WHE1 3GBML 3QDJD 2BVTA 3BO8B 1YEJL 2WLZA 1BJ8A 4IRZH 3GMOA 5D2LB 1U95A 4PJBA 1KLUB 1AR2A 4FQIL 5CKAA 1R5WA 2XKNA 3IDIB 2A6KA 4PY8I 3VI3F 1DE4B 2ADJB 1KB5A 4QRRA 1MH5B 1MCWM 1RUAL 4D8PA 3PL6D 3C09C 3EYVB 3WIHA 1R24A 4OCXH 2IBGA 3D3VD 3NH7H 4MNQB 4YX2H 4D3CL 2RFXA 4CN1A 1RULL 5FA3B 4NNXA 3RU8L 2CLVA 1YYLH 5EZOL 1S7SA 2E7CA 3AM8C 5FHAH 3RIFF 3VCLB 4NRXB 5TE6L 4CADA 2R1XB 4XBPB 4QRQA 4KJPC 1NAKL 4NO2A 4MS8C 5SV3A 2IPKA 1XGYH 3RNKB 5I16B 1KEGL 2Q86A 4OGYL 4M5YH 4I77H 3K74B 2FD6H 5CP7B 3EZ8A 3CLFL 4JAMB 4LFHG 4FZ8H 5BXFB 3K46A 4CU7A 5GRUH 3QUZC 4GAYB 1EFXD 4RA0C 2QHLA 1NCBL 4ZODA 4NT6A 2VR5A 4U1NB 5JORB 1OPGL 2V5TA 2DQJH 3W0WA 5C9JB 2EDYA 3GSVA 1FZOB 4NQSA 5FUZH 1CN4A 5HHOE 1E6JH 2SEBA 3V6BR 1Q9WA 1OM3H 3VXMA 4QRPD 3T4YB 2AERT 1A02N 5T1LA 1NFIB 4BH7B 2ZP0T 3GIVB 4HH9B 1EBPA 4YQXL 3HE7C 1RURH 3UROR 3BZFA 3PDOB 1BM3L 4NWTH 4RGNC 3ZL4L 4EI5A 4RWYL 1AXTL 1A7NL 1T20B 3CSYB 4NZTL 5MHSE 2VLRA 3DSNA 4I2XA 5DRWA 2YD4A 1F6AB 4U3XA 5D2LE 3FFCB 4TOYH 4XXCA 4YDKL 5FO7B 4BFBD 1JCKA 1HKLL 2ICWI 3JWOC 1FJ1A 4MGXA 1KJ2A 2VLME 4JZNA 3RDTD 4GLRI 5DUML 5T1KB 2Y7QB 2YPVH 4YHPA 1WBXB 1B6DA 4MNQE 1VCAA 1OGAD 2BNUB 1WIPA 1P5UA 3FB6A 3QHZL 4F3FB 3RVVD 5C07D 4NQUA 3UTZA 2AJYH 1UJ3A 5K33A 2MSPA 5HBBA 1UQSA 4OIAA 5HHVL 2IPUG 3X3GH 3N9GL 3HUJF 4YHZL 2H45A 3VFRA 5HVHB 3NABH 3OTTA 1AJ7H 1AP2A 1CU4L 2AQ3A 1NFKA 1AO7D 3KXFB 1FVDB 1CDHA 2OL3H 2R4SL 5FO8A 4YEFA 3MLSL 1OW0C 2FH8A 3MNZA 5CBEA 1NKOA 4X4ZA 4FG6D 4BM7A 4DW2L 5D1XD 2IALA 4QRRD 4DZ8B 2APWA 1ZGLP 4CL7A 1IGJA 2NLJB 3B6SB 3MCLL 4R9HA 4Q2ZA 5L7XL 3MLVL 1E4WL 4Y4HB 3OKOB 4PBWD 3CK0H 4WU5B 35C8L 1FC1A 3DSFH 3CMOH 3WFHA 1UYWH 4KTDH 1EV2E 2H9GB 2NY2D 3KHOA 4LEXH 1CGUA 5DEFA 2EYRB 5ERWA 5KVEH 4FFWC 3S36L 2RJMA 5J1AA 4M93B 2WBJC 3JV6A 2W0LA 2Z35B 3GJFK 4S2SA 3O3UN 2DJ4A 1EAPB 8FABA 3WSQL 5IR1B 1T6WA 4P23B 2Z0BA 3FFCE 3V4PH 4XCYA 1QPXA 2W60A 5I8KH 2GUOA 3QI9A 2JJSA 4JLRB 3LD8B 1JWMA 5C0JB 4U1LB 5JA9A 4H26B 1KFAL 2ZCHH 4L8SC 4PJIA 3W0WD 3CGTA 4WJ5A 5FYLD 1EHXA 1TQCC 1CFVL 2CRMA 1CS6A 5CJXC 5FUCC 2YOCA 3V6FB 3VXMD 2A38A 4L29A 3NIGE 4YXKH 2Y36L 5SWQB 4JKPH 1TVBB 2BY1A 3M17B 4JRWA 4XCCL 1D9KD 2ADGB 4OI8A 1YNLL 2YK1L 2FEDD 2QLVB 1CICD 1OSZB 2VLRD 5L88L 1N8ZB 1JZ8A 2CDEA 1HHKB 4WGVB 3KXFE 3T2NL 1MJUH 4LCIH 1EZVY 3NIFE 3CSPA 2E9BA 4FABL 1CTNA 2CMRH 4OT1H 4X9FA 1G84A 4O5LL 4R4BA 1YEDA 5C0CD 1N4XH 4WFEE 2HP4A 4HS6A 3PWVA 4PJAF 2A6DA 5IWLC 1BWMA 5IVOA 4XHJC 3P11L 1GZPB 3MXWH 3RTQB 1QFOA 2Q8BH 4ELKA 2YRLA 1CD9B 1N64H 2FL5B 3PWNA 1UWGL 4KK6C 2YWYA 1CE6A 2O5ZH 2WUBL 5DHVB 3AREA 4XTRD 4LLYA 1H3XA 1MWAB 1EO5A 3OR7B 1IC1A 43C9B 1OWRM 2V2XB 3NCBB 1Q9LB 3CC5B 4YXHH 4APQB 1JRHH 4G8FB 5DF0A 1MVFA 1DSFH 4LCCA 1YC7A 3SDAC 1XIWB 2CIKB 3RHWF 3VXOA 5ID1B 2AKRA 3D0LA 1JF5A 4X98B 5GSRB 1NUGA 3VA6A 3FCTB 4DVBB 3N1QC 1GZQA 3ZE1F 1IKNA 4M3KB 3LKPA 2NTFA 5D5MA 1UCBH 2AXFA 3RL1B 4ETQA 1Z5LA 2D7TH 4ZUWB 3QNZB 1HCFX 1KJVB 4FZEL 4N8VA 5KVGH 1NEZA 2JCCA 4X9GA 1ADQA 3DYMA 4OGZA 4PY7A 1IQWH 1W2KT 5CGYC 1QSFA 4JY6B 3FOMA 1BIIA 4WDIB 2ICEB 1ZA6A 3WXVH 3DBXA 1SYSB 4HK0B 4K94L 3GI8L 4K71C 2PTTB 1I1AC 2KH2B 2ED7A 4ELMF 5F7EL 4XCEB 2GQHA 1CG9B 4WFHE 5AZ2H 3UJJL 3N50A 1CF8L 2CLZA 3ULVD 4AEIH 4LPVA 1H3TA 1WIUA 4CMMA 2R0KH 2FX8L 1PD6A 1S7QB 3IDYB 1F97A 3TCLA 4WEBL 3GGWB 5HHXH 5DD3H 1UH4A 5F7FA 3MRNA 2H8PB 1CD1B 3UYOD 1SYVA 1B2WL 1SBBA 1G7PA 3STLA 5F1NB 4AENB 4U1SA 4WCYH 1MRCL 1WISA 4E42A 1CK0L 2YN5A 1IM3B 5F71A 4LIQH 4P5TB 2EDJA 4NQEB 2D9CA 3KYMA 4CKVX 2KZ1B 1MIML 3LKOA 4NGHH 2PO6C 5I75C 4DGYH 5IOPA 1RD6A 2FO4B 4RISL 3DX8B 3Q5TA 3WKML 2LTQC 3C60B 4JY4A 4HGKC 2VXSH 4TUOA 3UBXB 5F89B 1YY9D 4IOIA 2BSSA 4PTTB 4CAGA 3IVKB 3NCFB 3BHBA 3E3QC 2XA8H 1GGIL 4C59B 2X4UB 1P7KB 4YZFF 5C0BA 4P4KA 5C09A 2F58L 3C5ZB 1HHIB 4FRWA 1WTGT 4NO3B 2MWCA 3LDBC 4HGWB 1DBML 1HNGA 4BJLA 1M05A 3MUHL 2L7UA 3S36X 1IC5H 3BOVA 4FQ2L 3P3YA 4XPGL 2DQFB 3LPWA 3OR6B 4LGRB 3A67L 1VACA 4R7NB 5E9DD 4PJ9B 3GJEB 4X6DF 4XNUL 3OXSA 1QSFD 2AEPH 1ZT7A 4HC1A 1WZKA 1LEKA 4LLWB 1UKQA 2CDFA 5AD0B 3QWRA 2HT4C 4EDXB 2G5BA 3TZVA 3HPJA 3CU1A 4KPHL 3RX7A 4PV8B 5F9JB 2FRGP 4NQEE 4D9QD 2F5AH 5EWIL 3BIKB 3K7UA 3CX5K 2I25N 1U8HB 3GSNH 5HYQA 3C8KA 2QSCL 3DRTB 3HZMB 1YJDH 4HUMB 4KMQA 5SX5K 3FAWA 2YC1A 4MVBC 4JGUA 5J3HC 1KJMB 4UZGA 1NEZG 5L8LB 3IXAA 1HIML 3T09A 1P69B 1X5YA 3ZHLA 1EA9C 2F9BT 5FM4A 3D6GA 2HT2D 3O3DB 2J6EL 2L4OA 4WHYG 4YBLC 2VC2L 5EU4A 1OSPH 3C6LB 5L9DH 4NM8L 3IGAA 4PJ5A 1F58L 2A73B 2DQDL 1C16A 3QT2A 4OF3A 2GFBA 1KPUB 5TQ2H 5DZOA 3VWKA 5T5FL 2R1WA 3TPUB 1LILA 1DN2A 1IAII 1U8QB 1WEJH 4LLMA 2UWEA 3ILQD 5CEXB 5DJYA 3RGHA 3QUMA 1MCCA 5GGSB 3JV5A 4XC3L 4NOFA 3V0VA 1U2HA 3D9AL 2VOTA 3UC0L 1ITCA 3OXRA 1A4KA 2NY5C 1M7DB 3S35L 4J4PA 3FO1B 5MEOA 5C0BD 4XMPL 4P4KD 1S9YB 5EO0B 5C09D 4Z78B 4PRHD 1TZIB 2W92A 4G42A 3IJHA 3VFWB 3X3FH 4CNIB 3GHBL 5F7KC 2E6PA 1YEIL 4H20H 1F11B 5AYUL 1AXSB 1WFOA 1LE5A 4XPHH 1IEAA 5JXAH 4KK9C 1LK2B 2OTUA 2NY6D 3LEVL 3VGHA 3L3JB 4MX7B 2EDQA 2C9AA 5BV7B 2J88H 5BO1L 3LQZB 1SMAA 3CDYA 5D7JD 1OB1A 4WWKC 3KJ4C 1G9NL 3QWRD 4PR5A 4PB9L 4NBXB 1MFBL 3TZVD 5GSVB 4JN1H 1MSPA 2R23A 1J0KA 3KPLB 4G6FD 3LRGA 3DUUA 4E5XA 2X9YA 4HWEH 1MLBB 5KZCB 1YMMD 1JYVA 4NOBA 5D8JL 1I9IH 1P4IL 3F58H 4Z0XA 1NLBH 4JGJA 3KPOA 4FQJL 3ZTNL 4TQEL 3OZ9H 3MSPA 4NO0A 3TESA 3VW3H 2ZSVB 3AU1A 4PGEA 4D9RE 4I3SL 2XG5A 3QWOA 4PRAB 5I73B 5FHBL 2PYEA 4UNUA 2BRRL 5I19H 5JHLH 3ZYOA 5K59E 5HHQA 5I2IA 5HDQL 2WUCL 4JZJA 1U8MB 4PJ5D 5IUSA 2I24N 4E41B 4YPGA 2DQTH 2BHZA 3MGOB 4ZSOB 3MRQB 3VWKD 2X4RA 3RZCA 3QUYA 4IJ3B 4Q9RH 1WT5A 5I6XB 3U82B 2Q8AL 1C5BH 3GBNH 5JIPA 3RA7H 3NFSL 3PDDA 3DO7A 4PYGA 4U1HB 5KG9A 3MBED 1WZ1L 1DBKL 3VMPA 3MA9L 4AY0A 1KXTB 2OZ4H 5EOQL 1F42A 5HVFB 4RMTA 1SBSL 1Q0XL 4UNTA 5FA4A 1S3KL 3R4DA 4J4PD 4PPTA 2WZPD 1FORL 3FO0H 1YEHL 3NA9H 3EYOA 3QCTH 1JWUB 1WWAX 2MHAA 2EDKA 5DJ8B 3LQAH 1UACL 1CI5A 5CILH 1YN6A 3HB3D 5KS9F 4GXUM 2VABB 3C87A 3PGDB 4PYHA 5MEPA 2AQ2A 4OFDA 2P48B 1OAKL 4GKNA 5SWZB 1G6RA 5CJ5A 3RRQA 3FT4B 3CXDL 1KYOK 4DKFL 3MNVB 4YUEL 1FSKC 3D18A 2R29H 4IMKA 1A6TA 3QPQD 3KYNB 4O2EB 3GKWH 3A6CL 3FQUB 1B9ZA 4ERSH 4UINH 4YDLC 3QJFA 3U30C 3RIAF 4E41E 1XMWA 3MREB 1HI6A 3BXNB 1KPRB 3OKEA 4JPVL 4Z77A 4ZSOE 1MFCL 4XMKH 3ZT7A 3CDGA 2WIIA 1SVZA 5HI3C 4ZXBA 2QR0A 3MFFA 2WLYA 4Z6AT 1S7UA 3HI6H 4OCWL 4EKXA 1AY1L 2GW5A 4TNVK 3CCHA 4Z7UF 5DLMH 1MLCA 4OKVB 4NP4L 4M43L 4DFHA 3QUXA 1FL5B 4NO0D 1AI1L 1KG0A 4TULL 5EORL 1UZ8A 4P3DB 2DYPA 1K8DB 5F1KC 1FLRH 1DJSA 5I30L 3JTSA 5GGSY 3ZDZE 2PYED 5ICYA 5IMOA 1T0NB 4ODHH 3C08H 5CWSA 2J7LA 4M61A 2RQ8A 3L3OA 4OD3H 1A1MB 2FR4A 4HIEB 1UXSA 4TPRL 5DTFA 1E28B 1OTUD 3VGFA 3WFZA 5DMGC 1B6UA 3RZCD 3QUYD 2Z93B 1F8TL 4LLDB 4RGOL 3STZA 2EDEA 4FXLA 3HZKB 5SWZE 2XT1B 2PKDA 4LNRA 2QBWA 5HI4C 1BBJB 4NKMA 4Y1AA 4NC1E 4LSDA 3UZVB 1Q72H 3NPSC 5C1MB 2ORBH 3WFDL 1I7UB 3MRHA 5DI8A 5CHNB 1NBYB 4N0YH 4OCSH 3PWJA 5J6HB 1T22B 3RVTD 1NCDH 5EIIA 1J5OH 3G9AB 4YHNB 2HN7A 1U8OB 1AFVL 3PP4L 4YAQB 1IFHH 2NW3B 5AWNL 3UMTA 4GS7B 4KVCH 1VFOA 3RY4A 3GI9L 4Z7WA 3O4LA 2W0FB 4RIRA 2DQCL 1RFDL 5FK9B 2FO1A 1CLYL 2A6IB 5D6DC 1A9EA 1T4KA 3UJTL 4YGAB 4K2UL 1WFUA 2CK2A 4FXKA 3LN4B 4NNYB 4OLYL 3P30L 1IC7L 4TUJB 2KUTA 4LVNB 1TFHA 3G08B 1L9MA 5CS7A 5HGBB 4D94A 2VRAA 2AQ1A 3TBYA 1KB9J 2BVQA 4ZNEA 5C0ND 5HGHA 4JO1H 2WP3O 3ARDA 3D85B 2Z92A 4L3EB 1JFQH 3GIZL 1HXYB 2FECI 1VGKB 3HI5H 4HJJL 2DKSA 3CFBA 1NJ9A 3I75A 3V5KB 4AEFA 2XZCH 4PGBB 4HLJA 1YJDC 5GZNC 3PGCA 3ZE0F 2B8OT 4EDWL 5FYJU 3BUYB 1A7PL 2LAGB 3QIWA 4ZUTA 4AM0A 1FGNH 5H94A 4OI7A 3R06A 1LVEA 3LS5H 3QUXD 2I07B 2F8XC 3GMLB 4JO3L 1QACA 5F1OB 2XZQL 3EYUH 4A2MA 2VLLA 3QA3B 2BVOA 1DBBL 2DYPD 4QT5A 5EA0H 4YDVA 5C0FB 2OBGA 4JG1H 4K7FA 4NRYA 4JKLA 1AQDB 3JSSA 1KCLA 2YD6A 1LP9E 2GSGB 4CW1A 1JMXA 3IDGB 5IT2L 3X11B 4YFLF 4JFHD 2P8LA 3ARFA 5EU6A 1V3KA 3MJ8B 5DJCA 5F6IC 5BCAA 5EOTA 4OZHA 5CCKH 3V4VL 3N85L 2V7HB 1WC7A 2V5MA 2VDQH 2HFTA 1N3NB 5FGBC 2EXYD 2W91A 1OGTA 4JRXE 3MNWB 3RX5A 3KPTA 2GY5A 1CZ8L 3BN9C 4HLZH 5GRJL 3C5SA 5D7SL 1S5HA 5F3BA 3ESUF 3T65B 5CIPH 3L3IA 3PL6B 4Y1AD 3W9EB 4QXUH 3D3VB 3SDDA 1CR9L 3WFCH 4L3EE 4UT7H 4V2BA 2AEQL 2PR4L 1ODAA 2X1QA 5F44A 3RHWK 1A7RL 3P4NA 1JHLL 1I7ZA 2X89A 3EO0B 1QA9B 5DSCA 3UYRL 1NCCL 2A77L 5DYOB 5GJSL 4ONFH 3O4LD 4H25B 2DWEA 3VXSA 1Q9KA 2ID5A 3RWDB 3GSXB 2A9MH 4L9LA 4F33A 4DZBA 3ZKND 5DJ0B 2XFXB 1EFXB 4JREB 3ARGA 5LQBH 2OMNA 4X99A 3ZKMD 4UDTA 3L95B 1QLRB 4ZUUA 1I9RH 3B3IA 3RWCA 3LY6A 3VDAA 4GW5A 4XHQA 3O2WL 4QRPB 2DM2A 1YPZF 3IETB 3DURA 1YN7A 1BIHA 5E6YA 3CFKA 1HHJA 3HNTH 5JW4Q 4WI4A 3DVNB 3H3BC 3MJ7B 5FM5M 1OARH 3BKYH 1BX2B 1DEDA 1ETZB 2YMXH 2K7PA 2ZOKA 3QIWD 1LDSA 3U7YL 3WNOA 2FB4L 1QBLL 1NEUA 2HA1A 1XEDA 2GAZA 4G9DB 3NN8A 1MAJA 1RJZB 1TPXB 4RZCB 2H32H 3H3PH 2VDLL 3ARQA 3D3VE 1K5NA 4PY8J 2C1OB 5C86A 1IILE 1OGAB 4MNHB 4DGIH 1IKFH 5C07B 2EH7L 4PJGF 1AIFA 2NYYC 2HT3D 4XPAL 2C26A 4NWUH 1L7TH 3ARFD 1ZVHA 4NHUA 5EU6D 3FB8B 4ELMA 1EPFA 4CVXA 2NZIA 1D6VH 1BBDH 2EH8H 2W0KA 1PVHA 4WY7L 5L6YL 5JIHA 2XY2A 1AO7B 1KCUH 3BI9X 3BSZL 3GMOB 3MO1B 4FFYH 1U95B 3QPXH 1AH1A 1D6EB 1KXQE 5JR1H 3Q3GA 3AMKA 1R5WB 5ITFA 2XKNB 3NGBC 4HXBH 2XZAL 4QHUB 2A6KB 3AM8A 9CGTA 2K3TA 3LKRA 1KB5B 5D1XB 4QRRB 4JM4H 4KDWA 4D8PB 3G6JF 5SX4H 2X1XR 1D5IL 2HFFA 4JDVB 2RFXB 4QRPE 2CLVB 2HJFB 1S7SB 1UGNA 2NY2B 1N5YL 4KRLB 4CADB 2OJEB 3G9VA 4R90L 2X89D 4QRQB 5HY9A 4NO2B 3CVHL 5I1HH 2MPAH 2IPKB 4E9LA 5JZ7C 4X7DC 2Q86B 1H15B 1A64A 4L8DA 4LEOA 3VXSD 1TCRA 1CGWA 2CXKA 2PETA 3A6OA 3MOBL 4X0KA 4LRNH 1B0WA 1INEL 3WLWD 3KR3H 3PWUA 2ZCKL 3ARGD 2QQNH 5IJVA 3QAZB 1ITBB 2VXVH 3T0BA 3DX9A 3T0EA 4YK4B 3W0WB 1VFUA 3GSVB 2I9LA 4LARL 1OGAE 2ICWJ 4NQSB 1NGXA 5C07E 3GO1H 2NPLX 4P46D 5K9JH 5GZOC 1Q9WB 1OCWH 3RVXD 1WVZA 3VXMB 3MLYH 3D39A 4JCLA 4UIKL 1T7ZA 1DR9A 4FFZH 1D9KB 5FDWA 3U9UB 3BZFB 4RFEB 1TNNA 5JW4M 1CICB 2VLRB 3Q6GH 1OAZL 3ISWA 1DVFC 4R2GC 1AO7E 3EO9H 4I2XB 5DRWB 2WP3T 4L8BA 4HWBH 3VRJA 2W07A 3Q6FA 5I74C 2DJSA 5C0CB 5D7LA 4ZMAT 1FJ1B 1KJ2B 4G8EA 4JZNB 4QRRE 2EC9T 4YHPB 1NBVH 2WMPA 1P4BH 1NFDF 4FP8L 3FB6B 5IVXF 3U46B 4MZ2A 4ZFOL 4MCZA 4PLJC 3KPRA 3RWGA 1UJ3B 4ZS7H 4I0PC 1AE6H 1OW0A 1KNOB 1I8MA 3WNKA 4JVWA 4GAGL 5I0ZA 1A6WH 1IC4H 3VFRB 5BW7C 1T3FB 4WI6A 1AP2B 3QNXB 1C5CH 2FSEA 4GG6A 2VZOA 2R69L 5KN5A 3U4AA 2AJSL 5D96C 4MJ2A 4U0RC 5BS0A 2D7PA 5FO8B 1GC1H 3GMRA 3O11A 4NBZB 4HV8B 3DGCR 3MNZB 1A3RL 1CFQA 2CIIA 3WFEH 5CBEB 5A1AA 2EZ0D 2DBJA 1A0QH 2IALB 4FTVA 5E7BA 3W0WE 4D9LH 4GRWB 4KJPD 5FYLE 4MS8D 1IGJB 3WN5C 5FV2A 4Q2ZB 3G5XA 4X6EB 2N56A 4O2FA 3S37H 1AKJA 1X4YA 4OLXH 3VXME 3WFHB 3UTQB 2ZUQC 3GMNA 4LGPB 3KPQA 5DEFB 5ERWB 5BZWA 3U0WH 2CKBA 2NY1C 3H42L 5IBUB 4AG4L 2VLRE 4S2SB 4BSVA 5T3XL 3UTTB 3HS0A 1MF2H 1RUKH 4L8SA 4NZRH 3FTGA 4I2XE 4JANB 5TF0A 1IAIL 1ZA3A 5GS3A 1R0AL 2X4PB 5CJXA 1M71A 2VH5L 5C0CE 2W60B 3NCJL 2GUOB 4JDTL 1BFTA 1EAJA 1JWMB 4G5ZH 3HE7D 4PJ8C 4OM0L 1RU9L 3L9RA 2VQUA 4RGND 5C08A 4WJ5B 4MAUH 1ZLVK 3S6CA 3O9WA 5E1AB 2B1AH 1RK0A 2D0HA 2BRQA 4H88H 5CZXC 5ID0A 4L29B 3D39D 2DLHA 5IBTL 1U2CA 3UYPA 2ERJC 5CZKA 5DJAB 1MIEH 2PN5A 1TQBB 3GSWB 1GHFH 2UY6A 1MI5A 2WAHA 2F15A 4DN4L 1HK6A 4OJFH 4R4BB 1YEDB 1Q8MA 4XPTL 4NO5A 4HS6B 2R2HA 3PWVB 5D7LD 2QKIA 2A6DB 3WO4C 1J1PL 3VJ6A 2DMKA 5F72S 4Y16A 3G04A 4GRWE 4ELKB 3PWNB 1GGTA 1VGEH 1CE6B 5D2LF 2VDKH 1GPOH 2DWDA 3SDAA 4X80L 3KPRD 5L8JB 1S7WB 1FYHB 1TMCB 3TIDA 5TE4H 3F12A 5EU7E 1CD0A 5DMKA 1U58B 3VFOA 4LCCB 5DFWH 4LRIC 3SEPA 4KRMB 2V7NB 5E03A 1JTOA 4WUUA 1DP0A 3VXOB 5BS0D 1E4KC 2AKRB 3D0LB 5F96L 2Z8SA 4HHAB 4MJ4A 5IB4A 1LO4L 1X6NA 1F90L 1UM6H 1TTUA 4FTVD 3O4OC 3AROA 5J89A 4FFWD 3TM6A 3LKPB 3BE1H 2NTFB 5D5MB 1NMCB 1CLZL 1EHLH 1AKJD 1Z5LB 4A6YL 5ICXA 3KLAB 3H9HB 3ULVE 4M1CC 1NAML 1FNGB 1JZ6A 4N8VB 2PTUA 2Z91B 5E9DB 2JCCB 3RY6C 2ZUVA 2YKLL 5DFVC 3S88L 4YXLL 1H3GA 4JFYB 3SCMA 2D0FA 3QXDA 1CIUA 1QO3A 3WD5L 4PY7B 1T21B 3MGTA 1QSFB 1X9QA 1BIIB 2BSTA 2XQYG 5F9WB 1ZA6B 3QZWB 3DBXB 2MOVA 5DD0L 5IW1A 2APVA 5FYKD 1T80A 2Z31A 2HVKA 2P24A 5J6GA 3GBMH 1CD8A 2Z8VC 5C08D 3LB6D 3O9WD 4NCDA 5CP3H 1WZMA 2BHUA 1MJ7H 1NH6A 5DUBB 1YEJH 4B50A 3IU4L 3E6FA 3MLWL 2OXHA 3VFTA 4XC1L 3LRHA 1UZ6F 4PD4J 5MI0B 4FQIH 4PBXA 4Z7VA 4IHOB 1J8KA 1KN4L 4M6ML 5CSZA 5DHXB 5K93A 1RUAH 4XHJD 3DVFA 3I2CL 5KS9A 3MRNB 4YDJB 4D3CH 3NIGF 1RVFL 1C08B 1RULH 1SYVB 3D0VA 2C3WA 4NNPL 3AS0A 1I3RA 3GJFA 1AGCB 3RU8H 1F6FB 1G7PB 4RMQA 5EZOH 4U1SB 5C0DA 4J2XA 4E42B 1NAKH 3PXHA 3T0DA 1KEGH 1NGYA 4AT6B 2FYYA 3MODL 3V6ZA 4L1HA 3NIFF 5D5ME 4ZDHB 3VG9B 3KYMB 3WHE0 2D03L 3SDAD 4WTZA 4WENB 2VLKA 5HYFA 1B4JL 2D7MA 1IGFL 3VH8A 5A40E 5E9DE 3PUCA 5CJOL 2JCCE 4TUOB 4BUHA 1OPGH 4J3TA 3S97C 5FKAA 1T6VN 2BSSB 2Q20A 1QSFE 4ETYA 5E56A 3BHBB 3H9SA 1UENA 3I3DA 4WUUD 1LEGA 4HG4J 5B8CB 3FJTA 1JP5A 3TVMC 5C0BB 4P4KB 4Q97A 5DRNA 4YQXH 4PRHB 1NMAL 1X5KA 2J8OA 5ISZA 3ZL4H 4RWYH 1AXTH 2IGFL 5CFHA 4NZTH 4D9QE 3CH1A 3WIHL 1Z0NA 5CGYD 2EKSA 3FQRB 5LAXB 4R4FL 3DVGA 3MJ9L 4YDKH 2NY6B 3O6LH 1MY5A 1VACB 5EPMA 5E2UL 1FZJA 3CAFA 1A14L 3FQTA 1IGML 3SCMD 5DUMH 1FG9C 1A9BB 1F00I 5IV2A 5D7JB 3BPNC 3OXSB 4I18C 1CDJA 3U9PL 5CEZD 1Z9MA 1ZT7B 2B2XL 3QHZH 2CDFB 3VFUA 4FFVC 2G5BB 4ZO8A 3TZVB 3HPJB 2VLJD 2Z31D 4F9LA 3VWJC 1QNZL 2HKHL 3N9GH 4YHZH 4NN7B 1QBBA 4XMLL 1CU4H 5HYQB 4G6FB 4KWUA 1MRDL 3ARVA 4UILL 3C8KB 4BA8A 5L0QB 2IFGA 1YMMB 1XGQA 3OX8A 4K8RL 3MLSH 1JBJA 1IARB 4XCFH 5C0IA 5I8OL 3IXAB 4DW2H 1PEWA 2K9UA 3O2VL 4UV7L 1P9MA 3GHEL 1D3CA 5L7XH 3MLVH 3OAZK 3FQWA 3DYPA 3B8SA 5E2JA 4WEMB 35C8H 1G7JA 2YSSA 3LHPH 2BCKA 1MJ8L 5C0BE 3P9MB 1CE1L 3DTXA 4PRHE 1D5BA 1I7RA 4JDZA 1S7RA 1MCRA 3S36H 3IGAB 1UVQA 3JWNC 2OL3A 4CDGC 4JRYA 3SGKA 5I1EL 3HC0A 2D7NA 2R1WB 1FO0B 1U93A 1QR1B 2HH0L 2Q87A 3MRPA 5ILTL 2UWEB 1JNJA 2FECL 5TFSL 4PP2B 5DJYB 4X4YA 1EXUA 3QUMB 2FX9H 4Y5XC 4POZC 3V0VB 3MBEB 2B0SH 1GC1C 1HN1A 1C7TA 1CFVH 4J7RA 3O81A 4OFKA 1A4KB 1JGDA 3CSGA 1W8NA 1J1XL 1NC2A 2Y36H 5MEOB 1KELL 4X7SL 4XCCH 3OSKA 4O2CA 1IGCH 5ISZD 3U6RA 1YNLH 4GMSL 3A6BL 2IFFL 1KENL 4ODXA 3HAEB 5L88H 2M1KA 4WTZG 3TBSA 1LE5B 1YMME 4WWKA 4FABH 1IEAB 1QQDA 1U36A 1C5DA 5E00B 3VH8G 4O5LH 4NFBA 2HT4D 1PYWA 3HHRB 2OTUB 2HJKA 4LSUH 3OB8A 3P11H 3ZKQD 1TDQA 1UWGH 2G2RA 4O9HL 1OB1B 2WUBH 4OLVL 3JVGC 4DKAA 3RL2A 3QUKA 3X14A 1TNMA 3ZTJH 1Y18B 2X6MA 3CH8A 2O93L 2HWZL 4MVBD 1A7OL 5J3HD 1DQLL 2C3HA 4CVUA 1U92B 2R23B 4LASH 3VXRA 1T1WA 3DUUB 4E5XB 2UWEE 3IJYA 2ZNXA 3KPOB 5TDNB 1AQKL 1DL7L 3GMQA 4NO0B 3L3DA 3TNMB 3AU1B 4PGEB 4Q6IC 2C4FT 5AG8A 5CZVL 4Y4KC 1E4XH 2IQAB 1UWEH 2FGWL 3B2UC 1FNHA 2PYEB 3PV7A 1UXWA 4FZEH 4Y2DA 3S3PA 1RZJL 5HHQB 4WV1B 5I2IB 4ODTL 3DX7A 4JZJB 1RUQH 3DMMA 3RFZC 4G43B 4N0RA 1H3PL 4YPGB 3PWLA 1LO0L 1CYGA 5HDLA 1J87A 4CVWA 2X4RB 3RZCB 2YBRB 1QFUL 3QUYB 3WL9A 3I6LD 4F7MA 5F9OL 1SEBA 4K94H 3GI8H 1PSKL 1UH3A 1K3IA 3EJJX 3DO7B 5MENA 3JWDL 3BPCA 2GJZA 3CZFA 1Z9LA 1PFCA 2XICA 1FIGL 1R5IA 2PXYC 3D2UA 5DGQA 3UJJH 3RWHA 1CF8H 1PG7X 1FC2D 5FA4B 1KCSL 4TVPL 5JO5A 2YZ8A 1CFNB 5IQ9B 1NDGA 3B9KC 1NC2D 1TVHA 4KTYA 2M8XA 1LO5A 4KK9D 5C0GA 2R15A 1F4YL 1PQZA 1B90A 3QCUL 1YN6B 3RVUC 1FCGA 3ARZA 4MD0A 1JMZA 4WEBH 4I3RL 2AAVA 2WBWB 5KVDL 4JB9L 5MEPB 4RWHA 4WWKD 4MB3A 5DQJA 3F65A 1F4AA 1B2WH 3DROA 3BISA 4MHHI 1MRCH 1A6AA 1G6RB 1CK0H 4AH2A 3LN5A 4AJ0A 1JGVH 2FIRT 4R0LC 4MXQC 2DTMH 4C54A 1MIMH 3N1FC 1A6TB 2PYEE 3U7AA 1JWSB 1CCZA 4MNGA 2Y06L 1I3GH 3LAFA 3QJFB 1OAYL 3MRJA 2VQ1A 1I7TA 4LNVA 5IP4A 1HI6B 3BN3B 3O45A 3OKEB 3SE8L 2W9LA 3O6MH 3CDGB 3TBTA 3VXRD 3P4OA 5HPOA 1U8JA 4MCYA 1JPTL 3KNBB 2QR0B 1V8HA 3MFFB 1S7UB 5LVEA 1GGIH 3GM0A 3OF6A 1MLCB 1QD0A 2F58H 3QUXB 3KLSA 5BVPL 1KG0B 1UZ8B 2ENYA 4TVSa 2ZWLT 3IKKA 4HUUB 1KCRL 1DBMH 2DYPB 2R4RL 1O7VA 3MV8A 1ZSDA 4N0CC 5DQDL 2ITDA 1MFAL 2ICCA 3KPSA 4FQ2H 4K3EL 1AGEA 4XAWL 4XPGH 2XACC 5ICYB 2E6JA 4F37K 3P0YL 3L3OB 1QP1A 3DMMD 1UXSB 3HFML 4Y88A 5DTFB 4F80A 5KSAC 4QOKD 4XNUH 4ZFFA 5CEYA 2DBLH 1OAUL 1QEWA 4N0UA 5DD5L 2AV1A 5K59F 3STZB 4XB7A 5AZEL 1R3LA 5FF6A 4N68A 4K55A 5B3NA 4WTXA 2GTZA 1N2RA 4LNRB 4HK3N 1YYMH 3ILPA 3B9EA 1QLEL 1T5WA 5EWIH 4NKMB 3D2UD 3BRFA 4Y1AB 2ZOLA 1MEXL 2QSCH 1IGIL 3FT2A 5DI8B 5BQ7B 5A2FA 3PWJB 3MROA 3DXAD 3LS4H 5D6DA 1RJLA 3RGVA 2HN7B 3WNNA 4NBYB 2CD0A 1G1CA 5E4EC 2J6EH 4Z7WB 4XH2A 1T03L 4RIRB 2VC2H 4M1DL 1NFDA 1WAAE 1A9EB 1T4KB 1F4WL 5EC1A 2R56L 1BJ1J 4L4VA 5EU3B 2E5EA 4RMSA 3T8XB 1NCAL 4NM8H 1U3HC 2JKXA 4FXKB 1F58H 3C2SA 3GSNA 3NPZB 2DQDH 3EFDL 4P3CH 1OP5K 1H8NA 2MKLC 3I85A 3TBYB 3WIIH 5T5FH 5IFJA 2BVQB 4HC1L 4KZDL 5ICZA 5HGHB 2HTKC 2Z92B 1JE6A 4JFHE 1VFBB 3PV6A 1TIUA 1A6ZA 4M7LL 3BMWA 3PGCB 2O5XL 3UC0H 4ZD3L 1BFSA 4N8CL 3NFPB 5J13C 1MJJA 5FECA 3QIWB 4XBEH 5I9QC 1KJ3L 3MLUL 4HJ0C 4ZUTB 4CJ1A 4XMPH 5DMJB 2DIJA 5J4MA 3GHBH 1YEIH 2VITA 2VLLB 3F5WA 4YDVB 3MV8D 4QRUB 5AYUH 4Y1AE 2V6HA 5C0AA 1P6AB 4K7FB 4NRYB 5KANI 2QSQA 4BK4A 4CW1B 5B22A 5FOBB 1F3DJ 3LEVH 3TIEB 2H41A 5I1KL 1FN4A 1HQ4A 4X7FC 3FAXA 3U2SA 3WHXA 5B3JE 2P8LB 3ARFB 5EU6B 3ZDZF 4Z7WE 2BOCA 3O4LE 5HI4D 1FV1A 3FN9A 4OZHB 5EOTB 3TNNA 1J0JA 1WC7B 2A6JA 4D0CA 1WICA 2GJ6A 3LPFA 2ZUTA 3TN0A 3WNMA 4NN6C 5I76B 4N90D 3P73B 3QG7L 3MRFA 5A43C 2PW1A 5DDHA 3C5SB 1S5HB 5F3BB 3AS3A 3FOLA 5IMLB 5DT1L 3O3BA 4ZNEE 2DIBA 3I50L 2AJUH 3KJ6L 3Q48A 4X8XA 3VG0L 1A8JH 4E0RB 5D8JH 3I3EA 3BAEL 4FHBD 4FQJH 3ZTNH 4TQEH 1AHWC 3RJQB 4AL8L 3P4NB 4Z9KB 1I7ZB 1J88A 5DSCB 1J18A 4YHKL 1FFNA 3LIZL 4I3SH 1IM9D 2NZ9C 1JNLL 5HTSA 5HGAA 5D2LA 3ARUA 1KLUA 2DWEB 3VXSB 1Q9KB 2EECA 2IBZX 3K81A 4L9LB 4F33B 3TO2B 4DZBB 2VDRH 5HDQH 2WUCH 1JTTA 3T08A 1JL8A 3ARGB 1MH5A 3LEYL 2CH8A 4QF1A 4UDTB 4ZUUB 4MNQA 4MZ3A 3RWCB 5GZND 3RNQB 4YIQA 4U2YA 1LEIA 2O26U 5D71L 4P46B 3DETD 1JYWA 2J12B 2CK0L 2R1XA 4PJHA 4XBPA 1UEMA 3NBNA 1YN7B 1VEOA 1HYRC 4ODVL 1QSZA 5EU6E 4OLUH 1DBKH 5CP7A 2EKJA 4QWWC 3SOBL 4JAMA 1FRGL 4OZHE 5EOQH 5BXFA 1ED3A 1SBSH 4KKAC 1Q0XH 2YZ1A 4YHLL 1S3KH 1T0PB 1FORH 1YEHH 2X7LA 5JORA 4U1NA 1ZGLM 4ZQKB 2GAZB 4WI3A 4M1GL 4Z7NE 3NN8B 1F2QA 1U3ZA 3M1BA 3F7QA 5C0AD 4M48L 2YEZB 3MXVL 1K5NB 4LLQA 3HE6C 4PTUB 2H2SC 1LDPL 3P40A 1BAFH 4HH9A 1OAKH 3DARA 3WJLC 4P59L 1MRFL 1OTTC 2DKMA 4Z7OE 3MRRB 3BN9D 2K1MA 4P9HL 2OZ4A 4NHUB 3CXDH 2XTJC 3ZDXE 4DKFH 2P5WD 4K94C 4CVXB 5FXCH 4EUPH 1NBZA 4MQSB 3VXSE 1QG3A 3C09B 4XP6L 2GJ6D 4ODSL 4WO4C 3TN0D 5FO7A 3A6CH 5DMIL 5GGQL 2DJUA 2ARJB 3Q3GB 1W0WB 5ITFB 1IRAY 1B0RB 5JIKA 3OJDB 2C3XA 2XRAL 3LKRB 1KB9K 4JPVH 1GH7A 1MFCH 2ENSA 2BNUA 2Z4QA 4F3FA 1RJYB 1NCNA 1ZTXL 1PDKA 2HFFB 4OCWH 1AY1H 3H9ZA 5ACZA 4XWOC 2EC9U 4OKDA 4M43H 3ROLA 4M6AA 5I18L 1AI1H 5DK2A 4TULH 3QUZB 2BSRA 1BEYL 3EDFA 5HY9B 1TLKA 4LAJH 3RPKA 3KXFA 5I30H 1T83C 4L8DB 1CXKA 1OT2A 1FO0H 1TCRB 4X0KB 3T4AB 4RX4A 3ALPA 4M7LT 6FABL 4DZ8A 3CFCH 4P2YA 5HHNA 3CFIC 4TPRH 4ZNCD 2NLJA 3B6SA 3DX9B 4P4RB 3HE7B 1W72L 1L0QA 2V5YA 4RGNB 4XVSL 4LSPH 4Y4HA 3OKOA 4WU5A 4MA8H 5IMMA 1F8TH 4RGOH 4F8QA 1NGXB 1KCVL 4OTXH 1RZGB 1MREL 2LU4A 2BDNH 2HFGH 1D5MA 3D39B 1ZT4A 2VKWA 1SJEA 3GRWA 5FDWB 1PX3A 5IR1A 2DDQL 4P23A 3UTOA 2GSIB 3WFDH 2Q3AA 4L8BB 5C3TA 5E8OB 5DR5L 3VRJB 4HMEA 3LRSA 4JLRA 1I1FA 2P5EA 1NUFA 1AFVH 3K8KA 4FQHA 5D7LB 3EIFA 2NYYD 3PP4H 3NCYS 1MQKL 1BOGA 4G8EB 5AWNH 3GI9H 2A0LD 3MV01 4J3WA 2DQCH 2RR3A 5TDOB 1RFDH 1XGRA 5JQ6L 4GSDH 5SWQA 1TVBA 3CDCA 4HUKB 4HAFA 3UJTH 2HRPL 1A3QA 5I15H 3RWGB 4K2UH 2R1YB 4PGCA 5I1IL 1F3RB 2AJXL 1JNNL 3VA2C 1U8NB 3P30H 1IC7H 4PP1C 1I8MB 1S7VB 1HHKA 2FJGA 4HMDA 4GKOA 5AAWA 3WJJC 2MQ3A 2G60L 3ZKSD 2XG4A 3VXQA 2FSEB 3ZMRA 2X1OA 4GG6B 2AS5M 2C3VA 3WN5A 5DA0B 5KN5B 5BS0B 3U4BH 4HJJH 4OD2A 3GMRB 5EBLA 1M4KA 3O11B 1KIUA 1CFQB 1GSMA 2CIIB 1YNTA 4DKEL 5DHVA 5DZNA 4KJWC 4RGNE 5IB2A 2WBJB 3CX5J 4EI6B 4EDWH 3O0RH 1A7PH 1AKJB 1Q9LA 3CC5A 4WI7A 4DN3H 3D39E 3TC9A 4OZ4B 2DTSA 4JO3H 3HR5B 3IRPX 2XZQH 2CJUL 3KPQB 5BZWB 1IEBA 2CKBB 1ND0A 1DBBH 5FKPA 1R5VA 3KXFD 4BSVB 3HS0B 4L8SB 1P2CA 2VDML 3S34L 3FTGB 4X98A 5MEQA 1TQCB 4RX4D 3NACL 5IT2H 4XNXL 5C8JA 3TP4A 3QXAA 4DVBA 5D7LE 2LE9A 2D4DA 5EOCL 2PCPA 3EBAA 4PREA 3L9RB 4N0FB 3S7GA 5C08B 1AXIB 4Q0XL 3V4VH 3O9WB 3N85H 3QNZA 3PG2A 3AY4A 3WFBL 4R2GD 2AK1L 1ZANL 5FV1L 3OJ2C 5ID0B 1QSEA 1CZ8H 1ZKAA 3DUHA 5GRJH 3Q0HA 1K6QL 5INDB 3GB7A 2HMIC 3KYKL 5D7SH 4WDIA 3FN0L 4GG6E 4P23D 2YD7A 3CLEH 5DO2D 3RP1A 4ZPTB 4KH2A 5BS0E 2PTTA 5IHBA 4KK5C 1FBIL 2AEQH 2PR4H 2P5ED 2W9EL 2X10A 4PLJD 1A7RH 4NO5B 1JHLH 2OR7A 4JFZL 4WRLA 4FTVE 3UYRH 1NCCH 2OI9B 2A77H 3G04B 5GJSH 3GDBA 4BELD 1KACB 5K9QI 2EIBA 3SDAB 1J7VR 4XP4L 3TIDB 3GGWA 2NXZC 5CSGA 1G9NC 1VEMA 3F12B 3ULUH 4PJXA 2B1HH 4H1LH 3KYAA 5KVFL 2H8PA 5DMKB 3VFOB 3VU2A 1CD1A 1U9KA 1DZBA 3U0PA 5EBGA 2VB5A 1CBVL 3LD8C 4OCRL 4WUUB 4C4KO 5DJ2B 2JLLA 3VFVA 4YEEA 3B43A 3G5ZA 3O2WH 4NZJA 4JM2C 4U3CA 3MRDB 5FUCE 1BOYA 3T0AA 1J12A 5FYKE 1DQQA 4HULB 4KROD 1ACYH 3EJZC 5IB4B 2DI7A 4P5TA 2N4IA 4NQEA 4ZTPH 1PG7W 3JZ7A 5C08E 2NY1D 4F7CB 5T3ZL 2FO4A 3DV6B 4I4WB 5IJKC 3C60A 5ICXB 2FB4H 2HLFC 1AGFA 5CGTA 4K71B 4GMTH 3MTRA 4GRLC 3SCMB 1JGEB 2DLEA 3QXDB 1QO3B 2VDLH 4PFEA 4PJ7B 3MGTB 3CX2A 2NY0C 5F21B 2X4UA 3RTQC 3PGFL 1EFQA 1GOHA 2WQ8A 2EH7H 4XPAH 3B5GA 5IW1B 4Y2OA 2VLJB 3HNSL 1YEGL 2HVKB 2P24B 2X9XA 2EXWC 3GSUB 5J6GB 1RZKL 5HI5C 1TZGL 4XNZB 5AUMB 4PJDA 5L6YH 3ZT5A 2DQFA 2IAMC 4APQC 4KRPC 3OR6A 3BSZH 4XVTH 4R7NA 1QSED 1AC6A 1FFRA 4Z7VB 2XZAH 2H32A 1CXLA 4EJ1C 2VE6A 5CSZB 3P77B 1DLFL 1JVKA 1LO2L 2HG5A 2MQCA 5HD8D 2DN7A 1D5IH 4WUUE 2E3VA 2BNQA 5LGHL 4U4BA 3GJFB 3G5VA 3WCYA 3S5LB 1N5YH 2EC8A 2H6PA 15C8H 5E1HB 2LTQB 5C0DB 2YUWA 4MDJA 4R90H 3BIKA 3CVHH 2DRUA 2FYYB 3V6ZB 3O3AA 2YD1A 3DRTA 5IEKA 3HZMA 1NUDA 3MOBH 2XQBL 3IFOA 3L5IA 1INEH 5E8EB 3SDYL 1QFWL 2ZCKH 2Z8WC 3V8OA 3TVMA 4GRWF 1QRNA 3ELAT 2APFA 5FKAB 1KYOJ 4PJ7E 5BJTA 4IM8A 25C8L 4LARH 3LDBB 5CEZE 4LCWA 1LEGB 3MQIA 4P3WA 5ECJE 3W81A 4KRNA 3QEGL 3GZKA 2VLJE 4P5TD 1T7WA 1KPUA 1TENA 1H8SA 3DI2B 4C58B 5DFVD 3MUJA 1U8QA 1OAZH 3WUWA 2HLAA 3WDHA 2EKSB 4Y89A