4QXHB

Crystal structure of histone demethylase kdm2a-h3k36me1 with nog
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
b'QVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELASSDPKLALTGVPIVQWP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 2A
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/structural protein
total genus 19
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4qxhB00
4QX7B 4QXBB 4QXCB 4QXHB 4TN7B 4QX8B 4QWNB
chains in the Genus database with same CATH superfamily
2A3DA 3BK9A 4H9NC 4FI5A 2UXNB 3C4ZA 2NR4A 2WP9A 4YSZA 4P0BA 3QB5A 3F31A 4U72A 3OYXA 1KF6A 3RIUC 2CBJA 4B3RT 1CHUA 4DV6T 4ZI7E 2LEHA 4EB6E 5LMNT 2CHNA 4X65T 3RIUA 3FB2A 3ZPOA 1HS7A 3ZYMA 4TN7B 4AIUA 4EXTA 3CQCB 4IDPA 3RGLA 3RLFF 5CA1E 3N5LA 5FNVE 2I0MA 3AA1B 4G2AA 2KINB 3R84B 1V9DA 4CXYA 4O4IE 5JDHA 3ZT7A 5LG3A 2L8KA 2PBIA 4DO0A 1HG2A 3K3NA 1MMGA 2LKGA 3HI2A 3ZKRA 2BG9A 3ETUA 2D2SA 4I4TE 4ERRA 4JI0T 4K0UA 4LFCT 3AE8A 2P9BA 3AE9A 5AQSB 2R6GF 3O1HA 4AKGA 3RRCA 4IDNA 4QH1A 2LHNA 4Z91A 3AEDA 5AQGB 3OBVE 4X1KE 4ZI2C 2NP9A 2KWIB 2V5CA 5F5WA 5HWYA 5JDFA 3F57A 4ZHQE 4IE5A 1KNPA 3Q9DA 4HEAA 2IIUA 5LHHB 5HEJA 4EAHA 3SFEA 2QGSA 4KHZF 3N9QA 3C4XA 5J2UE 4XBFB 4TWFA 2WDQA 3T1YT 4EGWA 3P4QA 3RQUA 4AQYT 5IHYA 3AEGA 4I50E 4HWFA 2W66A 2CWOA 5HXCA 2YEVC 1MIYA 5HEHA 1S35A 5AQHB 5LG4A 4TNVA 1J5ET 2XM2A 4O4LE 2AE9A 4HFEA 1OEDE 2LSJA 4DR6T 1HG5A 3KVAA 2KNDA 1VOMA 4BJNA 3N9LA 5C3JA 1FIOA 3ZJ2A 5LHGB 4U2ZA 2UU9T 2N9DA 3CQGB 2JPFA 2WSSV 4NXMT 5ABEA 1FEWA 2H7OA 4IDQA 3KV4A 2WWVA 4WW0A 3CX6B 4CI3B 5AQNB 1HFAA 3LG7A 1YXRA 2XQYA 2V6YA 3E08A 3A7MA 2VKHA 2BKPA 2D5UA 4GOUA 4TWHA 3GA8A 5JTGA 2MTQA 4CN6A 3EHZA 1I6ZA 4JI2T 3OVUA 2D0TA 2JIWA 4YHJA 3TLTA 3QK6A 1UUSA 2JQQA 4ISSA 4EYUA 3C64A 2QYWA 2Y8DA 3T1HT 4A97A 2A9UA 5CA0E 3ZLIA 2DNXA 2LSIA 2YINA 2XAGB 5AQIB 3ZC1A 4DR5T 2X9YA 2Y48B 4EIWA 4PJLA 4ZZBA 3JC6D 4LF7T 2X0YA 2KSRA 1N32T 1XWMA 4TNWA 2VKOA 2CWYA 4LF9T 4WBOA 3RC3A 2IW5B 2DL1A 1OXZA 1G8XA 5KMGP 3O1JA 3ZMUB 2E2AA 3P8CD 3A5XA 3ZMTB 1HR0T 3O4XE 4QX7B 2KLQA 3I0QA 4LF5T 3L09A 4JI5T 4EEDA 5LYJE 3TLWA 3RHWA 2BS2A 2H7VC 3EDVA 2VQET 1Z0PA 3SRZA 5FY0A 4UV8B 2JMHA 2WS3A 3FBLA 3LBXB 4V1Av 3LK3B 1W0BA 3Q5WA 3KDSE 2XQ9A 5L4EA 2EHOC 3O1IA 4ZEYA 1MMAA 4DV4T 2XUEA 4JUYA 5F3JA 3DTOA 5GONE 4U3CA 4ZS2A 2MBGA 3P7IA 3PV0F 2W2UA 1T7SA 4YTPA 1CUNA 2DHRA 2NOXA 2FJEA 3ONXA 2FJAA 5HWXA 5JQGE 3UQ7A 2E5LT 1UCUA 4PK5A 2OLTA 3Q5XA 5HYAA 4P09A 1IAPA 4GKJT 4U7YA 3UUBA 5LGTB 1UX4A 4UXNB 3PJAJ 3JC6C 1HCIA 2BVMA 3ZCJA 1IBKT 3P4WA 4NUVA 1GQEA 1MNDA 1HTJF 4PJJA 3RYIE 2UXCT 3C51A 3QNUA 2PFVA 2IC6A 2XQ5A 3ZN1B 2OA5A 3NWIA 3AA7B 4EZHA 3L3PA 1OEDA 1Z8UA 1NAFA 1YQ3A 4L5GA 2YK0A 3P4PA 1W0AA 4KI0F 5ETWA 3GN5A 5DQVA 1M62A 2EHOB 1SE7A 2VWAA 3K3OA 3UT5E 2XASB 2YDSA 3PUWF 4HE8A 3V5SA 1QLBA 1ZEEA 2VL8A 4DBQA 4U74A 3ZT6A 3RQWA 4N78D 2YDQA 3KBUA 4WBNE 2JQHA 1YD8G 2HN2A 4OYKA 2WQYA 2X9WA 2YU1A 3HKCE 2VK9A 1Y64B 4DV1T 5FP3A 4ISTA 1D1AA 4TV8E 5HEGA 4UVBB 2CRBA 1KK7A 2H88A 2WM9A 4HKAA 5AQFB 4HWCA 2X68A 3AEBA 4X1IE 2LKHA 2DI4A 3CPZA 2M6BA 3J7Yq 2XQ4A 3AAEB 3CK6A 2XTLA 2Q9QA 1O3XA 5DJQC 2V7LA 4GIWA 2HHHT 2WB5A 4IHJE 4ZI2D 3O9XA 4J2CA 4EEBA 3R6NA 4DV2T 5FL0A 2LRLA 4GKKT 3UFGA 2VASA 2W63A 2WAUA 2ZM2A 5HXRA 4YTNA 3JCFA 2N2NA 1D0ZA 1J1JA 4QH5A 5HEUA 4C91A 4JI3T 4ILBA 5L2LA 3MXZA 2WDRA 5CB4E 3UULA 1HX1B 2E8IA 4PK6A 4C90A 2C0SA 3HA4A 3LJCA 4U33A 3C50A 3SWHA 1YKHB 2AXDS 2WZHA 4E7ZA 2J1DG 5L3CB 2W00A 3IF8B 5LOVE 3S4UA 1OWAA 4IE0A 4HFHA 4WNKA 3EAMA 5JREA 2BG9C 1G73A 4KX6A 1WRDA 2A72A 2VL0A 3ZSSA 4CI1B 1SA0E 3FZLB 3MACA 3Q2MA 4K0KT 4NPPA 3OKQA 4I43B 2V7KA 2KXPB 3GWHA 2NW9A 3AE5A 5LBQB 3QB5K 4B3TT 3AEAA 2KMFA 5FKYA 3ZT5A 2PG8A 2WZIA 3MKDA 5EK4A 3LFMA 1UK5A 4YHHT 4DUZT 2JQ9A 3AECA 1VCSA 2VB6A 3AEEA 2GK9A 4QXHB 1IBMT 4LFBT 4MFRA 4IGUA 5A1LA 4X64T 4EYYR 4OFZA 3I9WA 3RKGA 3ZSTA 2BBJA 4AKIA 5DQWA 2LSKA 1J5WA 1UGOA 5JDNA 4GYSA 4A56A 2MPKA 1XMQT 1WCRA 4B3MT 2KZ7B 3ANWA 2I6HA 5CGMA 2BZBA 4OX9T 2CA5A 2WMNA 3AE4A 3EVYA 4U2YA 4FJOA 3PUGA 4YT0A 4IREA 4HN9A 2ZLYA 1S94A 2Y6XA 5LP6E 1YW0A 2MYSA 3FBZA 2CXDA 3BQKA 2ACZA 4H9RC 2QA7A 4DUYT 2BG9B 2XAFB 4YXDA 2G0UA 3C4WA 2LRKA 3TLUA 3PUAA 5AQMB 2D0UA 5LCYA 2X66A 2LM2A 3UU4A 4LMLA 4HGAA 2YN6A 3LK42 3NZQA 3CKDA 4QXBB 3MZKB 1WR0A 5JDQA 1SUMB 1KNZA 5AQKB 3UU6A 4KUMB 4UVAB 2UXDT 1ZOYA 4XAXB 2VVSA 5HEOA 2RPAA 1E7PA 2EHOD 3MK7C 1FJGT 4PNIA 4ASKA 4CI2B 4PW8A 3IA3A 3ZMZB 3JADA 5AQRB 4UF0A 5IWAT 2VKDA 1WR6A 3VR8A 1D1BA 1SHZC 3ZJ1A 4UV9B 1HNWT 2E9XC 2LE8A 3JAEA 3FZFB 2SPCA 5FL1A 4QXCB 3B13A 5J0ZA 3LK2B 3SS1A 2XPKA 3UQ4A 2DLRA 4AQGA 4M1PA 2E9XA 5IYZE 3HKEE 3RC8A 1D0XA 3D0TA 3UUXB 1N33T 2IDOB 3K1SA 4F8HA 3L39A 2XAQB 3GMIA 3OPCA 3NZPA 3CIRA 1IBLT 4GK5E 3I1AA 3IHRA 2ODUA 2FJDA 2JMKA 1ZKEA 5CJ5A 3PUSA 1H7CA 3UFEA 4B6XA 1DU2A 4HFIA 1QSDA 4AKRB 4DR4T 4G63A 3RX6A 2V6YB 5C2TA 3WAJA 4UF0B 2W62A 2XQ3A 4PK4A 1MIVA 4CZZB 3TLVA 2NW7A 5LXTE 2V5DA 1IJ6A 1T8BA 3UTKA 3DJBA 1M7KA 3RKOA 4DR1T 5FXZA 2E9XB 4IT4A 4UVCB 2L9QA 3AXJA 2PTFA 1ZV4X 3CWZB 2MOZA 5HCJA 3HKBE 2V8SV 4YTMA 2K24A 2DWKA 2CHOA 4A5XA 3H37A 2CPTA 3N2OA 4DMVA 4KP3C 2HPLA 4AXPA 4MALA 5JVDE 3VKHA 3PU3A 4HTEA 2L3LA 5EK2A 4DR3T 3FZKB 3M3ZB 3UUNA 3K3QC 2ZM6T 2ZM8A 2WMOA 2ES0A 4QKNA 4CXXA 4MBQA 1OEDC 2WDVA 4NXNT 3OJAA 3ZC0A 1MNEA 3AVRA 3HKDE 1FMVA 4IE6A 1X9BA 3EUHA 5L3BB 1HNXT 3AXJB 3F2EA 4TX5A 2H89A 1LVFA 1IJ5A 3KFWX 3RPUA 2Z6EA 1W9RA 5FXWA 3AE3A 4UEMA 1LKXA 2XJ7A 5AQLB 2UUCT 4AKLA 5LJNA 3C98B 4HFBA 3AAAB 4JYAT 3KV6A 5JRCA 3AE7A 2QVAA 3W15B 2UXBT 3PE0A 4OHFA 1WYBA 3TKLB 2LT3A 4X5TA 5L3EB 4ADZA 5EK3A 3BQLA 4JLEA 3QOFA 3J9X1 2K3WA 3EDUA 4L0RA 5JR9C 4AISA 4MLKA 4IDZA 5LJMA 2NTYA 4H9PC 2Q9QC 4YLHA 2C5JA 4ANJA 4DV0T 4QHOA 5JR9A 4PAGA 4QX8B 3FXEB 1OEDB 3KV5A 2W0GA 5C8YE 5HAXA 2YDRA 1E1HB 2IAKA 2BDEA 2UXXB 2YKSA 1L0VA 3AE2A 3GN5B 2E5VA 3VHLA 3I0OA 4UELA 5AQPB 2K9AA 4JI4T 2F4VT 4DV3T 2BBHA 4HWHA 4MHCA 4Z8XA 1XNQT 1FMWA 4A98A 4WYVA 2OV9A 1MIWA 4IL4A 5JRCB 1NWMX 2LOPA 3Q5EA 4KHPT 3ZN0B 1BR4A 4EZ4A 4ZI3D 5TAOA 3HL6A 3RRWA 2HH7A 2XY8B 5JDGA 3RIFA 3NRXA 3E0ZA 4HFDA 2XQ8A 4DIDB 2WBLA 5LNKA 3B57A 4H9OC 4X20E 1US7B 4HFVA 3E22E 2X9XA 3EI0A 5IUXA 2K48A 2YOEA 1BR1A 4LF8T 4ZZCA 1N34T 3N9PA 2VVNA 3HR0A 5LHIB 5JR9B 2KWHA 3N2KE 4YSYA 2A2FX 4DVDA 3Q5DA 3EABA 2MAWA 2Q9QB 4O4HE 2WY2A 5BR8T 3VRBA 3KBTA 3ZYKA 5L4HA 3RYCE 2NW8A 4O2AE 3DP7A 1MMDA 3RF1A 1VRBA 3ONLC 2H3RA 5LA6E 2LHRA 2DWGA 4JEUB 4PJMA 2XSAA 3H3AA 3PJAA 4TV9E 5HCMA 2LOSA 4TWDA 4DNDA 3MA9A 4IL9A 3VR9A 1D0YA 4EV6A 2VQFT 4DMWA 1X79A 1WYCA 4YFSA 2X51A 4KBMB 3AE1A 4L9IA 2LM9A 2B1EA 1AJ3A 1XNRT 5LGNB 4O4JE 3BQIA 4IE4A 4ZXLA 2E9XD 4LF6T 2QRXA 3ONJA 2LJLA 4YJ2E 1HNZT 3B5MA 2XSBA 2LSGA 5ABFA 4H9SE 4JI7T 1KNRA 2B76A 2WU2A 2YU2A 3MJXA 4GYRA 1B7TA 4EOZB 5FVKA 2XAJB 2W61A 4OK0A 5FXVA 1XMOT 5KX5E 4LMJA 2BVLA 2ACXA 3PTRB 4BAYB 3VU7H 2CMRA 3M65A 4ZI3C 1HX8A 3ZMSB 4H9QC 3PUXF 5J1GA 3ETVA 4JI1T 1LRZA 3NRYA 3KINB 4AQFC 5L47A 4DR2T 3KV9A 4NIQA 4O2BE 5JDLA 3RIAA 4JI8T 4U7IA 5AQVB 4TUYE 5AQTB 5AQJB 2JRKA 4QH4A 4AQFA 3KVBA 2CLYC 1YKEB 1UX5A 3UU5A 3LDQB 5FXXA 3QC9A 2KT9A 2J62A 2IHR1 1QUUA 3UU8A 3CX7B 2XHEB 4Q25A 3X1DA 1KFYA 4E7SA 2V1DB 3PU8A 5ABFB 3UU3A 2XAHB 3ANWB 3UUMA 1NENA 1XDPA 5H6QB 5AQQB 3CMLA 5AQOB 5H6RB 3AA0B 3ZYLA 1XZYA 3NVOA 2W67A 5FMNA 3AE6A 3AEFA 2CCQA 2DCFA 2VURA 5ABHA 1ZP0A 1D1CA 2M6IA 4I0UA 3QUJA 4ILUA 4I55E 3RH3A 3K8PC 4HWIB 3RI5A 4BJMA 5EZYE 1YQ4A 2WWUA 2ODVA 4TZ4C 1NEKA 5ABGA 2V6XA 3ESLA 2X0LB 5CFBA 3FXDB 2VKJA 5ADXL 2CLYB 1BR0A 3LBXA 4ZOLE 1IZNB 3OYZA 2CXLA 4P0AA 2ZM0A 2UUAT 4X1YE 2PJQA 3NBXX 4DV7T 1HF8A 2XQAA 5KDMC 2V26A 5AQUB 4DR7T 1UURA 3JAFA 5F8PA 4CXWA 3OTOT 2V7JA 2WU5A 3N9OA 2IUBA 5L3GB 4NUUA 4UIGA 3RYHE 2BKOA 2HN1A 4BA9A 4ILCA 2X67A 4CQIA 3TLSA 1JNRA 4AKHA 3AAIA 2CBIA 3VRAA 2X9HA 3VKGA 5DABA 3P4RA 5FYMA 4X62T 5LB7B 2XZEA 1MMNA 5J2TE 4CN1A 3T8OA 4COFA 2JJ9A 1KEYA 4YSXA 4O8SA 5HXHA 4P1NA 3AVSA 1I94T 2FUPA 3WI3A 3V5UA 4F6RC 1T72A 2C5KT 1T98A 4LFAT 1XDOA 2RP4A 2CM0A 4JI6T 5LGUB 2IMLA 2Q9QD 4AI6A 4HFCA 4IIJE 2ZMAA 1BR2A 5JDMA 4LMKA 2BS4A 4DV5T 2EHOA 4OYJA 2RA1A 2FBWA 4KMCA 1U5PA 2BG9E 4U31A 4DBRA 3FHNA 2XM1A 3RYFE 3P4SA 3U3IA 2BKNA 3AB3B 5E0OA 3WAKA 3NKZA 3SOLA 4JBWF 3AA6B 3FZMB 3N2GE 3LSVA 3PUVF 1ZHCA 1WLXA 2M67A 2WCAA 5FY7A 3ZMVB 5FY1A 2CXFA 5FVLA 2LLYA 2JQKA 3L8RA 3A8YC 2V7MA 4YY3T 3G06A 2V7IA 3U78A 2BS3A 3N9NA 2NWBA 2X0HA 3P50A 1JNZA 5HXSA 1W09A 2K5BB 3FZHB 3PURA 5L3DB 4JEHB 5AFUL 3PUZF 4UR9A 3IEEA 4Z90A 3ZCIA 1WFDA 4PFOA 2J47A 3PUQA 3H3MA 1EZ3A 2C5IT 4GK0E 4X66T 3CQXC 3IBPA 5L3FB 3N9MA 2IC9A 5M4YA 4JV5T 4PJNA 3ZEFB 4QWNB 3I9YA 2D9DA 4IDOA 3ABVA 1R8IA 3CVRA 2LSYA 5BMVE 2CE7A 3SFDA 1U4QA 2HPJA 5LBMA 1N36T 3CX8B 2NTXA 4H63H 4PFPA 5LMUT 2J4GA 1VCTA 2FJBA 4ILAA 4CN4A 2CEAA 3PDYA 5KXJA 4WZXA 1E2AA 2W4XA 2UUBT 4ZS3A 4H63V 4LF4T 2XQ6A 4B3ST 2I59A 2XQ7A 5JH7E 1Y01A 5HXEA 1LVKA 4YJ3E 4HWDA 4IE7A 4XZCA 3PUYF 2N1GA
chains in the Genus database with same CATH topology
2ACXA 3PTRB 4NUVA 4BAYB 2A3DA 3NZPA 3VU7H 2CMRA 3BK9A 3M65A 4ZI3C 4H9NC 4FI5A 1HX8A 4GK5E 2UXNB 3C4ZA 3ZMSB 4H9QC 5J1GA 1MNDA 3I1AA 3IHRA 1HTJF 3ETVA 2ODUA 1LRZA 3NRYA 3KINB 4PJJA 4AQFC 2JMKA 3RYIE 3C51A 2PFVA 2IC6A 1ZKEA 3KV9A 4O2BE 5JDLA 3ZN1B 3PUSA 2OA5A 4P0BA 1H7CA 3AA7B 3F31A 3UFEA 4B6XA 4EZHA 3L3PA 4TUYE 4U72A 1NAFA 3OYXA 1QSDA 2JRKA 4AQFA 3KVBA 2CLYC 4L5GA 1YKEB 2YK0A 4AKRB 1UX5A 5ETWA 5FXXA 3GN5A 4G63A 3RX6A 4ZI7E 3QC9A 2KT9A 2LEHA 4EB6E 5DQVA 3WAJA 4UF0B 2W62A 2EHOB 1QUUA 3FB2A 4PK4A 1MIVA 4CZZB 3CX7B 2VWAA 3K3OA 3UT5E 3ZPOA 2XASB 2NW7A 1HS7A 3ZYMA 5LXTE 2XHEB 4HE8A 1IJ6A 3V5SA 3UTKA 4TN7B 1ZEEA 3DJBA 2VL8A 4DBQA 4EXTA 3CQCB 3RKOA 4U74A 4E7SA 5CA1E 3N5LA 2V1DB 5FNVE 3AA1B 4N78D 4G2AA 5FXZA 2KINB 3KBUA 3PU8A 3R84B 2XAHB 1V9DA 3ANWB 3UUMA 2E9XB 4CXYA 4UVCB 4O4IE 4WBNE 2L9QA 5JDHA 1YD8G 5H6QB 3CMLA 1ZV4X 3CWZB 4OYKA 2X9WA 5H6RB 3AA0B 2YU1A 2L8KA 2MOZA 2PBIA 3ZYLA 4DO0A 1HG2A 3HKCE 2VK9A 3K3NA 1MMGA 1Y64B 3HI2A 3HKBE 5FMNA 5FP3A 2K24A 4ISTA 3ETUA 2D2SA 2DWKA 1D1AA 4I4TE 4TV8E 4ERRA 3H37A 2CCQA 2DCFA 4UVBB 4K0UA 3N2OA 1D1CA 1KK7A 4DMVA 4KP3C 2HPLA 2WM9A 3QUJA 4HKAA 4ILUA 4MALA 4I55E 5JVDE 3RH3A 4AXPA 3K8PC 3VKHA 2X68A 3PU3A 4X1IE 2P9BA 2DI4A 3CPZA 3O1HA 4BJMA 3J7Yq 3AAEB 5EZYE 2XTLA 4AKGA 2WWUA 2Q9QA 3RRCA 1O3XA 2ODVA 4TZ4C 5DJQC 2V7LA 2LHNA 4GIWA 4IHJE 4HTEA 2L3LA 5EK2A 3OBVE 3ESLA 4X1KE 4ZI2C 2X0LB 4ZI2D 2NP9A 3FXDB 3O9XA 2KWIB 2VKJA 5ADXL 4J2CA 2CLYB 1BR0A 5HWYA 3LBXA 5JDFA 3UUNA 3R6NA 3K3QC 3F57A 4ZHQE 4ZOLE 4IE5A 2ZM8A 2WMOA 2ES0A 3Q9DA 4HEAA 1IZNB 4QKNA 4CXXA 3OYZA 2VASA 4MBQA 5LHHB 2W63A 4EAHA 2QGSA 3OJAA 2WAUA 2ZM2A 3N9QA 5HXRA 3C4XA 5J2UE 2CXLA 3ZC0A 4XBFB 4P0AA 1MNEA 2ZM0A 3AVRA 4X1YE 2PJQA 3NBXX 1HF8A 2N2NA 1D0ZA 5IHYA 3HKDE 5KDMC 2V26A 4I50E 1FMVA 4C91A 5F8PA 4CXWA 4IE6A 5L2LA 3EUHA 5L3BB 2V7JA 3N9OA 3F2EA 4TX5A 3MXZA 5CB4E 3UULA 5L3GB 1LVFA 2E8IA 4NUUA 1IJ5A 3KFWX 2CWOA 3RPUA 5HXCA 4UIGA 2Z6EA 3RYHE 5FXWA 4PK6A 2YEVC 1MIYA 4BA9A 4C90A 2C0SA 4UEMA 3HA4A 1S35A 2X67A 3LJCA 4CQIA 3C50A 1LKXA 4AKHA 3AAIA 1YKHB 3SWHA 5LG4A 4E7ZA 4O4LE 2J1DG 2X9HA 4AKLA 5LJNA 3VKGA 5L3CB 3C98B 5DABA 2W00A 3AAAB 2LSJA 3IF8B 3KV6A 5JRCA 5FYMA 5LOVE 1HG5A 3KVAA 1MMNA 1OWAA 3S4UA 5J2TE 2KNDA 4IE0A 4WNKA 3W15B 1VOMA 3PE0A 4OHFA 3T8OA 4BJNA 3N9LA 1WYBA 5JREA 3TKLB 2JJ9A 2LT3A 1FIOA 1G73A 4O8SA 5L3EB 3ZJ2A 1WRDA 2A72A 4ADZA 5EK3A 3BQLA 5HXHA 5LHGB 3AVSA 4JLEA 2N9DA 4CI1B 1SA0E 3MACA 3CQGB 2JPFA 2WSSV 3Q2MA 3J9X1 3WI3A 3OKQA 1FEWA 4I43B 3V5UA 4F6RC 2V7KA 3EDUA 2KXPB 4L0RA 3GWHA 2NW9A 2H7OA 2C5KT 5LBQB 3KV4A 1T98A 5JR9C 4WW0A 2KMFA 2RP4A 4MLKA 2CM0A 3CX6B 4CI3B 4IDZA 1HFAA 5LJMA 2NTYA 2PG8A 4H9PC 2Q9QC 4YLHA 5LGUB 3MKDA 3LG7A 5EK4A 2C5JA 2Q9QD 3LFMA 4ANJA 2XQYA 3E08A 4AI6A 4QHOA 4IIJE 5JR9A 2ZMAA 1BR2A 5JDMA 2VKHA 2D5UA 4PAGA 2VB6A 4GOUA 4QX8B 3FXEB 2GK9A 2EHOA 3GA8A 3KV5A 4QXHB 2MTQA 2W0GA 4MFRA 5HAXA 4IGUA 5C8YE 5A1LA 1E1HB 4OYJA 2IAKA 2BDEA 2UXXB 2RA1A 4EYYR 4KMCA 4OFZA 3I9WA 3GN5B 3VHLA 1U5PA 3I0OA 4UELA 4DBRA 3FHNA 2K9AA 2D0TA 4YHJA 3RYFE 3QK6A 2JQQA 4AKIA 4ISSA 5DQWA 2LSKA 3U3IA 5JDNA 4EYUA 3C64A 4GYSA 4A56A 2Y8DA 3AB3B 4MHCA 4Z8XA 5E0OA 2KZ7B 3WAKA 3ANWA 5CA0E 1FMWA 3ZLIA 2BZBA 2DNXA 2LSIA 3SOLA 2YINA 1MIWA 2XAGB 3AA6B 2CA5A 2WMNA 3ZC1A 5JRCB 1NWMX 3EVYA 3N2GE 2X9YA 2LOPA 2Y48B 1ZHCA 1WLXA 2M67A 4PJLA 5FY7A 4EIWA 3ZMVB 3JC6D 4FJOA 3PUGA 5FY1A 2CXFA 3ZN0B 1BR4A 2VKOA 4EZ4A 4ZI3D 2CWYA 5TAOA 4HN9A 2V7MA 2ZLYA 1S94A 3HL6A 2HH7A 2Y6XA 4WBOA 3RC3A 3RRWA 5JDGA 1YW0A 2MYSA 3FBZA 5LP6E 2IW5B 2CXDA 3BQKA 3NRXA 3E0ZA 2V7IA 1OXZA 2WBLA 3U78A 5LNKA 3B57A 4H9RC 4H9OC 2QA7A 4X20E 1US7B 3N9NA 1G8XA 4HFVA 5KMGP 2NWBA 2XAFB 3E22E 3O1JA 2G0UA 3C4WA 3ZMUB 3PUAA 3P8CD 3A5XA 3ZMTB 2K5BB 2X9XA 5HXSA 3PURA 5L3DB 2K48A 4JEHB 1BR1A 5AFUL 2D0UA 3N9PA 3O4XE 4QX7B 3HR0A 2KLQA 5LCYA 5LHIB 2X66A 3I0QA 2KWHA 3N2KE 5JR9B 3L09A 2A2FX 3IEEA 4DVDA 4HGAA 3LK42 3NZQA 3ZCIA 5LYJE 2Q9QB 3CKDA 4PFOA 4O4HE 4QXBB 2H7VC 3PUQA 3MZKB 3EDVA 3KBTA 5JDQA 1Z0PA 3SRZA 1EZ3A 1KNZA 2C5IT 4GK0E 3ZYKA 5FY0A 3RYCE 4UV8B 2NW8A 2JMHA 3FBLA 3CQXC 3LBXB 4KUMB 3LK3B 3DP7A 4O2AE 4V1Av 4UVAB 3IBPA 5L3FB 3N9MA 1MMDA 2IC9A 1VRBA 4XAXB 5M4YA 3Q5WA 2H3RA 3KDSE 5LA6E 4PJNA 2LHRA 2EHOC 2DWGA 4JEUB 4QWNB 3ZEFB 3O1IA 3I9YA 2EHOD 1MMAA 4PJMA 2XUEA 3MK7C 3H3AA 3CVRA 4TV9E 2LSYA 4PNIA 4JUYA 3DTOA 2CE7A 5GONE 4ASKA 4CI2B 5BMVE 5F3JA 2LOSA 4PW8A 3ZMZB 4ZS2A 2MBGA 1U4QA 4DNDA 2HPJA 3MA9A 5LBMA 3CX8B 4UF0A 2NTXA 3P7IA 1D0YA 2VKDA 4H63H 4PFPA 1WR6A 4DMWA 1CUNA 1X79A 2DHRA 2NOXA 1WYCA 4YFSA 2X51A 1D1BA 3ONXA 4KBMB 5HWXA 1SHZC 5JQGE 4L9IA 2LM9A 2B1EA 2CEAA 1AJ3A 3ZJ1A 5LGNB 3PDYA 3GMIA 1UCUA 4O4JE 3BQIA 4IE4A 4UV9B 2E9XC 2LE8A 4PK5A 2E9XD 2SPCA 2LJLA 4YJ2E 3Q5XA 4ZS3A 4H63V 5HYAA 4P09A 4QXCB 1IAPA 3B13A 2LSGA 3LK2B 3SS1A 4H9SE 2DLRA 2I59A 4AQGA 5JH7E 4M1PA 2E9XA 5IYZE 3HKEE 2YU2A 3RC8A 5LGTB 1UX4A 1D0XA 5HXEA 3MJXA 3D0TA 3UUXB 4GYRA 1LVKA 4UXNB 4YJ3E 1B7TA 4IE7A 4XZCA 3JC6C 2N1GA 4EOZB 2XAJB 2W61A 4OK0A 1HCIA 2BVMA 5FXVA 3ZCJA 5KX5E 2XAQB 2BVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QX7 B;  4QXB B;  4QXC B;  4QXH B;  4TN7 B;  4QX8 B;  4QWN B; 
#chains in the Genus database with same CATH topology
 2A3D A;  3BK9 A;  4H9N C;  4FI5 A;  2UXN B;  3C4Z A;  2NR4 A;  2WP9 A;  4YSZ A;  4P0B A;  3QB5 A;  3F31 A;  4U72 A;  3OYX A;  1KF6 A;  3RIU C;  2CBJ A;  4B3R T;  1CHU A;  4DV6 T;  4ZI7 E;  2LEH A;  4EB6 E;  5LMN T;  2CHN A;  4X65 T;  3RIU A;  3FB2 A;  3ZPO A;  1HS7 A;  3ZYM A;  4TN7 B;  4AIU A;  4EXT A;  3CQC B;  4IDP A;  3RGL A;  3RLF F;  5CA1 E;  3N5L A;  5FNV E;  2I0M A;  3AA1 B;  4G2A A;  2KIN B;  3R84 B;  1V9D A;  4CXY A;  4O4I E;  5JDH A;  3ZT7 A;  5LG3 A;  2L8K A;  2PBI A;  4DO0 A;  1HG2 A;  3K3N A;  1MMG A;  2LKG A;  3HI2 A;  3ZKR A;  2BG9 A;  3ETU A;  2D2S A;  4I4T E;  4ERR A;  4JI0 T;  4K0U A;  4LFC T;  3AE8 A;  2P9B A;  3AE9 A;  5AQS B;  2R6G F;  3O1H A;  4AKG A;  3RRC A;  4IDN A;  4QH1 A;  2LHN A;  4Z91 A;  3AED A;  5AQG B;  3OBV E;  4X1K E;  4ZI2 C;  2NP9 A;  2KWI B;  2V5C A;  5F5W A;  5HWY A;  5JDF A;  3F57 A;  4ZHQ E;  4IE5 A;  1KNP A;  3Q9D A;  4HEA A;  2IIU A;  5LHH B;  5HEJ A;  4EAH A;  3SFE A;  2QGS A;  4KHZ F;  3N9Q A;  3C4X A;  5J2U E;  4XBF B;  4TWF A;  2WDQ A;  3T1Y T;  4EGW A;  3P4Q A;  3RQU A;  4AQY T;  5IHY A;  3AEG A;  4I50 E;  4HWF A;  2W66 A;  2CWO A;  5HXC A;  2YEV C;  1MIY A;  5HEH A;  1S35 A;  5AQH B;  5LG4 A;  4TNV A;  1J5E T;  2XM2 A;  4O4L E;  2AE9 A;  4HFE A;  1OED E;  2LSJ A;  4DR6 T;  1HG5 A;  3KVA A;  2KND A;  1VOM A;  4BJN A;  3N9L A;  5C3J A;  1FIO A;  3ZJ2 A;  5LHG B;  4U2Z A;  2UU9 T;  2N9D A;  3CQG B;  2JPF A;  2WSS V;  4NXM T;  5ABE A;  1FEW A;  2H7O A;  4IDQ A;  3KV4 A;  2WWV A;  4WW0 A;  3CX6 B;  4CI3 B;  5AQN B;  1HFA A;  3LG7 A;  1YXR A;  2XQY A;  2V6Y A;  3E08 A;  3A7M A;  2VKH A;  2BKP A;  2D5U A;  4GOU A;  4TWH A;  3GA8 A;  5JTG A;  2MTQ A;  4CN6 A;  3EHZ A;  1I6Z A;  4JI2 T;  3OVU A;  2D0T A;  2JIW A;  4YHJ A;  3TLT A;  3QK6 A;  1UUS A;  2JQQ A;  4ISS A;  4EYU A;  3C64 A;  2QYW A;  2Y8D A;  3T1H T;  4A97 A;  2A9U A;  5CA0 E;  3ZLI A;  2DNX A;  2LSI A;  2YIN A;  2XAG B;  5AQI B;  3ZC1 A;  4DR5 T;  2X9Y A;  2Y48 B;  4EIW A;  4PJL A;  4ZZB A;  3JC6 D;  4LF7 T;  2X0Y A;  2KSR A;  1N32 T;  1XWM A;  4TNW A;  2VKO A;  2CWY A;  4LF9 T;  4WBO A;  3RC3 A;  2IW5 B;  2DL1 A;  1OXZ A;  1G8X A;  5KMG P;  3O1J A;  3ZMU B;  2E2A A;  3P8C D;  3A5X A;  3ZMT B;  1HR0 T;  3O4X E;  4QX7 B;  2KLQ A;  3I0Q A;  4LF5 T;  3L09 A;  4JI5 T;  4EED A;  5LYJ E;  3TLW A;  3RHW A;  2BS2 A;  2H7V C;  3EDV A;  2VQE T;  1Z0P A;  3SRZ A;  5FY0 A;  4UV8 B;  2JMH A;  2WS3 A;  3FBL A;  3LBX B;  4V1A v;  3LK3 B;  1W0B A;  3Q5W A;  3KDS E;  2XQ9 A;  5L4E A;  2EHO C;  3O1I A;  4ZEY A;  1MMA A;  4DV4 T;  2XUE A;  4JUY A;  5F3J A;  3DTO A;  5GON E;  4U3C A;  4ZS2 A;  2MBG A;  3P7I A;  3PV0 F;  2W2U A;  1T7S A;  4YTP A;  1CUN A;  2DHR A;  2NOX A;  2FJE A;  3ONX A;  2FJA A;  5HWX A;  5JQG E;  3UQ7 A;  2E5L T;  1UCU A;  4PK5 A;  2OLT A;  3Q5X A;  5HYA A;  4P09 A;  1IAP A;  4GKJ T;  4U7Y A;  3UUB A;  5LGT B;  1UX4 A;  4UXN B;  3PJA J;  3JC6 C;  1HCI A;  2BVM A;  3ZCJ A;  1IBK T;  3P4W A;  4NUV A;  1GQE A;  1MND A;  1HTJ F;  4PJJ A;  3RYI E;  2UXC T;  3C51 A;  3QNU A;  2PFV A;  2IC6 A;  2XQ5 A;  3ZN1 B;  2OA5 A;  3NWI A;  3AA7 B;  4EZH A;  3L3P A;  1OED A;  1Z8U A;  1NAF A;  1YQ3 A;  4L5G A;  2YK0 A;  3P4P A;  1W0A A;  4KI0 F;  5ETW A;  3GN5 A;  5DQV A;  1M62 A;  2EHO B;  1SE7 A;  2VWA A;  3K3O A;  3UT5 E;  2XAS B;  2YDS A;  3PUW F;  4HE8 A;  3V5S A;  1QLB A;  1ZEE A;  2VL8 A;  4DBQ A;  4U74 A;  3ZT6 A;  3RQW A;  4N78 D;  2YDQ A;  3KBU A;  4WBN E;  2JQH A;  1YD8 G;  2HN2 A;  4OYK A;  2WQY A;  2X9W A;  2YU1 A;  3HKC E;  2VK9 A;  1Y64 B;  4DV1 T;  5FP3 A;  4IST A;  1D1A A;  4TV8 E;  5HEG A;  4UVB B;  2CRB A;  1KK7 A;  2H88 A;  2WM9 A;  4HKA A;  5AQF B;  4HWC A;  2X68 A;  3AEB A;  4X1I E;  2LKH A;  2DI4 A;  3CPZ A;  2M6B A;  3J7Y q;  2XQ4 A;  3AAE B;  3CK6 A;  2XTL A;  2Q9Q A;  1O3X A;  5DJQ C;  2V7L A;  4GIW A;  2HHH T;  2WB5 A;  4IHJ E;  4ZI2 D;  3O9X A;  4J2C A;  4EEB A;  3R6N A;  4DV2 T;  5FL0 A;  2LRL A;  4GKK T;  3UFG A;  2VAS A;  2W63 A;  2WAU A;  2ZM2 A;  5HXR A;  4YTN A;  3JCF A;  2N2N A;  1D0Z A;  1J1J A;  4QH5 A;  5HEU A;  4C91 A;  4JI3 T;  4ILB A;  5L2L A;  3MXZ A;  2WDR A;  5CB4 E;  3UUL A;  1HX1 B;  2E8I A;  4PK6 A;  4C90 A;  2C0S A;  3HA4 A;  3LJC A;  4U33 A;  3C50 A;  3SWH A;  1YKH B;  2AXD S;  2WZH A;  4E7Z A;  2J1D G;  5L3C B;  2W00 A;  3IF8 B;  5LOV E;  3S4U A;  1OWA A;  4IE0 A;  4HFH A;  4WNK A;  3EAM A;  5JRE A;  2BG9 C;  1G73 A;  4KX6 A;  1WRD A;  2A72 A;  2VL0 A;  3ZSS A;  4CI1 B;  1SA0 E;  3FZL B;  3MAC A;  3Q2M A;  4K0K T;  4NPP A;  3OKQ A;  4I43 B;  2V7K A;  2KXP B;  3GWH A;  2NW9 A;  3AE5 A;  5LBQ B;  3QB5 K;  4B3T T;  3AEA A;  2KMF A;  5FKY A;  3ZT5 A;  2PG8 A;  2WZI A;  3MKD A;  5EK4 A;  3LFM A;  1UK5 A;  4YHH T;  4DUZ T;  2JQ9 A;  3AEC A;  1VCS A;  2VB6 A;  3AEE A;  2GK9 A;  4QXH B;  1IBM T;  4LFB T;  4MFR A;  4IGU A;  5A1L A;  4X64 T;  4EYY R;  4OFZ A;  3I9W A;  3RKG A;  3ZST A;  2BBJ A;  4AKI A;  5DQW A;  2LSK A;  1J5W A;  1UGO A;  5JDN A;  4GYS A;  4A56 A;  2MPK A;  1XMQ T;  1WCR A;  4B3M T;  2KZ7 B;  3ANW A;  2I6H A;  5CGM A;  2BZB A;  4OX9 T;  2CA5 A;  2WMN A;  3AE4 A;  3EVY A;  4U2Y A;  4FJO A;  3PUG A;  4YT0 A;  4IRE A;  4HN9 A;  2ZLY A;  1S94 A;  2Y6X A;  5LP6 E;  1YW0 A;  2MYS A;  3FBZ A;  2CXD A;  3BQK A;  2ACZ A;  4H9R C;  2QA7 A;  4DUY T;  2BG9 B;  2XAF B;  4YXD A;  2G0U A;  3C4W A;  2LRK A;  3TLU A;  3PUA A;  5AQM B;  2D0U A;  5LCY A;  2X66 A;  2LM2 A;  3UU4 A;  4LML A;  4HGA A;  2YN6 A;  3LK4 2;  3NZQ A;  3CKD A;  4QXB B;  3MZK B;  1WR0 A;  5JDQ A;  1SUM B;  1KNZ A;  5AQK B;  3UU6 A;  4KUM B;  4UVA B;  2UXD T;  1ZOY A;  4XAX B;  2VVS A;  5HEO A;  2RPA A;  1E7P A;  2EHO D;  3MK7 C;  1FJG T;  4PNI A;  4ASK A;  4CI2 B;  4PW8 A;  3IA3 A;  3ZMZ B;  3JAD A;  5AQR B;  4UF0 A;  5IWA T;  2VKD A;  1WR6 A;  3VR8 A;  1D1B A;  1SHZ C;  3ZJ1 A;  4UV9 B;  1HNW T;  2E9X C;  2LE8 A;  3JAE A;  3FZF B;  2SPC A;  5FL1 A;  4QXC B;  3B13 A;  5J0Z A;  3LK2 B;  3SS1 A;  2XPK A;  3UQ4 A;  2DLR A;  4AQG A;  4M1P A;  2E9X A;  5IYZ E;  3HKE E;  3RC8 A;  1D0X A;  3D0T A;  3UUX B;  1N33 T;  2IDO B;  3K1S A;  4F8H A;  3L39 A;  2XAQ B;  3GMI A;  3OPC A;  3NZP A;  3CIR A;  1IBL T;  4GK5 E;  3I1A A;  3IHR A;  2ODU A;  2FJD A;  2JMK A;  1ZKE A;  5CJ5 A;  3PUS A;  1H7C A;  3UFE A;  4B6X A;  1DU2 A;  4HFI A;  1QSD A;  4AKR B;  4DR4 T;  4G63 A;  3RX6 A;  2V6Y B;  5C2T A;  3WAJ A;  4UF0 B;  2W62 A;  2XQ3 A;  4PK4 A;  1MIV A;  4CZZ B;  3TLV A;  2NW7 A;  5LXT E;  2V5D A;  1IJ6 A;  1T8B A;  3UTK A;  3DJB A;  1M7K A;  3RKO A;  4DR1 T;  5FXZ A;  2E9X B;  4IT4 A;  4UVC B;  2L9Q A;  3AXJ A;  2PTF A;  1ZV4 X;  3CWZ B;  2MOZ A;  5HCJ A;  3HKB E;  2V8S V;  4YTM A;  2K24 A;  2DWK A;  2CHO A;  4A5X A;  3H37 A;  2CPT A;  3N2O A;  4DMV A;  4KP3 C;  2HPL A;  4AXP A;  4MAL A;  5JVD E;  3VKH A;  3PU3 A;  4HTE A;  2L3L A;  5EK2 A;  4DR3 T;  3FZK B;  3M3Z B;  3UUN A;  3K3Q C;  2ZM6 T;  2ZM8 A;  2WMO A;  2ES0 A;  4QKN A;  4CXX A;  4MBQ A;  1OED C;  2WDV A;  4NXN T;  3OJA A;  3ZC0 A;  1MNE A;  3AVR A;  3HKD E;  1FMV A;  4IE6 A;  1X9B A;  3EUH A;  5L3B B;  1HNX T;  3AXJ B;  3F2E A;  4TX5 A;  2H89 A;  1LVF A;  1IJ5 A;  3KFW X;  3RPU A;  2Z6E A;  1W9R A;  5FXW A;  3AE3 A;  4UEM A;  1LKX A;  2XJ7 A;  5AQL B;  2UUC T;  4AKL A;  5LJN A;  3C98 B;  4HFB A;  3AAA B;  4JYA T;  3KV6 A;  5JRC A;  3AE7 A;  2QVA A;  3W15 B;  2UXB T;  3PE0 A;  4OHF A;  1WYB A;  3TKL B;  2LT3 A;  4X5T A;  5L3E B;  4ADZ A;  5EK3 A;  3BQL A;  4JLE A;  3QOF A;  3J9X 1;  2K3W A;  3EDU A;  4L0R A;  5JR9 C;  4AIS A;  4MLK A;  4IDZ A;  5LJM A;  2NTY A;  4H9P C;  2Q9Q C;  4YLH A;  2C5J A;  4ANJ A;  4DV0 T;  4QHO A;  5JR9 A;  4PAG A;  4QX8 B;  3FXE B;  1OED B;  3KV5 A;  2W0G A;  5C8Y E;  5HAX A;  2YDR A;  1E1H B;  2IAK A;  2BDE A;  2UXX B;  2YKS A;  1L0V A;  3AE2 A;  3GN5 B;  2E5V A;  3VHL A;  3I0O A;  4UEL A;  5AQP B;  2K9A A;  4JI4 T;  2F4V T;  4DV3 T;  2BBH A;  4HWH A;  4MHC A;  4Z8X A;  1XNQ T;  1FMW A;  4A98 A;  4WYV A;  2OV9 A;  1MIW A;  4IL4 A;  5JRC B;  1NWM X;  2LOP A;  3Q5E A;  4KHP T;  3ZN0 B;  1BR4 A;  4EZ4 A;  4ZI3 D;  5TAO A;  3HL6 A;  3RRW A;  2HH7 A;  2XY8 B;  5JDG A;  3RIF A;  3NRX A;  3E0Z A;  4HFD A;  2XQ8 A;  4DID B;  2WBL A;  5LNK A;  3B57 A;  4H9O C;  4X20 E;  1US7 B;  4HFV A;  3E22 E;  2X9X A;  3EI0 A;  5IUX A;  2K48 A;  2YOE A;  1BR1 A;  4LF8 T;  4ZZC A;  1N34 T;  3N9P A;  2VVN A;  3HR0 A;  5LHI B;  5JR9 B;  2KWH A;  3N2K E;  4YSY A;  2A2F X;  4DVD A;  3Q5D A;  3EAB A;  2MAW A;  2Q9Q B;  4O4H E;  2WY2 A;  5BR8 T;  3VRB A;  3KBT A;  3ZYK A;  5L4H A;  3RYC E;  2NW8 A;  4O2A E;  3DP7 A;  1MMD A;  3RF1 A;  1VRB A;  3ONL C;  2H3R A;  5LA6 E;  2LHR A;  2DWG A;  4JEU B;  4PJM A;  2XSA A;  3H3A A;  3PJA A;  4TV9 E;  5HCM A;  2LOS A;  4TWD A;  4DND A;  3MA9 A;  4IL9 A;  3VR9 A;  1D0Y A;  4EV6 A;  2VQF T;  4DMW A;  1X79 A;  1WYC A;  4YFS A;  2X51 A;  4KBM B;  3AE1 A;  4L9I A;  2LM9 A;  2B1E A;  1AJ3 A;  1XNR T;  5LGN B;  4O4J E;  3BQI A;  4IE4 A;  4ZXL A;  2E9X D;  4LF6 T;  2QRX A;  3ONJ A;  2LJL A;  4YJ2 E;  1HNZ T;  3B5M A;  2XSB A;  2LSG A;  5ABF A;  4H9S E;  4JI7 T;  1KNR A;  2B76 A;  2WU2 A;  2YU2 A;  3MJX A;  4GYR A;  1B7T A;  4EOZ B;  5FVK A;  2XAJ B;  2W61 A;  4OK0 A;  5FXV A;  1XMO T;  5KX5 E;  4LMJ A;  2BVL A;  2ACX A;  3PTR B;  4BAY B;  3VU7 H;  2CMR A;  3M65 A;  4ZI3 C;  1HX8 A;  3ZMS B;  4H9Q C;  3PUX F;  5J1G A;  3ETV A;  4JI1 T;  1LRZ A;  3NRY A;  3KIN B;  4AQF C;  5L47 A;  4DR2 T;  3KV9 A;  4NIQ A;  4O2B E;  5JDL A;  3RIA A;  4JI8 T;  4U7I A;  5AQV B;  4TUY E;  5AQT B;  5AQJ B;  2JRK A;  4QH4 A;  4AQF A;  3KVB A;  2CLY C;  1YKE B;  1UX5 A;  3UU5 A;  3LDQ B;  5FXX A;  3QC9 A;  2KT9 A;  2J62 A;  2IHR 1;  1QUU A;  3UU8 A;  3CX7 B;  2XHE B;  4Q25 A;  3X1D A;  1KFY A;  4E7S A;  2V1D B;  3PU8 A;  5ABF B;  3UU3 A;  2XAH B;  3ANW B;  3UUM A;  1NEN A;  1XDP A;  5H6Q B;  5AQQ B;  3CML A;  5AQO B;  5H6R B;  3AA0 B;  3ZYL A;  1XZY A;  3NVO A;  2W67 A;  5FMN A;  3AE6 A;  3AEF A;  2CCQ A;  2DCF A;  2VUR A;  5ABH A;  1ZP0 A;  1D1C A;  2M6I A;  4I0U A;  3QUJ A;  4ILU A;  4I55 E;  3RH3 A;  3K8P C;  4HWI B;  3RI5 A;  4BJM A;  5EZY E;  1YQ4 A;  2WWU A;  2ODV A;  4TZ4 C;  1NEK A;  5ABG A;  2V6X A;  3ESL A;  2X0L B;  5CFB A;  3FXD B;  2VKJ A;  5ADX L;  2CLY B;  1BR0 A;  3LBX A;  4ZOL E;  1IZN B;  3OYZ A;  2CXL A;  4P0A A;  2ZM0 A;  2UUA T;  4X1Y E;  2PJQ A;  3NBX X;  4DV7 T;  1HF8 A;  2XQA A;  5KDM C;  2V26 A;  5AQU B;  4DR7 T;  1UUR A;  3JAF A;  5F8P A;  4CXW A;  3OTO T;  2V7J A;  2WU5 A;  3N9O A;  2IUB A;  5L3G B;  4NUU A;  4UIG A;  3RYH E;  2BKO A;  2HN1 A;  4BA9 A;  4ILC A;  2X67 A;  4CQI A;  3TLS A;  1JNR A;  4AKH A;  3AAI A;  2CBI A;  3VRA A;  2X9H A;  3VKG A;  5DAB A;  3P4R A;  5FYM A;  4X62 T;  5LB7 B;  2XZE A;  1MMN A;  5J2T E;  4CN1 A;  3T8O A;  4COF A;  2JJ9 A;  1KEY A;  4YSX A;  4O8S A;  5HXH A;  4P1N A;  3AVS A;  1I94 T;  2FUP A;  3WI3 A;  3V5U A;  4F6R C;  1T72 A;  2C5K T;  1T98 A;  4LFA T;  1XDO A;  2RP4 A;  2CM0 A;  4JI6 T;  5LGU B;  2IML A;  2Q9Q D;  4AI6 A;  4HFC A;  4IIJ E;  2ZMA A;  1BR2 A;  5JDM A;  4LMK A;  2BS4 A;  4DV5 T;  2EHO A;  4OYJ A;  2RA1 A;  2FBW A;  4KMC A;  1U5P A;  2BG9 E;  4U31 A;  4DBR A;  3FHN A;  2XM1 A;  3RYF E;  3P4S A;  3U3I A;  2BKN A;  3AB3 B;  5E0O A;  3WAK A;  3NKZ A;  3SOL A;  4JBW F;  3AA6 B;  3FZM B;  3N2G E;  3LSV A;  3PUV F;  1ZHC A;  1WLX A;  2M67 A;  2WCA A;  5FY7 A;  3ZMV B;  5FY1 A;  2CXF A;  5FVL A;  2LLY A;  2JQK A;  3L8R A;  3A8Y C;  2V7M A;  4YY3 T;  3G06 A;  2V7I A;  3U78 A;  2BS3 A;  3N9N A;  2NWB A;  2X0H A;  3P50 A;  1JNZ A;  5HXS A;  1W09 A;  2K5B B;  3FZH B;  3PUR A;  5L3D B;  4JEH B;  5AFU L;  3PUZ F;  4UR9 A;  3IEE A;  4Z90 A;  3ZCI A;  1WFD A;  4PFO A;  2J47 A;  3PUQ A;  3H3M A;  1EZ3 A;  2C5I T;  4GK0 E;  4X66 T;  3CQX C;  3IBP A;  5L3F B;  3N9M A;  2IC9 A;  5M4Y A;  4JV5 T;  4PJN A;  3ZEF B;  4QWN B;  3I9Y A;  2D9D A;  4IDO A;  3ABV A;  1R8I A;  3CVR A;  2LSY A;  5BMV E;  2CE7 A;  3SFD A;  1U4Q A;  2HPJ A;  5LBM A;  1N36 T;  3CX8 B;  2NTX A;  4H63 H;  4PFP A;  5LMU T;  2J4G A;  1VCT A;  2FJB A;  4ILA A;  4CN4 A;  2CEA A;  3PDY A;  5KXJ A;  4WZX A;  1E2A A;  2W4X A;  2UUB T;  4ZS3 A;  4H63 V;  4LF4 T;  2XQ6 A;  4B3S T;  2I59 A;  2XQ7 A;  5JH7 E;  1Y01 A;  5HXE A;  1LVK A;  4YJ3 E;  4HWD A;  4IE7 A;  4XZC A;  3PUY F;  2N1G A; 
#chains in the Genus database with same CATH homology
 2ACX A;  3PTR B;  4NUV A;  4BAY B;  2A3D A;  3NZP A;  3VU7 H;  2CMR A;  3BK9 A;  3M65 A;  4ZI3 C;  4H9N C;  4FI5 A;  1HX8 A;  4GK5 E;  2UXN B;  3C4Z A;  3ZMS B;  4H9Q C;  5J1G A;  1MND A;  3I1A A;  3IHR A;  1HTJ F;  3ETV A;  2ODU A;  1LRZ A;  3NRY A;  3KIN B;  4PJJ A;  4AQF C;  2JMK A;  3RYI E;  3C51 A;  2PFV A;  2IC6 A;  1ZKE A;  3KV9 A;  4O2B E;  5JDL A;  3ZN1 B;  3PUS A;  2OA5 A;  4P0B A;  1H7C A;  3AA7 B;  3F31 A;  3UFE A;  4B6X A;  4EZH A;  3L3P A;  4TUY E;  4U72 A;  1NAF A;  3OYX A;  1QSD A;  2JRK A;  4AQF A;  3KVB A;  2CLY C;  4L5G A;  1YKE B;  2YK0 A;  4AKR B;  1UX5 A;  5ETW A;  5FXX A;  3GN5 A;  4G63 A;  3RX6 A;  4ZI7 E;  3QC9 A;  2KT9 A;  2LEH A;  4EB6 E;  5DQV A;  3WAJ A;  4UF0 B;  2W62 A;  2EHO B;  1QUU A;  3FB2 A;  4PK4 A;  1MIV A;  4CZZ B;  3CX7 B;  2VWA A;  3K3O A;  3UT5 E;  3ZPO A;  2XAS B;  2NW7 A;  1HS7 A;  3ZYM A;  5LXT E;  2XHE B;  4HE8 A;  1IJ6 A;  3V5S A;  3UTK A;  4TN7 B;  1ZEE A;  3DJB A;  2VL8 A;  4DBQ A;  4EXT A;  3CQC B;  3RKO A;  4U74 A;  4E7S A;  5CA1 E;  3N5L A;  2V1D B;  5FNV E;  3AA1 B;  4N78 D;  4G2A A;  5FXZ A;  2KIN B;  3KBU A;  3PU8 A;  3R84 B;  2XAH B;  1V9D A;  3ANW B;  3UUM A;  2E9X B;  4CXY A;  4UVC B;  4O4I E;  4WBN E;  2L9Q A;  5JDH A;  1YD8 G;  5H6Q B;  3CML A;  1ZV4 X;  3CWZ B;  4OYK A;  2X9W A;  5H6R B;  3AA0 B;  2YU1 A;  2L8K A;  2MOZ A;  2PBI A;  3ZYL A;  4DO0 A;  1HG2 A;  3HKC E;  2VK9 A;  3K3N A;  1MMG A;  1Y64 B;  3HI2 A;  3HKB E;  5FMN A;  5FP3 A;  2K24 A;  4IST A;  3ETU A;  2D2S A;  2DWK A;  1D1A A;  4I4T E;  4TV8 E;  4ERR A;  3H37 A;  2CCQ A;  2DCF A;  4UVB B;  4K0U A;  3N2O A;  1D1C A;  1KK7 A;  4DMV A;  4KP3 C;  2HPL A;  2WM9 A;  3QUJ A;  4HKA A;  4ILU A;  4MAL A;  4I55 E;  5JVD E;  3RH3 A;  4AXP A;  3K8P C;  3VKH A;  2X68 A;  3PU3 A;  4X1I E;  2P9B A;  2DI4 A;  3CPZ A;  3O1H A;  4BJM A;  3J7Y q;  3AAE B;  5EZY E;  2XTL A;  4AKG A;  2WWU A;  2Q9Q A;  3RRC A;  1O3X A;  2ODV A;  4TZ4 C;  5DJQ C;  2V7L A;  2LHN A;  4GIW A;  4IHJ E;  4HTE A;  2L3L A;  5EK2 A;  3OBV E;  3ESL A;  4X1K E;  4ZI2 C;  2X0L B;  4ZI2 D;  2NP9 A;  3FXD B;  3O9X A;  2KWI B;  2VKJ A;  5ADX L;  4J2C A;  2CLY B;  1BR0 A;  5HWY A;  3LBX A;  5JDF A;  3UUN A;  3R6N A;  3K3Q C;  3F57 A;  4ZHQ E;  4ZOL E;  4IE5 A;  2ZM8 A;  2WMO A;  2ES0 A;  3Q9D A;  4HEA A;  1IZN B;  4QKN A;  4CXX A;  3OYZ A;  2VAS A;  4MBQ A;  5LHH B;  2W63 A;  4EAH A;  2QGS A;  3OJA A;  2WAU A;  2ZM2 A;  3N9Q A;  5HXR A;  3C4X A;  5J2U E;  2CXL A;  3ZC0 A;  4XBF B;  4P0A A;  1MNE A;  2ZM0 A;  3AVR A;  4X1Y E;  2PJQ A;  3NBX X;  1HF8 A;  2N2N A;  1D0Z A;  5IHY A;  3HKD E;  5KDM C;  2V26 A;  4I50 E;  1FMV A;  4C91 A;  5F8P A;  4CXW A;  4IE6 A;  5L2L A;  3EUH A;  5L3B B;  2V7J A;  3N9O A;  3F2E A;  4TX5 A;  3MXZ A;  5CB4 E;  3UUL A;  5L3G B;  1LVF A;  2E8I A;  4NUU A;  1IJ5 A;  3KFW X;  2CWO A;  3RPU A;  5HXC A;  4UIG A;  2Z6E A;  3RYH E;  5FXW A;  4PK6 A;  2YEV C;  1MIY A;  4BA9 A;  4C90 A;  2C0S A;  4UEM A;  3HA4 A;  1S35 A;  2X67 A;  3LJC A;  4CQI A;  3C50 A;  1LKX A;  4AKH A;  3AAI A;  1YKH B;  3SWH A;  5LG4 A;  4E7Z A;  4O4L E;  2J1D G;  2X9H A;  4AKL A;  5LJN A;  3VKG A;  5L3C B;  3C98 B;  5DAB A;  2W00 A;  3AAA B;  2LSJ A;  3IF8 B;  3KV6 A;  5JRC A;  5FYM A;  5LOV E;  1HG5 A;  3KVA A;  1MMN A;  1OWA A;  3S4U A;  5J2T E;  2KND A;  4IE0 A;  4WNK A;  3W15 B;  1VOM A;  3PE0 A;  4OHF A;  3T8O A;  4BJN A;  3N9L A;  1WYB A;  5JRE A;  3TKL B;  2JJ9 A;  2LT3 A;  1FIO A;  1G73 A;  4O8S A;  5L3E B;  3ZJ2 A;  1WRD A;  2A72 A;  4ADZ A;  5EK3 A;  3BQL A;  5HXH A;  5LHG B;  3AVS A;  4JLE A;  2N9D A;  4CI1 B;  1SA0 E;  3MAC A;  3CQG B;  2JPF A;  2WSS V;  3Q2M A;  3J9X 1;  3WI3 A;  3OKQ A;  1FEW A;  4I43 B;  3V5U A;  4F6R C;  2V7K A;  3EDU A;  2KXP B;  4L0R A;  3GWH A;  2NW9 A;  2H7O A;  2C5K T;  5LBQ B;  3KV4 A;  1T98 A;  5JR9 C;  4WW0 A;  2KMF A;  2RP4 A;  4MLK A;  2CM0 A;  3CX6 B;  4CI3 B;  4IDZ A;  1HFA A;  5LJM A;  2NTY A;  2PG8 A;  4H9P C;  2Q9Q C;  4YLH A;  5LGU B;  3MKD A;  3LG7 A;  5EK4 A;  2C5J A;  2Q9Q D;  3LFM A;  4ANJ A;  2XQY A;  3E08 A;  4AI6 A;  4QHO A;  4IIJ E;  5JR9 A;  2ZMA A;  1BR2 A;  5JDM A;  2VKH A;  2D5U A;  4PAG A;  2VB6 A;  4GOU A;  4QX8 B;  3FXE B;  2GK9 A;  2EHO A;  3GA8 A;  3KV5 A;  4QXH B;  2MTQ A;  2W0G A;  4MFR A;  5HAX A;  4IGU A;  5C8Y E;  5A1L A;  1E1H B;  4OYJ A;  2IAK A;  2BDE A;  2UXX B;  2RA1 A;  4EYY R;  4KMC A;  4OFZ A;  3I9W A;  3GN5 B;  3VHL A;  1U5P A;  3I0O A;  4UEL A;  4DBR A;  3FHN A;  2K9A A;  2D0T A;  4YHJ A;  3RYF E;  3QK6 A;  2JQQ A;  4AKI A;  4ISS A;  5DQW A;  2LSK A;  3U3I A;  5JDN A;  4EYU A;  3C64 A;  4GYS A;  4A56 A;  2Y8D A;  3AB3 B;  4MHC A;  4Z8X A;  5E0O A;  2KZ7 B;  3WAK A;  3ANW A;  5CA0 E;  1FMW A;  3ZLI A;  2BZB A;  2DNX A;  2LSI A;  3SOL A;  2YIN A;  1MIW A;  2XAG B;  3AA6 B;  2CA5 A;  2WMN A;  3ZC1 A;  5JRC B;  1NWM X;  3EVY A;  3N2G E;  2X9Y A;  2LOP A;  2Y48 B;  1ZHC A;  1WLX A;  2M67 A;  4PJL A;  5FY7 A;  4EIW A;  3ZMV B;  3JC6 D;  4FJO A;  3PUG A;  5FY1 A;  2CXF A;  3ZN0 B;  1BR4 A;  2VKO A;  4EZ4 A;  4ZI3 D;  2CWY A;  5TAO A;  4HN9 A;  2V7M A;  2ZLY A;  1S94 A;  3HL6 A;  2HH7 A;  2Y6X A;  4WBO A;  3RC3 A;  3RRW A;  5JDG A;  1YW0 A;  2MYS A;  3FBZ A;  5LP6 E;  2IW5 B;  2CXD A;  3BQK A;  3NRX A;  3E0Z A;  2V7I A;  1OXZ A;  2WBL A;  3U78 A;  5LNK A;  3B57 A;  4H9R C;  4H9O C;  2QA7 A;  4X20 E;  1US7 B;  3N9N A;  1G8X A;  4HFV A;  5KMG P;  2NWB A;  2XAF B;  3E22 E;  3O1J A;  2G0U A;  3C4W A;  3ZMU B;  3PUA A;  3P8C D;  3A5X A;  3ZMT B;  2K5B B;  2X9X A;  5HXS A;  3PUR A;  5L3D B;  2K48 A;  4JEH B;  1BR1 A;  5AFU L;  2D0U A;  3N9P A;  3O4X E;  4QX7 B;  3HR0 A;  2KLQ A;  5LCY A;  5LHI B;  2X66 A;  3I0Q A;  2KWH A;  3N2K E;  5JR9 B;  3L09 A;  2A2F X;  3IEE A;  4DVD A;  4HGA A;  3LK4 2;  3NZQ A;  3ZCI A;  5LYJ E;  2Q9Q B;  3CKD A;  4PFO A;  4O4H E;  4QXB B;  2H7V C;  3PUQ A;  3MZK B;  3EDV A;  3KBT A;  5JDQ A;  1Z0P A;  3SRZ A;  1EZ3 A;  1KNZ A;  2C5I T;  4GK0 E;  3ZYK A;  5FY0 A;  3RYC E;  4UV8 B;  2NW8 A;  2JMH A;  3FBL A;  3CQX C;  3LBX B;  4KUM B;  3LK3 B;  3DP7 A;  4O2A E;  4V1A v;  4UVA B;  3IBP A;  5L3F B;  3N9M A;  1MMD A;  2IC9 A;  1VRB A;  4XAX B;  5M4Y A;  3Q5W A;  2H3R A;  3KDS E;  5LA6 E;  4PJN A;  2LHR A;  2EHO C;  2DWG A;  4JEU B;  4QWN B;  3ZEF B;  3O1I A;  3I9Y A;  2EHO D;  1MMA A;  4PJM A;  2XUE A;  3MK7 C;  3H3A A;  3CVR A;  4TV9 E;  2LSY A;  4PNI A;  4JUY A;  3DTO A;  2CE7 A;  5GON E;  4ASK A;  4CI2 B;  5BMV E;  5F3J A;  2LOS A;  4PW8 A;  3ZMZ B;  4ZS2 A;  2MBG A;  1U4Q A;  4DND A;  2HPJ A;  3MA9 A;  5LBM A;  3CX8 B;  4UF0 A;  2NTX A;  3P7I A;  1D0Y A;  2VKD A;  4H63 H;  4PFP A;  1WR6 A;  4DMW A;  1CUN A;  1X79 A;  2DHR A;  2NOX A;  1WYC A;  4YFS A;  2X51 A;  1D1B A;  3ONX A;  4KBM B;  5HWX A;  1SHZ C;  5JQG E;  4L9I A;  2LM9 A;  2B1E A;  2CEA A;  1AJ3 A;  3ZJ1 A;  5LGN B;  3PDY A;  3GMI A;  1UCU A;  4O4J E;  3BQI A;  4IE4 A;  4UV9 B;  2E9X C;  2LE8 A;  4PK5 A;  2E9X D;  2SPC A;  2LJL A;  4YJ2 E;  3Q5X A;  4ZS3 A;  4H63 V;  5HYA A;  4P09 A;  4QXC B;  1IAP A;  3B13 A;  2LSG A;  3LK2 B;  3SS1 A;  4H9S E;  2DLR A;  2I59 A;  4AQG A;  5JH7 E;  4M1P A;  2E9X A;  5IYZ E;  3HKE E;  2YU2 A;  3RC8 A;  5LGT B;  1UX4 A;  1D0X A;  5HXE A;  3MJX A;  3D0T A;  3UUX B;  4GYR A;  1LVK A;  4UXN B;  4YJ3 E;  1B7T A;  4IE7 A;  4XZC A;  3JC6 C;  2N1G A;  4EOZ B;  2XAJ B;  2W61 A;  4OK0 A;  1HCI A;  2BVM A;  5FXV A;  3ZCJ A;  5KX5 E;  2XAQ B;  2BVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...