4QXHB

Crystal structure of histone demethylase kdm2a-h3k36me1 with nog
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
b'QVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELASSDPKLALTGVPIVQWP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 2A
molecule tags Oxidoreductase/structural protein
source organism Mus musculus
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
total genus 19
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4qxhB00
4QXBB 4QXHB 4QX8B 4QXCB 4QWNB 4TN7B 4QX7B
chains in the Genus database with same CATH superfamily
2WDVA 2E2AA 4GK0E 3ZCIA 3G06A 2KNDA 4WNKA 2ZM6T 2Y8DA 4H9NC 5H6QB 3VRAA 3PURA 3K3OA 5AQGB 5CB4E 2BKPA 4QH1A 3SFEA 1MIYA 3NZQA 3J7Yq 4HWDA 4NXMT 5AQPB 4WBNE 3FZKB 2V7MA 1ZEEA 2NWBA 3C4WA 2XUEA 3MZKB 5C2TA 3DTOA 3PJAJ 3UUXB 1MNEA 3WAJA 1LRZA 5F5WA 5FMNA 4E7SA 1KK7A 3TLUA 4A56A 4O2AE 2XQ5A 2FJEA 5AQKB 2XAHB 3P4RA 3PUSA 2H89A 1M7KA 4PK6A 2E9XD 2LKHA 4IHJE 3V5SA 2W2UA 2KZ7B 3CX6B 5J1GA 1WYCA 1HX8A 3AEBA 4TX5A 4WZXA 1SA0E 2XJ7A 3ETVA 1ZKEA 4CN6A 5LXTE 1E2AA 5FKYA 3ESLA 3ZC1A 4EZ4A 1BR2A 2VKHA 1FIOA 2DNXA 4OHFA 3QOFA 1DU2A 1I94T 2WMNA 4GIWA 2V26A 3AEEA 3UFGA 1YXRA 3ZSSA 5ABGA 1Y64B 5JDNA 3AXJA 2UUCT 1LKXA 3H3AA 2MOZA 4H9RC 3FZFB 2CRBA 3LJCA 3T1YT 2UXBT 4IE0A 4XBFB 4HTEA 2UXDT 4AKIA 1W0AA 5AQOB 2WWUA 3NBXX 1D1AA 5HXEA 5LYJE 1QUUA 4GK5E 2X66A 3C4XA 1KNRA 2AE9A 4HKAA 3AAEB 2IC9A 1IBMT 2FJDA 3CK6A 3CKDA 4MHCA 1ZP0A 4YHJA 5EK4A 4AI6A 3ZMSB 3NRYA 5AQNB 3QNUA 3RYHE 5LMNT 2CE7A 2XHEB 4ISTA 3ZJ2A 2WU2A 3HR0A 5LGUB 3UUNA 4P0AA 3UULA 2LM2A 2YKSA 1US7B 3ZYKA 2XQYA 4MFRA 2XQ7A 2G0UA 3MA9A 3RF1A 3RPUA 5AQTB 4TZ4C 1EZ3A 3N9QA 4H9QC 3ANWB 4B3MT 2X68A 3GN5A 4YSYA 2QVAA 4LFCT 1J5WA 2D2SA 2X9XA 3AA1B 3QB5A 2BG9C 4U31A 2JPFA 3ABVA 3NRXA 2NTYA 4UVBB 2NW9A 4JYAT 2LJLA 5M4YA 2ZMAA 4IDPA 3EDVA 2NW8A 4KBMB 2A2FX 2LRKA 2XSBA 2JIWA 3N9PA 3PUZF 4PAGA 3LK42 5AQVB 1J5ET 2V7IA 4AKLA 4DR5T 4DV2T 3AEFA 2YEVC 5AQJB 4X1KE 3OYXA 2VKDA 4PK4A 4U74A 4A98A 3AXJB 4ILUA 4N78D 5J2UE 2ODVA 2PG8A 4OFZA 5FXVA 4YTMA 4COFA 5JTGA 4L5GA 3O1HA 1NWMX 2CBJA 4HFDA 2XAGB 2P9BA 1IBKT 2V6YA 3E0ZA 3EDUA 2UU9T 5LCYA 3P4WA 1T98A 2Q9QA 3Q5XA 4PJLA 3UU5A 4EIWA 2FUPA 4YJ2E 2UXXB 4LF5T 1QSDA 1FEWA 3PUYF 4UVAB 4UXNB 4NIQA 2IUBA 5ABEA 2E5VA 4QH5A 2XQ9A 3FBZA 4AQFC 2NW7A 4EYYR 5FNVE 2JJ9A 3RGLA 4A5XA 1Y01A 2IHR1 2WP9A 1LVFA 3KV5A 2JQ9A 4CI3B 4X62T 4ZOLE 2CA5A 2A9UA 4IREA 2IIUA 3UT5E 3ETUA 3X1DA 4DO0A 2DLRA 1VCTA 3HKDE 4AISA 4DV0T 3ZYMA 2LSYA 2D0TA 2C5KT 4PNIA 4AQYT 5AQIB 4HWIB 4IIJE 3DP7A 3QC9A 2PBIA 5JDGA 3RKGA 1T72A 1JNRA 2D0UA 2V7JA 2WMOA 3RHWA 2KT9A 5LGNB 1XDOA 2XQ6A 3JC6C 2R6GF 2BDEA 2VVNA 2GK9A 4HWFA 2QA7A 3OPCA 2QGSA 2IDOB 1UX4A 2XQ8A 2ZM2A 3LBXA 3LFMA 3FHNA 4J2CA 3Q5WA 3RKOA 4ADZA 5L2LA 2KXPB 2OV9A 2VKJA 1N32T 5AQUB 2OA5A 2J4GA 2WZHA 5CA1E 2J47A 4CXXA 5AQQB 4JI7T 5LHGB 3ZT5A 2V8SV 4O2BE 1FMWA 2WDQA 4KX6A 4EV6A 5HWYA 4ZI7E 2LEHA 1UX5A 4OYJA 1UGOA 4IDQA 1G8XA 5ETWA 4ZI3C 3J9X1 3UQ7A 2XQAA 2NR4A 5HXRA 2D9DA 3SRZA 3HKCE 2HPLA 4UVCB 3KINB 5KDMC 1N33T 3ZSTA 1UCUA 2RA1A 5LGTB 4M1PA 3UQ4A 5FVLA 3MK7C 3O1JA 5CGMA 2LSGA 2I59A 4PJNA 2VKOA 2NTXA 1WYBA 3RIFA 4LMLA 5GONE 1D0ZA 3RC3A 3UFEA 4QH4A 5JR9B 1MMDA 4X65T 4TNWA 2YU2A 2KWIB 2V7LA 5LP6E 2MPKA 3CMLA 2X0HA 2WY2A 1FJGT 2IW5B 3ZN1B 4LFAT 4KHZF 1IAPA 3PUAA 3Q9DA 2Y48B 5DJQC 2N1GA 3UTKA 1AJ3A 2W00A 3NWIA 4JLEA 4YLHA 4ZEYA 3PUWF 2XQ3A 2H7OA 4YT0A 3CVRA 2YK0A 4I43B 3GA8A 3AE5A 1X9BA 3PUGA 2LSKA 2XY8B 2WWVA 1BR1A 4UF0B 3RH3A 4ZI3D 4HEAA 1X79A 2XPKA 3ZJ1A 2K48A 4KP3C 5J0ZA 2LOSA 2WU5A 2X0YA 2JMKA 1WLXA 4TN7B 3VKGA 3D0TA 3MXZA 3PUVF 3KDSE 3AA6B 4K0UA 3W15B 4JI5T 4DNDA 3HKBE 2HN2A 4DV3T 3Q2MA 2PJQA 3BK9A 4NPPA 4B3TT 3SOLA 4H9PC 2OLTA 3JCFA 2WDRA 5FY7A 2W63A 1W9RA 5IHYA 4P09A 3ZLIA 5ABFA 4YSZA 2LM9A 2JRKA 3LK2B 4UEMA 4UF0A 1MIVA 3AEAA 3EAMA 2VWAA 2XTLA 2J62A 2YOEA 5ABFB 3KVBA 4LMKA 2BS2A 3UUMA 5L3DB 2WBLA 4HGAA 3K8PC 5BR8T 2L8KA 4TNVA 4BJNA 2W67A 4QXBB 1HNXT 2UUAT 3PE0A 4AQGA 4YHHT 5FXZA 4XZCA 5ADXL 2DCFA 3ZC0A 3TLTA 1D0XA 2I0MA 3KBTA 3P4QA 3PU8A 3FXEB 2HHHT 3OJAA 4U3CA 2LHRA 3S4UA 3QB5K 3K3NA 4ZXLA 1BR4A 3F57A 5AQRB 3RQUA 4P1NA 3AE6A 2DL1A 4TV8E 5A1LA 4AKGA 1ZHCA 2DWKA 2KINB 2ODUA 4U7YA 1Z0PA 4MLKA 1LVKA 1L0VA 3AE8A 2BBHA 4AKHA 3PUXF 4CI1B 1NENA 1D0YA 2LHNA 3N9NA 4IGUA 3PTRB 2CXFA 3MKDA 3N2GE 4DVDA 1H7CA 5FL1A 3AEGA 4XAXB 4YTNA 2E9XB 4ERRA 5L4EA 5J2TE 3UU6A 4QX7B 4AQFA 4DUYT 5HCMA 3AAAB 2BVMA 5FL0A 5IYZE 4FI5A 4EOZB 3RYIE 5JDHA 1IBLT 4U72A 2D5UA 2C5JA 3BQKA 3V5UA 4DV7T 4IE6A 3ONJA 4HFCA 4EYUA 3A5XA 4IDZA 3IBPA 4LF7T 1YW0A 4O4HE 3AVSA 3N2KE 5E0OA 4ANJA 3NKZA 4HFHA 5AQLB 2MBGA 5HWXA 4DV4T 5BMVE 3K3QC 4LF9T 2XM1A 4ZI2C 4C91A 4I50E 1VCSA 4IE5A 4JV5T 4X64T 1OEDC 2EHOA 2BS4A 4UIGA 3EVYA 1YQ4A 1YQ3A 2HN1A 3UU8A 4KHPT 2RP4A 5C3JA 5FP3A 1J1JA 3I9YA 2A72A 4U2ZA 5LMUT 5CA0E 1WCRA 2FBWA 1OXZA 3BQIA 3F31A 4DR6T 2BG9E 4ZZCA 2KMFA 4Q25A 1OEDE 4JI6T 2WCAA 2LE8A 3AVRA 3N5LA 2F4VT 5LJNA 5HAXA 2LKGA 3O4XE 2L3LA 2VVSA 3JADA 3HL6A 1B7TA 1D1BA 2HPJA 2MTQA 2ZLYA 3OYZA 2C0SA 3UU3A 4JI2T 1MIWA 5LG3A 5DABA 2WM9A 4CQIA 4HFBA 1YKHB 4QXHB 3IHRA 4HN9A 1CUNA 2X9WA 2X9HA 1KEYA 3RYCE 3R84B 4ASKA 4DR4T 3OKQA 4EAHA 4U33A 1HS7A 1YKEB 1MMNA 3NZPA 2CPTA 3CPZA 3VR8A 2K5BB 3ZMVB 4B3RT 1HF8A 1O3XA 3CX8B 2WAUA 2XAQB 2XASB 4PK5A 3SWHA 4DMWA 4KUMB 2W61A 3IEEA 2BG9A 2DI4A 2PFVA 2VQFT 1R8IA 3PDYA 1HCIA 4DV6T 4GKJT 3AE1A 3L3PA 3TKLB 2UXNB 1Z8UA 2H7VC 2V6XA 5KXJA 3CWZB 1WR0A 4I4TE 1HNWT 2Q9QD 5HCJA 3SS1A 3KV9A 2CM0A 2CBIA 2BVLA 2NOXA 3FB2A 4HFEA 4HWHA 4L0RA 2V7KA 3E22E 4TUYE 1KF6A 4ZZBA 1N34T 5FXXA 4WYVA 4ZHQE 2ZM0A 4IDOA 3UU4A 3C4ZA 2CLYB 1HFAA 3ZCJA 5AFUL 3O1IA 4DV5T 1JNZA 1OEDA 1QLBA 2E9XC 2EHOC 3QUJA 1VRBA 4G63A 4L9IA 4Z91A 3P8CD 5LOVE 2CXLA 4C90A 1CHUA 4KI0F 4DR2T 4Z8XA 4UV9B 2J1DG 4JI0T 1BR0A 3LK3B 3N9LA 2CWOA 3JC6D 4ZS3A 2V5CA 4NXNT 4B6XA 2I6HA 2IAKA 4JEUB 4YFSA 5L47A 5HEGA 2H3RA 4PFOA 5AQFB 1SUMB 2WS3A 3B13A 3GWHA 3CIRA 4QX8B 2W0GA 1HG5A 4IDNA 3RQWA 1WFDA 2FJBA 2XAFB 3L09A 3UUBA 1HG2A 3RIUA 3P7IA 4H63H 4F8HA 3GN5B 3KBUA 2UUBT 3B5MA 4LFBT 3PUQA 4QKNA 3QK6A 4AXPA 1ZV4X 1UK5A 2BG9B 4DMVA 1OEDB 1D1CA 2CXDA 2AXDS 2Y6XA 4O4JE 5JDLA 5L3FB 5FVKA 1MNDA 3CX7B 1XZYA 5F8PA 1E7PA 2W66A 3FXDB 2E5LT 4I55E 5HXCA 4GYSA 4ILCA 3AE9A 2BBJA 2CEAA 5LG4A 2VK9A 2YDRA 2SPCA 3H37A 3I9WA 2M6IA 4X5TA 4CI2B 2JQHA 2CLYC 2LLYA 3N2OA 4BAYB 3OTOT 2W4XA 3PV0F 1MMGA 3RIAA 2VB6A 4JI1T 2JQKA 5FY1A 2WSSV 1U5PA 2K3WA 2YDQA 5L3EB 2CWYA 5HEOA 5FXWA 4OK0A 4YXDA 5KMGP 5JVDE 5FYMA 5CJ5A 3C50A 3ZKRA 2LSJA 3GMIA 3LDQB 5L3CB 4E7ZA 5LJMA 2QRXA 3AA7B 2W62A 1WR6A 5EK2A 3Q5DA 3ZT7A 3MACA 4OYKA 1VOMA 1IJ6A 3PJAA 1KFYA 4PJJA 2C5IT 4QHOA 3WAKA 5JH7E 2X9YA 2V5DA 3C51A 4EEBA 3R6NA 3AE4A 1E1HB 4HE8A 3M65A 3JAEA 3BQLA 5C8YE 2K24A 4HFIA 4PW8A 4TWHA 3AECA 4YY3T 1HR0T 3WI3A 2K9AA 2KLQA 3L39A 2E8IA 5HYAA 2H88A 3H3MA 1HTJF 4UR9A 2N2NA 3RC8A 4NUVA 2YDSA 2FJAA 2E9XA 3K1SA 5DQVA 2HH7A 3FZMB 2EHOB 4LF6T 1XMQT 4AKRB 5JR9C 2VL0A 3CQGB 1NEKA 4JI4T 5JRCA 4LF8T 3RRWA 3P4SA 1SHZC 3A8YC 3VKHA 2WQYA 4CN4A 2XQ4A 4O4IE 4KMCA 3RI5A 2WB5A 2CHNA 2DWGA 3ZMUB 3F2EA 3HA4A 5L3GB 2YINA 5ABHA 2RPAA 4H9OC 4IE4A 4IL9A 3AE3A 3ZMTB 5KX5E 3OVUA 5JR9A 2MAWA 2Z6EA 1OWAA 2X0LB 5LA6E 2XSAA 4JEHB 4V1Av 4DBRA 4WBOA 4X1YE 5JQGE 1M62A 3EI0A 5HEUA 4LF4T 2ACZA 4DR7T 5H6RB 2ZM8A 3ZT6A 4DUZT 4BJMA 3MJXA 4MBQA 2LOPA 3Q5EA 2A3DA 5EK3A 4YSXA 1ZOYA 2IMLA 4TWFA 3ONXA 4DV1T 5JRCB 4O4LE 2DHRA 3LSVA 4TV9E 2YU1A 4JUYA 5AQMB 4WW0A 4JI3T 1W09A 4H63V 2BS3A 3AB3B 1XMOT 5F3JA 1KNPA 1UURA 3B57A 3LG7A 3U78A 4UV8B 4DBQA 2BKNA 4GKKT 1NAFA 2N9DA 3VRBA 4LMJA 3T1HT 5TAOA 4X66T 1S94A 1WRDA 3ZYLA 3TLVA 3CQCB 3RYFE 2B76A 1G73A 4ILBA 4O8SA 4EZHA 2CHOA 3T8OA 3ZPOA 1XNRT 4NUUA 2NP9A 4DR3T 4TWDA 4ZS2A 1GQEA 2ES0A 4EXTA 3I1AA 3EUHA 3I0OA 4I0UA 4QWNB 3NVOA 3AE2A 2BKOA 3AAIA 2IC6A 4X20E 4FJOA 2XZEA 5LBMA 3ZMZB 4AIUA 5FY0A 4GOUA 3VHLA 3O9XA 3C64A 3L8RA 1V9DA 2LSIA 2YN6A 2Q9QB 3KV4A 3P50A 3M3ZB 3RLFF 4CZZB 5HEJA 2KWHA 1XNQT 2V6YB 2ACXA 1SE7A 3ONLC 2VQET 3JAFA 3ZEFB 5IUXA 3RIUC 4U2YA 2MYSA 2XAJB 2LRLA 3EHZA 1HNZT 2BZBA 4Z90A 5HXSA 4JI8T 4QXCB 5HEHA 3EABA 2M6BA 3IF8B 4HWCA 4IE7A 4YTPA 3IA3A 1W0BA 2V1DB 4IL4A 3SFDA 2L9QA 3VR9A 1XDPA 3A7MA 5L4HA 1N36T 4ZI2D 2LT3A 3I0QA 2X67A 1HX1B 2M67A 3OBVE 5EZYE 2JQQA 5LBQB 5AQSB 2KSRA 3ZN0B 5JDMA 1XWMA 4MALA 2VURA 4PJMA 4P0BA 1T8BA 3AEDA 4B3ST 4H9SE 2VASA 5LHIB 2CMRA 2VL8A 4YJ3E 5JREA 3HI2A 4HFVA 2CCQA 4G2AA 4U7IA 4F6RC 1KNZA 4K0KT 5HXHA 2WZIA 4ISSA 5DQWA 4CXYA 4EEDA 3KVAA 3RRCA 4DIDB 5IWAT 3P4PA 4IT4A 1T7SA 1U4QA 3CQXC 2UXCT 5AQHB 3AE7A 3TLWA 3AA0B 4GYRA 4UELA 4BA9A 4EGWA 5JDQA 4A97A 1FMVA 2JMHA 5LB7B 4EB6E 1UUSA 1S35A 3C98B 2Q9QC 3U3IA 2PTFA 3FBLA 3LBXB 2QYWA 3N9OA 4CN1A 3FZHB 1IJ5A 5LNKA 4DR1T 4OX9T 2B1EA 3KFWX 4ILAA 4PFPA 1I6ZA 3E08A 2XM2A 5JDFA 3DJBA 5LHHB 1YD8G 2X51A 3RX6A 4X1IE 3TLSA 3FZLB 3VU7H 5CFBA 1IZNB 5L3BB 1MMAA 4CXWA 2EHOD 3ANWA 3KV6A 3N9MA 3HKEE 3PU3A 4JBWF
chains in the Genus database with same CATH topology
4GK0E 3ZCIA 2KNDA 4WNKA 2Y8DA 4H9NC 5H6QB 3PURA 3K3OA 5CB4E 3J7Yq 1MIYA 3NZQA 4WBNE 2V7MA 1ZEEA 2NWBA 3C4WA 2XUEA 3MZKB 3DTOA 3UUXB 1MNEA 3WAJA 1LRZA 5FMNA 4E7SA 1KK7A 4A56A 4O2AE 2XAHB 3PUSA 4PK6A 2E9XD 4IHJE 3V5SA 5J1GA 2KZ7B 3CX6B 1WYCA 1HX8A 4TX5A 5LXTE 1SA0E 3ETVA 1ZKEA 3ZC1A 4EZ4A 3ESLA 1BR2A 2VKHA 1FIOA 2DNXA 4OHFA 2WMNA 4GIWA 2V26A 5JDNA 1Y64B 1LKXA 3H3AA 2MOZA 4H9RC 3LJCA 4IE0A 4HTEA 4AKIA 2WWUA 3NBXX 1D1AA 5HXEA 5LYJE 1QUUA 4GK5E 2X66A 3C4XA 4HKAA 3AAEB 2IC9A 3CKDA 4MHCA 5EK4A 3ZMSB 3NRYA 3RYHE 2CE7A 2XHEB 4ISTA 3ZJ2A 3HR0A 5LGUB 3UUNA 4P0AA 3UULA 1US7B 3ZYKA 2XQYA 4MFRA 2G0UA 3MA9A 3RPUA 4TZ4C 1EZ3A 3N9QA 4H9QC 3ANWB 2X68A 3GN5A 2D2SA 2X9XA 3AA1B 2JPFA 3NRXA 2NTYA 4UVBB 2NW9A 2LJLA 5M4YA 2ZMAA 4KBMB 3EDVA 2NW8A 4YHJA 2A2FX 3N9PA 4PAGA 3U3IA 5LG4A 3LK42 2V7IA 4AKLA 2YEVC 4X1KE 3OYXA 2VKDA 4PK4A 4U74A 4ILUA 4N78D 5J2UE 2ODVA 2PG8A 5FXVA 4L5GA 3O1HA 1NWMX 2XAGB 2P9BA 3E0ZA 3EDUA 5LCYA 1T98A 2Q9QA 3Q5XA 4PJLA 4EIWA 4YJ2E 2UXXB 1QSDA 1FEWA 4UVAB 4UXNB 4AQFC 3FBZA 2NW7A 4EYYR 5FNVE 2JJ9A 3KV5A 1LVFA 4CI3B 4ZOLE 2CA5A 3UT5E 4DO0A 3ETUA 2DLRA 3HKDE 3ZYMA 2LSYA 2D0TA 2C5KT 4PNIA 4IIJE 3DP7A 3QC9A 2PBIA 5JDGA 2D0UA 5LGNB 2V7JA 2WMOA 4AI6A 2KT9A 3JC6C 2BDEA 2GK9A 2QA7A 2QGSA 1UX4A 2ZM2A 3LBXA 4J2CA 4OYJA 3LFMA 3FHNA 5L2LA 3Q5WA 3RKOA 4ADZA 2KXPB 2VKJA 2OA5A 5CA1E 4CXXA 5LHGB 4O2BE 1FMWA 4ZI7E 5HWYA 2LEHA 1UX5A 4ZI3C 5ETWA 1G8XA 3J9X1 5HXRA 3SRZA 3HKCE 2HPLA 4UVCB 3KINB 5KDMC 5LGTB 1UCUA 2RA1A 4M1PA 3MK7C 3O1JA 2LSGA 2I59A 4PJNA 2VKOA 2NTXA 1WYBA 5GONE 1D0ZA 3RC3A 3UFEA 5JR9B 1MMDA 2YU2A 2KWIB 2V7LA 5LP6E 4XBFB 3CMLA 2IW5B 3ZN1B 1IAPA 3PUAA 3Q9DA 2Y48B 5DJQC 2N1GA 3UTKA 1AJ3A 2W00A 4JLEA 4YLHA 2H7OA 3CVRA 2YK0A 4I43B 3GA8A 3PUGA 2LSKA 1BR1A 4UF0B 3RH3A 4ZI3D 4HEAA 1X79A 3ZJ1A 2K48A 4KP3C 2LOSA 2JMKA 1WLXA 4TN7B 3VKGA 3D0TA 3MXZA 3KDSE 3AA6B 4K0UA 3W15B 4DNDA 3HKBE 3Q2MA 2PJQA 3BK9A 3SOLA 4H9PC 5FY7A 2W63A 5IHYA 4P09A 3ZLIA 2LM9A 2JRKA 3LK2B 4UEMA 4UF0A 1MIVA 2VWAA 2XTLA 3KVBA 3UUMA 5L3DB 2WBLA 4HGAA 3K8PC 2L8KA 4BJNA 4QXBB 3PE0A 4AQGA 5FXZA 4XZCA 5ADXL 2DCFA 3ZC0A 1D0XA 3KBTA 3PU8A 3FXEB 3OJAA 3S4UA 2LHRA 3K3NA 1BR4A 3F57A 4AKGA 4TV8E 5A1LA 1ZHCA 2DWKA 2KINB 2ODUA 1Z0PA 4MLKA 1LVKA 4AKHA 4CI1B 1D0YA 2LHNA 3N9NA 4IGUA 3PTRB 2CXFA 3MKDA 3N2GE 4DVDA 1H7CA 5J2TE 4XAXB 2E9XB 4ERRA 4QX7B 4AQFA 5IYZE 3AAAB 2BVMA 4FI5A 4EOZB 3RYIE 5JDHA 4U72A 2D5UA 2C5JA 3BQKA 3V5UA 4IE6A 4EYUA 3A5XA 4IDZA 3IBPA 1YW0A 4O4HE 3AVSA 3N2KE 5E0OA 4ANJA 5HWXA 2MBGA 5BMVE 3K3QC 4ZI2C 4C91A 4I50E 4IE5A 2EHOA 4UIGA 3EVYA 2RP4A 5FP3A 3I9YA 2A72A 5CA0E 1OXZA 3BQIA 3F31A 2KMFA 2LE8A 3AVRA 3N5LA 5LJNA 5HAXA 3O4XE 2L3LA 3HL6A 1B7TA 1D1BA 2HPJA 2MTQA 2ZLYA 3OYZA 2C0SA 1MIWA 5DABA 2WM9A 4CQIA 1YKHB 4QXHB 3IHRA 4HN9A 1CUNA 2X9WA 2X9HA 3RYCE 3R84B 4ASKA 3OKQA 4EAHA 1HS7A 1YKEB 1MMNA 3NZPA 3CPZA 3ZMVB 2K5BB 1HF8A 1O3XA 3CX8B 2WAUA 2XAQB 2XASB 4PK5A 3SWHA 4DMWA 4KUMB 2W61A 3IEEA 2DI4A 2PFVA 3PDYA 1HCIA 3L3PA 3TKLB 2UXNB 2H7VC 3CWZB 4I4TE 2Q9QD 3SS1A 3KV9A 2CM0A 2NOXA 2BVLA 3FB2A 4L0RA 4OFZA 4TUYE 2V7KA 3E22E 5FXXA 4ZHQE 2ZM0A 3C4ZA 2CLYB 1HFAA 3ZCJA 5AFUL 3O1IA 2EHOC 4G63A 2E9XC 3QUJA 1VRBA 4L9IA 5LOVE 3P8CD 4C90A 2CXLA 1BR0A 4Z8XA 4UV9B 2J1DG 3LK3B 3N9LA 2CWOA 3JC6D 4ZS3A 4B6XA 4JEUB 2IAKA 4YFSA 2H3RA 4PFOA 3B13A 3GWHA 4QX8B 2W0GA 1HG5A 2XAFB 3L09A 1HG2A 3P7IA 4H63H 3GN5B 3KBUA 3PUQA 4QKNA 3QK6A 4AXPA 1ZV4X 4DMVA 2CXDA 1D1CA 2Y6XA 4O4JE 5JDLA 5L3FB 1MNDA 3CX7B 5F8PA 3FXDB 4I55E 5HXCA 4GYSA 2CEAA 2VK9A 3I9WA 2SPCA 3H37A 4CI2B 2CLYC 4BAYB 3N2OA 1MMGA 2VB6A 5FY1A 2WSSV 1U5PA 5L3EB 2CWYA 5FXWA 4OK0A 5KMGP 5JVDE 5FYMA 3C50A 2LSJA 3GMIA 5L3CB 4E7ZA 5LJMA 3AA7B 2W62A 1WR6A 5EK2A 3MACA 4OYKA 1VOMA 1IJ6A 4PJJA 3WAKA 4QHOA 2C5IT 5JH7E 2X9YA 3C51A 3R6NA 1E1HB 4HE8A 3M65A 3BQLA 5C8YE 2K24A 4PW8A 3WI3A 2K9AA 2KLQA 5HYAA 2E8IA 1HTJF 2N2NA 3RC8A 4NUVA 2E9XA 5DQVA 2HH7A 2EHOB 4AKRB 5JR9C 3CQGB 5JRCA 3RRWA 1SHZC 3VKHA 4O4IE 4KMCA 2DWGA 3ZMUB 3F2EA 3HA4A 5L3GB 2YINA 4H9OC 4IE4A 5KX5E 3ZMTB 5JR9A 2Z6EA 1OWAA 2X0LB 5LA6E 4JEHB 4V1Av 4DBRA 5JQGE 4WBOA 4X1YE 5H6RB 2ZM8A 4BJMA 3MJXA 4MBQA 2LOPA 5EK3A 2A3DA 3ONXA 5JRCB 4O4LE 2DHRA 4TV9E 2YU1A 4JUYA 4WW0A 4H63V 3AB3B 5F3JA 3B57A 4DBQA 3LG7A 3U78A 4UV8B 1NAFA 2N9DA 5TAOA 1S94A 1WRDA 3ZYLA 3CQCB 3RYFE 1G73A 4O8SA 4EZHA 3T8OA 3ZPOA 4NUUA 2NP9A 4ZS2A 2ES0A 4EXTA 3I1AA 3EUHA 3I0OA 4QWNB 4X20E 3AAIA 2IC6A 5LBMA 4FJOA 3ZMZB 5FY0A 4GOUA 3VHLA 3O9XA 3C64A 1V9DA 2LSIA 3KV4A 2Q9QB 4CZZB 2KWHA 2ACXA 3ZEFB 2MYSA 2XAJB 2BZBA 5HXSA 4QXCB 4IE7A 3IF8B 2V1DB 2L9QA 4ZI2D 2LT3A 3I0QA 2X67A 3OBVE 2M67A 5EZYE 5LBQB 2JQQA 3ZN0B 5JDMA 4MALA 4PJMA 4P0BA 4H9SE 2VASA 5LHIB 2CMRA 2VL8A 4YJ3E 5JREA 3HI2A 4HFVA 2CCQA 4G2AA 4F6RC 1KNZA 5HXHA 4ISSA 5DQWA 4CXYA 3KVAA 3RRCA 1U4QA 3CQXC 5JDQA 3AA0B 4GYRA 4UELA 4BA9A 1FMVA 2JMHA 4EB6E 1S35A 3C98B 2Q9QC 3FBLA 3LBXB 3N9OA 1IJ5A 5LNKA 2B1EA 3KFWX 4PFPA 3E08A 5JDFA 3DJBA 5LHHB 1YD8G 2X51A 3RX6A 4X1IE 3VU7H 5L3BB 1IZNB 1MMAA 4CXWA 2EHOD 3ANWA 3KV6A 3N9MA 3HKEE 3PU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QXB B;  4QXH B;  4QX8 B;  4QXC B;  4QWN B;  4TN7 B;  4QX7 B; 
#chains in the Genus database with same CATH topology
 2WDV A;  2E2A A;  4GK0 E;  3ZCI A;  3G06 A;  2KND A;  4WNK A;  2ZM6 T;  2Y8D A;  4H9N C;  5H6Q B;  3VRA A;  3PUR A;  3K3O A;  5AQG B;  5CB4 E;  2BKP A;  4QH1 A;  3SFE A;  1MIY A;  3NZQ A;  3J7Y q;  4HWD A;  4NXM T;  5AQP B;  4WBN E;  3FZK B;  2V7M A;  1ZEE A;  2NWB A;  3C4W A;  2XUE A;  3MZK B;  5C2T A;  3DTO A;  3PJA J;  3UUX B;  1MNE A;  3WAJ A;  1LRZ A;  5F5W A;  5FMN A;  4E7S A;  1KK7 A;  3TLU A;  4A56 A;  4O2A E;  2XQ5 A;  2FJE A;  5AQK B;  2XAH B;  3P4R A;  3PUS A;  2H89 A;  1M7K A;  4PK6 A;  2E9X D;  2LKH A;  4IHJ E;  3V5S A;  2W2U A;  2KZ7 B;  3CX6 B;  5J1G A;  1WYC A;  1HX8 A;  3AEB A;  4TX5 A;  4WZX A;  1SA0 E;  2XJ7 A;  3ETV A;  1ZKE A;  4CN6 A;  5LXT E;  1E2A A;  5FKY A;  3ESL A;  3ZC1 A;  4EZ4 A;  1BR2 A;  2VKH A;  1FIO A;  2DNX A;  4OHF A;  3QOF A;  1DU2 A;  1I94 T;  2WMN A;  4GIW A;  2V26 A;  3AEE A;  3UFG A;  1YXR A;  3ZSS A;  5ABG A;  1Y64 B;  5JDN A;  3AXJ A;  2UUC T;  1LKX A;  3H3A A;  2MOZ A;  4H9R C;  3FZF B;  2CRB A;  3LJC A;  3T1Y T;  2UXB T;  4IE0 A;  4XBF B;  4HTE A;  2UXD T;  4AKI A;  1W0A A;  5AQO B;  2WWU A;  3NBX X;  1D1A A;  5HXE A;  5LYJ E;  1QUU A;  4GK5 E;  2X66 A;  3C4X A;  1KNR A;  2AE9 A;  4HKA A;  3AAE B;  2IC9 A;  1IBM T;  2FJD A;  3CK6 A;  3CKD A;  4MHC A;  1ZP0 A;  4YHJ A;  5EK4 A;  4AI6 A;  3ZMS B;  3NRY A;  5AQN B;  3QNU A;  3RYH E;  5LMN T;  2CE7 A;  2XHE B;  4IST A;  3ZJ2 A;  2WU2 A;  3HR0 A;  5LGU B;  3UUN A;  4P0A A;  3UUL A;  2LM2 A;  2YKS A;  1US7 B;  3ZYK A;  2XQY A;  4MFR A;  2XQ7 A;  2G0U A;  3MA9 A;  3RF1 A;  3RPU A;  5AQT B;  4TZ4 C;  1EZ3 A;  3N9Q A;  4H9Q C;  3ANW B;  4B3M T;  2X68 A;  3GN5 A;  4YSY A;  2QVA A;  4LFC T;  1J5W A;  2D2S A;  2X9X A;  3AA1 B;  3QB5 A;  2BG9 C;  4U31 A;  2JPF A;  3ABV A;  3NRX A;  2NTY A;  4UVB B;  2NW9 A;  4JYA T;  2LJL A;  5M4Y A;  2ZMA A;  4IDP A;  3EDV A;  2NW8 A;  4KBM B;  2A2F X;  2LRK A;  2XSB A;  2JIW A;  3N9P A;  3PUZ F;  4PAG A;  3LK4 2;  5AQV B;  1J5E T;  2V7I A;  4AKL A;  4DR5 T;  4DV2 T;  3AEF A;  2YEV C;  5AQJ B;  4X1K E;  3OYX A;  2VKD A;  4PK4 A;  4U74 A;  4A98 A;  3AXJ B;  4ILU A;  4N78 D;  5J2U E;  2ODV A;  2PG8 A;  4OFZ A;  5FXV A;  4YTM A;  4COF A;  5JTG A;  4L5G A;  3O1H A;  1NWM X;  2CBJ A;  4HFD A;  2XAG B;  2P9B A;  1IBK T;  2V6Y A;  3E0Z A;  3EDU A;  2UU9 T;  5LCY A;  3P4W A;  1T98 A;  2Q9Q A;  3Q5X A;  4PJL A;  3UU5 A;  4EIW A;  2FUP A;  4YJ2 E;  2UXX B;  4LF5 T;  1QSD A;  1FEW A;  3PUY F;  4UVA B;  4UXN B;  4NIQ A;  2IUB A;  5ABE A;  2E5V A;  4QH5 A;  2XQ9 A;  3FBZ A;  4AQF C;  2NW7 A;  4EYY R;  5FNV E;  2JJ9 A;  3RGL A;  4A5X A;  1Y01 A;  2IHR 1;  2WP9 A;  1LVF A;  3KV5 A;  2JQ9 A;  4CI3 B;  4X62 T;  4ZOL E;  2CA5 A;  2A9U A;  4IRE A;  2IIU A;  3UT5 E;  3ETU A;  3X1D A;  4DO0 A;  2DLR A;  1VCT A;  3HKD E;  4AIS A;  4DV0 T;  3ZYM A;  2LSY A;  2D0T A;  2C5K T;  4PNI A;  4AQY T;  5AQI B;  4HWI B;  4IIJ E;  3DP7 A;  3QC9 A;  2PBI A;  5JDG A;  3RKG A;  1T72 A;  1JNR A;  2D0U A;  2V7J A;  2WMO A;  3RHW A;  2KT9 A;  5LGN B;  1XDO A;  2XQ6 A;  3JC6 C;  2R6G F;  2BDE A;  2VVN A;  2GK9 A;  4HWF A;  2QA7 A;  3OPC A;  2QGS A;  2IDO B;  1UX4 A;  2XQ8 A;  2ZM2 A;  3LBX A;  3LFM A;  3FHN A;  4J2C A;  3Q5W A;  3RKO A;  4ADZ A;  5L2L A;  2KXP B;  2OV9 A;  2VKJ A;  1N32 T;  5AQU B;  2OA5 A;  2J4G A;  2WZH A;  5CA1 E;  2J47 A;  4CXX A;  5AQQ B;  4JI7 T;  5LHG B;  3ZT5 A;  2V8S V;  4O2B E;  1FMW A;  2WDQ A;  4KX6 A;  4EV6 A;  5HWY A;  4ZI7 E;  2LEH A;  1UX5 A;  4OYJ A;  1UGO A;  4IDQ A;  1G8X A;  5ETW A;  4ZI3 C;  3J9X 1;  3UQ7 A;  2XQA A;  2NR4 A;  5HXR A;  2D9D A;  3SRZ A;  3HKC E;  2HPL A;  4UVC B;  3KIN B;  5KDM C;  1N33 T;  3ZST A;  1UCU A;  2RA1 A;  5LGT B;  4M1P A;  3UQ4 A;  5FVL A;  3MK7 C;  3O1J A;  5CGM A;  2LSG A;  2I59 A;  4PJN A;  2VKO A;  2NTX A;  1WYB A;  3RIF A;  4LML A;  5GON E;  1D0Z A;  3RC3 A;  3UFE A;  4QH4 A;  5JR9 B;  1MMD A;  4X65 T;  4TNW A;  2YU2 A;  2KWI B;  2V7L A;  5LP6 E;  2MPK A;  3CML A;  2X0H A;  2WY2 A;  1FJG T;  2IW5 B;  3ZN1 B;  4LFA T;  4KHZ F;  1IAP A;  3PUA A;  3Q9D A;  2Y48 B;  5DJQ C;  2N1G A;  3UTK A;  1AJ3 A;  2W00 A;  3NWI A;  4JLE A;  4YLH A;  4ZEY A;  3PUW F;  2XQ3 A;  2H7O A;  4YT0 A;  3CVR A;  2YK0 A;  4I43 B;  3GA8 A;  3AE5 A;  1X9B A;  3PUG A;  2LSK A;  2XY8 B;  2WWV A;  1BR1 A;  4UF0 B;  3RH3 A;  4ZI3 D;  4HEA A;  1X79 A;  2XPK A;  3ZJ1 A;  2K48 A;  4KP3 C;  5J0Z A;  2LOS A;  2WU5 A;  2X0Y A;  2JMK A;  1WLX A;  4TN7 B;  3VKG A;  3D0T A;  3MXZ A;  3PUV F;  3KDS E;  3AA6 B;  4K0U A;  3W15 B;  4JI5 T;  4DND A;  3HKB E;  2HN2 A;  4DV3 T;  3Q2M A;  2PJQ A;  3BK9 A;  4NPP A;  4B3T T;  3SOL A;  4H9P C;  2OLT A;  3JCF A;  2WDR A;  5FY7 A;  2W63 A;  1W9R A;  5IHY A;  4P09 A;  3ZLI A;  5ABF A;  4YSZ A;  2LM9 A;  2JRK A;  3LK2 B;  4UEM A;  4UF0 A;  1MIV A;  3AEA A;  3EAM A;  2VWA A;  2XTL A;  2J62 A;  2YOE A;  5ABF B;  3KVB A;  4LMK A;  2BS2 A;  3UUM A;  5L3D B;  2WBL A;  4HGA A;  3K8P C;  5BR8 T;  2L8K A;  4TNV A;  4BJN A;  2W67 A;  4QXB B;  1HNX T;  2UUA T;  3PE0 A;  4AQG A;  4YHH T;  5FXZ A;  4XZC A;  5ADX L;  2DCF A;  3ZC0 A;  3TLT A;  1D0X A;  2I0M A;  3KBT A;  3P4Q A;  3PU8 A;  3FXE B;  2HHH T;  3OJA A;  4U3C A;  2LHR A;  3S4U A;  3QB5 K;  3K3N A;  4ZXL A;  1BR4 A;  3F57 A;  5AQR B;  3RQU A;  4P1N A;  3AE6 A;  2DL1 A;  4TV8 E;  5A1L A;  4AKG A;  1ZHC A;  2DWK A;  2KIN B;  2ODU A;  4U7Y A;  1Z0P A;  4MLK A;  1LVK A;  1L0V A;  3AE8 A;  2BBH A;  4AKH A;  3PUX F;  4CI1 B;  1NEN A;  1D0Y A;  2LHN A;  3N9N A;  4IGU A;  3PTR B;  2CXF A;  3MKD A;  3N2G E;  4DVD A;  1H7C A;  5FL1 A;  3AEG A;  4XAX B;  4YTN A;  2E9X B;  4ERR A;  5L4E A;  5J2T E;  3UU6 A;  4QX7 B;  4AQF A;  4DUY T;  5HCM A;  3AAA B;  2BVM A;  5FL0 A;  5IYZ E;  4FI5 A;  4EOZ B;  3RYI E;  5JDH A;  1IBL T;  4U72 A;  2D5U A;  2C5J A;  3BQK A;  3V5U A;  4DV7 T;  4IE6 A;  3ONJ A;  4HFC A;  4EYU A;  3A5X A;  4IDZ A;  3IBP A;  4LF7 T;  1YW0 A;  4O4H E;  3AVS A;  3N2K E;  5E0O A;  4ANJ A;  3NKZ A;  4HFH A;  5AQL B;  2MBG A;  5HWX A;  4DV4 T;  5BMV E;  3K3Q C;  4LF9 T;  2XM1 A;  4ZI2 C;  4C91 A;  4I50 E;  1VCS A;  4IE5 A;  4JV5 T;  4X64 T;  1OED C;  2EHO A;  2BS4 A;  4UIG A;  3EVY A;  1YQ4 A;  1YQ3 A;  2HN1 A;  3UU8 A;  4KHP T;  2RP4 A;  5C3J A;  5FP3 A;  1J1J A;  3I9Y A;  2A72 A;  4U2Z A;  5LMU T;  5CA0 E;  1WCR A;  2FBW A;  1OXZ A;  3BQI A;  3F31 A;  4DR6 T;  2BG9 E;  4ZZC A;  2KMF A;  4Q25 A;  1OED E;  4JI6 T;  2WCA A;  2LE8 A;  3AVR A;  3N5L A;  2F4V T;  5LJN A;  5HAX A;  2LKG A;  3O4X E;  2L3L A;  2VVS A;  3JAD A;  3HL6 A;  1B7T A;  1D1B A;  2HPJ A;  2MTQ A;  2ZLY A;  3OYZ A;  2C0S A;  3UU3 A;  4JI2 T;  1MIW A;  5LG3 A;  5DAB A;  2WM9 A;  4CQI A;  4HFB A;  1YKH B;  4QXH B;  3IHR A;  4HN9 A;  1CUN A;  2X9W A;  2X9H A;  1KEY A;  3RYC E;  3R84 B;  4ASK A;  4DR4 T;  3OKQ A;  4EAH A;  4U33 A;  1HS7 A;  1YKE B;  1MMN A;  3NZP A;  2CPT A;  3CPZ A;  3VR8 A;  2K5B B;  3ZMV B;  4B3R T;  1HF8 A;  1O3X A;  3CX8 B;  2WAU A;  2XAQ B;  2XAS B;  4PK5 A;  3SWH A;  4DMW A;  4KUM B;  2W61 A;  3IEE A;  2BG9 A;  2DI4 A;  2PFV A;  2VQF T;  1R8I A;  3PDY A;  1HCI A;  4DV6 T;  4GKJ T;  3AE1 A;  3L3P A;  3TKL B;  2UXN B;  1Z8U A;  2H7V C;  2V6X A;  5KXJ A;  3CWZ B;  1WR0 A;  4I4T E;  1HNW T;  2Q9Q D;  5HCJ A;  3SS1 A;  3KV9 A;  2CM0 A;  2CBI A;  2BVL A;  2NOX A;  3FB2 A;  4HFE A;  4HWH A;  4L0R A;  2V7K A;  3E22 E;  4TUY E;  1KF6 A;  4ZZB A;  1N34 T;  5FXX A;  4WYV A;  4ZHQ E;  2ZM0 A;  4IDO A;  3UU4 A;  3C4Z A;  2CLY B;  1HFA A;  3ZCJ A;  5AFU L;  3O1I A;  4DV5 T;  1JNZ A;  1OED A;  1QLB A;  2E9X C;  2EHO C;  3QUJ A;  1VRB A;  4G63 A;  4L9I A;  4Z91 A;  3P8C D;  5LOV E;  2CXL A;  4C90 A;  1CHU A;  4KI0 F;  4DR2 T;  4Z8X A;  4UV9 B;  2J1D G;  4JI0 T;  1BR0 A;  3LK3 B;  3N9L A;  2CWO A;  3JC6 D;  4ZS3 A;  2V5C A;  4NXN T;  4B6X A;  2I6H A;  2IAK A;  4JEU B;  4YFS A;  5L47 A;  5HEG A;  2H3R A;  4PFO A;  5AQF B;  1SUM B;  2WS3 A;  3B13 A;  3GWH A;  3CIR A;  4QX8 B;  2W0G A;  1HG5 A;  4IDN A;  3RQW A;  1WFD A;  2FJB A;  2XAF B;  3L09 A;  3UUB A;  1HG2 A;  3RIU A;  3P7I A;  4H63 H;  4F8H A;  3GN5 B;  3KBU A;  2UUB T;  3B5M A;  4LFB T;  3PUQ A;  4QKN A;  3QK6 A;  4AXP A;  1ZV4 X;  1UK5 A;  2BG9 B;  4DMV A;  1OED B;  1D1C A;  2CXD A;  2AXD S;  2Y6X A;  4O4J E;  5JDL A;  5L3F B;  5FVK A;  1MND A;  3CX7 B;  1XZY A;  5F8P A;  1E7P A;  2W66 A;  3FXD B;  2E5L T;  4I55 E;  5HXC A;  4GYS A;  4ILC A;  3AE9 A;  2BBJ A;  2CEA A;  5LG4 A;  2VK9 A;  2YDR A;  2SPC A;  3H37 A;  3I9W A;  2M6I A;  4X5T A;  4CI2 B;  2JQH A;  2CLY C;  2LLY A;  3N2O A;  4BAY B;  3OTO T;  2W4X A;  3PV0 F;  1MMG A;  3RIA A;  2VB6 A;  4JI1 T;  2JQK A;  5FY1 A;  2WSS V;  1U5P A;  2K3W A;  2YDQ A;  5L3E B;  2CWY A;  5HEO A;  5FXW A;  4OK0 A;  4YXD A;  5KMG P;  5JVD E;  5FYM A;  5CJ5 A;  3C50 A;  3ZKR A;  2LSJ A;  3GMI A;  3LDQ B;  5L3C B;  4E7Z A;  5LJM A;  2QRX A;  3AA7 B;  2W62 A;  1WR6 A;  5EK2 A;  3Q5D A;  3ZT7 A;  3MAC A;  4OYK A;  1VOM A;  1IJ6 A;  3PJA A;  1KFY A;  4PJJ A;  2C5I T;  4QHO A;  3WAK A;  5JH7 E;  2X9Y A;  2V5D A;  3C51 A;  4EEB A;  3R6N A;  3AE4 A;  1E1H B;  4HE8 A;  3M65 A;  3JAE A;  3BQL A;  5C8Y E;  2K24 A;  4HFI A;  4PW8 A;  4TWH A;  3AEC A;  4YY3 T;  1HR0 T;  3WI3 A;  2K9A A;  2KLQ A;  3L39 A;  2E8I A;  5HYA A;  2H88 A;  3H3M A;  1HTJ F;  4UR9 A;  2N2N A;  3RC8 A;  4NUV A;  2YDS A;  2FJA A;  2E9X A;  3K1S A;  5DQV A;  2HH7 A;  3FZM B;  2EHO B;  4LF6 T;  1XMQ T;  4AKR B;  5JR9 C;  2VL0 A;  3CQG B;  1NEK A;  4JI4 T;  5JRC A;  4LF8 T;  3RRW A;  3P4S A;  1SHZ C;  3A8Y C;  3VKH A;  2WQY A;  4CN4 A;  2XQ4 A;  4O4I E;  4KMC A;  3RI5 A;  2WB5 A;  2CHN A;  2DWG A;  3ZMU B;  3F2E A;  3HA4 A;  5L3G B;  2YIN A;  5ABH A;  2RPA A;  4H9O C;  4IE4 A;  4IL9 A;  3AE3 A;  3ZMT B;  5KX5 E;  3OVU A;  5JR9 A;  2MAW A;  2Z6E A;  1OWA A;  2X0L B;  5LA6 E;  2XSA A;  4JEH B;  4V1A v;  4DBR A;  4WBO A;  4X1Y E;  5JQG E;  1M62 A;  3EI0 A;  5HEU A;  4LF4 T;  2ACZ A;  4DR7 T;  5H6R B;  2ZM8 A;  3ZT6 A;  4DUZ T;  4BJM A;  3MJX A;  4MBQ A;  2LOP A;  3Q5E A;  2A3D A;  5EK3 A;  4YSX A;  1ZOY A;  2IML A;  4TWF A;  3ONX A;  4DV1 T;  5JRC B;  4O4L E;  2DHR A;  3LSV A;  4TV9 E;  2YU1 A;  4JUY A;  5AQM B;  4WW0 A;  4JI3 T;  1W09 A;  4H63 V;  2BS3 A;  3AB3 B;  1XMO T;  5F3J A;  1KNP A;  1UUR A;  3B57 A;  3LG7 A;  3U78 A;  4UV8 B;  4DBQ A;  2BKN A;  4GKK T;  1NAF A;  2N9D A;  3VRB A;  4LMJ A;  3T1H T;  5TAO A;  4X66 T;  1S94 A;  1WRD A;  3ZYL A;  3TLV A;  3CQC B;  3RYF E;  2B76 A;  1G73 A;  4ILB A;  4O8S A;  4EZH A;  2CHO A;  3T8O A;  3ZPO A;  1XNR T;  4NUU A;  2NP9 A;  4DR3 T;  4TWD A;  4ZS2 A;  1GQE A;  2ES0 A;  4EXT A;  3I1A A;  3EUH A;  3I0O A;  4I0U A;  4QWN B;  3NVO A;  3AE2 A;  2BKO A;  3AAI A;  2IC6 A;  4X20 E;  4FJO A;  2XZE A;  5LBM A;  3ZMZ B;  4AIU A;  5FY0 A;  4GOU A;  3VHL A;  3O9X A;  3C64 A;  3L8R A;  1V9D A;  2LSI A;  2YN6 A;  2Q9Q B;  3KV4 A;  3P50 A;  3M3Z B;  3RLF F;  4CZZ B;  5HEJ A;  2KWH A;  1XNQ T;  2V6Y B;  2ACX A;  1SE7 A;  3ONL C;  2VQE T;  3JAF A;  3ZEF B;  5IUX A;  3RIU C;  4U2Y A;  2MYS A;  2XAJ B;  2LRL A;  3EHZ A;  1HNZ T;  2BZB A;  4Z90 A;  5HXS A;  4JI8 T;  4QXC B;  5HEH A;  3EAB A;  2M6B A;  3IF8 B;  4HWC A;  4IE7 A;  4YTP A;  3IA3 A;  1W0B A;  2V1D B;  4IL4 A;  3SFD A;  2L9Q A;  3VR9 A;  1XDP A;  3A7M A;  5L4H A;  1N36 T;  4ZI2 D;  2LT3 A;  3I0Q A;  2X67 A;  1HX1 B;  2M67 A;  3OBV E;  5EZY E;  2JQQ A;  5LBQ B;  5AQS B;  2KSR A;  3ZN0 B;  5JDM A;  1XWM A;  4MAL A;  2VUR A;  4PJM A;  4P0B A;  1T8B A;  3AED A;  4B3S T;  4H9S E;  2VAS A;  5LHI B;  2CMR A;  2VL8 A;  4YJ3 E;  5JRE A;  3HI2 A;  4HFV A;  2CCQ A;  4G2A A;  4U7I A;  4F6R C;  1KNZ A;  4K0K T;  5HXH A;  2WZI A;  4ISS A;  5DQW A;  4CXY A;  4EED A;  3KVA A;  3RRC A;  4DID B;  5IWA T;  3P4P A;  4IT4 A;  1T7S A;  1U4Q A;  3CQX C;  2UXC T;  5AQH B;  3AE7 A;  3TLW A;  3AA0 B;  4GYR A;  4UEL A;  4BA9 A;  4EGW A;  5JDQ A;  4A97 A;  1FMV A;  2JMH A;  5LB7 B;  4EB6 E;  1UUS A;  1S35 A;  3C98 B;  2Q9Q C;  3U3I A;  2PTF A;  3FBL A;  3LBX B;  2QYW A;  3N9O A;  4CN1 A;  3FZH B;  1IJ5 A;  5LNK A;  4DR1 T;  4OX9 T;  2B1E A;  3KFW X;  4ILA A;  4PFP A;  1I6Z A;  3E08 A;  2XM2 A;  5JDF A;  3DJB A;  5LHH B;  1YD8 G;  2X51 A;  3RX6 A;  4X1I E;  3TLS A;  3FZL B;  3VU7 H;  5CFB A;  1IZN B;  5L3B B;  1MMA A;  4CXW A;  2EHO D;  3ANW A;  3KV6 A;  3N9M A;  3HKE E;  3PU3 A;  4JBW F; 
#chains in the Genus database with same CATH homology
 4GK0 E;  3ZCI A;  2KND A;  4WNK A;  2Y8D A;  4H9N C;  5H6Q B;  3PUR A;  3K3O A;  5CB4 E;  3J7Y q;  1MIY A;  3NZQ A;  4WBN E;  2V7M A;  1ZEE A;  2NWB A;  3C4W A;  2XUE A;  3MZK B;  3DTO A;  3UUX B;  1MNE A;  3WAJ A;  1LRZ A;  5FMN A;  4E7S A;  1KK7 A;  4A56 A;  4O2A E;  2XAH B;  3PUS A;  4PK6 A;  2E9X D;  4IHJ E;  3V5S A;  5J1G A;  2KZ7 B;  3CX6 B;  1WYC A;  1HX8 A;  4TX5 A;  5LXT E;  1SA0 E;  3ETV A;  1ZKE A;  3ZC1 A;  4EZ4 A;  3ESL A;  1BR2 A;  2VKH A;  1FIO A;  2DNX A;  4OHF A;  2WMN A;  4GIW A;  2V26 A;  5JDN A;  1Y64 B;  1LKX A;  3H3A A;  2MOZ A;  4H9R C;  3LJC A;  4IE0 A;  4HTE A;  4AKI A;  2WWU A;  3NBX X;  1D1A A;  5HXE A;  5LYJ E;  1QUU A;  4GK5 E;  2X66 A;  3C4X A;  4HKA A;  3AAE B;  2IC9 A;  3CKD A;  4MHC A;  5EK4 A;  3ZMS B;  3NRY A;  3RYH E;  2CE7 A;  2XHE B;  4IST A;  3ZJ2 A;  3HR0 A;  5LGU B;  3UUN A;  4P0A A;  3UUL A;  1US7 B;  3ZYK A;  2XQY A;  4MFR A;  2G0U A;  3MA9 A;  3RPU A;  4TZ4 C;  1EZ3 A;  3N9Q A;  4H9Q C;  3ANW B;  2X68 A;  3GN5 A;  2D2S A;  2X9X A;  3AA1 B;  2JPF A;  3NRX A;  2NTY A;  4UVB B;  2NW9 A;  2LJL A;  5M4Y A;  2ZMA A;  4KBM B;  3EDV A;  2NW8 A;  4YHJ A;  2A2F X;  3N9P A;  4PAG A;  3U3I A;  5LG4 A;  3LK4 2;  2V7I A;  4AKL A;  2YEV C;  4X1K E;  3OYX A;  2VKD A;  4PK4 A;  4U74 A;  4ILU A;  4N78 D;  5J2U E;  2ODV A;  2PG8 A;  5FXV A;  4L5G A;  3O1H A;  1NWM X;  2XAG B;  2P9B A;  3E0Z A;  3EDU A;  5LCY A;  1T98 A;  2Q9Q A;  3Q5X A;  4PJL A;  4EIW A;  4YJ2 E;  2UXX B;  1QSD A;  1FEW A;  4UVA B;  4UXN B;  4AQF C;  3FBZ A;  2NW7 A;  4EYY R;  5FNV E;  2JJ9 A;  3KV5 A;  1LVF A;  4CI3 B;  4ZOL E;  2CA5 A;  3UT5 E;  4DO0 A;  3ETU A;  2DLR A;  3HKD E;  3ZYM A;  2LSY A;  2D0T A;  2C5K T;  4PNI A;  4IIJ E;  3DP7 A;  3QC9 A;  2PBI A;  5JDG A;  2D0U A;  5LGN B;  2V7J A;  2WMO A;  4AI6 A;  2KT9 A;  3JC6 C;  2BDE A;  2GK9 A;  2QA7 A;  2QGS A;  1UX4 A;  2ZM2 A;  3LBX A;  4J2C A;  4OYJ A;  3LFM A;  3FHN A;  5L2L A;  3Q5W A;  3RKO A;  4ADZ A;  2KXP B;  2VKJ A;  2OA5 A;  5CA1 E;  4CXX A;  5LHG B;  4O2B E;  1FMW A;  4ZI7 E;  5HWY A;  2LEH A;  1UX5 A;  4ZI3 C;  5ETW A;  1G8X A;  3J9X 1;  5HXR A;  3SRZ A;  3HKC E;  2HPL A;  4UVC B;  3KIN B;  5KDM C;  5LGT B;  1UCU A;  2RA1 A;  4M1P A;  3MK7 C;  3O1J A;  2LSG A;  2I59 A;  4PJN A;  2VKO A;  2NTX A;  1WYB A;  5GON E;  1D0Z A;  3RC3 A;  3UFE A;  5JR9 B;  1MMD A;  2YU2 A;  2KWI B;  2V7L A;  5LP6 E;  4XBF B;  3CML A;  2IW5 B;  3ZN1 B;  1IAP A;  3PUA A;  3Q9D A;  2Y48 B;  5DJQ C;  2N1G A;  3UTK A;  1AJ3 A;  2W00 A;  4JLE A;  4YLH A;  2H7O A;  3CVR A;  2YK0 A;  4I43 B;  3GA8 A;  3PUG A;  2LSK A;  1BR1 A;  4UF0 B;  3RH3 A;  4ZI3 D;  4HEA A;  1X79 A;  3ZJ1 A;  2K48 A;  4KP3 C;  2LOS A;  2JMK A;  1WLX A;  4TN7 B;  3VKG A;  3D0T A;  3MXZ A;  3KDS E;  3AA6 B;  4K0U A;  3W15 B;  4DND A;  3HKB E;  3Q2M A;  2PJQ A;  3BK9 A;  3SOL A;  4H9P C;  5FY7 A;  2W63 A;  5IHY A;  4P09 A;  3ZLI A;  2LM9 A;  2JRK A;  3LK2 B;  4UEM A;  4UF0 A;  1MIV A;  2VWA A;  2XTL A;  3KVB A;  3UUM A;  5L3D B;  2WBL A;  4HGA A;  3K8P C;  2L8K A;  4BJN A;  4QXB B;  3PE0 A;  4AQG A;  5FXZ A;  4XZC A;  5ADX L;  2DCF A;  3ZC0 A;  1D0X A;  3KBT A;  3PU8 A;  3FXE B;  3OJA A;  3S4U A;  2LHR A;  3K3N A;  1BR4 A;  3F57 A;  4AKG A;  4TV8 E;  5A1L A;  1ZHC A;  2DWK A;  2KIN B;  2ODU A;  1Z0P A;  4MLK A;  1LVK A;  4AKH A;  4CI1 B;  1D0Y A;  2LHN A;  3N9N A;  4IGU A;  3PTR B;  2CXF A;  3MKD A;  3N2G E;  4DVD A;  1H7C A;  5J2T E;  4XAX B;  2E9X B;  4ERR A;  4QX7 B;  4AQF A;  5IYZ E;  3AAA B;  2BVM A;  4FI5 A;  4EOZ B;  3RYI E;  5JDH A;  4U72 A;  2D5U A;  2C5J A;  3BQK A;  3V5U A;  4IE6 A;  4EYU A;  3A5X A;  4IDZ A;  3IBP A;  1YW0 A;  4O4H E;  3AVS A;  3N2K E;  5E0O A;  4ANJ A;  5HWX A;  2MBG A;  5BMV E;  3K3Q C;  4ZI2 C;  4C91 A;  4I50 E;  4IE5 A;  2EHO A;  4UIG A;  3EVY A;  2RP4 A;  5FP3 A;  3I9Y A;  2A72 A;  5CA0 E;  1OXZ A;  3BQI A;  3F31 A;  2KMF A;  2LE8 A;  3AVR A;  3N5L A;  5LJN A;  5HAX A;  3O4X E;  2L3L A;  3HL6 A;  1B7T A;  1D1B A;  2HPJ A;  2MTQ A;  2ZLY A;  3OYZ A;  2C0S A;  1MIW A;  5DAB A;  2WM9 A;  4CQI A;  1YKH B;  4QXH B;  3IHR A;  4HN9 A;  1CUN A;  2X9W A;  2X9H A;  3RYC E;  3R84 B;  4ASK A;  3OKQ A;  4EAH A;  1HS7 A;  1YKE B;  1MMN A;  3NZP A;  3CPZ A;  3ZMV B;  2K5B B;  1HF8 A;  1O3X A;  3CX8 B;  2WAU A;  2XAQ B;  2XAS B;  4PK5 A;  3SWH A;  4DMW A;  4KUM B;  2W61 A;  3IEE A;  2DI4 A;  2PFV A;  3PDY A;  1HCI A;  3L3P A;  3TKL B;  2UXN B;  2H7V C;  3CWZ B;  4I4T E;  2Q9Q D;  3SS1 A;  3KV9 A;  2CM0 A;  2NOX A;  2BVL A;  3FB2 A;  4L0R A;  4OFZ A;  4TUY E;  2V7K A;  3E22 E;  5FXX A;  4ZHQ E;  2ZM0 A;  3C4Z A;  2CLY B;  1HFA A;  3ZCJ A;  5AFU L;  3O1I A;  2EHO C;  4G63 A;  2E9X C;  3QUJ A;  1VRB A;  4L9I A;  5LOV E;  3P8C D;  4C90 A;  2CXL A;  1BR0 A;  4Z8X A;  4UV9 B;  2J1D G;  3LK3 B;  3N9L A;  2CWO A;  3JC6 D;  4ZS3 A;  4B6X A;  4JEU B;  2IAK A;  4YFS A;  2H3R A;  4PFO A;  3B13 A;  3GWH A;  4QX8 B;  2W0G A;  1HG5 A;  2XAF B;  3L09 A;  1HG2 A;  3P7I A;  4H63 H;  3GN5 B;  3KBU A;  3PUQ A;  4QKN A;  3QK6 A;  4AXP A;  1ZV4 X;  4DMV A;  2CXD A;  1D1C A;  2Y6X A;  4O4J E;  5JDL A;  5L3F B;  1MND A;  3CX7 B;  5F8P A;  3FXD B;  4I55 E;  5HXC A;  4GYS A;  2CEA A;  2VK9 A;  3I9W A;  2SPC A;  3H37 A;  4CI2 B;  2CLY C;  4BAY B;  3N2O A;  1MMG A;  2VB6 A;  5FY1 A;  2WSS V;  1U5P A;  5L3E B;  2CWY A;  5FXW A;  4OK0 A;  5KMG P;  5JVD E;  5FYM A;  3C50 A;  2LSJ A;  3GMI A;  5L3C B;  4E7Z A;  5LJM A;  3AA7 B;  2W62 A;  1WR6 A;  5EK2 A;  3MAC A;  4OYK A;  1VOM A;  1IJ6 A;  4PJJ A;  3WAK A;  4QHO A;  2C5I T;  5JH7 E;  2X9Y A;  3C51 A;  3R6N A;  1E1H B;  4HE8 A;  3M65 A;  3BQL A;  5C8Y E;  2K24 A;  4PW8 A;  3WI3 A;  2K9A A;  2KLQ A;  5HYA A;  2E8I A;  1HTJ F;  2N2N A;  3RC8 A;  4NUV A;  2E9X A;  5DQV A;  2HH7 A;  2EHO B;  4AKR B;  5JR9 C;  3CQG B;  5JRC A;  3RRW A;  1SHZ C;  3VKH A;  4O4I E;  4KMC A;  2DWG A;  3ZMU B;  3F2E A;  3HA4 A;  5L3G B;  2YIN A;  4H9O C;  4IE4 A;  5KX5 E;  3ZMT B;  5JR9 A;  2Z6E A;  1OWA A;  2X0L B;  5LA6 E;  4JEH B;  4V1A v;  4DBR A;  5JQG E;  4WBO A;  4X1Y E;  5H6R B;  2ZM8 A;  4BJM A;  3MJX A;  4MBQ A;  2LOP A;  5EK3 A;  2A3D A;  3ONX A;  5JRC B;  4O4L E;  2DHR A;  4TV9 E;  2YU1 A;  4JUY A;  4WW0 A;  4H63 V;  3AB3 B;  5F3J A;  3B57 A;  4DBQ A;  3LG7 A;  3U78 A;  4UV8 B;  1NAF A;  2N9D A;  5TAO A;  1S94 A;  1WRD A;  3ZYL A;  3CQC B;  3RYF E;  1G73 A;  4O8S A;  4EZH A;  3T8O A;  3ZPO A;  4NUU A;  2NP9 A;  4ZS2 A;  2ES0 A;  4EXT A;  3I1A A;  3EUH A;  3I0O A;  4QWN B;  4X20 E;  3AAI A;  2IC6 A;  5LBM A;  4FJO A;  3ZMZ B;  5FY0 A;  4GOU A;  3VHL A;  3O9X A;  3C64 A;  1V9D A;  2LSI A;  3KV4 A;  2Q9Q B;  4CZZ B;  2KWH A;  2ACX A;  3ZEF B;  2MYS A;  2XAJ B;  2BZB A;  5HXS A;  4QXC B;  4IE7 A;  3IF8 B;  2V1D B;  2L9Q A;  4ZI2 D;  2LT3 A;  3I0Q A;  2X67 A;  3OBV E;  2M67 A;  5EZY E;  5LBQ B;  2JQQ A;  3ZN0 B;  5JDM A;  4MAL A;  4PJM A;  4P0B A;  4H9S E;  2VAS A;  5LHI B;  2CMR A;  2VL8 A;  4YJ3 E;  5JRE A;  3HI2 A;  4HFV A;  2CCQ A;  4G2A A;  4F6R C;  1KNZ A;  5HXH A;  4ISS A;  5DQW A;  4CXY A;  3KVA A;  3RRC A;  1U4Q A;  3CQX C;  5JDQ A;  3AA0 B;  4GYR A;  4UEL A;  4BA9 A;  1FMV A;  2JMH A;  4EB6 E;  1S35 A;  3C98 B;  2Q9Q C;  3FBL A;  3LBX B;  3N9O A;  1IJ5 A;  5LNK A;  2B1E A;  3KFW X;  4PFP A;  3E08 A;  5JDF A;  3DJB A;  5LHH B;  1YD8 G;  2X51 A;  3RX6 A;  4X1I E;  3VU7 H;  5L3B B;  1IZN B;  1MMA A;  4CXW A;  2EHO D;  3ANW A;  3KV6 A;  3N9M A;  3HKE E;  3PU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...