4QXOA

Crystal structure of hsting(group2) in complex with dmxaa
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
182
structure length
182
Chain Sequence
b'SVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFRDMLPQQNIDRAGIKNRVYSNSVYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stimulator of interferon genes protein
molecule tags Immune system
source organism Homo sapiens
publication title Binding-Pocket and Lid-Region Substitutions Render Human STING Sensitive to the Species-Specific Drug DMXAA.
pubmed doi rcsb
total genus 57
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2014-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qxoA02
5CFOA 4QXPA 4KBYA 5CFLA 4EMTA 4YP1A 4F5EA 4KSYA 4EF4A 4EF5A 4QXOA 5CFQA 5CFNA 5CFMA 4F5WA 5BQXA 4F5YA 4F9EA 5CFRA 4LOJA 4F5DA 4QXRA 4LOIA 4LOKA 4F9GA 4LOLA 4KC0A 4LOHA 4QXQA 5CFPA 4JC5A 4EMUA
chains in the Genus database with same CATH superfamily
2V9ZA 3LQYA 3IHWA 4ND3A 2BE7A 3EXIA 1DT5A 1FS6A 3AL3A 1MB2A 4KGXA 4UFNA 1UEIA 2R48A 2ZE6A 4UBNA 4LDAA 2C92A 1TK2A 1K5DA 5IZCA 2PMCA 3UHJA 4DT1A 1J9EA 1P2UA 1M6VA 3E7XA 1N2OA 4CV0A 4AK9A 2JARA 2XSZD 3IEMA 1HKUA 3E5RA 3FNIA 1L7DA 4TLCA 4YRTA 1C0LA 3A1UA 2I80A 4ZAWA 5IAOA 2VDMB 5KB3A 3WSTA 1OXSC 4AYTA 4BAUA 1QFMA 1DEOA 1LTKA 1ZMBA 1JQLB 3G2IA 2YVLA 1UM9A 3P0HA 1Z5WA 2VT6A 2LKDA 5JI2E 4QM6A 4YACA 3HM9A 4E1AA 3OCZA 4V3CA 3IP1A 1YAJA 3C6ZA 1RWWA 3AVQA 4IG4A 3E6AA 2O2JA 1VL0A 3BSFA 4CTKA 2HNKA 4XX1A 3WI7A 4LV5B 4CG3A 1NLMA 3CZ9A 4JUFA 1X8JA 3PVCA 1YJ8A 3SS9X 1CQIA 3BSWA 3Q5EA 3S1SA 3SC2A 2NIPA 4BS9A 2PV7A 5C1OA 2HU5A 2F17A 1DXOA 1ISMA 2PLWA 4HVCA 4GC5A 5LA6A 1FRQA 4C22A 1PYOA 2DG2A 2OFXA 4J07A 4LOJA 4TN1A 1YL5A 2I4MA 1Q12A 2TMGA 2FUNB 2O05A 2YZGA 1YZFA 2H0RA 3N76A 1AQNA 1XK6A 2V7QA 1GRQA 3NIDB 1OLXA 3PXBA 3KQVA 4P9NA 3QMVA 3ORFA 1L5KA 5FTNA 2FP4B 4WXRA 1SG9A 1F5NA 3CMMA 1E5VA 1XEFA 1YR3A 3FNBA 5CA0F 1QHNA 1WM1A 3PHJA 3TJRA 2QTMA 3ANYB 2HNAA 3DVSX 4LZPA 4PTYA 4UHHA 1CUJA 5HF8A 2RD2A 1PHPA 5FIUA 5CDHA 1VJRA 2BZ0A 1XQ9A 3JATA 3EZXA 1UKEA 2V74B 2FQYA 1Z22A 4MKZA 5E9QA 1W7AA 3ZCQA 2G8LA 4D57A 1HDGO 3LC7O 3QXJA 4X60A 1IEVA 3UV7A 2HJWA 4RF2A 5MF6A 2GA8A 2DKNA 4HAIA 2Z56A 2PKXA 3Q9NA 4FKMA 4DV7B 3LBIA 1ZVJA 3ESCA 3ZGLA 2FSVA 2CDCA 2RAPA 3FGPA 1CJKC 5DNWA 4L8GA 3V2UA 2VJPA 3WLSA 1CF9A 3DKRA 4Y2RA 4JV5B 4CMIA 3PRYA 4FGZA 3C6XA 2F9FA 3DHWC 1Q2UA 2Q3EA 3BMCB 3UFXB 4UTNA 2O0JA 4LCJA 1ISIA 1BMFA 1RJDA 5I4IA 5KIAA 1U2DA 1A82A 1RTKA 1Y7PA 2XCIA 5JPCA 3SM3A 1PQ4A 5KKCA 4DUZB 2YCBA 1Z2AA 1I3OA 4TTJA 1KSGA 4YQFA 2JG3A 5A4MS 1HOXA 1SCKA 4NBUA 3LBHA 5D1HA 1VG8A 2C9DA 2IHYA 3CH6A 1XB2A 2FPXA 2OBLA 3EC2A 3V42A 5H4HA 1WZUA 3JYNA 4Q4DA 2XT6A 3DNFA 5ENDA 2CLOB 1FSGA 2EKBA 3FIUA 4YJHA 5DN6A 3R74A 3ZWMA 4DE5A 3SKXA 4NYJQ 2QX8A 1IK6A 2XWSA 3VISA 4HQ0A 2FLKA 1YIAA 2PPVA 4O8ZA 5GP1A 1F2UA 5T67A 1V6AA 1K97A 2B5OA 2CY0A 5IVIA 1X1EA 5CT5A 4EB6B 3CVYA 3KXIA 3R5FA 3AUJB 7ADHA 1IZ9A 4NYMQ 3SAJA 4EK9A 2CDNA 2D59A 3EQZA 1N5KA 3FDIA 1HEIA 2C1EA 4H2DA 3SICE 3LHKA 2ISSD 3GEDA 1JL3A 1EEHA 1GU1A 4L5IA 4ND5A 4ZHQA 1TEZA 3VV2A 1FNSA 1PJRA 2JGEA 1EHIA 5K05A 1U4OA 4CIVA 5IM4F 4Z53A 3WQQA 3WLIA 4UTVA 1PJZA 2GRUA 4COOA 2BBTA 5AJHA 1NT2A 3HDQA 2X41A 1WF6A 3TF5A 10MHA 4M9QA 5LLTA 3DUWA 1X7WB 3WIBA 2JGDA 4PCAA 1JDZA 1MX9A 3PDJA 1MO4A 3BCSA 3AJAA 4KN6A 1IN6A 2MWMA 3N2GA 7ABPA 2J9YB 1LJUA 4UUMA 3V4RA 2GLXA 3ZU4A 4YJKA 4DR5B 3NV7A 4D6XA 3EDQA 4PG4A 1EVLA 1WUHS 1SIWA 4QFCA 2NX2A 3KBBA 2GWHA 1UF9A 3T9FA 1U9IC 4KGVA 1R0BA 3C41J 4R71A 3AF0A 1JP7A 2O2HA 1A9PA 4X95A 1L5SA 1USUA 1T2NA 2FN8A 1Z15A 4LMAA 2AHRA 3ZD8A 4Z5XA 1D2CA 3VAAA 4DNFA 5TPWA 1WXIA 3BWBA 5KVSA 1GPBA 4P4GA 1IN1A 3EHEA 4XTCS 4A5OA 1GA6A 1CZRA 4HH4A 1UADA 4QO7A 3TTUA 4BNFA 2QRQA 4HDKA 1KVRA 5SY9A 2P2ZA 5AK6A 1SEVA 3K8QA 1Z6XA 5ITSA 4YYEA 4TVSA 3RS3A 1WDLA 2VJYA 1HL7A 1IM8A 1EDEA 2D74A 3B9BA 4LNUB 3BRSA 1E7WA 3UT5B 4E22A 4C07A 4MWBA 1N6PA 2PKRA 3O4VA 3PG5A 4MAFA 1VJDA 2A84A 1DEAA 3CLTD 4Y2HA 5JCPA 4LE1A 3L8ZA 4I3HA 2VPXA 1TQDA 4HBGA 3I6ZA 5JCXA 3BIOA 4I50B 2O3UA 3GEIA 3FH0A 1YVEI 3GH3A 3OQ1A 4HVLA 3T99A 3SVTA 5FOVA 4QTUB 3RSCA 1RZUA 1KGSA 1UWKA 2DR0A 3QJGA 3SLGA 2HI0A 1JTVA 5IARA 1INLA 3HUDA 1R8SA 1RVDA 1V95A 3HRKA 3NHSA 4AWXA 2FCRA 2FF5A 2FHSA 2ASVA 2OAEA 3L0ZA 3LUCA 4L4SA 4K1LA 2AW3A 4F86A 4YJ3F 3IBFA 3GYGA 2Y93A 2ZKIA 3KJZA 4UE3S 3UT0A 3VYSB 3UMVA 3GPBA 4Z9XA 1AGNA 1GFSA 3O4IA 4JKOA 4OL9A 4ZAYA 4BEWA 1VDZA 5KOIA 4FR2A 3KETA 4UE2A 3ZGYA 1Z56C 5CA1F 3DMNA 2XCTB 3OHMA 5IYZA 1ZD9A 4JZYA 2X8JB 1M72A 2X1LA 3TW0A 3W90A 4CT0A 1G291 3OTHA 5AVTA 2L42A 4HGYA 4B44A 2JBAA 2PK3A 3MHPA 5LLDA 1FK8A 3U37A 5BWCA 1PFVA 1UDRA 3DE5X 3DB1A 3BSSA 1C5KA 4G6ZA 2QAGC 3LX5A 2E0IA 3OE5A 3WS7A 1XG5A 2VHWA 4LGYA 5C2JB 3W9UA 1L1FA 4XDYA 3WGGA 4EYKA 3WSVA 1Z34A 2YZMA 2WTNA 4F21A 3WK4A 4CKZA 3K0FB 1CHNA 3QQPA 1U8EA 1Y1PA 3E0XA 3LAWA 5K8CA 2PMFA 4WERA 1J33A 5CT9A 3T5MA 2R4QA 4ML3A 1GGKA 5A3QA 4DQLA 1C9YA 4F6CA 3IURA 3K70C 1Z0AA 2FI1A 3HYRA 4DS3A 4Z7JA 2A1UB 1E2JA 4MTCA 2GZ3A 1BGVA 1NF3A 2IZ0A 2VFAA 1ZUHA 3GAMA 4J29A 2C98A 2OR3A 3AUUA 4TL8A 1QHSA 5FORA 3ZZMA 1PJTA 4B3MB 3AQ4A 3TN7A 3VRHA 1E6WA 1EG7A 4GMKA 4M6WB 4YCLA 3UBTA 1SUDA 3DZJA 4HC4A 3T3IA 4UHEA 4RF4A 1YBHA 3PCRB 3FAKA 2M6LA 4JBGA 4U00A 3THXB 4QBTA 3WRYA 2R1VB 1V2GA 4TVOA 3S4YA 1AO0A 4BTLA 1TUGA 3ER9A 4LCBA 3IT1A 4NZMA 5EUQB 4AY5A 3ZWPA 1EE9A 4TVKA 4FDAA 2WMDA 2O3JA 2JA2A 4HWGA 4XM1A 1W76A 2X0IA 4QUIA 2P2GA 4M37A 2QYOA 3OX1A 1GEGA 4GZLA 1JGTA 4ER5A 3CBQA 2CCKA 1L3IA 4Z3DA 3PJRA 3V8NA 4DDWA 3FKQA 4D8UA 5HP4A 3JU3A 2QQ5A 5DLDA 2Y1KA 3S2GA 1FYWA 2P5SA 4MKRA 4WY8A 5DO9A 1XC7A 4IZHA 3B1XA 2Z6AA 4R9VA 2BKVA 2Z3VA 4W6ZA 4ZYVA 2JLBA 2ZCJA 3MRXA 2ISCA 4NE9A 1MC1A 5K0EA 2OECA 2PD4A 4XA8A 3AEKB 3OIWA 4A8PA 5IS2A 2OWDA 3EFHA 2AUTA 1K8QA 2D4HA 3UMGA 1L4EA 3GDHA 4LFAB 1G7TA 2ZBUA 4RJ2A 4N3NA 1RKBA 4LNAA 1RCUA 2C54A 3Q40A 1OX5A 2WD7B 4OGFA 5IJ9A 3ACCA 1EB8A 2LIVA 3P45A 3AVXA 2R1VA 1KXJA 2Z9BA 3ICWA 3MCTA 5BVHA 1UOEA 1ZM7A 2L69A 3MFQA 2FMTA 4NEHB 3MGKA 2PLAA 1LCIA 2NU6B 3OIVA 4JC5A 3UG6A 1QO9A 4UEWA 3RU2A 2PRYA 2YHIA 4FSDA 1G9XA 3I2YX 1ONPA 4JD5A 1LVUA 1PJSA 3U3JA 4YAJA 4AJ1A 3UPTA 2BSXA 3SJBA 3W2EA 1KVUA 2X0NA 1DKLA 3AJRA 4FW8A 4NXNB 1FSFA 3C6YA 2PNFA 4OJYA 3RNOA 2ISQA 3T5DA 1VIDA 4GXRA 4Q01A 1T1IA 4C06A 2WKQA 4L28A 2EZTA 4L02A 4C30A 4OVKA 3BFPA 2AQIA 3PFBA 4HAXA 1Z6PA 4INOA 4ALMA 2CV0A 1NWCA 3IO5A 4I5IA 1C3XA 4ZPJA 2PR7A 5L8VA 3HVHA 1XVAA 2GN9A 2F2TA 4ZZ1A 1SVIA 4C3ZA 2ATXA 3WMGA 4O2AA 4D79A 1W96A 3ANMA 2DECA 3I8OA 3TD9A 2VAXA 3DONA 4QQRA 1LRJA 4HWKA 2FG5A 2VLBA 4LUCA 3DBOB 3T9CA 1ZIPA 4F2WA 4QELA 2R86A 4I5DA 3U3RA 2GN0A 3DKPA 1NZFA 1X15A 2Z98A 1PFGA 1V7ZA 1CY7A 1DJNA 1MJGA 1U0SY 3B3GA 3VJKA 2GB4A 3S27A 3T8YA 1U2QA 4A82A 1MA3A 4FI3C 2PANA 4OHVA 4EG0A 1VCMA 2YWBA 2ZWAA 1UWLA 4KGDA 4YV1A 5KNBD 5G41A 1CTQA 1PL0A 2NNLD 4MGZR 3SNHA 4YCNA 3CSSA 4RD3A 1E2BA 3ZDDA 3I2JA 3SX0A 3EZGA 2O48X 3QBDA 4K6FA 4YXFA 4BFTA 3G1UA 2W70A 3Q6NA 1BE8A 3PR1A 2WILA 4FI3F 2R6GA 1W0CA 3ED1A 5AYVA 4YHHB 2FWJA 3FUUA 1RAGA 3KKOA 3L6DA 4Q3EA 4HLUC 1GPLA 3GQVA 1FTNA 2NADA 3SJZA 4JI8B 2YMMA 4Z4CA 3WE7A 3LT1A 2FW1A 3HJGA 2A1IA 4JEHA 2CNWD 3USES 1MNAA 4XI9A 5DGHA 4TLEA 1OWNA 6CHYA 4LECA 5A2QA 4GPTA 4NPAA 3QYAA 1EA5A 2EW1A 4GVXA 4EHJA 1X9IA 1Z07A 1NGSA 3P71T 2OCAA 1ODTC 4D98A 1CE8B 5B4VA 4B4DA 2QM8A 3INYA 2ZS7A 3IUSA 4RL6A 4RABA 4U2CA 1V8OA 5DYTA 1Y9JA 2FSUA 1EFVB 1SUIA 3SDZA 2H29A 1U1CA 3RTEA 1YKFA 2C77A 5ARBA 5C3MA 1JEOA 2XD9A 5DZSA 5HKKA 5SZIA 1HYGA 1C0IA 1AN0A 1P7VA 2HK7A 3CG0A 3HCRA 3Q8WA 4R1LA 5H70A 5F1YA 5CIYA 2JAQA 3QFSA 3CEJA 4OYLA 3RQSA 4Z54A 1SBZA 2O5VA 3EVBA 4ZAFA 4C7KA 3M8KA 1WKCA 1TT7A 2V59A 3CUVA 3L7LA 4K9NA 3H9UA 4WKBA 1BN6A 3BRCA 4E5YA 1IZ8A 4TV9F 4P1ZA 4BFZA 4QFDA 4BX0A 2W37A 5E0OA 5C46F 2MINB 3CNOA 3OE7D 4F93B 4HAZA 3LNTA 4FNOA 1ZH0A 3VM6A 2CYCA 3ZZNA 2H54A 3HABA 1ESNA 3G5UA 4C7OA 3GD5A 3A4LA 5ALXA 3MIIA 1P0MA 4LDRA 1CUGA 1U1GA 2Q8QA 1Z4OA 2JZNA 3TDMA 2FWMX 3QK7A 1NR7A 1Z82A 4XIJA 1GAEO 3AWDA 4M1TA 4PRLA 3USCS 4Y6RA 4NCXA 2NTEA 1BZYA 3FJOA 1R6DA 5ALPA 4HCJA 3WMEA 1XN4A 4FK8A 4L15A 4NBKA 4HJXA 5HQTA 1CQPA 2BMDA 2C96A 3D64A 1G8FA 4IDDA 2CBGA 2VQ6A 3OEED 3GRVA 1D0VA 3ND7A 1RQXA 4XIYA 1EHYA 3KYDB 5BQ3A 1S2MA 1VC2A 2JHCA 2WIDA 2QT0A 3FMVA 4P92A 3KHUA 3M1AA 4ZQGA 1DQRA 1MOPA 1G6OA 2JFHA 1P2BA 1QDUA 1CHDA 3C2QA 3ESZA 1UZLA 3RWMB 5CPFA 2VTKA 3SYNA 4EKDA 2YJ4A 4QLOA 3DEHA 3OCVA 1VHLA 2Y1DA 1SPBS 2J9FB 3NHBA 2WPDA 2EIHA 4IXWA 4RU1A 4ZK6A 2BDTA 5A5GA 5LMUB 4IJUA 4NIMA 5HKKD 4OHFA 2QRMA 3WKDA 3OY2A 2X7JA 1H8HA 3C1TA 1ZKMA 1HX7A 4BQSA 1IXRC 1EGHA 5ECGC 2F1JA 2HLPA 4WLOA 4OAQA 5JYBA 2XKKA 1Z5PA 4RTRA 1J0XO 4P2GA 2CJWA 2DFPA 4M4SA 1VIVA 3F3SA 4JJ4A 4D9NA 2WVHA 5ESWA 4HAOA 2YZ2A 1EAYA 1GGEA 4CTNA 2XRZA 1NW7A 4IM7A 2I34A 1Y89A 3PEFA 4IQ4A 4UPDA 3UK1A 3VYUB 4A0HA 7MDHA 2GUWA 4L27A 3PNBA 5K0TA 1YTLA 5DGTA 1BMTA 4NLLA 3D6TB 3I62A 1SULA 3RIMA 1C3OA 5H02A 3AERA 3LWNA 4GWGA 2LCQA 3VFDA 2H1OA 2Z8ZA 4NVRA 1BRTA 5ITVA 3JY6A 4B5LA 4HTFB 3X1ZA 5GOTA 1V8DA 3S0JA 3DL0A 3TEFA 1I80A 4KQ6A 3RWOA 1UP7A 1T2UA 1DLJA 1SXJB 3NWJA 1EFRD 2I6FA 4IDEA 4V03A 4MR7A 3ZHUA 3LT2A 1N3LA 1N7JA 3HJFA 1GGFA 4EJSA 4HUQB 1CUCA 3KWLA 4OIFA 5C0OE 3JARA 5THKA 4S0ZA 2ORED 1RLMA 1IWPB 2DTDA 1QOPB 5LLSA 1ZK4A 1U7WA 4CGYA 4YRNA 1GJRA 2VCYA 3QHQA 5CBKA 5I3ZA 3TGLA 3HCBA 3VKWA 1YK0A 3CF4G 1G3UA 1R6AA 3RSZA 5AJTA 1FJGB 3TEMA 2YNMA 4FOTA 4DQXA 5FA8A 3P96A 4G97A 1Z36A 1DAEA 2FPPA 3B52X 5EXSA 4XWKA 5DNYB 1FFBA 2OB1A 2OY0A 3QKUA 4HXYA 2HMTA 1I6KA 3UGKA 4BLPA 1B8UA 1FXWF 3KZKA 4BQQA 1CB7A 1JR3E 1ATZA 1KAHA 1U2RA 2QRNA 3H83A 3LMKA 3OEHA 3O94A 3JQBC 4L9WA 2Q7DA 2E55A 3U4IA 5IG2A 2UUCB 4KXFB 3G0OA 3VTZA 1EFCA 2BI7A 2QWXA 3ZZ0A 4JLJA 1EUYA 2E18A 3MT9A 4YRJA 1YCGA 2EZ9A 1ZIYA 3C1OA 3K53A 4BXOA 4DCJA 4X1OA 3GN1A 5BSHA 4J7CA 4BO8A 4C0XA 5DNCA 3WMRA 1JG6A 5BOSB 3WKAA 2YVAA 4QOEA 4AY3A 2DKFA 3IXMA 4FFSA 2VTBB 2G5PA 4OFWA 4WCFA 1WKBA 3PHIA 5FL3A 2Z9CA 4ZV4A 4GMGA 4XSHA 3FWPA 1QAOA 1WCXA 1M6VB 1NC1A 1QH0A 1SELA 1SUSA 2B92A 2I9PA 3PEEA 5TVGA 3RVJA 4I46A 1K06A 4Q4JA 3R3VA 4TQ9A 5LOVA 4WJZA 5EIXA 1AF7A 3KXLA 1PJAA 4OMCA 4DSUA 4KQFA 2QW8A 3I6MA 1UPTA 4JP2A 3CX4A 2YASA 1YMVA 4AF6A 4G1BA 4F3RA 2PH5A 4L16A 1ABFA 5GMOA 4ZDKA 1E1NA 1H9CA 3QUCA 3C4VA 2NUBA 3SE0A 1ACMA 3NXKA 1S8NA 1SN7A 2Q4EA 3PUHA 4H6PA 4CKBA 3HJCA 2QR5A 2Z9DA 3E48A 1RYDA 1YR9A 1YZUA 2XBLA 4U7PB 4YDSA 3NV9A 2IY7A 3ZR4B 4YCSA 1H4QA 1KFBB 3OFSA 1G8YA 2WINI 3WMFA 2V03A 5FPQA 1EESA 5KKNB 1QVRA 1K75A 4HMQA 1WNFA 1W52X 1YNOA 2HSWA 3IT2A 3L4EA 4HR7A 2IU0A 4TZ0A 2Q5IA 1PNQA 4FEEA 1GR1A 2CB0A 4OGGA 5TQ2A 3TQTA 4Q7JB 5BUCA 5JJLA 1V3VA 1XTVA 3JALA 5EWMB 3SJ7A 3A32A 4X3PA 4XR9A 2WSIA 5CT8A 1V16A 4WBNB 4IW3B 3EAGA 2CVPA 3H1TA 2BMFA 3X1KA 2J5RA 4AZ3B 2ECKA 3ZBTA 1E99A 3TRKA 2GXQA 2BLLA 4WXPA 5COQA 2B3DA 1M1NA 4U3JB 3REGA 3VJRA 4RSGA 3AO0B 1OT3A 4WCFC 1GZ4A 1QTNA 3LDFA 4BLWA 4BO7A 4F9EA 1K7CA 4CIAA 3K73O 2ZRJA 1A7JA 1L6RA 1AT1A 2CVHA 1ISHA 2YIDA 3QYJA 4R5MA 1K89A 1QC5B 1W0JA 1W30A 2GO7A 3TOSA 5BNTA 1WMAA 1TIKA 4M36A 4D3DA 4UOZA 5CDGA 4PSAA 2ZB4A 3QU9A 2CZCA 4GLLA 4II7A 4AO6A 1N6HA 4KI7A 1MIOB 1U65A 1D2AA 1WX1A 3PK0A 4RXTA 2B4TO 2FSGA 4F46A 2VJMB 3D43A 3G85A 3CW2A 3N8HA 3WWDA 5CDFE 2C5SA 2ZRIA 2DWPA 1J24A 1MT3A 1QM5A 5KCMA 5BW8A 4YRAA 5HIJA 2RE8A 2C7PA 4TZ6A 1JKXA 1QGDA 2GVZC 4GPZA 5KDOA 1PGJA 4KQ1A 2PKWA 2AQHA 3W2FA 3G0HA 1DBIA 2XNCA 3GLHA 3RODA 5AD1A 2G72A 1XLUA 2YNMC 4H6WA 5CNIA 2R68A 2V9PA 2AFHB 2QJOA 1LDYA 3RU3A 2H7XA 4AYWA 1ZGGA 2FZWA 1W6UA 3WP0A 2AMLA 4PZPA 2DFDA 3RYHA 4OHRA 3OX2A 2I4NA 3CRQA 1STOA 4DYHA 5B7QA 3ZHOA 2OL4A 4PFKA 2PCLA 4NFYA 3ZWOA 4PF1A 2JIQA 5AHWA 4EJSC 3KT6A 4KKXB 5LBIA 2FEXA 4W63A 4BB0A 3DDUA 2GXAA 2XOKD 3D7KA 4Q12A 4S1OA 5HKBA 3ZJTA 1WXEA 2C7GA 2AMYA 2JH8A 2IYYA 3AEUA 2YN0A 5DMXA 1NM5C 3NOXA 4K03A 4BUZA 4CIWA 1EWQA 3UWSA 4KNYA 4BNJA 1Y5IA 3LPLA 4ER0A 3OI7A 2CFTA 3NM5A 4JCCA 4UXIA 1ODFA 5HIAA 1U4SA 4WJLA 3M6XA 2BGJA 1DJPA 3NPAA 2OZKA 1HE3A 2XEXA 3BIWA 4OKSA 4TLLB 3MPUA 4D9FA 5EJ9A 3R3YA 3VR2A 2XYQA 1K9SA 1YZLA 2AG6A 1Z7YA 2BMJA 5E2AA 3JAMA 1N5RA 1AA6A 2BIFA 5EE9A 2IT1A 2ZIWB 4MS3A 4L72A 2LVBA 4RBNA 4WZAE 1PGQA 2RGRA 2C2OA 2N9UA 1JLLA 4AL4A 3JD0A 4BC0A 5LXTB 4HX9A 1SBIA 1SXPA 2J9GA 1XZCA 4I99A 3M1YA 2XVXA 3ZUPA 4ARUA 3H5OA 1T4GA 4K05A 3MD9A 1D1SA 3K9NA 1FP4A 5IAAA 3IVMA 3FCYA 5CDTA 2ACWA 1PS9A 4R3WA 3KV3O 1DIHA 1LWNA 2XMQA 4CETA 5AVXA 1T2FA 1PG5A 2HTEA 3O75A 2ZBRA 1F8FA 5ALSA 1FFWA 1N2CE 1N8TA 1HBJA 1UZUA 3D0KA 4KNVA 3OURA 4RPGA 2HJHA 3LO8A 4PN7A 3WAGA 5BN4A 1TZ2A 4ARZB 4KPGA 3AY7A 2VJCA 3UAVA 4ATNA 1Z4LA 2VTEA 4OHPA 2OAP1 3DMTA 4Q4AB 3KLOA 3TLCA 5A04A 4A0QA 5EY5B 4WFIA 3H5NA 1RXVA 2HQ1A 3VJLA 1G42A 1EWYA 3B78A 1G21E 2FLVA 1GLVA 3LO5A 4U1RA 4MI9A 5KHLB 2VWGA 5ECDA 3KNZA 3TXAA 1XTBA 1CUFA 4WK0B 4WBNF 2WTXA 3SY8A 5ADHA 1C9NA 3CU5A 2ODPA 2CV1A 1Z0IA 4HRYA 5CP8A 2WT8A 1SAYA 3HWX1 3WHPA 1Z62A 4LIPD 3PF9A 3W7AA 2BKUA 1MV8A 1PGNA 4FFVA 2P9CA 1IWBB 4EO9A 3N3AC 4L4XA 1A4UA 1DCMA 4NFLA 1Z7EA 3W77A 5F7JA 3D81A 1KDYA 3JYLA 3GLHE 3NAMA 4HDRB 4EGQA 3N8DA 5HE9A 5CYOA 5H3CA 1TAUA 3JWPA 3M7IA 4QU0A 3ENZA 4BGDA 5KSYA 1WBBA 1NF2A 3KZOA 1G19A 3U40A 3H2ZA 4FFNA 4JOQA 5AVUA 3QE4A 1VFPA 1GV1A 1MEOA 2XNDD 1KO7A 4YV2A 4FGUA 5IUJC 2Y0BA 3FFXA 1Z26A 3PD1A 1K4KA 4LQDA 1MDBA 1YJAA 3D1LA 3JWGA 4MKFA 3T1HB 4PY2A 2ZJ7A 2YKGA 3ZK7A 1J6UA 2OTCA 3I2IA 3IPRA 4KLCA 1EBFA 4CEHB 5B1DA 2EG9A 3W79A 3HFGA 2HXYA 1JJ7A 1WSBA 3P27A 4Y9SA 3BD7A 3L02A 1A2OA 2HGZA 4ARCA 3WB9A 1SQ6A 3DW3X 1FYXA 2WY2D 4CTJA 2HWKA 4Q18A 2PX6A 2DJIA 3NJ4A 3C7DB 4M1OA 1KAQA 5BORA 3COZA 3C8ZA 4IWXA 4AX4A 1JUDA 2R1TA 2YQ5A 4AJIA 3LBYA 2AQKA 2BF7A 5G3YA 4CWAA 1AS0A 1OJ7A 4KMRA 4Q3LA 2HF8A 2QAJA 4HLUA 2ZT5A 1KXZA 1R50A 2ZJ1A 1LVGA 3ILSA 3EGCA 1GZ6A 2BHTA 3KT8A 4NMMA 1JBEA 4P54A 4ESHA 1BNCA 1FTGA 3E1SA 4RVGA 5LUBA 4EPTA 1EM8A 3ET4A 2XLCA 4A1FA 3HNOA 2CDRA 4QODA 1ENYA 4CI0B 3OWXA 2FEWB 3THWB 1G7CA 3MGCA 4PSDA 3CLSC 3N39C 2ZANA 4HHEA 3RUAA 2GJ8A 4O4IA 4UNIA 1IQPA 1U99A 2GZHA 2V7QD 1OMOA 4W7IA 4CBVA 3P2YA 3TE6A 2NO0A 3FKSD 4XTRA 5DKFA 3X1WA 1I3MA 1N2JA 3DT6A 4JITA 1H66A 4DCOA 4NPHA 1QDEA 2V9CA 3HL0A 4OL0A 3ZNNA 1SKQA 3NGXA 2ATEA 3GJ5A 3OLXA 4F7DA 4YUAA 3QKSA 3UZUA 4H4CA 5HBRA 1CVLA 2C2HA 2IUSA 3BMCA 4H3KB 4UUBA 1FDVA 4O1IA 4E5PA 5JFOA 3TFOA 1SM4A 1AU9A 1VCOA 1NJ8A 1P18A 2X5OA 3H9EO 4ZAGA 1L1QA 5T3UA 3AF5A 4HNRA 4MJXA 4G8DA 2FH5B 3FLBA 4B3IA 4TRJA 4PZEA 4HS9A 1UANA 2XODA 1IAVA 4DLKA 1JA1A 3B38A 2B78A 3WFJA 3PFGA 3ZTYA 4UTXA 5A06A 3UNXA 4J6EA 3RRJA 1E9RA 1R5NA 4QPJC 3W5DA 1M1XB 1DC3A 5DP1A 3SEZA 1GQRA 1U3TA 5LZ2A 4M0DA 3KSDO 3QVVA 4P5EA 2H2HA 5KSWB 1E5DA 2PX3A 1I7LA 1G3MA 2HHAA 4I50F 4DLTA 4IIUA 4ALNA 2AS0A 4FPXA 2O8VA 3LQ1A 3ZUGA 4DPKA 4NZYA 1JSLA 2K5UA 3O8CA 1FPMA 4OOEA 4FXOA 3IAEA 3AL2A 5CCXA 3H1AA 2JI8A 5ALRA 5T5QA 3N07A 5L3SB 5FUXA 1FS4A 4H1TA 4HMOA 2B2NA 3MYYA 3MF4A 4LC9A 2PZMA 4REOA 4LX8A 5B3JC 4CM4B 3PUZA 4BNDA 4L5AA 4BXOB 1CRZA 4ZJYA 4RHXA 2I65A 3RC3A 3D3KA 5KWSA 4B47A 2Q45A 1TTQB 3RBVA 1TM4E 3LDUA 1QSGA 1M1YA 4TKUA 1RKUA 3EGIA 4HGRA 5C5CA 1QFYA 1RC1A 3ITNA 3NG1A 3KUCA 3R5XA 2GLUA 1XDUA 4LC1A 4YS6A 1IU9A 4RD1A 2IUEA 1F4LA 4R8MA 2OBXA 4I4TB 3NKVA 1LA2A 3TLBA 4RMHA 3UC5A 3PE3A 5BQFA 4HLDA 1DBSA 4IICA 3KOOA 4MZDA 4CFSA 4KR2A 3E61A 2C3OA 4CLEA 5BUQA 3HXTA 1SFRA 4PG5A 3ER6A 4Q9LA 1EFKA 1BMDA 1YU6A 1ZD4A 1QGOA 2ZQYA 3KR0A 3QVGB 2UVPA 4LA4A 4RM2A 5G1PA 4YCCA 1V5GA 4U7GA 4F4JA 4YXWD 2J59A 3EZ7A 4TL6A 5LQDA 4RJTA 4JGIA 1HZJA 1H0SA 1KZ9A 3EMBA 3F71A 1VL1A 1K3UB 3MYRA 2O4CA 4G4JA 1GPKA 1AURA 1CZNA 1QPGA 1WXHA 1KMNA 1XTUA 2GTIA 2Y99A 3QUTA 4LTNA 4MLZA 2CLLB 3WQHA 2WLSA 2FX5A 5AHOA 3RSGA 3VTKA 2IYEA 2XI4A 2NVUA 3ORRA 3QBEA 5AM0A 3WKCA 2ZSUA 3W6UA 3MMXA 2Y0PA 1BXKA 1DQPA 4ZVLA 2VS1A 3OIGA 5EGNA 1BW9B 1C7IA 3R0VA 3U7FB 3DFIA 5JHHB 3TBHA 1ZXLA 3LT5A 3NO4A 2JKVA 3GBVA 4DQVA 2O8DA 4NC9A 3E8SA 3EA0A 3FMOB 2GHIA 1L8AA 2GBLC 3C1AA 4PHTA 1TT5B 1FY2A 3A25A 3BRWA 3DDNA 2B1GA 3HZOA 4IZOA 4JDUA 4MCAA 4CNQA 1IPFA 4HRVA 4BV3A 3DYVA 1CSEE 4Q6BA 2IX9A 3F6BX 5T3YA 5AW3A 4F92B 3VPXA 1PZGA 1X7XB 4HFNA 2WWFA 3D6VA 4KYUA 2W2PA 1GYRA 1P4AA 2DFKB 2NNWB 3R20A 4WRRA 5JSQA 3ZCUA 1MP0A 5C7LO 1N3BA 1QX4A 1A27A 1U1IA 1KK3A 2UAGA 1C4OA 4QBFA 2XQKA 3G2LA 3T5BA 4EY6A 4LBVA 4P5PA 1M0TA 2VNSA 4PCLA 1NA5A 3S7TA 3SK0A 3WZLA 2OAQ1 3I0MA 3T3NA 1BWPA 3IR5A 3EHDA 2IBSA 2M1ZA 2R4TA 3GI1A 5DNEA 3KVRA 1U3VA 4MRRA 2B3TA 4AKSA 3KSUA 5ALOA 3GOHA 2C04A 2X0KA 2NOAA 3ZDFA 2WVGA 2MR6A 2G9ZA 3AR8A 3GVIA 4PLVA 3RG2A 1TB4A 5AKYA 5EE3A 1OV4A 3K1YA 1IQRA 1OVMA 3DD1A 1Y7TA 1WZIA 2FPWA 4CMAA 2PZBA 4MOWA 2XUFA 2P9GA 3PB3A 4QX6A 3B7GA 3I1FA 3TLEA 4FJ1A 1OX6A 1USGA 3OUZA 3TLAA 4ZC8A 1THZA 3B9RA 2ZYAA 3G5MA 3AK4A 3OTGA 6NULA 5LUAA 3Q12A 3BXZA 4US0R 5HUHA 1OAAA 4HQLA 3KR1A 1NQTA 3V8VA 4OI0A 4CM3A 1X7GA 1JE1A 4P86A 4ZKEA 4NDNE 5FPKA 1A88A 3BJIC 4HFRA 4IEEA 1A9YA 3K94A 5B4UA 4HXGA 1QB7A 4YUXA 3H1FA 1BVHA 2J7PD 3WRVA 1BQEA 1ZRHA 2XVZA 4QOSA 2QIPA 2QGZA 3H0CA 3NASA 2G1KA 2VHXA 3PVSA 3ZWBA 3FVWA 3O4JA 5AVJA 1RSZA 3DZGA 4PANA 2LDXA 3WLOA 5T8KA 1P5RA 1OW3B 1T2VA 4MYRA 4EENA 1P7PA 4QARA 5LM3A 4A8JC 1YDWA 5F78A 3RVBA 5LQKA 1JHMA 3IDZA 4HEJA 2ZB8A 2ZIGA 5BOVA 3WB1A 4EA8A 1JDNA 1KJYA 2C3MA 3EFBA 2ONKA 3HU5A 4WESA 2A5JA 4HV4A 2JS7A 5DT2A 3Q41A 2XCQA 4JI0B 4EG5A 1KMMA 3BS4A 2PE5A 4J7UA 3ZW7A 3KO8A 1OZFA 4OREX 5B6PA 1DX4A 2B2CA 3TLMA 3WYCA 4JENA 4PC2A 5AOVA 1VKRA 1U9IA 2XX3A 3ILXA 3S7ZA 1RXWA 2OO3A 3KZCA 3TECE 4Z1OA 4A0FA 2J3KA 2BDUA 2C9MA 2QGFA 2WIJA 1BQ4A 3GFSA 3H11B 2GD2A 4J0GA 2ZUTA 3RR2A 4RTNA 4RELA 2BEVA 1JIXA 5F76A 4ZV7A 1T9GR 1VOTA 1XL0A 2R3SA 4OLJA 5TC4A 3RFCA 5EJ4A 5LR6A 3IEKA 3OQNA 1TI7A 2H5EA 2VJNA 3R9XB 1I7DA 1OV6A 3U0BA 2VT2A 3MVEA 2ZZMA 2YRWA 2WWVD 2DBQA 3DBRB 4WA7A 2YJ6A 4IWNA 4L0DA 1ESMA 2PMBA 3KE8A 4A2WA 2QD1A 4DANA 4EGCB 4BZWA 5BN5A 1E2PA 2KHZA 1N9KA 3BWVA 3BN3A 1K92A 3SNKA 3C8DA 4LZZA 1UBCA 4MKHA 4KSCA 2BBSA 3J81k 3D0QA 3DWIA 1Z6ZA 1RLOA 2PGOA 4QDJA 1TUIA 4DQUA 4DEYA 4P80A 1PO7A 1QFXA 1O0BA 1S1CA 3NB0A 4MV6A 2WOJA 4Y6SA 5IAJA 2J6CA 1EK2A 1B6TA 2HADA 4BKPA 4AICA 2Q9AA 4XW2A 3TD2A 2C84A 4OP2A 1NXTA 3H0EA 1A96A 1VE7A 1A76A 3WBJA 5ALHA 5SYMA 4J0QA 4WDQA 2OPHA 2B4AA 3QVXA 5FJJA 4PLYA 2FRXA 1BKDR 2BFFB 2FEOA 5JATA 4RMJA 1HURA 2ATIA 4N6OA 1BN7A 1XMIA 4J1QA 5CX1B 5EIOA 3Q7EA 5LNK6 1VGRA 1J0CA 2AOVA 3L7BA 1YUMA 1ILWA 5EZSA 1EVIA 4MA0A 2GPJA 3E35A 1XEXB 1HE8B 5G40A 5A3JA 3T12A 1O97D 4F84A 4YPOA 3A1EA 3K9WA 1PAUA 2G4VA 1DUSA 3WHIA 4CG0A 3C97A 4KAJA 3R24A 3NBMA 4XJVA 4PV7A 3ZQ6A 1OFVA 3HZRA 2IU3A 3S5JA 3IBYA 1KKMA 2QRLA 4IBOA 4IHKA 3ICEA 5DW0A 4AN0A 1A69A 3TG8A 4LE2A 3PCXA 1JDBB 2VZ9A 1FRZA 4W8OA 1JIJA 3E8MA 1JS1X 2CUNA 3VGJA 7REQB 3T5PA 2FSVC 5IULC 2P90A 3G2PA 1CULC 4NH0A 1VJ5A 4F9GA 2YYSA 2Y9MB 3Q6IA 1UMBA 2I5PO 2YQZA 2IP4A 3TPFA 1L5MA 1E3SA 2GTHA 1W87A 3JQPA 3HXOA 4CM1A 2NZUG 5AIAA 2PKYX 3FZQA 3TTWA 1C4WA 1LTHR 2X9VA 1K8XB 2G6TA 3L4SO 4XUDA 2VSNA 3WIOA 4K9KA 3B7PA 2VSFA 1SCNE 1A9ZA 1KZ1A 3IR7A 2ZYWX 4MINA 5DNVA 3CE9A 1JFVA 1FYFA 4RLFA 3IMCA 3LGAA 3NHLA 1UBEA 3GGSA 3MWDB 4LYGA 4NPCA 4U0JA 4YMSA 4E03A 1ECBA 3IILA 2A9RA 2Q28A 3H13A 3KPJA 2HJGA 3UPUA 1TRHA 1G6KA 1T8WA 2LP4Y 4QU5A 4FYYA 1JU4A 4AVYA 4JLAA 1U0EA 1VB5A 2CLHB 2EKQA 3KHTA 4PC1A 4UBOA 2GEVA 3VNQA 4BBJA 4KAAA 4DA6A 3AP2A 2AZTA 4M0CA 4LOHA 1J42A 4E08A 2ZUFA 1P1BA 1U3CA 1COWA 1P3JA 2KLBA 4LK3A 1L5NA 2P2CA 2ZCVA 1T9AA 3RS4A 5LDDC 3C14C 4QDTA 5EC8A 3QOFA 3ZOKA 2WG1A 5CB4B 4C7MA 1GTJ1 1GU7A 1ZK2A 2IDJA 3MOGA 3SHWA 3PUWA 4X9XA 2O5EA 2L18A 3VZRA 3OO1A 3I72A 4W4TA 4EMBA 1S9DA 2C5BA 5AOCA 1KDRA 1PEKE 4JFRA 3IYLW 4Z1MD 3M5DA 3W5HA 1IZZA 5DBHX 3HXQA 2RMKA 4JR2A 3PPXA 3THRA 1RXYA 1MCZA 4TKVA 2O8DB 5JY6A 4QXQA 2W2LA 1DFHA 3AXTA 1G60A 2OYRA 1DIAA 1CDOA 1MEEA 3GRRA 5C3UA 4PRZA 4EL0A 1LBSA 1UFQA 1POXA 4DLLA 5LYJF 4QEKA 1CNFA 1EVKA 2RGUA 4NBNA 3MWJA 1GPNA 5F2OA 3DO8A 3NIWA 5DCWA 4MRMA 2JCYA 2DU8A 4URHA 3DVAA 3W3ZB 1V8PA 1JVSA 2PKCA 3DLHA 2H11A 8ATCA 1QFZA 5IZCC 3FFTA 1Z88A 1DUVG 1MABB 3KX2A 3P26A 2ZTVA 1ZOOA 1J9ZA 3V3KA 4A2CA 1KAGA 4R9UC 5EJFA 1L7XA 1Z4KA 3KLMX 2CMFA 5KU7A 4ZCLA 3NCTA 1Z0DA 4X54A 1NVXQ 5FHRA 2P5UA 2QDXA 1SC4A 1N2BA 1T6NA 1I6LA 2GYWA 3ND9A 2CMGA 4UD2A 2DCMA 3WL7A 1EE2A 1T4CB 4YMUA 4O4JB 3TFWA 4L1KA 2Q2VA 2BP7A 2H06A 2BN4A 3TTXA 3WWCA 1YZQA 4CIYA 4MV0A 5L7TA 3ZVMA 1D1TA 1T9GS 1S9HA 1F51E 1ZU4A 2O14A 1VRVA 2QJWA 3E2MA 4P3PA 4V0MA 2HFJA 3K31A 3OLZA 4Q02A 4F71A 4IDBA 3LW8A 4RK5A 3NKFA 3E7FA 3Q8KA 1ZG3A 1MVNA 1KQ3A 4GOOD 5CGQB 1Q44A 5T4BA 5K4GA 1TNDA 3A2MA 3GFQA 1UOPA 3OEWA 4XWAA 1ECFA 3PX3A 1M0SA 2AJCA 3DA8A 1X42A 1YGYA 1JHXA 2JHAA 3GEMA 4OF4A 2FRDC 1GDTA 3RARA 3KJGA 3H8VA 3SBOA 2Q2OA 2G1PA 3VNVA 2Q2WA 3WIUA 4DARA 4EJMA 5ITZA 4RD4A 1X0XA 2FFJA 4YWJA 2YOGA 3I32A 3LFTA 4Q9DA 3MSCA 4RY8A 3U3KA 3A2NA 4WN3A 4MLDA 4RIIA 4F85A 4E07A 3OPYB 2D5AA 4TS1A 3LU1A 1QNLA 1QZZA 1XYGA 2HU7A 1BXRA 2WTAA 3E3LA 1O57A 4FU0A 2B21A 3E9DA 2ZSDA 4NMWA 5D7NA 5FFMA 4MLPA 1O8BA 2W42A 3R3HA 3A3KA 2QV0A 2WT9A 1TX4B 3MUOA 3OPMA 3PPYA 3EPHA 2EDAA 1FRVA 3O2QB 4GPD1 521PA 1MH1A 2ZYUX 2J0EA 5L7YA 4IIVA 2W0MA 2RHJA 4OHBA 2QT9A 1VI2A 1SHUX 2JBHA 2P4EA 5FLKA 2UV8A 1GPAA 4GP7A 4K40A 2PX2A 1NBEA 2YZNA 5L6LB 4EO7A 2E4UA 2A0KA 4Z0TA 2QUAA 3GG2A 4AZTA 4ALJA 3JWHA 4P93A 2A0WA 1R12A 1Y8ZA 4L2IA 3VZSA 3VC1A 2O8FA 3QY0A 2CHQA 3S2SA 1SD1A 4KLNA 1GNVA 5A5VA 3G02A 1APBA 5FEMA 1D0SA 4G0QA 3QF4B 2CKMA 2AKAB 5D8DA 3X2EA 5JMOA 1AV6A 2R6HA 4FX2A 3UBMA 2E5WA 3ITEA 5KNDH 2G1JA 4LHXA 1EWVA 2FZKA 2DUNA 3ZE0B 3ES9A 5CFZA 1QPBA 3M6MD 4DNXA 4G9BA 5FDFA 1IVNA 1II9A 2C3YA 3PNQA 2RHHA 3QP9A 3IB6A 3K8YA 3ZHYA 1V6SA 4OLFA 2ZAMA 3QWBA 1J9GA 1SUEA 1Z18A 2CXRA 2PS0A 5I5GA 3O7WA 2GRJA 4CU2A 1T0BA 3IVAA 1Z63A 2BW0A 2JANA 3A70A 2AC7A 3LHDA 2LNDA 2ON6A 4FD3A 1K1EA 3B8HA 4MV3A 2EFHB 1MX1A 2CXXA 5ALEA 5PNTA 3STXA 4WQMA 4DXHA 1T43A 4Q9JA 3CGGA 3THXA 3HBAA 3RUFA 3IV7A 3T7KA 3M9LA 1K6IA 1QVZA 1O87A 3KJIA 1SPXA 2ETXA 2H1FA 5JBIA 3UJNA 3KK0A 4B7ZA 2Y6VA 2XITA 2RGEA 4P35A 1H2YA 2IUFA 3RU7A 4X6UA 3UJCA 2XPCA 4P3YA 5TT1A 2KBEA 4D4KA 4H08A 5DHAA 2Q7OE 2BTEA 2G17A 3KSBC 1KC3A 1ZSVA 4NESA 3PX2A 5IJWA 4ON9A 5HDBB 3HVIA 2CHEA 3TQSA 2XVYA 4PHHA 4WZZA 4KPFC 4N49A 3DE0X 5FF9A 2W2KA 4P3NA 1VE5A 3GCXA 1NFFA 2R97A 1WY7A 1I4EB 5AP9A 5JO0A 5JC8A 1EUDA 4D56A 5B1YA 1KEUA 1R9GA 4GUDA 3RAJA 1TW3A 4LY0A 3T7RA 1FNBA 1RAIA 3BIXA 1E8DA 2VHVA 3C5HA 1WCV1 2MMCA 4BWVA 2CXSA 4RVSA 1FF9A 1K9VF 1RAFA 2HNBA 2R7LA 3A26A 3T4XA 3FYUB 4PGMA 1MVLA 4UNRA 5GADl 2JD2A 4OI2A 3U4GA 4LYHA 5BSVA 3FGZA 3A1DA 3AX6A 3P9PA 1PYGA 2AFIA 1SUWA 1KI3A 4FWIB 4IAOA 2BFPA 2BFBB 2ONZA 4BNIA 8ADHA 4EVQA 1Q6YA 1E58A 3JQCA 4NR0A 4NWIA 4TTAA 4IGIA 4RD2A 3LCCA 5F12A 3VI4B 4I1RA 3ZE2B 4MV1A 2ZRGA 1U0JA 4IZIA 4RKRA 4HSEA 2CT8A 2M32A 5FBLB 5FUBA 2CL6X 1EK6A 5LYYA 1E60A 1FP6A 1VPVA 2FZ5A 2QYSA 1UEXC 2C2MA 3BRWD 3FMIA 3SFTA 3PSHA 1DMRA 1Z74A 1N3IA 4MPTA 1K8RA 1RWOA 1X94A 1AKVA 3DAGA 5DNDA 1DBVO 3CONA 4PFSA 5AK0A 4KJXA 3KTDA 1GG9A 5BN3A 2G4LA 3VUFA 2PRIA 4PXSA 5DASA 3DTVD 1F0YA 3MM4A 3WO1A 3U6KA 1ULZA 3B6KA 4KXQA 2ZDHA 4JP5A 4UJ5A 4G0MA 3U26A 1VMAA 4NZOA 4CFZA 1TKBA 2VZLA 5B12A 1M9NA 2Y4OA 1IVSA 2JLZA 1Y0BA 4XIIA 3IIIA 4ILEA 3D4NA 5HUQA 2A57A 1AKMA 4L6CA 3BH6A 3E82A 2DY0A 4QXMA 1Z4JA 1Y7LA 4J1TA 4YR7A 4TRNA 5BMVF 4EG8A 2HRDA 2QRHA 1XEWY 2NXJA 3ZKAA 4OYYA 2IPMA 5BQXA 1YUBA 4ENRA 3ASZA 3EODA 4KYVA 4XVCA 1QG4A 1IULA 3NC0C 4F2GA 3DMPA 2F59A 2R8YA 3JRNA 2AX4A 4FTWA 4KOEC 1YAHA 4DN6A 3LVRE 1RHQA 2W83A 4NP6A 3AUKA 3HU1A 1JW9B 5DBFA 5TPWB 4ND6A 3GRUA 1NLUA 4TTVA 3EOZA 5EJGA 2VQ3A 3TM5A 5FBRB 1ZQ9A 1SOAA 1WCWA 3U49A 4C2UA 2FSFA 3HGTA 3O3NB 5GZ6A 1TD9A 2NSJA 5EHGA 3IX7A 5M34A 2AYYA 4FYWA 2AZ4A 2HH9A 1JHQA 1WSDA 1N5IA 2QVGA 2W6QA 2G9RA 5BYJA 1DELA 1TE2A 3F97A 3PEWA 2C0CA 3HUUA 3DYIA 3NJRA 2VLIA 2WB4A 3RW9A 2VCHA 2GOYA 5A5EA 2YUIA 3G13A 4XOUA 4KPYA 3ROFA 4EEZA 1DZIA 4D9EA 2JHGA 1Z39A 3BTVA 1J21A 4WLEA 5K6AC 3B2NA 2F1RA 2ZVQX 2ZBQA 1EBUA 2GCOA 3AFHA 2P9ZA 3HLYA 2PQ0A 1D5CA 1GLGA 2OV8A 2YVUA 3OJEA 3PFIA 4OQLA 3VTFA 4ASUA 5NULA 2BDEA 1WHTB 3VR4A 1YASA 1HLPA 3COYA 3AYZB 4EHHA 3CMCO 2PSJA 3LHFA 4E70A 4MICA 1YE8A 1WW3A 2FSHA 3K9BA 2LWIA 3N0VA 4ZJUA 4Q24A 1Y8AA 4CL0A 5THXA 3O8OB 1GG8A 4HATA 4BZXA 1QIMA 2OV1A 4MHOA 5DBEX 4QUHA 1XKQA 3G49A 1LDBA 4JROA 2G1AA 4OCZA 1XXHB 4RKQA 3U7JA 1KEZA 3UWKA 1UKYA 3ILVA 4O4JA 3ZGNA 3MJHA 2O3QA 1VXOA 3F5MA 4OU5A 1V48A 4NQRA 2VQFB 2PT9A 5HIMA 1G0NA 3JVVA 4NJOA 3L84A 3IUMA 1C3LA 3N2IA 4KR0A 4R2JA 3PYLA 3WY9A 5F7ZA 1LDNA 3U81A 2GXSA 5EZYB 2PJRA 4Q3DA 1W4LA 4PLHA 3CT4A 4OG2A 3ZVLA 4PU0A 3BT7A 5HMMA 3X2SA 2YS6A 1U7XA 2X6TA 2X4LA 1N6RA 3PWTA 5HIIA 1JMYA 5CA0A 4MRAA 2VDLB 3M4YA 5DM1A 2JCXA 4I6EA 2XWJI 4LWOA 1GPDG 4JCOA 2I9KA 3OIFA 4IJMA 3MTGA 5IN5A 2MSCB 3TW4A 5DH9A 4TUYB 4FQ7A 1SU6A 4R8KA 5D3QA 3I61A 3WKEA 3L0CA 3GGJA 5C52B 3PEYA 5ISMA 4QYTA 3U7HB 4ZRDA 3GK3A 5EMHA 3LBFA 3PT5A 3IEUA 2JI4A 4UPEA 2A5LA 4NK5A 3VVMA 4BO6A 2R44A 1CR2A 1W5BA 1TC1A 3GJ8A 2OC4A 2Y71A 3OJFA 3ZI4A 4A8TA 1P81A 2KW5A 4B8WA 1Z7WA 4CQLB 4US2R 1SVSA 2QM0A 2W48A 3FB4A 2NUAB 2Q3FA 5JRJA 1Q1ZA 1G0OA 1IHOA 1GSAA 3L05A 2OBMA 2X23A 3PGKA 1OTHA 1W85A 4JVOA 2AMJA 4FHEA 1UAAA 5M29A 3GLTA 3DDZX 2ADFA 1NSTA 1N25A 1IJEA 3JQ9A 3DOCA 1RMQA 1F0PA 3FTEA 1KOFA 1ZN7A 4E4RA 3NDRA 3PNYA 1I4LD 2X9QA 4Y2UA 3AINA 2JEZA 2Z04A 1C9JA 3TPCA 3W7VA 4CKBB 4R1SA 1AD2A 1QIEA 5JXWA 2PS1A 1VL5A 4F3TA 1YVUA 5JQGA 5DYNA 1FXSA 1ZUNA 3ROEA 2ENWA 1VLMA 3JVDA 3LIIA 4MROA 1Y34E 4XPIA 1I9CA 5KCZA 2XWBF 4QXRA 3SPXA 4JY7A 5SV2A 1ACLA 2P3SA 5T57A 1J2YA 5JZMA 4Y1FA 3LLMA 5KWVA 1BJKA 4MKIA 5J58A 2G6BA 3VKHA 1U3UA 1S4QA 1BH2A 1HG0A 4PZAA 5I7OA 2GESA 1E6KA 2F8MA 4RE6A 4DA9A 2VP3A 3BXOA 2Q5QA 1E3TA 2QMEA 4NS1A 2CLIB 3WXBA 4ARAA 2WD9A 2OBNA 3BFVA 3Q7QA 1DKOA 1VYUA 3UT6A 4Z86A 1SC3A 2ZBDA 4OD0A 4A3SA 3OEHD 2BZSA 3HSYA 4D82A 2XXJA 3ME5A 4YNBA 3S2YA 2PWBA 4DMFA 1FZQA 3HFSA 5DW3A 4WZBA 3BJZA 3P0EA 1JPNA 4GX1A 4DCVA 4PVCA 1NRWA 1ODSA 4RPIA 3WK7A 1T8SA 4RM3A 2FSSA 3WRXA 5AKEA 5JWRA 2FPMA 4TV9B 1D1PA 4BX9A 4QQ8A 2REOA 2Z6VA 2RHWA 4MB2A 4Q7QA 1U1FA 3RTCA 3SEFA 5D3ZA 1XCLA 4CQMB 2VXYA 1OHHD 4DIKA 1Z29A 4JYZA 4GEGA 1X7ZA 4F5EA 1XEXA 2ZYDA 4GWKA 4I4TA 1GKIA 1V7CA 4W5QA 3OZSA 5GY7A 2EZ8A 1BOFA 1M3SA 1Z68A 3O8OA 1JJBA 4G85A 4JOBA 4QQNA 3RYIA 3QW4B 3A11A 2YWGA 2NTJA 3DP7A 1E59A 2BGIA 4FN5A 5CNJA 4DIMA 1ZD1A 2ZWIA 1VHQA 2VDRB 2F90A 2GTPA 3JWEA 3NOQA 4KSBA 4Q3CA 1ZK3A 4JLVA 1L5OA 3WDKA 1YJXA 3UJ8A 4X8HA 3RFUA 1RJ9A 1RQ2A 1AKWA 1NNUA 2CUZA 2FP3A 2WF7A 1P8AA 3IAFA 3NCHA 2FKNA 3O1LA 3PXGA 1VXRA 5ANRB 5C4MA 3MCAA 1P5HA 5JYCA 1XDSA 2H59A 3JV7A 2A1TR 2HY7A 2X9NA 2OCXA 3OOEA 1T25A 1VB3A 4ENVA 5KWEA 3PC8A 5KYWA 1KH1A 1N9GA 4URFA 4U8GA 1ODCA 4X45A 1N6NA 2PZ8A 5EMKA 1J7KA 5J40A 1P91A 2EJWA 3QU5A 4EW6A 1M5TA 1Z5ZA 1AKQA 2IYTA 2QVYX 3GMTA 3QLTA 5C7YA 4I9GA 3R75A 3NWOA 1HE1C 2E3JA 4K1XA 4EKEA 4F04A 1WMFA 1TJYA 2LKCA 1Q7RA 4WCVA 4NDZA 1JQEA 2FW9A 1KS2A 2WYIA 5LU9A 1GUBA 2GEUA 2OFOA 3NP9A 4ZALA 4RGVA 3AU9A 4LVNA 4MGKR 4C4TA 2WAOA 3KB6A 5IM5A 3H2HA 4FCVA 4Y1RB 4RK4A 3OTIA 4KE6A 1ZL0A 2G40A 5JDCC 3FNFA 3RIXA 3TJZA 4NU5A 3KQHA 4A23A 5JH7A 1Q1GA 2HWYA 2QYTA 2WUFA 4UQOA 1YRQA 1LXCA 3ZGZA 1LPOA 3WGKA 5GZ3A 4RQUA 4PN3A 4MW9A 1XEAA 1C9MA 2NXCA 4BMPB 3AOGA 4BKUA 1L7NA 2J45A 2ZRKA 3JAKA 1UBTS 1WY5A 3AFGA 1W4BA 1Q3TA 2BM8A 2O57A 3I04M 5E7IA 5B53A 1DRUA 2FY8A 2IELA 5A6VA 4AZSA 2EKZA 4OQNA 2JLAA 2J3HA 3BFKA 2W8BA 3DPSA 4KIUA 2VSXA 2A6PA 4FHFA 4KQ9A 2PRKA 4ZAZA 3PGVA 1R0WA 1YRBA 4FT4A 2VNJA 4IFTA 4MWEA 4CQMA 1T4DA 1GNPA 2NZWA 2IEYA 4Y9DA 5TGZA 3DTVA 1P61B 3BSYA 3SQMA 1ZKDA 3HYLA 3CEPB 1N34B 2EBWA 2VP6A 2YWCA 4M7PA 1DMSA 4BGUA 4MVJH 2WQ6A 5CFPA 4PSUA 1IHXA 4RGQA 1AB5A 1RRCA 4K2AA 2C4TA 2GNOA 2N47A 2OGSA 2WMYA 5EG5A 1GV0A 1H8ED 1R4NA 1ZRSA 2FU5C 4IJVA 4R41A 5KOYA 4G07A 1XZBA 2PYIA 3NBZC 4RQBA 2GCOB 1WDMA 4KEAA 3ZNPA 5JIBA 3L1UA 1F2TB 1IJFA 1IYZA 1UBRS 3SHVA 5FULA 4EPYA 4K9MA 3KL4A 1SO8A 5IWCA 3N7UA 4QOJA 4B87A 2FUG6 1YQGA 4S0XA 1XEWX 5FOQA 1SBYA 4JJZA 1EXMA 1V47A 2ZEJA 2BMWA 3O7MA 4I9HA 4I8DA 1BVYF 4KXUA 1R4AA 5I4KA 3DXYA 3FOCA 3A6HA 2XW6A 3CIOA 4LX0A 4NCIA 4NU0A 2YN4A 5MHTA 3CS3A 1DEXA 1MU0A 3AONB 3G5LA 4G5OA 1L8QA 1MIHA 1GGNA 4K9SA 3R7SA 3TWOA 2HTFA 4GOLD 4Q47A 1NG9A 3GFFA 5JZBA 5K20A 2P9BA 1WUYA 1XTJA 4BV2A 2VDJA 1P4JA 1NBMA 1HWYA 2IIBA 5ES3A 1T5DX 1L5LA 3UY4A 2P68A 2PQ6A 1I94B 2ZXUA 4LQCA 3VPFA 4BLSA 3PC2A 2ZTMA 1SQSA 5CFQA 1RWQA 5KTNA 4UVIA 621PA 1PR5A 1XZEA 5JSKA 4DA4A 2W9XA 1UC4B 3K09C 5ICSA 1WB4A 1RHUA 4F5YA 2YXDA 1FU8A 4M76B 5B2ZA 3IP8A 1RLTA 2NM0A 4XD7A 4I1YA 4JU8A 2E5LB 2XADA 3A6LA 3A9TA 1I2AA 1GQOA 1JMVA 3RYIB 5IXSA 1HDOA 1PV4A 2AYXA 3B5JA 5EMMA 3EYAA 2R79A 3DLIA 3VNUA 4PS1A 1Y4UA 3MJTA 2AF3C 2VWQA 2ECOA 2ZIVB 5DTEA 3RCBA 4ARVA 2EQAA 1KZYC 3FAZA 2PS9A 2VBFA 1JIVA 2ZTUA 3BBPA 3EGEA 1CE8A 5ER9A 4BV9A 2XMZA 1ZNWA 3PA6A 4M8SA 1OFTA 3E7PA 4PBRA 1NVWQ 5FB3A 7YASA 3TOXA 1SOUA 1U8UA 3F7OA 2IZZA 3E9EA 3U17A 2ANBA 3W05A 3WLMA 4F2DA 3P2IA 1H65A 3LDGA 3G2NA 4LJRA 1M2KA 4LDPA 2Z08A 3H84A 5C1BA 3PR2B 2SCUA 2ZKLA 3P4UA 2DUJA 2I1VB 3I3SR 1UT8A 4JVLA 5WRFA 1FVHA 2EF1A 2QEQA 3FWZA 4TXHA 4NOMA 3HK2A 2Q6OA 1J06A 4V3BA 3LY8A 2ZPUA 5D51S 4TS9A 4A27A 2QPOA 4AWAA 4QJIA 3KB2A 1JKJA 1Z73A 4C21A 2O52A 2X22A 2LUOA 4LJSA 5FP0A 3L93A 4FHGA 2IYXA 3TSWA 3O3MB 1NQOA 1CPYA 5ALTA 1HTBA 3OO0A 4N82A 3RSQA 1I0ZA 1JR2A 4ND8A 5D01A 3H4TA 1OLSB 2CHVA 4JC0A 3C5EA 3EGDB 4YMLA 3DE4X 1PJBA 1XNJA 3PEUA 1L3BA 2O8CA 3F7NA 5KYKA 1I32A 1XYVA 4U9HS 2CLMB 1QZ3A 1JDPA 2AFRA 4R83A 3M6AA 4BQIA 2JLWA 5K3FB 1L7PA 3GFBA 2ODEA 5IC6A 3A6ZA 4FILA 1EK0A 1EUDB 2BCEA 1F14A 3GJSA 4DUGD 1HDEA 2HA4A 3OQJA 4BATA 1Q1BA 2I6TA 2GH1A 1JNYA 1QCYA 1YS7A 2CGEA 2FRVA 5ESDA 5EYPA 2IGTA 4LEIA 3IPXA 2SKCA 2IU6A 3FPSA 3E5HA 4LQ4A 3B82A 2ZOSA 3EW9A 4ENWA 4FJ2A 1EKXA 4IUYA 4MVJE 4UU8A 1B0AA 3GGCA 2W6NA 3NNDA 1CY1A 4DM7A 3G3EA 4U2KA 4IKEA 4K3VA 2MU1A 3ZN2A 4CRWB 5C7OO 4LG1A 3IUEA 2IWHA 3PS9A 4GLFA 3SM9A 2QU7A 2YY5A 1UJBA 3W8DA 5BRAA 1NMEA 2QZJA 3LL7A 4O3FA 5J4HA 1ZYUA 2BMVA 1Z75A 2H5LA 3LXXA 3TIIA 2QXYA 3JQ8B 2G71A 3O82A 2WA1A 3A37A 3AUSA 1QS0B 4OJMX 3W9SA 2ABWA 3W2HA 3B6MA 1D2HA 4GR5A 3ADPA 1XNGA 2CK3D 3KOWA 1PU2A 3PC8C 3OHSX 4IXMA 4MYCA 5DK6A 3EWAA 4DUYB 4LF9B 3DVRX 4HAYA 4NNPA 2NU7B 3EDOA 1WUIS 4OTZA 4MI3A 2FPKA 3FPFA 3H3FA 5L3ZA 3F9IA 4IRXA 1B8PA 2D8AA 3BZUA 4Y2TA 1RPNA 2NU6A 1NBWB 4E33A 5AI6A 1A7UA 2GEJA 2G3YA 4ZP1A 4Q19A 2VYVA 1UODA 4MMXB 3HKBA 1SVMA 1HV8A 3KZVA 4PG7A 4WKCA 1JG4A 4G0YA 2WPDD 3SJAA 1YONA 3S68A 2YOHA 2TSYB 5AH0A 4AMBA 1F5SA 4R7TA 1QG0A 4C0WA 2IYUA 3LSTA 4HS4A 2XH8A 4LY9A 3FHLA 3NUQA 4KP7A 4L4RA 4WI1A 2VYND 4FFBB 3RHSA 1Q19A 3T5TA 2EGUA 3HTXA 5JLJA 2JAWA 4PXYA 2B1JA 1J22A 4ZRNA 5HDQA 4Q1EA 3V3TA 4X63A 1VP9A 2C9YA 4L50A 3KD2A 2A9PA 4G01B 5I47A 2JIZD 4XKJA 1EE1A 3C4JA 3MB8A 3LK7A 3IPLA 3LK6A 2YY6A 1MIOA 4KOAA 1VGVA 4XB1A 3R7LA 2KE5A 3IMEA 3DZKA 3BWYA 1SVLA 3MBIA 1EWRA 3Q3HA 5DYIA 5IKOA 3FSJX 4GU5A 1M1YB 4TKUB 4ABTA 3FZEA 4PAWA 2L82A 1VFNA 2I3GA 1NI4A 3LDHA 3Q3CA 1NF8A 3WISA 1LW7A 3STTA 5FR2A 3A9CA 1CV2A 1YR6A 2AJLI 3WNZA 2CEKA 1GGVA 3GJ7A 3OT4A 4QT0A 1JEQA 1UBFA 2VPYA 3KHKA 2VH2A 1XTPA 5BV1A 3QWAA 2K7FA 1GT6A 1KI9A 5I45A 3ZLBA 3OEEA 5JG7A 2W98A 4JL6A 2PKQP 3GPCA 1R6UA 3ODPA 4OM8A 4F4DA 1R2QA 1FPQA 4PX5A 1ZD3A 4B4VA 4CKWB 2G83A 1H0KA 1Y42X 3RC8A 4J0JA 3OZ7A 4ZO6A 3ZV4A 4X94A 5CD1A 3W5JA 4EPXA 3INTA 3DE6X 5IHXA 1J0DA 3VKGA 1ZEJA 1SOVA 2VQSA 2HLNA 1P3DA 4B75A 4IWYA 4NBRA 4KR6A 3G6WA 4QATA 2H9YA 3MELA 1K63A 3R5JA 3RVKA 3EOAI 4CDRA 2C7OA 1DZ3A 1ZC3A 4HVAA 4BJ6A 3CNEA 3ZPXA 2NU8B 1IJBA 5A02A 5DI9A 4E09A 4ABYA 3LW7A 5AM5A 1QVVA 5A6SA 4CKCA 1RABA 2ZR0A 1AF4A 5HOEA 2D7CA 1RRPA 3S28A 1N0HA 4MEBA 5YASA 1FFAA 2X8JA 1ESDA 2XF8A 1P9LA 2ZRNA 2X9LA 4FNAA 4PQFA 4WOKA 4X44A 1P1KA 5CCBA 1AUVA 1N0UA 1V11A 2NZYA 1GPWB 5JSHA 3HB9A 1FLNA 2SHKA 1NVMB 3GZJA 1P17A 2P2YA 4O4HB 5BUSA 4YDRA 4CN9A 1KFEB 2JIMA 4QGHA 2NXEA 3IS3A 2V3VA 1YRHA 4EPVA 5DHSA 5JS7A 1KK2A 1QQ5A 1EQ2A 1PKXA 3BE5A 4BVGA 1UQRA 2ZRCA 2NZVG 3JQGA 4CHTA 4KRXA 5B1EA 1REQB 2ECFA 5AKLA 4RS3A 1NKSA 4ZCPA 2BFWA 1KERA 2HZBA 2WV9A 4KXVA 5I8WA 4FDVA 3IQDB 3OQHA 4PBTA 1I4WA 1XAJA 4XUGB 2EG5A 4EYOA 2PX0A 3BYZA 3PJEA 2PQ2A 4O29A 3NYIA 3DLBA 4RHFA 4L3VA 3KTOA 2R87A 2WSLA 1BCSA 1XPJA 2E4AA 2Y0DA 3HCOA 4IIJF 4ZTBA 4O2BB 1CBUA 3D8RA 1NN0A 1W46A 2RHDA 3E2PA 4MQ6A 2QR2A 4C01A 1IEQA 5BWMA 1V9CA 5DE3A 3B6IA 4JYMA 2K2WA 1Y5MA 2IHZA 5FPPA 4D1YA 3RT1A 1WG8A 1QHHB 2DWUA 4IFBA 3D2AA 3TSOA 4RVFA 1ABEA 4FZRA 1EA7A 4KFSA 1GUYA 4ZHQF 2OENG 2OCKA 2UYCA 1E1DA 2FEKA 5D3KA 5BQPA 5KVCA 1K08A 2IGBA 2C95A 1Y63A 3G6KA 1OCEA 3R7BA 4X1YA 3V1TC 1ST2A 4KUHA 1G3RA 4Y6PA 5TV2A 3PDIB 4X7BA 1AHNA 1GTG1 2QMYA 2P6NA 5HEKA 4HUQA 1RBMA 4F91B 1J0EA 4NABA 4Q3KA 1OI2A 4DIEA 3PU6A 1HO3A 3YASA 2VA9A 3L7DA 4X0EA 3EG9B 3OD5A 5K8VA 3HDJA 2PFKA 1J56A 3NRJA 4KLZA 1VKNA 3TIGA 5AHKA 4B6FA 4EYQA 3FLAA 1TYEB 3W9YA 1UK6A 3BMOA 3PKIA 4P98A 2JIOA 3WGJA 5K0GA 5E6RB 4Z3OA 3B20A 5JTUA 1ZQ1A 2RONA 3KB1A 3E53A 2GBLA 2HYDA 4LOIA 1HZZC 1E1CA 1U6IA 2MMGA 3TRFA 1PJLA 3CX6A 1VA5A 3G82C 3HA7A 4Z2AA 5H1YA 4XH9B 4YAKA 3GEGA 3H11A 3IOCA 4GQIA 1KVSA 3UIEA 5LU8A 2GSDA 1PL7A 4AQ7A 4RZ2A 3LD9A 2AK3A 2Z3WA 3TQFA 4DLBA 4DV6B 4U6QA 4GICA 2F8LA 2JIZA 1HM5A 1MORA 1HYBA 2EBUA 4Y98A 1JLHA 3WK5A 4RHYA 3O8LA 1X7ZB 1KI2A 4E5MA 2PSHA 2VHZA 4ZOLB 3AKYA 4X93A 2ZJ3A 4WESB 2IKSA 2P62A 2EWVA 3OTOB 1SUPA 1DX6A 2LTAA 1H5NA 2VQDA 3D6UA 1E1LA 3H87A 1GKLA 4AJHA 1U0RA 5JRZA 2GUGA 2X8AA 4R8SA 3T3GA 4BQFA 2BTQA 2QTRA 4WZBB 1P1RA 2C2WA 1QQ7A 4YP5A 1AKUA 4ENPA 4X65B 2O2ZA 3Q10A 1KEEA 1YC2A 3RRBA 3G7UA 5AKHA 1UC9A 1DTWB 1XNQB 2J9ZB 4DABA 2OHOA 2B1QA 2O0KA 3ZQKA 3R3ZA 5JXGA 3KKLA 4ZVPA 1E7QA 1AX9A 1LPBB 1Z2PX 2QXUA 4LJ7A 3UH0A 3W6PA 2VWHA 3PXUA 5A3VA 2RGWA 1P2TA 4YO8A 2HUPA 5B3JA 3R44A 3KCQA 4W1QA 4WKOA 5BN5B 3WGZA 1QR6A 2QTWB 3KP1A 4TYQA 1V1RA 3SC6A 3K5IA 4AT1A 5C9ZA 5LMNB 5KOHB 4WLFA 5CHEA 3X1DA 5LJIA 2EC5A 2REXB 4XB6B 5FI5A 4EF6A 3RRXA 4IILA 4X8MA 5D6NA 3GDWA 4XGRA 5AUOB 3D6NB 2OC9A 3A06A 3E22A 4LRSB 3TRHA 5JS2A 1QK4A 4D26A 5B57C 4G1CA 2BR5A 4MVJD 1V16B 4BX2A 3UAGA 1ZAKA 1XCPA 1JHRA 3KE9A 1SJ9A 4O2RA 1QG2A 1M2VA 2IDZA 2B4RO 2A0FA 2P27A 2Z1MA 4J03A 2IX3A 4N9QA 3NHWA 3CNNA 1Q57A 3GOQA 2AB0A 1E63A 2Q6KA 2JGJA 3BE6A 4QHSA 3KZNA 4RHEA 1CRQA 1OH7A 2FP4A 1E0SA 3H5IA 4C0SA 1SQFA 1R4ZA 4NHEA 1ZI9A 2QQ0A 5IU6A 1W85B 3QE0A 3BF8A 5CEEA 2PD3A 2XT0A 4RCVA 2X3YA 4BO2A 3SP1A 4DG9A 2ZBPA 3O03A 4OBEA 3RTBA 3T4UA 4HN4B 3IQFA 1QVWA 1RYMA 3H2YA 2VDQB 4N8DA 4KVFA 3UXEA 4ZJZA 5I4CA 3L1KA 3GJYA 3BL5A 4B6JA 3RYTC 4B2PA 5C5EA 2IZ5A 2JIRA 2C2KA 2C2GA 1V6CA 2J48A 2JC3A 2OLKA 2RKWA 2XYHA 3OCXA 2DFLA 2PUVA 2WHRA 4WHMA 3ZIAA 2JLCA 4H7DA 3IQZA 2M98A 3D3WB 4L4ZA 4N0DA 2BFEB 3MEQA 2F64A 3QLVA 4PYLA 3THYA 4TUYA 1IL0A 3UXMA 2HEGA 4HNGA 5A05A 4WIAA 1KYQA 1L7AA 1OTXA 2FVYA 3M5CA 5ELLA 2IYWA 4RKYA 1RM3A 4OFZA 4G2NA 5IM4A 3TYXA 3OLYA 5CVCA 5C7IO 2WWIA 1P7WA 4YXWA 1RQGA 5TJHA 5KNCH 1BVRA 1FOEB 4Q9IA 3ISVA 1PL6A 2WAMA 2QNIA 2WJ4A 1KMHA 3EVEA 2AXQA 3MQ4A 4FONA 1HH4A 2Q0QA 1TVMA 3RANA 3IEPA 4YBRA 3SSOA 4ZGGA 3DMHA 3MWGA 4EJ6A 1P4RA 4L73A 3LXMA 4ZVNA 16PKA 3AY0A 2RGDA 3UA4A 4AECA 4BNGA 1AXGA 1KKUA 4XD7D 2ZB7A 4CMEC 5FTMA 2BYTA 1CUBA 1QP8A 1WKVA 1XDZA 1ZU5A 4HB4A 3WC4A 1EFPB 1G8JA 2A78A 5P8WA 1JTFA 1YZHA 1KC1A 1XTIA 5ENZA 3TNDA 1JHVA 5ADWA 2GRAA 2D6FA 1ISFA 1Q95A 2BHRA 5M04A 1G38A 2FN3A 4P58A 1HETA 1Q1AA 4JBNA 1MZVA 1NKTA 2X19A 3INGA 4IP0A 1X1CA 3KWMA 4G25A 5CXXA 1FX0A 2A86A 3BHIA 4DB4A 3I9FA 2C58A 2ZU6A 4FYHA 3OCUA 5EKTA 3H3JA 1IAQA 3B6JA 3KELA 4C14A 2BAGA 4MP3A 4HQ6A 4U7TB 5ALGA 1L5RA 3QU4A 4G1MB 1KYZA 2A3NA 1NV8A 3MT8A 2Q5FA 1CIPA 2YMLA 4OHKA 2ERYA 3PZBA 2RIRA 2XCOA 1FL9A 1DB3A 4E1BA 1X39A 1G5PA 2WF6A 2D0OB 1B0ZA 3SQXA 4HNTA 4LDJA 3FYSA 4LOKA 2I67A 1TCCA 3C3JA 4JYPA 4MV8A 4WWHA 1U7PA 5GWXA 3ZIUA 4MITA 4UDXX 2DYKA 4DA0A 3FTQA 3SHOA 5A7FA 4XWOA 4UEKA 4YR9A 1T4BA 3DKKA 1DAPA 3EF3A 3NTQA 1K6XA 4GBMA 4HNUA 1BU8A 5H81A 1NU6A 3PHLA 4XUCA 2FUEA 2IRWA 1Y98A 2R1UA 3U4QB 2R6ZA 4NZ9A 5E3IA 1UPXA 3CRRA 1RP7A 3NM4A 5FO1A 4BJ1A 1GRCA 3EEYA 3ZKWB 2XMBA 4JQZA 2G7ZA 2QMUA 4RENA 3QFFA 4OEHA 2FX3A 3X0DA 1JR4A 2DH5A 4BQRA 3C7AA 4QFBA 3PVZA 1R6XA 4RZUA 4ZYXA 3J7TA 4FFOA 1E96A 4QUEA 3P5SA 2V3CC 2X40A 3KEGA 4CE6A 1RRVA 2J3QA 2R00C 1K4MA 4OQPA 1THMA 4YP1A 1EX7A 1R16A 3BXGA 3EEFA 3FNEA 5CCDA 3QKRB 5BQOA 1Q14A 1QO0D 1X77A 2BFMA 5DF1A 3RVMA 2AOXA 5BV7A 3C8HA 3DB2A 1NUQA 4ISCA 3F6YA 4PZDA 4MI6A 2X2PA 1B16A 4C6SA 1BDMA 5I7RA 4ADSG 4WXHA 3GJZA 3A14A 2JZCA 3H19A 4YJ2B 2YWDA 1B41A 4MW6A 4DLZA 4YLYA 1A8HA 4ZVTA 3D7NA 5HZKA 5J47A 3AIKA 3M33A 3QVUA 4BWYA 1GM5A 3FDJA 4NV0A 4RMIA 1KNQA 3VR5A 1SB8A 4CHGA 1LU9A 2IS4A 2EKPA 4RMGA 1LPMA 3SXUB 2AFIB 1U98A 2QTLA 2BONA 1XRMA 2EEPA 1D4ZA 3DTYA 3GO4A 4WOPA 3SU8A 5LQJA 1ESEA 1EAMA 1H6BA 2P65A 3QOXA 1KZHA 3FVQA 2ARKA 4F6LA 1U0FA 1VKHA 2WIKA 1R4MB 2NAPA 3PLNA 1GNRA 3C6KA 4ZVVA 3UO8B 2HMYB 5KYWB 3R9XA 1VCNA 3NR2A 2I7DA 4IIGA 4L22A 4X1YB 4D3XA 3DWEX 1HDRA 3NTRA 3WWYA 1O97C 5TPZD 3RVDA 1H2EA 2R6CA 3LGXA 4GKAA 4GDFA 1RJ9B 3LZDA 3UJBA 1G21A 3UOGA 1JFSA 4XFKA 3ZXYA 1XA4A 2CNLA 3EY4A 4WK4B 5H68A 5HUJA 1CY2A 3TLZA 1AV7A 2BGNA 2FUKA 5L3RA 2P1DA 1XMJA 3PNKA 5ALFA 5CEFA 3HBMA 3RTDA 2IZOA 5A71A 3SLRA 2QR3A 3I4FA 2A59A 4LI3X 1EFPA 2PMEA 1XCGB 3ROXA 2WFAA 3N7TA 2JFOA 2HIAA 2LRHA 1W73A 4XARA 5ALLA 4NZPA 5DHPA 5JNLA 2AN3A 4G5HA 3OZXA 1P9NA 3MS2A 9ABPA 2M9MA 4TLBA 2X0FA 3M6IA 5F1KA 1IOZA 3TVDA 3L7MA 3Q72A 2J1LA 3MQFA 4GF5A 5FO0A 3O2JA 5C18A 4KTVE 3Q9LA 1RBZA 1SU4A 3C0KA 4NONA 3SOPA 4PNHA 2WJ3A 4J0FA 4V0SA 1HYQA 1F7UA 2O8BA 4G56A 1BS2A 2B0JA 5COBA 2OK8A 3CYFA 5BSTA 4U2FA 3FPHA 4XIGS 1G6HA 1FC0A 1VBNA 3F2VA 3K92A 3PQDA 4HOYA 2PAAA 4DV5B 2BBWA 1Y6JA 1SC9A 4DLNA 1EK1A 3RRNA 4IJWA 2COUA 4ZVUA 1AH2A 4UBLA 4Y67A 5AW5A 5SZJA 2HCJB 1N6KA 3OZDA 5LZ5A 3QPDA 3VU9A 3DMGA 3JWJA 4JP1A 3QXXA 2XF2A 5F9MA 1ACJA 1MB4A 1C7RA 2I8LA 1KEVA 3ENQA 2IDKA 3EH1A 3VU3A 4QIHA 1BA3A 3A1WA 4UEQA 4UM9B 2QP3A 3KT0A 3LVQE 1CEXA 2NO1A 1ABBA 2C8JA 3RC2A 1ZMOA 4B82A 4AO8A 1XZIA 4B9EA 1QQTA 4FDMA 2X0EA 4CKXA 1KZ7B 4UCQA 4KAXA 2NU8A 2X42A 3RS7A 1ZUNB 6AT1A 3RADC 2HA2A 1O94D 3O8BA 3QNMA 3LP8A 3WZMA 3SZ3A 4Q1CA 1E69A 2FKAA 5SZHB 3WIEA 4CUJA 3VR5D 4EMTA 3CJTA 1C7EA 1MVOA 2BCJQ 2H0AA 1H9BA 3KM0A 2FUCA 1CP3A 5ICGA 2JVJA 3KD3A 4FNMA 4W8HA 4YAWA 2UUBB 1XAGA 4QYWA 1VLLA 2QQGA 4MJ3A 5EPUA 3SYTA 1ZFNA 1XJ5A 3RGGA 1QKIA 2GZDA 3I37X 1YOVB 1RYNA 3PF8A 2X4GA 1BS9A 5AQ1A 4R0MA 3FCXA 2XD4A 2EGGA 3MERA 4IHQA 5IJ0A 5IK2D 3KZMA 4K81B 3N87A 3COPA 4UHJA 1H22A 3GLKA 4GGMX 3P2EA 5EEGA 3TLXA 4PZCA 1CP2A 4DLWA 3AJ9A 3EJWA 2X8LA 4LYFA 4L7VA 1G63A 1YFKA 1G5TA 1XKXA 3HSKA 5EPEA 3FXAA 3TXYA 3CG4A 5JSFA 3H6KA 3HG7A 2QPAA 4KZPA 4CTMA 1TK9A 4RVHA 1YZNA 1EJ0A 3CUYA 2IPOA 1MXHA 4U2DA 4LY6A 1VSBA 3HKEA 1RQPA 1H4TA 1RRMA 4IQGA 4DA8A 4C78A 3COVA 4V39A 1UMCB 5T4EA 4EB6A 1T9ZA 4IVPA 4Q4AA 4IOKA 4BYGA 4M1QA 5BRNA 1FYVA 4Z7NB 1L3CA 1RTTA 1QHGA 3EWIA 3JAWB 4QICA 5JAIA 1FW6A 3ZE8A 5CA0B 4CGZA 4TYPA 2WT4A 1ID8A 4JQSA 4IF4A 2E1PA 3H5TA 2JAUA 4POAA 2VSYA 2XUGA 3I42A 3FPEA 4MCJA 3DEZA 1OFIA 4CXMA 2HK6A 3B3JA 1WZCA 3C3PA 4OSPA 4UAVA 4EP1A 4PLPA 3H5AA 3DOEA 1I33A 3D9QX 3EGVA 1G7RA 3DF7A 3IPCA 4N0QA 5B3KA 5HJ7A 4HH0A 3IL2A 3EB9A 1UJMA 5T8KC 1E8NA 3HR4A 2ATCA 3ZWQA 2PGLA 4I2NA 1RE0A 3EIFA 4K26A 4MRMB 2ATVA 1ENZA 1DBWA 1T1GA 3DFFA 1J20A 3FCOA 1YI0A 4KRGA 3QPCA 1OU0A 1S3FA 2B25A 3G8AA 1ZWKA 1J4AA 4YRIA 3ZWXA 4OLBA 1BXGA 1PFQA 3UOWA 4RKFA 3ZI7A 1KI6B 3R09A 2VP0A 3ZHBA 4NCKA 1PVVA 2DMRA 1LS6A 2AT1A 4B0PA 4RNCA 3L1VA 4P6VF 2WHPB 5IAGA 3PTAA 4FFLA 2VPQA 1C1XA 3IGFA 4UHKA 3QYFA 2Q9CA 2CF5A 4K6CA 2RCYA 2RK6A 4LZAA 5LQSA 3KS9A 4UM7A 1RCFA 4UULA 5IDQA 3UANA 2WIFA 4WTOA 5C32A 3MLBA 2WRZA 3M6LA 4P0TA 5J5VA 2Q21A 5J2TB 3DM5A 1LPAB 3OQBA 3Q2OA 2HD4A 4OOFA 5TMDA 3JALB 2C59A 2PEZA 4RTSA 1YDGA 1DJQA 2X8BA 3CCBA 3KLNA 3NT4A 1T9KA 1GL9B 5BNFA 1JYEA 2YMPA 1SXJD 2Q4OA 3AESB 4KG7A 5CB4A 2X15A 1XJQA 4BEJA 2DOKA 3PYXA 3VR6A 1V8FA 2HOQA 5BV8A 2P6RA 2DTXA 4FCTA 1W75A 2FW7A 2W2OA 1ZA2A 2WM2A 1JG3A 2B34A 3EFOB 4LK2A 5EE0A 2Z4RA 5LD2C 2P67A 3DAPA 4F56A 3CLVA 5KAMA 5I6DA 5JZVA 3AY3A 3F3KA 4YX9A 2AFHA 2B99A 3LI2A 2VDPB 5FBKA 5K3FA 1T10A 4Y1GA 3EXG2 1PNOA 2TMKA 3HNRA 1PT9A 4PX2A 3A9UA 3H8JA 3IV9A 1QJCA 2G88A 3AEKA 1T8PA 2GO1A 3GIWA 5E8JA 3PQFA 3ZDBA 2YXBA 1FMCA 3DL4A 4UOEA 2R84A 3AFOA 1JAXA 1V7QA 1GNSA 2IIQA 2QUKA 1Z2DA 3PUYA 4CPDA 2R6FA 5JXJA 5GV7A 5J63A 5CK4A 4EHNA 2P69A 3R5HA 4YMHA 3HDGA 3L04A 5EGSA 3TD6A 3C16C 3AUFA 5ALIA 3SBDA 4F9FA 5H80A 3AF6A 3TIXB 3T5GA 1IUNA 1DJMA 5HWSA 1YOBA 3D8BA 4O4IB 2R5NA 3RREA 1UUFA 1Y6RA 3SEAA 1JIKA 2OG1A 3K9GA 1L0BA 3EVAA 4DCNA 3JQDA 3ZW9A 4DV2B 3U5ZB 1YUNA 1OHHA 2RGGA 3QOYA 4MYSA 1YV9A 2I62A 1JWBB 1H05A 1QMGA 4HZGA 1HDIA 4EKYA 1P75A 2O1SA 2WJ6A 3CPJB 1V71A 2I78A 2VDWB 1W34A 3RKRA 5HZHA 3IJ5A 1Q83A 3PIIA 5LFAA 4MIKA 4RY9A 3VR6H 2Q5EA 3N0RA 3NANA 1I2ZA 3U0VA 1N2CA 3DQQA 2GF0A 1N5OX 2BELA 1CW2B 4ZDWA 3ELYA 2OKCA 2BUBA 1AZWA 3NUZA 4L5CA 5AXCA 3NBAA 4MVJI 3BWXA 4GWLA 3R23A 2PUFA 3HO1A 2HLDD 4PGGA 1YJQA 3M3HA 1YS4A 5EWMA 1B26A 1YI8A 1R15A 2R1ZA 2R6AA 4XFDA 2BOVA 3E9CA 4A6XA 2YNMD 3I39X 1A50B 3QUSA 1LV7A 3FPLA 4AIIA 3SWWA 3BHJA 4XX0A 3CVUA 1ZW6A 1L5FA 4I81A 4GZ5A 3GCWA 3E4CA 4LAFA 3V55A 4F3CA 1ATIA 5EIEA 4G23A 4F38A 1LQ2A 5A6SB 1SCUA 2RCNA 1J2TA 4XM2A 3ITDA 2OXIA 3EAFA 4AJEA 3RVPA 2XHZA 3PFCA 5AVOA 1V25A 3VZBA 4EHLA 4C0KA