4QXPA

Crystal structure of hsting(g230i) in complex with dmxaa
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
182
structure length
182
Chain Sequence
SVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTIDRAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding-Pocket and Lid-Region Substitutions Render Human STING Sensitive to the Species-Specific Drug DMXAA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Stimulator of interferon genes protein
total genus 52
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qxpA02
4EF4A 4LOLA 4KBYA 4QXPA 4QXRA 5CFLA 4F5WA 5CFPA 5CFNA 5BQXA 5CFRA 4EMTA 4KC0A 4LOIA 4F5DA 5CFMA 4F9EA 5CFQA 4EMUA 4KSYA 4F5EA 4QXQA 4YP1A 4EF5A 5CFOA 4LOKA 4LOJA 4LOHA 4F5YA 4QXOA 4F9GA 4JC5A
chains in the Genus database with same CATH superfamily
3LUJA 1U1IA 2Y68A 2UZ3A 2I9KA 5LLSA 1B93A 3E81A 2G1UA 4LCJA 2NU8B 3ZXIA 1S2IA 4ENRA 2E6KA 6NULA 2R68A 3EK2A 4HFRA 1A5ZA 2NT3A 4V3CA 3OHMA 1ZQ1A 1II8A 4MPPA 3NCTA 4N5NA 2B7BA 1GYRA 2GF9A 2N3ZA 3UYKA 4K8RB 5HOEA 4I9FA 2H17A 1DJQA 2C8KA 3AI7A 3PQ2A 1PKEA 4N01A 3P2JA 1XZAA 4EJFA 3FE2A 5IF3A 3L40A 3GIWA 4PSDA 3TGLA 4DA7A 3R09A 1KWKA 1SHJA 3LCUA 2YJ5A 1HFWA 3TX2A 2DM6A 1KE1A 3VXKA 1YDGA 4YP6A 2C9DA 2WTBA 4HNAB 1Q3TA 1BCSA 2R79A 3L1VA 4G9EA 1KY5A 1J7KA 3II6X 2FE1A 4KLRA 4YHBA 5LZ7A 2FPOA 1SWWA 4HBZA 5JO9A 3IQGX 4PLWA 4H60A 3K0CA 4RKRA 4BKMA 1UUFA 2JLYA 1DT5A 1TZKA 1X7ZA 1QGUB 4HJRA 2R8BA 1U7PA 2JASA 2V7VA 5DVZA 1LF5A 5ILOA 3GGCA 5THXA 1E3LA 4NCBA 1Z88A 4S1VA 4IHQA 5KI6A 2J5BA 4GXQA 3VVCA 4MVJM 3QBEA 1WPRA 2IE0A 2GPWA 4BGDA 3S8EA 1Y34E 3L8ZA 1PQYA 1BQEA 2ID9A 1Q7GA 1T9GS 1N6NA 1PSWA 2GWHA 1SC1A 4HZGA 1JG1A 4R3NA 3X1JA 2H18A 3OC6A 2YWJA 4KXLA 2C8JA 4RORA 2W4IA 4TMWA 4TYPA 5F51A 2GN4A 3VR2A 1Z4NA 2JGKA 3EVTA 1ABFA 2Q7OE 4V0QA 4Q9KA 3ZIAD 3B6KA 3ETEA 3CLTC 4EGQA 1JPNA 3BJZA 4KQFA 4G0NA 4R3WA 4KFUA 3BMNB 2HLDD 2VJNA 3UMBA 1OT3A 5BNIA 3DAYA 1ZOIA 2W0SA 3X43A 1RC8A 2C4NA 1V7PC 1UXKA 4NOLA 3SXUA 4BNZA 4FSDA 4P9NA 3RS8A 3V32A 3BKXA 3IQZA 1Z25A 4UD6A 4FB4A 4WJKB 3T8YA 3QP9A 1DXQA 3AP3A 4RPHA 6Q21A 5GZ6A 1E2UA 1UPTA 3SHFA 2D1TA 3GUCA 4RA6A 3WYEA 2CHFA 1RRKA 2WMOB 5F77A 2GPNA 1Y82A 4HQ0A 4F8YA 2PR7A 1LW6E 3L1HA 4JOSA 2GX6A 4UJ3A 4P7FA 3DOJA 4JJAA 4D0SA 5CVCA 3WVNA 3Q3GE 4RHEA 3ELYA 3COSA 3QQ5A 5EVCA 1VJGA 1I2MA 3GJQA 3O2NA 4DL9A 2VTBB 2BDEA 1J8DA 2CXPA 2FMKA 2GK6A 3S2FA 2OM2A 5HF8A 4FYIA 5DHUA 4QGAA 4D5EA 2QW0X 3ASYA 3RC7A 1NP7A 4P33A 4AK9A 1JXAA 3NB0A 3ADDA 4ESEA 3PDJA 1UOPA 3NVKI 2ECOA 4HUQA 2DFLA 5B53A 3HDYA 3BE6A 4JH0A 1X6VA 1SHLA 2TYSB 3NR2A 1PLJA 2NVUB 4M2LA 2Q9CA 1HMPA 4POOA 1NNEA 1RQRA 4ZZIA 2YJZA 1HFKA 3RRYA 2GZ3A 1ZUNA 3FRJA 4BNKA 3D64A 3IRVA 2P2DA 1C4XA 3U39A 3GBPA 1BMDA 4MAAA 5DLEA 1NC1A 5EMKA 1SVSA 4BGUA 1OT5A 3MYRA 5JI2E 1EHYA 1RTKA 1VL2A 1T4BA 2FOLA 3PFNA 2XMGA 1G0OA 3EGDB 4GX0A 5LB2A 1TYCA 3NOQA 3HXTA 4XCQA 4II3A 3BQNB 4XWGA 4AG5A 4RY9A 2H2WA 3JPYA 3PJDA 1TUIA 1RYMA 2ZRCA 1M6EX 4L2IA 1JSXA 4Z99A 4EQZA 5B2EA 4XARA 3QVGA 2VSNA 3E9DA 5J2TF 3FUVA 1D1SA 4I3HA 2D6FA 4CQJA 4CMKA 3BXPA 4RVSA 2YCBA 1Y4ZA 4LKOA 3H2ZA 5ALWA 3RVPA 1Z08A 3FBGA 1GV1A 5BRAA 2WUFA 5I3CA 3MMSA 4B7AA 2AJ8A 2O52A 2VJDA 1C9DB 2Z5LA 1VYTA 3JSXA 4B1FA 1CY7A 1D2EA 2PK3A 1MXHA 4E5VA 1KC3A 1GSAA 1FLAA 1OAAA 3DOIA 4EEKA 4MS4A 3I83A 2I87A 5J1SB 1OWLA 1A2BA 3UMGA 2XDWA 2AE2A 3MAGA 4TLLB 4Y9UA 3SXPA 2QSUA 5IUNC 2H4FA 5DBEX 3O4RA 2HXYA 4O2AF 4MCHA 1IZ9A 1FDIA 4EY3A 3IP8A 3KZKA 1YO6A 3FGNA 1V7CA 2GN6A 2YHIB 2WRZA 2RHGB 1M10A 3R4CA 2OBNA 2W6ID 4MUYA 2IDZA 4Z9BA 2H5IA 2EKDA 3KYBA 4N6OA 2QY6A 3GMSA 1SM4A 2R60A 1RAEA 1DE0A 2O05A 3HZRA 3JWEA 3LTEA 4MW2A 3UN1A 2PZEA 2RHCA 4BGIA 3I6YA 1HE5A 4TKVB 3RSSA 2QIOA 3VU9A 2WWFA 4MR7B 3NW9A 2OQRA 3ONVA 1HZZC 1DQNA 1W47A 1Y48E 1HL7A 2VDJA 1JEJA 1J2JA 2VJQA 4Q39A 1HETA 2O8CB 1QHYA 1HTBA 1FVFA 3AUFA 4GPTA 4JYMA 4KNYA 3C4VA 1PNOA 1IY1A 1CQXA 1UDXA 4OM8A 5K0JA 3K92A 3PUZA 2HU5A 2WICA 4TKUB 5C5IA 4P0QB 2AFHA 3CLUC 4PX5A 1SUFA 3PP8A 4I7EA 3IVRA 2YWDA 4QSHA 3LLMA 3ZE8A 3DC7A 3EBOA 4WXHA 2RGEA 5LZ5A 3FOZA 4TTIA 4NCKA 2I99A 4B48A 3DB2A 4O4IB 4LYAA 1Z37A 3I53A 4IXWA 3D2AA 1RI3A 1QZUA 2IY7A 2Y1OA 3OLZA 3WGKA 4V39A 5I8WA 4KQGA 3KKMA 3RW9A 3VNSA 3V8QA 3K05A 3MWLA 4G89A 1Z0JA 1NUSA 2CBGA 1RI5A 2IYNA 2JJ8A 4KCGA 2VCHA 2I91A 3VAYA 2VHYA 2QYSA 3OIVA 3VO8A 1VA5A 2RKWA 4XX0A 5TR9A 4B3TB 4QAQA 5JXHA 5HZGA 5AXBA 1R2QA 3ZWMA 4X6XA 4N7RA 2QG9A 3C5WP 1SA0B 3ABRB 4G86A 4DR2B 1E7MA 2QXYA 1M5UA 4YR9A 4LVUA 1FP4A 1OZGA 3LUHA 1XJWA 3OECA 5IC6A 2C9OA 3RS9A 3UA3A 4F3YA 3AG5A 4KQMA 2YWFA 1VFNA 4HB3A 5AKYA 3AFIA 1UP4A 4P2GA 3RKUA 2W6OA 5JYDA 5LYYA 1QK5A 1YE8A 2HNAA 2ATXA 1R1DA 1VJ0A 2OCLA 1P2TA 3Q7IA 4RXTA 4JI1B 4BVKA 2EFJA 1F1JA 4GYJA 4XGRA 2B5OA 5T57A 4AJOA 1NUPA 3THYA 1F12A 1DBQA 1BH6A 1J8QA 3O9VA 1KDOA 4DCCA 3TBKA 2R6FA 4ZEMA 2G1PA 3GUUA 1EXMA 3DR5A 1EJ6A 3G89A 5CDYA 2FW6A 3HJNA 1FXWF 3A0RB 1WP9A 4PLYA 4TN1A 1DWOA 3SIPA 1SXJC 2O48X 4QYMA 4RMNA 4HEQA 2R6HA 4BMXA 3R0QA 3PL1A 3HL4A 4YJDA 2BUBA 1RZRA 5CH5A 2OQIA 3F3MA 4FDVA 1YDHA 1F0YA 2CLOB 4H77A 1U2QA 4LZJA 5JZSA 2Y9PB 2WAXA 4R2JA 4PS1A 4A4DA 1YUBA 3QBTA 3DE1X 3NVAA 4J16C 3BSWA 1PW7A 4MINA 4WNAA 5SYAA 1KZ7B 3W5VA 3CT6A 4EY4A 4E46A 5LQAA 5F1YA 3FZYA 3KVNA 5EHNA 2QTHA 2AOUA 4I4LA 4PRLA 4U7GA 5AXDA 3CWZA 4HTAA 3RBVA 1B7GO 2R3SA 1G3UA 3HPRA 5DNUA 2J67A 1QE5A 4CIDA 5EIEA 1ZY2A 3C3JA 1O6ZA 5TQ2B 2G9QA 5JALA 1RRCA 2JFFA 3ZNNA 4TTQA 1NLFA 1WWKA 3WK6A 4R69A 2J4DA 4UU1A 1QHIA 4AQ7A 3L7JA 3WGTA 3LHSA 4W5OA 1YU9A 3ZOZA 3ZE6A 4AO8A 1YOVB 3Q41A 3NFYA 2HLNA 2PSHA 3K3PA 1B6SA 5E1OA 2Z2YA 3TR6A 2REXB 1QIJA 5TGDA 2ZXUA 1MB9A 4P3XA 1G98A 3V4LA 4K6GA 4BKOA 4URXR 1RHKA 1G42A 2CK3A 2QT1A 4C7MA 4E31A 1ZISA 3PHLA 1YB5A 3FYTA 3PUWA 1GZ3A 1HT0A 2G3YA 2V7PA 3GRCA 3Q72A 2O7NA 3PWZA 2P9FA 4RDIA 1QVAA 5DH9A 3ZH9B 2OSVA 2V4ZA 3MIIA 3OPQA 1C7RA 9MHTA 1SXJD 2C31A 1JFSA 4I5IA 2AJCA 4DQVA 2BMFA 1A77A 1K6JA 3PHGA 1XHEA 3NONA 4ZT7A 1C7ZA 3WWEA 1DAEA 5K3BA 3L0OA 4W8OA 1P4RA 2B4YA 3MXOA 1QYDA 2DPYA 3FG9A 3HXMA 4GPBA 1L4YA 2M6RA 3AKCA 3QTLA 3PVCA 1YBAA 5TJHA 4LFCB 1NBAA 1TNDA 2I65A 2HFKA 2V54A 4K9LA 4Y9RA 1L8AA 1FUKA 5FADA 4C6TA 3HA2A 4V0OA 4JROA 3GUHA 4F3CA 3OM8A 4R2HA 5K99A 4L5JA 2JD2A 1MC1A 1ISRA 1GILA 2YZNA 3KXDA 5HIJA 3REOA 2WIGA 3EBPA 2IQ5A 3DXZA 3DDWA 1WXGA 2G5TA 3NT4A 4IJMA 1ZGZA 4IWNA 4WJZA 4DHWA 4CLOA 1JE1A 4WL0A 1EFCA 1JFRA 4JOQA 3C3MA 1DC7A 1G64A 2ODEA 3MILA 4H1TA 3ZCRA 2GUWA 4RNCA 4EB6A 1JE0A 1TCAA 1Y89A 3TFQA 3ZTYA 4S05A 3L2OB 4GWGA 4KR2A 3PIIA 4N8EA 4IIUA 1U80A 1FYEA 4NMXB 1POWA 3RVKA 2X5NA 3JAMA 1E7WA 4BO7A 3I0MA 3HMKA 3IVXA 3RWBA 4X62B 4MW9A 2BEJA 2OAGA 2DWOA 4DA0A 3GLVA 4KXQA 1KH3A 3CUKA 3A4IA 3E1SA 2UYOA 2VP9A 3N5CA 2WHRA 2WTAA 3H11B 3OT4A 1Z7EA 2VYFA 4IIBA 4ZTBA 3ROFA 2EERA 2VHJA 1XMOB 4A10A 3PR1A 5CIQA 1T29A 1E59A 2WD7B 2YZMA 3TMAA 4CCYB 3KDAA 4EEXA 4A15A 4L5IA 5HKLA 5KTTA 3S5JA 4LXUA 4YC7A 3RANA 2AFHE 3WDMA 4ZVSA 5B7NA 1U3DA 1RRGA 4WQMA 1FIUA 2G9VA 3MJTA 4K9NA 2J4FA 4JJ6A 5IYZA 1XLVA 4R3UC 2JFPA 5ULLA 4EZEA 3B1WA 3PQ5A 1YJBA 4AFNA 4B6OA 3FNRA 2XDYA 2VEDA 4IJWA 5KZMB 3DHWC 3ZHCA 1QOPB 3P9YA 2QRHA 1IN7A 3F5QA 1AB5A 4JUDX 3EUAA 2PUBA 3OG9A 1XEXA 2B1IA 1AQIA 3L77A 4QNNA 4ZQHA 1DHRA 2IP2A 4FU0A 3WIDA 2IX3A 1KYWA 4PRKA 1O97D 3DJYA 1M33A 4BYGA 2DPHA 3TUJC 2HJGA 3AI1A 3B3AA 3WKDA 4ZN6A 1Z8FA 3SX0A 1WXEA 1H3FA 2Q6KA 3BOSA 3G8AA 4FOPA 4LDQA 3PIRA 1YS9A 1UZMA 3CS3A 3FCXA 1KEZA 1GZ7A 2NP7A 5AW2A 1W0KD 1BJKA 2G1AA 3BB3A 3FIUA 1B42A 1GG9A 3BXOA 2IVZA 1QONA 2XUQA 3NHFA 3WLQA 3A11A 3AZQA 5I9SA 4IIEA 1PAUA 3G88A 4ID9A 1E1DA 1G9SA 2X4IA 3C7DB 3LCRA 4C05A 2R6R1 1BKDR 3F5DA 3M4ZA 3QVGB 2G4CA 4PZZA 1CK4A 2NXJA 5IKXA 2O7VA 4W5QA 1NNSA 3K09C 2ZEJA 3FOWA 4GRDA 2Y67A 3WGNA 4L50A 4YCSA 2YIVX 5JV5A 5H16A 4HWPA 1Y1TA 2JC3A 3MTDA 4I1OA 1VE7A 1ZESA 3WIUA 4W5WA 2ZUEA 4Z9YA 4P53A 1IY2A 1ODKA 1TCBA 1DAIA 3OCCA 1J2EA 2GESA 3PDHA 1AV7A 1ZOOA 4IS3A 4QWMA 2BGJA 2PZ8A 2SCUB 3EXG2 5AT1A 4NE9A 3ZNOA 2CJPA 1M1NA 5AJTA 1K98A 3FKJA 4TTSA 2XCIA 2QAJA 2BTOA 3EVFA 5DCLA 4EG1A 3JZAA 1KJQA 4Y6QA 1JPVA 1T1SA 1PF7E 3B1FA 2D5LA 3W06A 1Z28A 2H7VA 1T5SA 3OEWA 3FSGA 4G84A 3VKUA 7GPBA 4HFJA 4NPAA 3LIPA 2I54A 3OTGA 2WG2A 1EBUA 1IE3A 2N1MA 1ESEA 3DWGA 5UKDA 2O6HA 5A3RA 1VHTA 4HN9A 4P3NA 3Q5DA 1JI0A 4LF7B 2WPDA 3I73A 1BVYF 2V5UA 2ZXFA 1E9EA 5L40A 4LKRA 5E2AA 1J0XO 1J49A 2XQFA 3Q3IA 1M2GA 2VRBA 5JG7A 2G1KA 1XRPA 3VSCA 3ZW7A 1J4AA 1C0IA 2PQ6A 3RREA 3W3AA 4KK3A 5KCZA 3KVYA 1HSOA 3H2BA 2O0KA 1SOAA 1V5EA 4INOA 4CF3A 4CI9A 2PJRA 1VTKA 4NOJA 3ZIUA 3QA9A 2YMPA 4CLEA 3HXLA 3KT6A 2REQA 3VR4H 1M5RA 4ZYUA 2JF0A 5DISB 3AEUA 3Q7QA 3I32A 4F5EA 1XTUA 1KVQA 1QPBA 4HP8A 2ZSJA 4V24A 1NJ1A 1YASA 5FHRA 1POXA 4MGIR 4N5MA 3RRJA 1PT6A 3SIWA 3V4VB 1DBSA 4UNRA 3JZIA 2VJCA 4JKOA 4Q3OA 4R9UC 1F8GA 2H2DA 3W9BA 1CS0A 4MUFA 2XMPA 3FSRA 3GGDA 3TRHA 2R7NA 4OY3A 3ZQJA 4P5EA 3T99A 3V80A 4QTZA 4R7TA 3ISJA 4PXAA 2Z8ZA 2O59A 3EB9A 4BO3A 2PMFA 5KINB 4BWGA 4F9TA 4WZAA 3ER9A 3OBIA 1JG2A 2BM0A 4PLTA 1RCTE 3OOSA 3IMEA 4F91B 1TZJA 2H5JA 4QRDA 2BFCB 2PMBA 3C24A 1AY0A 4FNOA 1JPUA 4GSLA 2QD5A 2QP9X 4KUHA 4QPZA 4PGHA 2VTDA 2BL4A 3SMQA 3A36A 3GRAA 4MCAA 5BVHB 2BJHA 2JGJA 2QORA 3L7OA 3BZBA 2O57A 1XLTC 4ZU3A 4EFKA 1Z0KA 3TLGB 1UODA 2HZBA 3W5UA 4JSRA 3U17A 3DXFA 2CXHA 3GYGA 3QE2A 5FHQA 1GNQA 2VR1A 4MGEA 2RGCA 5CFZA 5HKAA 1P5FA 4WADA 1WR8A 5IK2D 3RYCA 4AZ3A 1AO3A 5AM2A 3UB3A 1DAGA 4Y6GB 1FCJA 1ODIA 2IHVA 3L4BA 1A8IA 2BISA 2OFXA 3H9GA 4Z9FA 5TY0A 1XTVA 3CM0A 3EYWA 4OQYA 3AP2A 5DTJA 3KU4A 2CVZA 4KIFA 3RUAA 2H4HA 3SC3A 1IMOA 2QPLA 3TE7A 2AG6A 4UXHA 1RPZA 5K3OA 1V7ZA 4AKTA 2VK4A 5CAEB 3GJ8A 3U7FB 3DOUA 1J5PA 2JJMA 1XF1A 1K5DA 4KO8A 3PGMA 2CNDA 1R4NA 2PXAA 3HCFA 4TMXA 5F76A 5FOVA 4BO4A 3V8MA 1D4AA 1NJ6A 1DOZA 4JQSA 5EE0A 1TUGA 2XE4A 1U2TA 4JBGA 1ZEJA 2G5PA 3G1UA 5FLEX 1V95A 4BDSA 2WK1A 1TB4A 2H57A 3PXGA 1VG8A 4F7WA 2J7PD 1T13A 3P4XA 3DFUA 3D31A 3P0JA 3FM9A 4MPRA 2G82A 4DLPA 3GLGA 3RGWS 4LQDA 4WLNA 4J3JA 2J85A 3VMFA 4C3VA 3WNCA 4JOCA 4B3GA 5I8ZA 2XE7A 2ZRPA 3CCCA 1ZU5A 2WUGA 4D3YA 5AESA 1O6FA 3BKWA 1E1LA 2R00A 4N7MA 4MOWA 1ICEA 2BGNA 4O5OA 3RIHA 1NVFA 3WLIA 2HA2A 3WKEA 4C3OB 3PQ8A 1XAGA 1HE8B 3L8CA 3TW6A 2QTNA 4E5MA 4IILA 5TQ2A 4JI5B 2LCIA 2JD0A 1SURA 2AWNA 5BNTA 4NZNA 5IAKA 3L8FA 5C34B 3H2GA 2CVFA 2ZSKA 1ZICA 1AT1A 2OLEA 3DUFB 2ZBEA 4OXXA 5COQA 3HCPA 5ALXA 3ZHZA 5JQWA 1T34A 3ZQ4A 4YB8A 3V2GA 4C0SA 2Z3ZA 3CSUA 3AJ8A 4GBMA 4QJ5A 1PFQA 4AX8A 2NUBA 2OCAA 2JPDA 1ICIA 2QX9A 2XADA 1ZOLA 3R9KA 4QYIA 5CR9A 1TVEA 4FFOA 1VM6A 3RC8A 2J8ZA 5BPHA 3O95A 1T3TA 1FNSA 3QEAZ 4BO0A 1I7PA 3HBLA 4L3OA 5LL6P 2I7DA 4EELA 2DLDA 3FVWA 2EV9A 2BP7A 2J59A 2WMNB 3JQ8A 2E4WA 2RGUA 2XMQA 3O38A 3P45A 3ZI4A 5I7OA 3HBMA 5A9RA 3CURA 3HL0A 3GN2A 4M55A 3PB3A 4QXAA 1N57A 1NTOA 3S7TA 4URHA 3ZXSA 4C2TA 4WBNF 2QVZX 2EL9A 3WK7A 1YRQA 2Y2UA 3F4BA 1G21A 5BQXA 3I62A 5FPPA 4EHIA 1YAHA 4HKTA 3TKAA 1HNXB 3NDBB 4BN5A 3NEYA 4TYQA 3L7DA 2ZYUX 2QX8A 3JTEA 1YUMA 2IOFA 4D0NA 3DP7A 4WUTA 4C7JA 1KJZA 1N5RA 1MC4A 1QE0A 2AQIA 4RV9A 1Y1QA 4RJTA 2QZ9A 1EBBA 2HA3A 1OXSC 4KP7A 2IYOA 4RHFA 3HA3A 2MINA 3B48A 1D1PA 2A35A 4Z7QB 4U7JA 4QYSA 5JNLA 1MX5A 2BFEB 3K7EA 3MCZA 5EUMA 3A9WA 4QUJA 2QMQA 4TT8A 1A71A 1QO9A 2NXWA 2PGOA 3AOGA 4YJHA 4B3HA 4ACAA 3ERCA 1EX9A 2MMGA 2Q1SA 2WT9A 3G79A 1K68A 1YMVA 2CWWA 4A03A 2E6UX 1TTHA 1UDRA 3KSZO 4ZJPA 3UH0A 2ZRMA 3WFZA 1U8XX 2FPKA 1E61A 1X15A 1JI3A 2C00A 1EFUA 1XELA 2QRGA 3F5FA 4NYJQ 3TJRA 4DE5A 3BF7A 1NA5A 2CJFA 2QYOA 4LJ9A 3BUSA 1UP7A 4PANA 5DHFA 4C2AA 3ZGYA 1UBRS 3DOCA 5CHEA 1YRAA 4XSVA 3FWHA 1AGNA 5DBGA 4BKPA 5BN1A 3ENNA 3N9IA 1OA1A 1XCMA 3E35A 4HMQA 4RETA 1T6ZA 4QBFA 1CJMA 1SIWA 3PFKA 3K9WA 4XM0A 4OHYA 1XMJA 4B8ZA 1FLVA 4QJ4A 1Z18A 3A9VA 3E9MA 1CUSA 2C2BA 1RHRA 3CRRA 4KLAA 3TNFA 1I13A 4H0NA 1IN4A 1F6DA 3NOVA 4RHCA 1QQ5A 1JP7A 3F78A 2I4RA 3HCDA 5AKEA 4BEBA 1U98A 3FSGD 1ADBA 2BEUB 4NY1A 2P8SA 1U2EA 4PYKA 3BGOS 4BE7B 1P3DA 3QEOA 4RGBA 4Y2YA 1SHUX 4AS1A 3BGWA 1PR9A 3SSMA 2QV7A 1DV2A 3N0WA 5LMZA 3WGZA 4PAQA 3GLSA 4L95C 4XAQA 4ZZ1A 5LPNA 1G3MA 1BEEA 1CQPA 1FQOA 2CB0A 2Q1WA 3H86A 3JQ7B 4WOJA 4BV8A 1BE8A 1FX0A 2VKTA 3AM5A 3DEYX 4FYVA 4K87A 4NARA 5DXJA 3KZOA 4MH0R 4E1VA 4CGZA 2JLVA 3EHDA 4U7WA 3FNEA 4MIOA 3VDRA 2C2XA 1PVOA 2P69A 1KI2A 1JA0A 2QRVB 4M0PA 3LAWA 3V1LA 4GF5A 4KVGA 2FPXA 1RVDA 4JI7B 4UBJA 4F46A 3FYSA 1S8NA 3QOYA 4DMCA 4PE5B 3T5AA 1QRDA 1ISHA 4N3BA 3VUEA 3DC2A 1FP6A 1F0NA 1SPXA 4ZAVA 1ZMXA 1Q15A 2AR9A 3MFQA 4UMEA 2YNMA 4YMTA 3WFJA 3MVEA 4L6AA 2ODTX 3B20A 3LC2O 4N7JA 1XQ1A 4F97A 5IMSA 5F5NA 3N0VA 2WM3A 4W8GA 3WG9A 4W5RA 1Z13A 4KXFB 1OYVA 3PYXA 2WWVD 1T2CA 1JQJC 1Y7HA 2W2KB 2PH1A 3GLUA 3I34X 5BSKA 3EH1A 5FTLA 4BWVA 1JIQA 3LW8A 4WZ6A 4D9MA 2AB0A 5L8VA 3PEEA 4KH1A 3WRWA 3SEFA 3IV9A 1O6CA 3Q3VA 1OLOA 1FB5A 3THWA 2ES4A 2ZIXA 2G67A 4LHVA 2VPWA 4F8EA 3DLAA 4TRMA 1Z0DA 3IMKA 4KWIA 1MQSA 3TGPA 2JVJA 2VK8A 4NCXA 3UV6A 1WKCA 3WDSA 1ZK1A 4NYIR 3NIWA 1Q7CA 4XFKA 5LD2B 3CVVA 5AHRA 4QJIA 3U9SA 4X95A 4YCNA 4TLBA 4L4YA 1C9MA 2IYFA 3HKDA 4H6PA 3NWBA 4MRVA 4EB8A 3SHVA 2VF5X 1P9WA 1VGVA 3OQBA 4WN9B 1JKMA 4DKJA 2WWRA 4OL0A 1JR2A 1YBVA 5B7GA 2IH5A 5DX0A 5CDHA 1LSSA 1VKNA 2OHFA 5B4VA 1ZC3A 1IZYA 4HGOA 2XJ4A 4RZQA 2B94A 4PFQA 1OI4A 3G6WA 3IT3A 2XUKA 4LF6B 5IWCA 4GOND 1OY1A 1E2PA 1FX0B 2ZFUA 1KETA 4C4XA 4BQQA 1JR4A 2XYHA 3IPRA 3NVDA 3TN7A 1HR0B 1F2UB 3IL2A 1VIDA 1Z4IA 3WJAA 2IZ6A 2Z57A 1ZG3A 3FYCA 4BCBA 5KQRA 4UOEA 1VLVA 5ITZA 4LV8B 2GETA 2QJFA 2VLIA 4JITA 5FDFA 2P2YA 2GJSA 3MNFA 4RTJA 1GVHA 2CFOA 5C7YA 1G21E 2FFAA 2YS6A 2CSUA 1HH4A 4ZQEA 5GMOA 5IP5A 4B2IA 3W8DA 3IQDB 2W90A 2HK9A 4AY5A 1QGZA 4DANA 4D0LB 3RASA 4TV9B 1SVIA 1T9CA 4C29A 5JATA 1J00A 2O1XA 1CR1A 1QK4A 2OBMA 3FWKA 2FU5C 3KYCA 1HE3A 4RTNA 3SYMA 2LBPA 2WLSA 1HTWA 2FUKA 5CT8A 3L7IA 3RSFA 2XCOA 4OFXA 1H8HA 4CLRB 4RK4A 5BVHA 3PDIB 1CB7A 2QTAA 2H8KA 3CKKA 3D6HA 5JMTA 4TZ0A 1ZRHA 3GW8A 4MKZA 4V0LA 4G4GA 2GPSA 2JLZA 2GM3A 2GAIA 2QK4A 3LX4A 1LBHA 3VPFA 3GNLA 3FNHA 1CZHA 4JCCA 4RD2A 3UGJA 2PBFA 3C7TA 3WLFA 2CW5A 3FCCA 3AY3A 1VDMA 2ZBVA 3AEQA 4WGFA 3TG2A 4F3TA 4L57A 1IOWA 5HVNA 3LOQA 2P6MA 3C0KA 1E2HA 3SD7A 3AGQA 5DSTA 4KIJA 721PA 4E94A 4FNAA 2OAEA 4MRPA 4UUPA 4BBJA 4R81A 4OQLA 3OZSA 4WXPA 5FA6A 4ZV7A 2JDID 2JA2A 1LNZA 1MZVA 3RTBA 5LLDA 4GMHA 1YB7A 1Z3IX 3NNNA 1RI1A 4RM3A 4QVGA 4TRRA 3EXEB 3MTIA 3COPA 4GXNA 5DHTA 1JQ5A 3T12A 1EZZA 2WTXA 3PHCA 3REQB 4K0RA 5D3QA 1J2RA 3AESB 3B5JA 2CEKA 1U4OA 1VDZA 2PBLA 4Q01A 3E2MA 3VVMA 2B7LA 2OHVA 1VJTA 3NOXA 4Q15A 4JB3A 5E4JA 2C77A 2YV2A 3K0SA 4HRYA 1MJNA 3E3AA 4NK4A 1XWFA 5JH7F 2OCKA 2GRUA 2RG1A 4FIZA 1UDAA 4BXOA 2HM7A 3NBXX 3MTBA 1EG2A 3ETGA 4IJKA 2FZ4A 3KOXA 1Q44A 1EFRD 3VO1A 5IASA 1BO6A 1OASA 2C9MA 1SZDA 1UBOS 4FNMA 4PCVA 2GVZC 2WU0A 3NWOA 5EIBC 4OQMA 1E4EA 3VFDA 5HA5A 3KUDA 1OJ7A 3D7LA 2YWGA 4FR5A 1G5QA 2QR2A 4IWYA 4J3NA 4BLQA 4UCWA 1LLUA 2FFRA 3N3AC 4JP5A 4M38A 4D44A 4AKSA 1DDOA 3VJRA 3N8HA 3PFIA 1KDTA 4MA5A 2CYAA 5H4GA 3L5OA 5HG0A 3P5SA 4IVQA 5KYWB 5K0BA 1WCWA 5FP0A 4ETWA 1NNI1 5TMBA 2O2SA 4QFDA 1RAAA 4MWTA 1T8YA 3V4ZA 1TCUA 2IY8A 4KGXA 3VR3A 1R6UA 1EVQA 4L5BA 4PGAA 4B73A 1SRQA 2YDYA 2DQKA 2CKMA 3BDVA 2JKVA 2UXBB 4A5OA 3NEAA 1IXZA 5DKFA 3ZNQA 1EWVA 4I4TB 5KBYA 2H54A 1NXWA 2YJ4A 1QF7A 1EK0A 2DH6A 4RTSA 3WHPA 4O4LF 1MLDA 1WPXA 3EAQA 2WQ6A 2HPZA 3G5UA 5EQJB 3BE5A 1P9LA 2FWRA 1E8DA 1TIBA 1ZK2A 2QMEA 3TECE 1EGVB 2B82A 4FYYA 2QWXA 2DY0A 2DECA 3GT3A 4KBFA 3HKEA 2WC1A 4Q66C 1H05A 4KPGA 3RVDA 1I4WA 3QITA 4XUEA 1UJBA 3DWFA 1Q0HA 1SZCA 3HDTA 1YVPA 4PNPA 1M2VB 1QIEA 4XB6B 1EP2B 1OUMA 5B6PA 4H1WA 3KDSE 4CIVA 1CRQA 3DA8A 4UKDA 4H7EA 1H69A 4RESA 1TQ2A 1W93A 1E8NA 2ETXA 4ZD6A 3PFHA 3PC8A 4D4IA 2V7EA 1KIFA 4BX8A 4FYXA 3MPOA 1JAIA 4HQKA 1N8SA 3ILXA 5KEIA 1ECCA 4HGNA 3DAFA 2C0QA 2VF7A 1B6TA 3HNPA 4S1OA 1P7ZA 2C78A 1A27A 1AURA 3VGPA 2PBZA 2PX8A 3G2NA 5BSMA 2FDRA 2AK3A 4M9ZA 3SZLA 3SZMA 1U7ZA 2ZUWA 4AQYB 4AKHA 4OB8A 1XFAA 1RMQA 3UWDA 3BA6A 2L17A 4JD5A 3KCQA 1TKBA 3PEVA 1I3LA 4RY2A 3E9QA 1VJ1A 2LKDA 1R0LA 1SPBS 4KXNA 4N9QA 4F11A 1Z2CA 3SS9X 2H1IA 2X1VA 3ZGXA 4D3DA 4JXJA 1X1TA 1EA7A 1TM7E 2DF8A 5EXDA 2C98A 3GEMA 1PL8A 4IV8A 4Q9IA 5TS3A 1EBFA 3QVUA 1C7IA 4QWWA 3RIGA 4UEKA 1IQRA 1QG2A 2PYZA 3Q0TA 4JEUA 1N5DA 3W4KA 2CEAA 1QU2A 1IL0A 1NQAO 4K81B 4O0LA 1YIAA 4H7DA 2QDKA 5CPFA 2YC4C 1BC5A 1S4MA 2DFVA 3H8SA 4QG7A 4QLAA 4YRQA 2CLHB 1NI5A 1RYBA 3QU2A 1XXLA 3G2PA 5JBNA 3DOHA 5CIWA 5FCDA 2W6ZA 2LTAA 4U8GA 4QASA 1DG1G 3O82A 1E9VA 4MV0A 4QDJA 1E3EA 1I9GA 5D84A 1SUDA 3QUQA 2J30A 1D07A 2X8JA 4IBOA 2VWHA 3JQBC 5CEJA 5CHYA 2COEA 5H5JA 1IJFA 1O95C 3O3NB 1SEPA 1GKUB 4Q03A 1N7GA 5EGNA 5KPJA 1H9CA 4E4RA 3CWQA 2QGZA 3LQQA 2H92A 1CFJA 2ATVA 4JJFA 2BRUC 7YASA 3BEDA 4NBWA 1G8PA 1TUBB 3NHLA 1XRQA 4ZO9A 2ZBRA 3CXRA 4M8IA 4JJKA 5AI4A 3T7JA 1M6VA 4G24A 4G6ZA 3EEIA 4GL4A 5A3VA 3T38A 3E84A 1N92A 4H1HA 1U9IA 2VPQA 3I23A 4QZVA 2YTZA 4IH1A 5SY4A 3BIXA 1ULUA 2IUUA 1U28A 2OCYC 1WXXA 1U31A 2Q4TA 1WDMA 1H5NA 1S3IA 3R3WA 4X5OA 1L4EA 5B12A 1DVRA 1BXRB 1FRZA 2WVHA 4XEHA 5TMEA 3WGIA 1J0BA 5DFAA 1CUXA 1XZLA 1Q7EA 1E1QA 2IIVA 4G0YA 1UAYA 4MP3A 4J4BA 4P2BA 2H3HA 1BX3A 5FBWB 5KCMA 4YMGA 1KEUA 5KSPA 3JYNA 2BBOA 4EYKA 4RADA 4QRHA 4DLRA 4NP6A 5I7FA 3CVOA 2PRZA 4PZDA 3KNZA 3TSCA 1KR2A 3HM2A 4LDNA 1JF8A 2Q0QA 1U94A 2RKBA 2WUVA 4N0EA 4JC8A 4EJSA 2NPOA 1W25A 2IZ0A 1HG0A 3AMVA 2JHGA 4FFWA 4Y9DA 5IKMA 3ZD9A 1ZX1A 3LVRE 1C8KA 3B2EA 1G5TA 3VPBA 2VPYA 2MSCB 3SR0A 1SBIA 5ENZA 5FWNA 2YKGA 1Y5NA 2C82A 3BH0A 3CTMA 1MQ8B 3FR8A 4LMRA 4A0SA 4BC1A 1PZXA 1C0KA 1WULS 2BAGA 2WAOA 2B4RO 2OC9A 2YXDA 4JA2A 2OFFA 2OD2A 3WB1A 2NTYC 4RK7A 3AVWA 1ODJA 1T3SA 1ZZGA 4P3OA 3D5TA 3MIZA 2LCQA 2AFHB 4EUSA 2RFLA 3W5IA 1IY9A 2D5AA 3N8DA 1Z17A 4CN9A 5A9SA 3SFTA 5KKCA 4YGYA 3O1HB 1TF5A 3D6MA 3CRQA 4LJ7A 1VGQA 2B78A 4PGGA 1YOBA 1NJ5A 3NTUA 4DTCA 5AW5A 2OG1A 2CLLB 4MP8A 5FBRB 4LHEA 1IQUA 5LBIA 2B21A 1W8DA 4D6XA 4MS3A 1M2OB 3ZWDA 3GPIA 1M2NA 1UANA 1WMSA 1VHLA 3MOIA 4P3KA 5ESRA 3ZX4A 2OB2A 2HWUA 2HU7A 2ZTUA 3IAHA 3LKDA 4B45A 2VAXA 3QLVA 3AF3A 3MAJA 4GPIB 2NTEA 2NUTA 2IVFA 1CR4A 4YY3B 4UEQA 3KUCA 1C3JA 2VPTA 1CJVC 1SG0A 3ANYB 1GP2A 3S2UA 3QEMA 3V9PA 4E2XA 1EE2A 3BICA 4XJXA 5DNDA 4F86A 5F3WB 3O3CA 5DM1A 1ZCAA 5FKJA 4M0CA 1IUPA 1EB8A 4OJMX 3S8YA 4DQXA 1V8DA 1Q20A 3SBXA 2B6HA 3K8OE 2X3FA 3KPVA 2HF2A 2H51A 3A1WA 4MWZA 3RC9A 5KOHB 4XGKA 1FVHA 3UJDA 4DRXB 3HKCB 5LWQA 1E0JA 3AF0A 3AM4A 3NOOA 4R54A 4TM8A 5AK5A 5GIOE 3I3OA 2UYCA 4LSWA 1VL6A 5M29A 4MDEA 2OORC 1Q6ZA 3BQ9A 3KJNA 3OQHA 1GV0A 1NYTA 1T3HA 3KR1A 1ZN7A 1XFDA 1TAGA 2J1LA 3T4UA 2D2VA 3EOBI 3KQOA 4NCIA 1T1RA 4YUWA 4ZCMA 4JLAA 1GQ2A 1F8FA 4K46A 2QNBA 5AK0A 3WDKA 5DHAA 3BRWA 3AEQB 4CCSA 4N9WA 1CEYA 3H18A 4OD0A 4HDRA 3OTIA 1VG1A 3UXYA 4KPFC 5ES4B 3EZ2A 5HGXA 4PEVA 5CNKA 2ZDGA 4DLUA 2OGWA 1C41A 1RNLA 1T2VA 2XD4A 1RWMA 3O8DA 4WEOA 5IJ9B 1NJSA 3M6XA 1RW4A 1C8BA 3IDSA 2QX7A 5SZHB 2M1XA 4X1KA 3TD6A 5AVZA 3NYWA 3RH0A 3R8FA 1VPWA 3EF3A 2E48A 3TMKA 1Z2AA 4H31A 4QRIA 1OI2A 2A5DA 4AKEA 2DLNA 4BLWA 4LXYA 1H2WA 1B0AA 1I4TD 3T0GA 3HGQA 1CIVA 2QE6A 4OYLA 4D4KA 2O2ZA 4DV4B 1A4IA 1U7UA 3IJPA 3B36A 2D5BA 3ONDA 4PCLA 1OFIA 2CBXA 1FYDA 3UK2A 4DSZA 3JY6A 4AIIA 4BNTA 3OF2A 4O3MA 2QN9A 2QN2A 3A4NA 1KFEB 2G0TA 3DFKA 3W3ZB 3NBMA 3Q3JB 2D7CA 1VLMA 3PTLA 4J0EA 3V7WA 2H9YA 3M34A 4GMKA 3N2IA 2O2XA 3DLIA 3WK9A 1B4DA 4MB6A 5CXQA 4KO1S 3EXFB 1Z7YA 2M9MA 3OT1A 4HMOA 2NADA 5AVVA 1U1GA 5KTRA 2X3UA 5EHXA 3E4CA 5EWMA 1KQOA 1M2FA 2CBZA 4Q4LA 4ZREA 3ZWBA 5IFLA 4KQXA 2O2JA 1JAHA 4GOMD 4IDOA 1QC5A 3DYIA 3I04M 2LNDA 5AKIA 2WY2D 1GL3A 1IRXA 1EX1A 3Q6NA 5DX1A 5T3UA 2PVCA 3H1TA 4IF4A 1WF6A 4YGXB 3LV8A 3ED5A 4LX8A 2AN3A 4ER6A 4IJ6A 1K66A 1YONA 1Z45A 3R7BA 1AN9A 1JDVA 1MORA 3DTYA 5CG1A 4F1WA 2KBEA 5FTMA 3HRIA 4EVQA 4R0MA 1NYRA 5B2ZA 4EFNA 1CETA 1TO2E 3OQIB 3ZDAA 1F8UA 4MUEA 4EVSA 1RPJA 1R4NB 1M6HA 2IZ7A 3M9XA 1TTPB 4JJZA 2BE7A 3KVVA 4URUR 1YJ8A 4PX2A 2GJ9A 2EFGA 1L7RA 4ERNA 4KTTE 3E05A 3GIDA 5D01A 4KFTA 5KUTA 3M3PA 1ORWA 1LDMA 2KM1A 5E1DA 5L45A 2PMDA 5CTAA 2HF7A 1X0VA 3BMCA 2YXNA 3RVRA 2WV7A 3EXHA 3I1FA 4ZYLA 2V7WA 5J3JA 5EMHA 3VJKA 4C03A 1KOLA 2JJ2D 3B6ZA 4S1PA 2F9LA 2OHJA 4M9XA 2ONKA 4EPWA 2OO5A 3KEFA 4BMCA 3ROXA 2FSUA 3U3DA 4B71A 4QXPA 2GBLA 2AYZA 3WL4A 2B8NA 4ZAYA 2ZWIA 3SZUA 4B85A 2W2QA 4HSEA 4MPDA 3E22A 4ALIA 1JAYA 3QJGA 1V16B 4WNCA 3SJBA 2QN6A 3ZV5A 3ZHSA 3FKQA 3D7RA 2BC9A 1W29A 4CG1A 5IDQA 1YQTA 1C4OA 1P45A 2BGWA 4ON9A 2QSZA 2ODPA 4RIHA 1DQRA 2I9PA 2AN1A 4UVDA 1E94E 4FSHA 3GNQA 4M98A 1C7EA 4KRYA 2ZRJA 2J5KA 4CQMD 4NF2A 2QQ0A 3QKSA 1FVXA 3CR7A 3MF4A 2DWCA 2GAFA 2HSWA 4BLVA 1BDHA 4UMFA 1XQ6A 1NLZA 2ZBUA 3MRXA 3WIBA 3E9NA 1U4NA 4A8JA 2QG6A 2ZS7A 4JUFA 4RHYA 2LWIA 4L0MA 2W8BA 2QB5A 1QYVA 3G1WA 4CEJB 4IIJB 4KJXA 4M1EA 3E4DA 5F3DA 5LNK1 4JMLA 4N49A 4PR3A 5ERGB 5KNBD 4WCVA 5E4FA 1FYFA 2HQRA 3A6JA 5CB4F 5A0FA 1S5PA 1OV4A 2ZSHA 3Q9UA 3SJAA 1RSZA 2D0PB 2QOEA 2MSKA 4GUDA 2F3QA 3I64A 4N18A 4TV8B 3I6MA 5GQSA 3AY0A 3EJWA 2NU7A 1LK7A 5KYUB 1G2OA 1RM5A 5E7JA 5BW5A 5K20A 4QKQA 2ZCUA 1GSOA 3VPSA 1TYDE 3W5HA 2RHHA 3OZ7A 4EP1A 1EK1A 1E4VA 1RHJA 3VVLA 1WMEA 2CVHA 2C7RA 4AJ9A 2I8LA 2DHRA 4PTZA 3RF6A 3AB3A 3EWIA 1XD2A 3QMMA 4NOKA 3J7AC 4S2EA 1OREA 1X8LA 1ODFA 3AZOA 1Q17A 1YCDA 4A0GA 1SVOA 4AKGA 1I32A 4K9SA 3W5CA 3I5YA 2FF5A 3IOYA 5MHTA 1KH1A 2EKPA 3CUTA 1PLKA 1ENZA 3QFFA 2OBLA 1I7NA 3QXJA 1ZP6A 1C80A 2R85A 3AVQA 5HS6A 3L06A 1FC0A 3O8OA 4RE5A 4HNVA 1J2TA 4G0QA 4I8IA 2BFEA 4KWCA 1BS9A 1NFQA 1KZ9A 1V1MA 1I3NA 1M1NB 2B4TO 4FFVA 4F71A 1K75A 4RLQA 4B44A 1PZEA 4FP9A 4A2CA 3DE0X 1C7QA 2A1IA 2H1WA 4JHXA 1VSBA 2IQIA 3DJFA 3HLTA 1WSWA 3IALA 4B8WA 2IU4A 1S2DA 2OFPA 2A9PA 2GFIA 5K0LA 3DFIA 1IH8A 4Q7EA 2IWHA 1E3TA 3PWSA 3IRUA 3L4EA 1WZNA 1RJ9B 3M4YA 3TO5A 4TV9A 3AVOA 1GXSB 4TN5A 2R65A 3BSSA 1TC1A 1WBDA 1JDSA 4PO3X 1U7DA 2CJXA 3EGCA 4WLVA 2W70A 4EITA 1AQ6A 4CLRA 4B81A 4FQ7A 1XU4A 2PX5A 4UFNA 3ZCUA 3VR6H 1TOAA 1LXCA 3LQ1A 2A9OA 3N76A 4G4IA 4KVFA 2ZAOA 4GPZA 4KFRA 1MGPA 4CTNA 1ZITA 3SYNA 3ICEA 3ZGOA 2HL6A 4DFDA 5DM0A 3FGZA 2GVNA 2J41A 3TI7A 5CM8B 3TIIA 4FNGA 5BURA 4G0MA 4JEIA 4EKEA 2BMAA 1J25A 1RQXA 3R9XA 3E53A 4OHWA 2ZJBA 1XDSA 4L07A 1FUIA 1HDIA 1JUDA 2Q4BA 4OFZA 4KR3A 1MJ5A 1NI4A 2EX0A 5K4AA 5MN6A 3NT2A 2ANBA 2FGKA 2Y1CA 2EHJA 1W6RA 4K6OA 3NBAA 1EIWA 4ZKDA 1ZD9A 1QAOA 1W4AA 4EB3A 4ZT5A 2AOUB 2AGVA 3I5MA 5CT5A 3PX2A 3OLVA 2UZ4A 3TAXA 3UJPA 2JARA 4MIKA 5AUQA 2HWYA 3EDYA 2C4HA 1TM2A 2BKUA 3RU3A 5FFFA 1GARA 3R0JA 2V6MA 2WSIA 1CIPA 1VRVA 4HCJA 1SG6A 5FI3A 1RQLA 4KAFA 1UPUA 2ZI9A 2ZJZA 2ETVA 2ZKIA 2FEMA 4H17A 3UAZA 2YIJA 2A5FA 3PQ3A 3UT5B 5CD1A 1U0FA 2P4HX 2Y76A 2ZTSA 3TNLA 4HTFA 421PA 2F3UA 2JGRA 3HKCA 5CT6A 2HN9A 4HN4B 2J3IA 3F6SA 4BEJA 3NKVA 2EFYA 3IQHX 3LC1O 1K4YA 1RMYA 2D8MA 5F1PA 4CBVA 3P20A 2GO7A 2ZRKA 3GRZA 4JSTA 4YVFA 3ZUPA 1VZ2A 4Q1DA 3VOSA 4CDGA 4DRZA 2I03A 1ZVQA 3A1UA 3QWFA 1JEOA 2W2OA 1PT5A 2IYSA 4OI1A 4ICIA 4MR8A 3VHXB 1YGYA 1MJFA 3IP5A 3AUJB 3HXOA 4JAVC 2GEUA 4YJ3B 5FUMA 2C3YA 3KAKA 2BJVA 2CF6A 1BD4A 3JPWA 3PE6A 4KIWA 4QYTA 3PLNA 3OJXA 3O8BA 2VK2A 5F5XA 3TRFA 3X2SA 1WABA 3QSGA 2GZ2A 1VBNA 1PFKA 2EG9A 3CUEF 5KTSA 2ECKA 3X3HA 4CDNA 4HB0A 2NZYA 5GJVC 4QTTB 5D3MA 4GVLA 3KU1A 1RACA 4HK4A 4KSYA 1QSGA 1RHUA 2FMHA 2IHYA 3GLKA 4MJ7A 5EZYA 5FUYA 4ZVRA 4PZ9A 5TPZD 5COBA 4J0FA 3W77A 3GP3A 3ANNA 2BMEA 3UPUA 2V9ZA 4BBPA 5JAIA 2A1UA 4FKMA 1E1MA 2C4UA 3DEZA 1BE0A 3SHOA 2V4MA 4ZDIA 5JMWA 1C81A 2VF2A 1KZ1A 4LYYA 4IHKA 2FFQA 3AFMA 3D4OA 4D3FA 2VDMB 2NVBA 3JRNA 4WA8A 1JTVA 1UM9B 3DLTA 2K7ZA 4GO1A 4HFMA 4P32A 5EJAA 3W6UA 3W1WA 4DZZA 1M8PA 4XRGA 4I14A 3ZHTA 1MOSA 4WH0A 4V0SA 1ZBQA 4R8RA 4C0JA 4J9UE 1W34A 1ZVVA 4NHOA 5AHKA 1NUTA 2VL7A 2JAUA 2IU0A 3CB2A 4BP3A 4NBKA 1U1FA 4JT9A 4WK4B 1DTWB 4O25A 1H4SA 1CYEA 3UAYA 1CUJA 1C1XA 4V03A 3UK7A 1VBFA 2QV0A 4MGZR 1M72A 3CX8A 3FFBA 4UNQA 5SYMA 4BRSA 3G7SA 4QUDA 5IDXA 4NCAA 1J21A 5ARDA 4E22A 4NQZA 5EHQA 1F5NA 1CNEA 4C76A 3N6VA 2FN4A 4LSMA 1XVLA 5CVTA 5FA8A 1E5LA 2DCMA 1G41A 1JVSA 1Q11A 2VZ0A 3M89A 1PL7A 2OMEA 3PC2A 3QPAA 4LY9A 5G0UA 2VXCA 5AJWA 1KI3A 1GO2A 1QH9A 1UBEA 1QWOA 1XDBA 3CB4A 3PF9A 4MWEA 2H00A 3S1AA 3WLSA 1P1FA 1UK7A 2AN4A 3VU0A 2FG5A 1VL1A 1T5LA 3AC0A 4RKWA 4F5WA 1Y7IA 3W5BA 1LDGA 4OQZA 5ILQA 5JNSA 1E2EA 1JJAA 4EUEA 2NZXA 1YQQA 3NIGB 4RV5A 4MVJG 3OD5A 3H13A 3MELA 1IBSA 3OZAA 4EVRA 1KAHA 4N03A 4AY2A 3UFXB 2K5UA 1J0AA 1U3CA 4FEAA 4F2HA 1OZFA 5ALMA 4D3ZA 5JADA 5HF9A 3RAPR 1IYZA 3M1AA 2XOKD 1GKLA 1K5GA 4J1SA 2HY7A 2ZUBA 4KXUA 5CNJA 5A71A 2DG2A 3TLXA 3QEKA 1XG5A 2ZJ6A 4G2NA 2CXTA 4E32A 3PK0A 4PC3A 1VSTA 3PQFA 4AWXA 3K2BA 1UC5B 4CIAA 4R2XA 5JD4A 3BL5A 4UMVA 1U3FA 5I3ZA 1W76A 3CZ4A 4EY6A 3SVLA 2IHJA 3AYZB 1GRNA 2DTXA 2WHEA 3NASA 5DHPA 5AXCA 1R10A 2O3TA 2OL4A 4HH3C 3VR6D 1X7DA 5BUCA 2OZLA 1K1EA 1X38A 3TZEA 3VA7A 1CU1A 5DOVA 2QQGA 1H2EA 3WA7A 5T6BA 4PC7A 3UF0A 2XTMA 3SNKA 1YB1A 3RJ9A 4ES6A 1OB5A 3BXGA 3DQZA 1DQSA 4LHSA 4NECA 3R77A 4A26A 5KWSA 1L4BA 3UWSA 3GJTA 3IVMA 3PA8A 2F59A 1FFGA 4RKEA 2GO1A 2R62A 1XQ9A 1CUUA 2GUGA 4NI5A 1N9GB 4GS5A 1GZ6A 1HLFA 1XK7A 2YXBA 3DV0B 3BWMA 3EH2A 5BUSA 1GU7A 1C1DA 3AKYA 1NQXA 4YIKA 3DOFA 1QH8A 4MS4B 1V9SA 1EU1A 4HLNA 4OYYA 1RYNA 4HHEA 5A4KA 2QRQA 3ZHVA 3NV9A 2VDQB 3O8QA 2JRCA 4ISBA 2IUYA 3IA7A 1P0FA 1PX2A 1XQXA 3TNYA 3ZXXA 1BCRB 4Y1RB 2ZJ2A 4GYYA 1L7NA 4P3PA 1LX7A 2V6GA 4HO1X 1GR1A 1XWWA 3KQNA 1M66A 3DO6A 1QHEA 1JG7A 3DOOA 3LT4A 3QMVA 3MLEA 4UEWA 4XUDA 1GTRA 1KYVA 1IC6A 1PZFA 1UKCA 1EFRA 3D0QA 2CXNA 4KYTA 3E1GA 2OCIA 4GKAA 3GJ7A 4C4AA 3WGJA 1ZNQO 1QYCA 3K6SA 3MSXA 1MKYA 4WVFA 4DA4A 2TRSB 2F43A 1OXVA 1D7AA 2HI0A 4DEYA 2XLBA 3NHPA 1GSIA 1ZN2A 2CUKA 2IYWA 3IEIA 3LYUA 4O2AA 1JN0A 2WYHA 1J23A 1Z75A 2QAGB 2Q8NA 2ZIEA 4U7FA 2ARKA 5B3LA 2Q6VA 1OAOC 2DMRA 4X71A 2BM9A 1PUJA 3A4MA 3VKWA 1MEOA 2JVKA 3H6GA 4JWKA 3TQIA 3ZXUB 3JARB 4CLDA 3ZEAA 4DTIA 2XZLA 16PKA 4NYMQ 4CM1A 3SXJA 3Q6IA 4OGLA 2C3UA 4C30A 4QO7A 1Q0SA 3TXYA 1YIDA 5FUXA 3IOBA 1QORA 3EDQA 5A5GA 2AN5A 1JIIA 5CBKA 2QTVB 4RSGA 5JTUA 2QLFA 2QTWB 1GXSA 5EUQB 3A1NA 3KQYA 1JHYA 1YXMA 4N0DA 1L4MA 2DTDA 1MIOA 2OXCA 1IBMB 3ZD7A 1UIMA 4LF8B 4G5QA 4PSVA 3UHOA 4ZI7A 4V1CB 4ZEWA 1UBGA 1Y4DE 1RXEA 3PEUA 3EA4A 4LIPD 4Q9AA 3CGGA 4FD2A 1LDYA 1X7XA 2A0YA 3DD1A 3OLCX 1X80B 3PNKA 4IKOA 1GZ5A 1O58A 4LK3A 4B80A 1UMCB 5AVWA 4B3DA 2FWIA 1OSNA 4KGDA 3LZDA 3TVDA 3FMFA 4TRJA 4YDHB 1WDWB 4JBYA 2WJJA 2FPPB 3ZU3A 1SXGA 4FCTA 3K4QA 2Z5FA 5KYKA 2NSHA 3D5EA 1BW9A 4YPFA 2V5AA 4CMAA 4F4HA 5JFGA 5DN6A 3X1ZA 2P9HA 2BTQB 4C88A 3ANMA 4M46A 1JLHA 1JSCA 4CMHA 2B92A 3CR8A 2AX4A 1RJEA 1U7XA 1YJQA 2XY4A 3PEFA 3B53X 2W11A 2EGGA 4DR5B 4QUIA 1AKMA 1YWGO 3ZKWB 4ARAA 4MCIA 4GUAA 1Z0FA 1P60A 2WA1A 2B4KA 1NAHA 3LKZA 1LLCA 5B6IA 2PX0A 2Z5VA 5FWAA 5KHAA 1JHMA 5FLKA 2EARA 1T2FA 3BL8A 1IY8A 2F1JA 3OTHA 3BERA 1P9OA 2GN8A 3NEPX 4IJVA 5LQSA 4K1LA 1KWGA 4YT5A 1IWBB 3HN7A 4X20A 1Z73A 3D54D 4R1SA 1F4LA 3SDSA 1LQ2A 2V96A 2YWRA 1AUXA 3LT2A 3CPEA 3CVUA 1GQSA 3T5MA 1ZGJA 2E4VA 3D6AA 3CMMA 3RSLA 3L9XA 3SQOA 2P6NA 4LJ8A 4S2UA 4HLCA 2XDAA 3BB1A 2Q1XA 2QZPA 2PYDA 4OJKA 5E6SB 4AJ4A 1Z4OA 2JH3A 2ODQA 4QGGA 4BO2A 3ZE9A 2OO5C 2OXFA 2ZTHA 2JLXA 1DKPA 1JIVA 1P31A 1Y8CA 4ZALA 2Q45A 4LVOA 3C15C 4M53A 3KYIB 3UYLA 3L43A 3AEZA 5HZKA 5JC8A 1B8PA 1M6NA 4HH1A 3K53A 1RHQA 3IHLA 4C6RA 3VPGA 5U9CA 4XXHA 3OD1A 4YRLA 1V41E 3H9QA 1UT6A 3HUEA 3HBNA 1UZUA 2ZYTX 4X97A 3SC2B 2UYHA 1PG5A 1X74A 3DW3X 5I9IA 3QPUA 1OX4B 3FMIA 2RHWA 3OFSA 3RBAA 5M3BA 2BTQA 1AU9A 3G2KA 4BLTA 4DM3A 3GHYA 2QUKA 1A8SA 3CO0S 5ALVA 3HFGA 1TA9A 1FU8A 2HMYB 3STWA 2H5EA 1EB9A 2C3MA 3OQIA 3SNHA 2QTMA 4RZ3A 1G19A 2C8VA 1X7ZB 5C31A 4C9BA 1JJBA 4Y2PA 4MKHA 3AK4A 4QT0A 5HJ7A 1HEIA 1VB3A 3ED1A 4FD3A 4LYDA 3HA5A 2ZCJA 4AJ2A 3PCXA 1H9BA 1I1NA 1NV8A 1P7WA 2GK4A 4JC5A 3U16A 4U8HA 2NVWA 1XP8A 1OGYA 3JD4A 4UE6A 5CLFA 5B1HA 4ZARA 1K7EB 4BQPA 5EJ6A 1Z6TA 3QVWA 1YHNA 3BK7A 5FI5A 2BFOA 3DE5X 3WICA 3D6FA 3EMVA 4I6GA 4O2BF 1QV6A 4RABA 4JLWA 5HUQA 1YE5A 2Z1DA 4Q02A 1KE2A 5DXFA 5DTIA 4A16A 2QYHA 3RK0A 1PBNA 5EP3A 1W4BA 2PKRA 4G41A 1CVRA 3UMSA 1PWEA 3G8DA 1CTQA 4YREA 3S99A 1UXHA 3OCJA 3H9UA 5BSHA 4UNNA 4HDKB 1E7QA 1BS2A 3F4LA 2ZIGA 2VJMB 2YBDA 4OEHA 1Z0AA 3FROA 4D3SA 5B1IA 2IXFA 1GRVA 1FF9A 5B58T 3S1LA 8GPBA 3GJ0A 3KJIA 4HDMB 5EZ5A 1YDEA 2QTRA 3OPXA 3PI6A 4DC9A 4L8LA 1GAXA 4NOMA 2CD7A 4Q1EA 3TRKA 4YCBA 1KPGA 1AM4D 3EXIB 2IELA 3I42A 3IBTA 4D57A 2IIQA 1PGQA 1U5AA 1NP3A 3GZNB 3KWJA 4R7ZA 4W5HA 4YI5A 4M0LA 4X90A 3S5UA 2CLMB 1CZRA 4XDZA 4BP9A 1R50A 1ML3A 5CJPA 2H1SA 4MPTA 4X00A 5EP4A 4M3NA 2DEUA 2ODBA 2OUKA 1C0PA 1PJSA 4OI0A 4LPSA 1Z06A 1XYYA 3G2QA 3O31A 3RVSA 4AUKA 1W94A 2NLOA 4ARZA 4MV4A 2RAUA 1J70A 1MF7A 4QFBA 2O8EA 5EIHA 5G02A 2H0QA 3DMDA 2EP5A 3A3OA 3BK2A 3W8FA 3ISTA 2C83A 4I55B 1TEZA 4AP9A 2YOHA 4Z0NA 2P1ZA 3OZWA 2WJGA 2RHTA 2HMVA 2GEFA 1SC6A 4MCJA 3OQJA 3ZK8A 1UC8A 3D1LA 3I8SA 3GVPA 3GJSA 1F9AA 4A7PA 4QO8A 4FCWA 3UJ7A 5FBKA 4G2TA 4WPGA 3RSQA 4P93A 2XECA 1B41A 4N76A 4JZKA 3WLKX 2QTZA 4I8DA 5F4BA 4TLDA 3TSOA 4MWSA 2OKCA 2Q6OA 1UK9A 3IQXA 1SD5A 5AHXA 1PV1A 3W3AD 4JP1A 4JLMA 3M3DA 3EXFA 3F1KA 2NW6A 4N3CA 2VJYA 3D59A 4YP9A 4NU0A 1QFJA 4LJKA 5LM3A 1QG6A 1DX4A 5K5EA 3D8TA 3U7IA 3OU7A 4EH1A 3GQBB 1QYIA 1RXSA 1ZBDA 4BU0A 4Q1FA 2KJQA 4OUDA 3KJGA 1PT7A 4KAAA 1M1YA 1RJ9A 3C3DA 4BLRA 5KVVA 2PRYA 5CB0A 1K8ZB 4KITB 2RK4A 3G0HA 1G5IA 3A6LA 4BVGA 5FTJA 3ZLTA 2PCLA 3CF6R 2I6QA 3FCAA 1XVAA 3WGUA 4W82A 4EUFA 5BYAA 1GPYA 4QAJA 1V48A 2LR0A 1IWPB 2BONA 5LU9A 3NGLA 2OZPA 1PX0A 4Q4HA 4UFPA 3OMLA 1R0XA 1URPA 4TSFD 3DGEC 5DTEA 3VJMA 5FOQA 2C96A 3MK31 4PZAA 1R66A 4C7OB 4Q3DA 1BWRA 4LI0A 1ZYUA 3PVSA 1YFZA 2DU8A 3GFVA 2VATA 1JWAB 2I2XB 1VSVA 2WM8A 2NQ8A 3HBAA 4IF6A 5E6UB 1DG3A 4Q7LA 1PHPA 1MW8X 1K9SA 3TTXA 3Q2IA 2CCKA 3IBFA 1SVNA 4L0CA 1WMDA 3GH3A 3PU6A 5FR1A 3ORHA 3QYJA 1JL3A 1YJXA 4NE7A 3WDLA 5JLJA 3QKRB 2VTVA 1M34E 4Q9JA 1I5EA 1RC1A 3VYUB 3SJ7A 2HAEA 1YR8A 2E4YA 2DHQA 1VFPA 3LA6A 1J8FA 3EE6A 2R48A 1R9GA 3IIKA 2FUCA 4UHBA 4NJOA 3GZ4A 3TCKA 2IHTA 4DPLA 1KO5A 2AVDA 3A7DA 3J81A 2MINB 1HNZB 1ONSA 5TIIA 4O4HA 1UFVA 1XD8A 2EFHB 4NULA 5TS2A 3VPCA 2X4GA 1YK1A 3WBKA 5CD9A 1CT9A 1G3QA 1VMDA 3R5JA 1K6MA 1GU1A 2PUEA 2KS6A 1XKXA 1IN8A 1PFWA 3CNEA 4ENQA 3ICQB 3NJ8A 2GI4A 4IQFA 1JR3A 1XKQA 1UJNA 5KC8A 4PAGA 3LL7A 5IHXA 4QTXA 1ISSA 1L6RA 1XTZA 1ZH8A 3HCWA 5G41A 3TDKA 3W2EA 5HM6A 1EVKA 5KAPA 5DNAA 1K5HA 4DCOA 4K9RA 5LN1A 1GKYA 4FLFA 3LVBA 1QH1B 4YTEA 4G8BA 4Q6WA 4MGKR 2P30A 1DBIA 4CG0A 3AR7A 2VDPB 4OIFA 3LXUX 5LCXA 5JJLA 4ER5A 1XJCA 2FDCA 1WMFA 5AKJA 1JNXX 3EQ6A 4DQLA 4LQLA 2IL1A 4GI2A 1RXCA 3CLRD 2WYVA 4PZLA 3VHXA 3CV3A 4I9GA 4B3JA 1U9IC 2AOTB 1GFSA 2BFDA 4WT7A 2FWMX 1TA4A 1E9FA 1AKQA 3JV7A 2X7JA 3NZEA 2BGIA 2BHSA 2IHKA 4KZKA 2OUIA 4MEBA 3U61B 5EJFA 1YZVA 2C1EA 3PUHA 4OFBA 4PQEA 1PNRA 1Y1RA 5K0ZA 2GN1A 1KAOA 1U9YA 4DSOA 3U40A 2A4KA 4TWJA 4LOKA 1DFIA 2PRKA 3VQTA 3GCZA 4HATA 3W9YA 1AB6A 1FFSA 4BJ6A 1XROA 1FL9A 1JYSA 2ABWA 2W37A 4RFSB 1WS6A 1NW3A 4I2NA 3D1JA 3RUIA 1KDRA 1NPTO 1ECPA 1T5IA 2M32A 2FW7A 1I4LD 3AESA 3H2SA 3N74A 1N7HA 3S2SA 3T7DA 2OO3A 1N9KA 3K31A 1LX6A 2J3MA 3K0KA 3EVAA 4O4IF 1K3UB 4L9RA 3TK1A 1Z5WA 3DBLB 4RM2A 5FNVF 1QS0B 1Y9DA 4PRYA 5HUHA 1MD9A 2H52A 2ZVJA 1ZR2A 4H35A 2CFSA 2GHIA 2PUHA 3DKIA 3JQEA 5AJUA 3K70D 2BI8A 4BVEA 2I2WA 1E2LA 5AVYA 2VXYA 3GJRA 4M0EA 3WP0A 2N47A 4JB8A 1BWQA 1R8YA 4Z5XA 4P5PA 2PQ0A 3KQLA 1PR2A 3CUWA 3N05A 4PLFA 2RBKA 1ADCA 3LLSA 4OHOA 1C9KA 4FMBB 3SHQA 1D7OA 5L4SA 2UU9B 4G1VA 4PC6A 4KYIB 3S2YA 1E5VA 1EM6A 3FTCA 1Y81A 2BOVA 1KBZA 1XV5A 1YS6A 2HTEA 3P2IA 1P6XA 1T8WA 2ZIXB 4U0JA 3TKYA 3T9AA 4EJSC 3AEYA 1BSVA 1CJTC 4QDUA 2Y1GA 3U0VA 4DLWA 1BGVA 3GPCA 5HW0A 3EQ2A 1N3IA 5KNCH 1FLNA 3LW7A 1SVLA 1R0ZA 4LY3A 1DC4A 2C7OA 4N3AA 5JISA 1ZW6A 1A98A 3HBFA 5DP1A 1ZSYA 3JWGA 4X60A 4UFOA 4WOKA 3DE3X 4JKYA 3SDBA 1GWNA 2GZRA 4MICA 1UXJA 1ND6A 2HREA 3MUOA 1H3NA 1TGYA 5JWHA 4A8JC 3ROTA 1CE8A 2HCFA 4K3UA 4LC0A 4R8VA 2R6AA 5I7WA 5K3SA 2XMZA 2BFBA 5D1NA 3UATA 1IHDA 4RMHA 5TLSA 1QTIA 3TKLA 3NKFA 1Y5RA 3RHFA 2E85A 2ZRAA 3UMRA 3SS7X 3NHKA 3DM9B 2YYYA 4Q4AA 1RBQA 4C21A 1KKUA 2JD1A 1G16A 4D99A 3OAAD 2EW8A 2I4MA 1QWSA 2YS7A 4YO7A 5HX7A 5E4TA 1F0PA 3R3UA 3LRTA 3AR9A 2NU8A 4EZBA 4YBRA 1PL0A 1MP0A 1YVUA 1MG0A 3K73O 4N65A 5DBFA 5SZIA 3V8NA 3HC7A 1UMBA 1ZL0A 4HWGA 4AUNA 5JZBA 3TYXA 3OCVA 2I3ZA 2AD5A 1NZDA 1NZJA 2Y1FA 4MLZA 2JI9A 5FXMA 2FVYA 2NSDA 4IL5A 4JA0A 3RIYA 2VP4A 3MBKA 2X22A 3BD7A 4S0XA 4CNQA 5HFAA 2R5FA 1I80A 4H1VA 1I8TA 5J4HA 1HI9A 4LNAA 2EW1A 2YJGA 5T4EA 4BFVA 5J43A 5JS7A 2AZDA 2VA8A 2Z2KA 2ZQ5A 4KOEC 3OQ6A 2AC7A 3BZWA 1IHPA 1UZNA 2B5WA 4OV6B 4BP8A 4YRJA 1XE3A 1SCUA 3FR7A 3K15A 3JQGA 5GAJA 5KYGA 4OHBA 4GE3A 5AKXA 5JAOA 4TRNA 2PX6A 4DSAA 1XZBA 1OH6A 4ZVPA 2AXEA 5HKBA 1FDSA 1DEXA 1UFQA 2PSSA 1P2BA 1P62B 1E2GA 3KJZA 3L4BC 4JUIA 4OKNA 3MW8A 2ZJ3A 4RFLA 3UGTA 5BMVB 1YNSA 1SKAA 4KAJA 2F62A 3PHIA 4H7PA 4UNIA 3M0EA 3WMRA 1YZFA 3TG8A 4HG2A 4TL9A 4CPDA 1L7BA 3K9QO 1IFXA 3B1YA 1R9JA 1Z4LA 4M86A 1FDVA 2I6UA 4CLHA 1N33B 1CJSA 3ETLA 4ROTA 1NM5A 2TMYA 3OZFA 4YFYA 5GV8A 3EVEA 4F96A 4AP5A 4ZZ0A 3IUNA 4KVAA 5BMOA 4EYOA 4ZT2A 2B8WA 3EPJA 3C48A 2NP6A 2GF2A 3EXHB 5TVGA 3CKMA 3CZRA 3PL5A 2ZOSA 4PYLA 4E30A 4UVEA 1KJIA 4ER3A 1JHOA 5IU6A 1V8ZA 4CQLB 1JX6A 1MZPA 3THXB 3TQFA 2EJUA 4Z54A 1E0KA 2OB1A 1R8QA 1IQPA 4K9MA 1WX1A 4GMDA 1R9NA 3NP7A 4E4YA 5KTYA 2JJ1A 3ZOKA 2C5AA 1MW9X 4LE1A 1NG9A 1NUAA 1V16A 2A5YB 4E0BA 1UAGA 4FFBA 4B17A 1XQWA 4QQKA 4G0VA 3BHNA 1E2JA 2OY0A 3BHMA 5IEBA 3KZVA 4M6WA 3ZU6A 2WD8A 3GRVA 3STUA 1X0XA 3AUYA 3L6RA 4PN7A 3FOFC 1TUBA 2QUHA 3I12A 1Z2NX 1ZIOA 3O4JA 4YJ3F 4H27A 4KJZA 2FPWA 3F96A 1XNGA 3AOEA 3D0OA 1E9CA 1NXOA 4PG5A 5DCWA 2FSGA 1QFZA 5B3AA 1YVDA 1P6UA 5C1PA 2JLBA 4WESB 3GPDG 2J31A 1HRDA 3OIDA 4Q7MB 1GADO 3CVYA 3X1YA 4TYYA 1T4DA 4H1UA 1YH3A 2OD7A 3CSDA 2XKAA 3P26A 4G9GA 1R0WA 1Z36A 3GRPA 3OKPA 2HPVA 3RT9A 3ESXA 4EQ6A 1P5ZB 5H1YA 4BRUA 4FGKA 4YDQA 1Y5IA 2R1TB 4M9QA 2HK6A 1JLLA 1H4QA 1BMQA 4HEJA 3CW9A 4MUGA 2RGBA 4DABA 2IBSA 2ST1A 2C95A 3KZMA 3WTBA 4S3MA 3X0DA 2VNHA 5ALRA 5KX5A 4QODA 3GEBA 1HUQA 1I3CA 1OZAA 4AT1A 1T5DX 4D92A 4E08A 4N82A 4C78A 3G17A 2XXAB 4FB5A 3P71T 1JMYA 1X1RA 2J09A 3I5UA 3ZGZA 3LCVB 3INTA 3QXHA 5EJ2A 1RXUA 3GCXA 4FM9A 7MDHA 1Z5NA 2AG1A 2C7QA 5GGXA 2DUWA 5GM1A 3WGYA 4CM4B 5KIAA 1K8RA 1UWCA 1XPOA 1TKAA 1KMQA 2JGIA 1V45E 3TWOA 3PC3A 3T9DA 1Q19A 3BH6A 4F5ZA 3K09A 5ALGA 4KPUB 3L8GA 4H6XA 2FLVA 4MHOA 2Z2JA 3CISA 3L1UA 4QBGB 5FQNA 3ZE2B 1E1KA 2IOQA 2OKGA 1QIDA 1VL0A 2YRFA 1RR6A 1J5EB 3SQMA 1XZNA 3AUXA 1RAGA 3CH7A 1U0HC 3B1JA 4G1UC 4JI6B 4D9IA 5B7QA 1SUCA 2P9ZA 4FFLA 2VH1A 1Z0SA 1CD5A 3B8HA 4FHCA 4RZXA 3RC2A 1L4FA 1J2UA 2X23A 3AIOA 3MJEA 2O5VA 1NVTA 1VE1A 4U63A 4C7BA 2B0JA 2LZ0A 4MROA 3ZS8A 3P4YA 4AZ0B 2FH5B 4R84A 3DKKA 1RLMA 5FB3A 3OF5A 3Q8WA 1W87A 3P9PA 2R44A 3QBJA 1PWZA 2D00A 5BWNA 3DTTA 1P18A 1ZHOA 4PYOA 1IAVA 1XZHA 3L46A 4BJ3A 4C06A 1ORVA 5C53B 1IAQA 2V58A 2ZDQA 4FJ2A 5FEMA 1RYHA 1JTFA 1P0CA 1Q0QA 1W48A 3ENVA 2CVQA 5IAOA 3IAM6 2YRXA 1W96A 3NDPA 1EK6A 4DY4A 4W5TA 1D3AA 2BFFA 2ZATA 4GPEA 1FU4A 4Q93A 3N2NA 1L5NA 3FA2A 1NXXA 1XMSA 1MPTA 4KUGA 1AKUA 4E5DA 4TWRA 1GG8A 2BFAA 5AM4A 3S44A 3DL4A 1CP3A 3WZLA 2NYVA 2JIPA 5HDQA 3FPGA 5AMXA 4CT5A 4KI0A 5AQEA 2GJ8A 3TAUA 2XB8A 3PQCA 1AQYA 1A2QA 4H7KA 4B31A 4M21A 1G3IA 1OLXB 1T1IA 1DJNA 1T6YA 4NVRA 3GDGA 5ESDA 1G6Q1 2ORED 1M8JA 4JU9A 3W9UA 1TTQB 1GUBA 1YL5A 2BUCA 1BFUA 3DB1A 4L5YA 1N2CA 1IPEA 2OVFA 1L4HA 3OPYI 3WWDA 2CE2X 4YLGA 4GP6A 5A6SB 4CKYA 3T6KA 4ZAGA 1IBCA 3AVUA 4ITUA 2IFTA 2XCUA 3O92A 2W43A 4PHFA 4GX2A 1OW3B 2NUPA 4QOHA 1MX3A 4DEVA 4YV2A 3BMQB 5ADVA 4XUCA 5HKOA 1L1FA 1XT6A 4ZJUA 3BXZA 3JWJA 1S89A 4DJTA 4RQUA 3VOBA 1WB5A 3K0BA 3MWEB 5CPBA 3HWX1 2Y4OA 4QOFA 2AJDA 3ZDQA 1AQLA 1SBQA 1U2GA 2ONYA 2SCUA 2V03A 2YIMA 2ZYAA 1IUOA 3H5WA 5JDIA 2BI7A 3K0FB 1DG9A 1OX5A 4ZXFA 2QF7A 3K71B 5CXSA 1E7SA 4CRWB 3L1JA 2L18A 5KTKA 3IBGA 4ZANA 3CKLA 4JSYA 1PYDA 3E7PA 4YRSA 3JVDA 1WOMA 3MM4A 3COJA 1NMEA 4PQFA 3VU8A 4YV1A 3JATB 4QUAA 3H05A 3U19A 1D1TA 1HE4A 3I92A 3BH7A 4HTFB 4XB1A 1FXSA 2ZSBA 4IVRA 4BZQA 2HJRA 3DF7A 4OB6A 1KK2A 3K2EA 5BOSB 1SEVA 1U1EA 4Z8XA 1J0CA 1NGSA 2XKBA 1R0KA 4FIDA 3UJBA 3PDIA 1U63A 5J23A 3HN6A 1UXOA 1ECFA 3FWPA 1TADA 4PHGA 4DBLE 5H9VA 5T3YA 1HOXA 3O4IA 2FN9A 2ZLBA 4NMHA 2KPOA 4QU9A 2F48A 2QVBA 2A92A 3UWPA 4XW2A 1DWPA 1A04A 4YRFA 1SKYE 4X8HA 3VR4D 1N36B 3ABIA 1O9BA 4P4SB 4QDZA 2J07A 4WNAB 3TOZA 4DIEA 1MFZA 1ECBA 4WIAA 4KPYA 4DR7B 2V74B 4NS4A 1N4AA 1WVIA 5HP4A 3ICCA 3MJFA 3G1TA 2FEXA 2IU6A 1FRVA 1GTG1 1V8FA 4FGZA 2VUIB 1GYPA 5CLIA 2QN1A 1PTKA 3QE9Y 4EECA 2E18A 4EJ6A 1C3OA 2ID8A 1GHTA 4GLOA 4IVPA 2SICE 4KQ6A 4Q18A 4TXJA 3MGKA 4I50F 5IBQA 4BFSA 2Q5OA 5AJYA 4WKGA 2ECFA 5JTTA 3KUXA 5K7SA 4MWOA 4BMZA 3O8LA 1K7XB 4RXMA 1WLYA 1ZVJA 3DVSX 2DP4E 4RLHA 2FCAA 2PYIA 3GFBA 3Q9SA 1KAQA 5I47A 4FILA 1DP4A 1UM9A 4QLOA 3E82A 3ZEIA 5KYNA 3TTWA 3SYKA 5BNWA 2ESRA 1PDOA 3BMNA 2XE8A 3SZRA 5L7TA 3BTUA 1PD1A 2Q62A 3NORA 1K5PA 3THOA 4D5GA 2H11A 3GT7A 3OICA 4BQFA 4FI3C 3HJFA 1WTAA 3BE8A 1JLMA 3SQNA 4KHPB 1CZLA 2E21A 4UD2A 2AI1A 4IDHA 4UBIA 1QIMA 3WB2A 4P4LA 4I4NA 5C2JB 2VG8A 1ENOA 3ELBA 2BLNA 5IW8A 4R8LA 3HUFA 3OJWA 1JLSA 2OILA 3V48A 1U2GC 3SVZA 2EZTA 4O8ZA 2OHGA 3AVVA 1RWNA 2O2IA 3O7WA 3NH6A 3QKUA 5FBZA 4F4UA 1EINA 1G6HA 5IRCD 3OC0A 4GQAA 5IANA 3IAXA 3TW8B 1XCOA 4J16A 5AD1A 2Y66A 2QM3A 1SCQA 2GHQA 4HGZA 1YRHA 4RVNA 1R88A 4ZO8A 4G36A 1R37A 4BU1A 2JIBA 1KORA 4HDNB 3BT7A 3IC5A 2ZRDA 2XT9A 1NAIA 4TVBA 5DYNA 4HYYA 4PVDA 1J8MF 2YWHA 4L8GA 3LDAA 1FMJA 3OX4A 3TOXA 1RQ7A 1XF9A 3M2TA 1I1QB 2DBYA 3HKBA 1T1EA 2WFZA 3RKRA 2ZQZA 5BW6B 1OH5A 2ZT6A 5J59A 4MEJA 2NN3C 2WF7A 3R2JA 1VE3A 1Z9BA 1I6KA 1K92A 1ABEA 1LB1B 3L6DA 2RBEA 4J1TC 4YDRA 4EI9A 3AEXA 5BT8A 4HDCA 1KEPA 5ED0A 2O3JA 4C4PA 1R4MB 2WZCA 4AJKA 5L3QB 2FP4A 1NW8A 2C99A 2WTNA 1KS2A 2C3OA 3ORSA 4J7UA 4RDCA 1HYBA 1SQSA 1Y6JA 5F5LA 4JLNA 2PWYA 3UPDA 1QG4A 2ZB8A 3WISA 5IT0A 1G63A 3AERB 3LO5A 1IMJA 4YJFA 2H7CA 3UHFA 1GY8A 2CKDA 4BBAA 1YHZA 1V1MB 1ST2A 1XTKA 2VP5A 1NPDA 3L0SA 5EYPB 3RNOA 3TIFA 3GJZA 3RLFA 2VAVA 3HBJA 3EVBA 3RK4A 3SZ3A 1QO0D 4YPVA 4HDKA 2DYKA 3E9RA 3K20A 2JIZD 2Q2NA 3A6FA 3FUUA 4WNIA 3IAAA 5BYKA 2XVMA 1LZLA 3V4PB 4EAAA 3Q9NA 1ZR4A 2JI4A 4LBYA 2VVTA 5FIUA 1VSUA 1DDGA 3I2YX 5CBPA 4UTRA 2O0JA 3BF8A 2XXAA 3RM3A 1T3GA 2OV8A 3H4IA 1FXWA 2C97A 5H81A 1VI5A 4GRIA 4AURA 4ZHQA 1GCUA 3BEOA 3NO4A 2O2HA 3NBFA 5BXYA 4YCDA 4LSGA 1WDLA 3FDZB 3L04A 2FPLA 1CVLA 4LNUA 4MX8A 1AKWA 1Y63A 1NMXA 3DT6A 2UDPA 1BGWA 3RDPA 1GDTA 3AM1A 1PE0A 3BA1A 1M7GA 1GNVA 5ITVA 2C0PA 1X92A 1FFEA 4Q1CA 2ZBPA 3L0IB 1VPTA 1PTJC 2Q3BA 2X8AA 4XEUA 3OTQA 3DEJA 3N2GA 4PZEA 1E5QA 4WV3A 1LPSA 4HUJA 4R6WA 1KNXA 3L8EA 4ZI5A 1G8JA 1X9GA 2AH5A 3F3KA 4YDSA 3AETB 2XZDA 1A4UA 3LFUA 5KB3A 4DMLA 2H85A 5DI9A 4HV4A 3FGOA 821PA 3NPAA 5B55A 3VGJA 2D59A 4G5XA 4MVJD 4R0VA 5F7ZA 3F8WA 4RVOA 3Q11A 3TSYA 1QMGA 5EJ8A 4UQOA 2HRBA 4P1ZA 3QKTA 4UHDA 3UMMA 2NACA 1PQUA 2I5PO 2PT6A 3AEKB 3GJXC 3NYQA 5DTQA 1OKKA 1J1IA 4TWZA 3TUIC 1N77A 1JRLA 3IO3A 4UM8B 3ITNA 4MB2A 2C4MA 3V6MA 4NKRA 3L1IA 1KU6A 4L6CA 2EXXA 3VR2D 5EKTA 4GBJA 4P38A 2ODNA 3EARA 2IUTA 4U6QA 3RGGA 7REQB 3KB1A 4N5IX 4F3NA 3DZFA 3HXQA 2VT3A 3MWKA 1FSGA 3VM6A 4A36A 2JHAA 221PA 1DC6A 1XI2A 2CLEB 4JR2A 5DX8A 4V1CA 3NJRA 3S7ZA 3HS3A 1OVGA 2Z43A 3PG5A 2YWXA 3Q10A 4G9BA 4ID3A 3RAEC 1TYZA 2D1SA 4YUZA 1MQAA 3GEIA 4RCYA 1GAQA 4QBIA 3KKEA 4C7OA 2JFOA 2Y92A 2QSYA 4U39A 1VE6A 3Q7EA 3GG9A 3ZW8A 5HJ5A 1CR6A 2G0NA 1OLUA 3JQCA 2G36A 1GFIA 1M8GA 3EGVA 2FSIA 4B82A 1FTNA 1L1RA 4U2BA 5BR4A 4DNOA 4UXIA 5SICE 3O0DA 3GLFA 2WB2A 4RL4A 1N2ZA 1XPUA 1JMKC 5HNKA 1U0GA 2XEDA 2J5QA 2YMLA 3S81A 2VIIA 5C0OE 4HAOA 4KXWA 2O54A 2IPXA 4HWOA 1LC3A 3VH4A 4NU8X 1MU0A 1SUWA 1MIHA 4S24A 5AVUA 1ZD3A 3WY9A 4P58A 3K32A 5JDIC 2E4UA 3LX5A 1J33A 2QGNA 4I81A 2W42A 3OQOA 1W7AA 3A70A 3JALB 1Q14A 2IJGX 5C8YA 1S9DA 2ZROA 5HF6A 3K9LA 2QX6A 5EPOA 5ICEA 2GCIA 2VNKA 4MQFA 3FPJA 3A05A 2BH9A 4PSKA 1DAOA 3T34A 1HORA 4QOEA 2CT8A 1SOMA 4NATA 3GR6A 1U90A 1QDLB 3Q6MA 4RYDA 4W6ZA 4B2YA 4MTCA 4GEGA 4BTLA 2VKQA 1D5WA 3VC3A 3T1YB 2H4ZA 4YN3A 3DDSA 4DJFC 2DT5A 4XYGA 4E5NA 3B3JA 2II6A 1EUDA 1DIRA 4QJBA 2BZGA 2ZUFA 1FFXA 2RB4A 1DQZA 1WSDA 4NG4A 1CEEA 1P75A 4LZZA 1QGDA 1XCGB 2YOFA 4NSNA 2A88A 3U37A 4CW7A 1KI7A 2JHPA 3A9UA 4H0CA 4IO0A 3UJCA 3UOAB 3E5RA 1MTOA 2ON6A 1YNOA 2NU6B 1NDQA 3W7BA 2G1JA 3ADCA 3H16A 3C1AA 4RZ2A 1S01A 1AG9A 2XA1A 3M8KA 3Q9LA 3N7TA 1FYVA 9ABPA 1I14A 2EX1A 1YB4A 3PKJA 4EUKA 2P77A 4G07A 3DTVA 4DPKA 3CYFA 4B74A 1ZKMA 4FHEA 3TLJA 3ZHBA 4EEZA 4EOGA 5LIRA 4LHZA 2R6GA 1CDEA 1QP4A 4MA0A 4Q19A 1SK9A 5C52B 5AKHA 5HTKA 2V6BA 3RUEA 4EKNB 4UQPA 3KK0A 5SY9A 4DPMA 1WVMA 1CYDA 3QYPA 5ES3A 1Q84A 2P2GA 1F8YA 3SHTA 2WPDD 5CDTA 5JSUA 2ZZMA 3EDMA 2PKEA 4P54A 2PH7A 1E69A 2I2AA 1CULC 1I0LA 4LRXA 1U81A 3GGOA 3QBDA 1PR1A 3GVHA 4F4CA 2PUAA 1GGEA 3P8ZA 1KKMA 1S3GA 1QAMA 3LU1A 2O8BB 1F14A 1R4AA 2ALJA 2BKAA 3LY9A 1H2YA 4Y2SA 4JYZA 2QY9A 4NJMB 4GGPA 1NQWA 4N41A 2CXOA 2Q3CA 4UPVA 1V39A 1NRXA 2REBA 2QP4A 2XYQA 1FSZA 3U60B 3RFFA 1JH9A 4WUVA 4GEKA 5KNLA 3FNBA 1G4HA 3RJTA 4IIGA 4BNNA 4B3RB 3H3JA 3ZCXA 1D5CA 1YBHA 1WV0A 3I4LA 4ITVA 1I2CA 4H59A 1E20A 4YWJA 3TM4A 4I9HA 5A4AA 5FLXA 4LQ4A 3KQKA 1GCOA 1X7GA 4ZOEA 2R5WA 3OOHA 1R0RE 4KDRA 4MYUA 3UBMA 3VR5H 3NIDB 4DA8A 3TW0A 4B0OA 5LA6A 5EHGA