4QXWA

Crystal structure of the human ceacam1 membrane distal amino terminal (n)-domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
107
structure length
107
Chain Sequence
QLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Carcinoembryonic antigen-related cell adhesion molecule 1
publication title CEACAM1 regulates TIM-3-mediated tolerance and exhaustion.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qxwA00
1T1YA 3TIEB 5I18H 2XWJB 3IGAB 1I3VA 3S98A 2FWOB 5TDPA 5FGSA 3FB5B 3FQUB 4PJ9A 3KYKH 5GGRB 4JFDB 4UNUA 3T2NH 3RWCB 5HGAB 5JW5B 3QFDA 1U91B 3HUJA 3ZKNC 4Z7NF 3ZHLA 1X5ZA 4MA8L 5SX4I 4F15C 4GG6A 2VR4A 4C56D 4P57A 1OAZL 2B8OT 4JFOA 4NP4H 3KYNA 3QWOB 1FAIL 5B22A 2BSRB 2DI8A 3VXME 4K9EH 1YEGL 2JELL 1PG7H 3I84A 3V4UL 4HGKC 3PWPA 1T5XB 4NRXB 4F7CB 3SJVB 2Z0BA 4BH7A 1ONQA 3KYMA 4D0BA 2BZDA 2JLLA 2WINB 5ANMA 3MC0A 2EDNA 5EBLB 4PB9H 2KQMA 1T7VA 2FYYA 3UTTE 4ZUTA 3QXAB 2VAAA 1G7IA 4GMSH 1RJYB 4OUUA 2VIRA 7FABL 1Z9OA 3C6LD 4M1DH 4CN4A 2OR9L 3IJYB 3QJHB 2VISB 1BQHG 4GRLB 5IR1A 4BJLA 4MJ5B 1DBJH 4HJ0C 1WTGT 4PJAB 5JMRA 4OLZL 4AENA 1EO8H 3G08B 4CN1A 4N9GB 3FQTA 3MLZL 1MLBA 2EICA 1INQA 3VRLF 3DX9B 1BZQK 3K4ZA 4F7MA 4JN2A 3TEUA 3PV7A 3BD5A 2DYPD 2IALA 3BKYL 3HUJB 2DLFL 3PP3H 2R1XA 4F33B 2CLVB 1AR1C 4Y19A 4LAQH 3UTSA 1ORQA 4P57B 2CMRL 4ZOCA 5AYUL 3W0WB 1JNNH 2BNQB 1OPGL 1RUKH 2MPAH 2L7UA 5I16B 1BJ8A 4ZTOH 4XBGB 2VJXA 4EIGB 4N68A 1W72B 3T08A 1NBQA 5DMKA 4KZDH 4DZ8A 4JY4B 2YN3A 1QTYT 3KYOA 2BSSA 3QQ9D 3VG9C 1LO5B 3CFCH 4KRLB 4J7RA 4JRYA 3VXRD 2FCBA 5D7KE 2Z31C 5EUOF 2QEJA 4D0BB 2G5BB 1JHLL 5FYKD 1UCBH 3TN0A 3CFEB 5CSBA 1YQVL 1ZLUH 5FHAH 2H3NB 1EEYA 2UZXB 4JGMA 2Y6SC 1F90H 4HK0A 2F19L 4R7NA 5DI8B 1NCTA 2OYPA 5T1KA 2AV7A 1JPSL 5SX4H 4AM0A 2XKNA 2QSCL 2A6KA 5FYKL 5DJ8A 2RJMA 1MOEA 3JWDH 1H5BB 2N7AA 3THML 3MV7A 4EZMA 4B0MM 3IKCB 5GZND 1KLGA 1T04A 1YEIH 5IM7A 5BMFL 3HC4L 5J11B 4X98B 2BVQA 4HKBA 2A77H 2VLJE 4NZRL 5HI4D 5HHOA 1CDGA 4QHMA 4OTXH 5B38B 2NMSA 4IOFC 2X4TB 1T66D 1TTGA 2H9GA 4F7MB 4DGIL 1MI5D 3GSXB 3ZSTA 4HWZA 4JCLA 4A6YA 1N0XL 1F02I 4B7IA 4DUWA 5HGBA 5EZLA 5GRVL 2IALB 1NMBL 3B2UD 4XNUH 2E5EA 2VLLA 4JPIA 4Z9KB 1SJEA 3VXSA 5BCAA 3F58L 2W07A 1I1FA 1KN2H 4XH2B 4JM4L 3ARQA 1NGZA 3IJSA 5ACZA 1IKNA 5EFIB 1FG9C 1GC1C 2BHUA 3TFKD 2HWZL 2XTJD 3LIZH 3P77A 5FYLD 4IBLT 3V6ZB 3WO4B 5KSAD 5DS8B 4Z7UF 1J0KA 4QRTB 4FTVE 1KEGH 2EDWA 4JPKH 2HVJB 4XPFH 4PJCA 5C0CE 5FYLL 4ZFOB 3ULSB 3T09A 3H3PL 4NC0B 4R7NB 4Z7VB 3N85L 2H2PC 5BS0A 1FVCA 1HH9A 1F11A 1V5JA 2OTPA 1NDMB 2ADGB 4IRSD 3SGDI 4JHBA 2VDNL 3IDIA 2XQYG 4IJ3B 1U8PB 3RHWK 1XGTA 3WIHH 1SYVB 5D1XA 3QI9B 5DJ6B 5IK3A 3IXTA 1LD9B 1RI8A 3MOBL 4OCYL 5E8DH 5F9AC 8FABB 4CMHB 5H2BA 2H9GB 2CRMA 3WD5H 3EDEA 2Q7YA 3DPBA 1MNUH 1Z5LB 1TZIA 4DTGH 4XXCA 4KQ3L 5HVWA 5I8OH 1AQKL 2K3TA 4L8SB 3HS0A 1OAYH 4FFZL 4OIBA 2WIIB 4PJ8C 1I1FB 2W0KA 3DETD 2V7HA 3IJSB 2AJYL 4PJ5B 3CSYB 4OBRA 1Z2KA 1N8ZB 1DBBL 3P77B 4GOSA 5EPMB 4H25A 4N1EA 4K3GA 1VB9A 3O6FD 1TJHH 3VFRA 3KPQB 2R0KL 4R97B 4MCYB 5DJDB 1YMHB 4JB9L 5AZEH 1E4XL 2ZUQB 3OKKA 1U92A 2F15A 4L3EB 4AJ0A 5KVDL 1Y18A 1AGFB 1D6VL 4YHZH 3IDIB 5DTFA 3WSQL 1OF2B 1A1NA 1MFDH 1IGIH 3ARFC 1R5IA 1SEBB 4OD3H 2QSQA 3MRRA 2AVGA 5CLWA 4AG4H 4APQB 5CJQL 4QF1B 4FFYH 5FYJD 4HJJL 4KJYB 3QXTA 5D9SA 1GSMA 5BZWB 5TDOB 4XWOD 1DBMH 2B2XH 3D0VB 5FYJL 3NBNA 4HIHA 3DRQB 2VR9A 3TA3C 4UT6L 3RNKB 2DIJA 4ETQB 5D7IB 2L7JA 3NCJL 2BHYA 1G84A 1ZHNB 4GXVL 4D9LH 4UDUA 5EIVA 3C60C 4JO1H 3RWFA 2E8YA 4WDIA 4JFYA 4PFEA 5DK2B 3TGXA 2X4SB 5F70A 3BKCL 5J13C 4M5YL 5BW7A 4E42A 4EUPB 5EULV 4MAYC 1FFPB 1EIBA 2NYYC 3CMOH 4LQFL 1J1PL 4K8RD 4J2XA 5EUOE 1RJLA 5KTEH 3ULUC 1MJ8H 1QLRB 1SQ2N 1R5WB 1A1MB 2HT2C 1U92B 5IVXF 3RFZC 3U82B 4K8RL 2M26A 4I18A 4TRPH 4HXAH 4IHOA 3T0EE 4AY0A 5ABDE 4YHNB 4HUXA 3QIUB 3VGDA 2AS5M 2X5PA 3RY6C 4OCLC 2OMBA 4PJAF 4RNRB 3JTSB 1YNKL 2HFEA 4KTEH 1M71A 3ILQD 3TCLA 1IQWH 5F1IA 5E08H 5HYQA 3ZYJA 5JA8B 4X8JB 2BVUA 4KY1H 5JW4R 5F7WC 4BQ8A 3FO1A 3OXRA 2ARJA 4U7KA 4AEIH 2C3XA 4IMKA 2ZUXA 1A9EB 2AXJA 1RIVL 3RIFF 1V7ML 2P48B 1T3FB 2YPLA 1N4XL 2W60B 2JKXA 3D3VA 2M2DA 3N9GH 3RVTD 1SYSB 5DWUH 5DMJB 2VQUA 4G9DB 3QRGH 4U7MA 4L8DA 1C5BL 1J0HA 3NACL 4KHXH 1BOGB 2X9XA 3CVIL 5C0AD 1HQRA 4OQ1A 1GRWA 4WCYH 4Y4KB 1X9QA 3ZYIA 4NQCA 3DRTB 1FSKC 4QY8B 1RJLB 3GMLB 1KPUB 2BDNH 2WBJA 2E6QA 3OSKA 3DURA 4ZNEA 1G7QA 2CDFA 3NZHL 5I1JH 4HS6A 1AY1L 1KB5A 3CDGA 4HDIB 4I18B 4ZO8A 3LPFA 4D0DA 1ACZA 2H26A 4LSPH 4WHCA 3RTQA 4YBHA 1U8QA 3HR5A 2A6DA 2E27H 2PYEE 4R0LA 5CD3B 2IQ9H 3HCVB 3VGGA 3ARUA 3X3FH 5D7JD 1YECH 3RA7H 2IPTH 4WNQA 2OJEB 3GIVB 4MJIE 1HQ4A 2HFEB 4HUUA 4ZG1A 3TCLB 5K9KA 5C6TH 1I7TB 3PUCA 5L2JA 4JLRB 4U1MB 1UVQB 2IBBA 4WV1C 4JO3L 1GHFL 2NNAB 4X6CA 3MGOA 1OP5H 2NY0C 5MI0B 3PQYB 3UTPE 3SBWA 3VMNA 2Z93B 1IAKB 1P7QB 4MNQD 3UBXA 1FYTD 5CEZE 1FFRA 3TJHD 3MYJB 1JF6A 1KUMA 4MA8H 3GSOA 4XAKD 4L8DB 5ESQB 1MCLA 3WNNA 3F7VB 1OAZH 4RFOL 5D93B 4GMTH 3BFOA 4NUJA 2P44B 2AEWA 1FAIH 4P5MA 2F8VA 1MY7A 3BQUA 4NQTA 5CBAA 1YEGH 2VO5A 3ARDB 3GRWA 5E6ID 3V4UH 3L1OH 5EOCH 3MACL 5DJ2A 4ZPTA 4Z7VF 4Q9BA 5ID0B 1AR1D 4KK9C 1H3VA 3O2DA 4Y0GA 4Z7QF 4G8EA 3AMKA 1CDUA 1XH3A 4Q2ZB 1WBXA 3S35X 4P2RE 3U0WL 4JG0L 1PG7W 5GJSL 2R2HA 3CLFL 3QULA 3RTQB 3VXNB 1U8KB 1WIUA 3DROA 3TVMD 2OR9H 5F3BA 2HKHH 1HQ4B 3VXTB 4HS8L 4OLXH 2JJSA 3H9HA 4FP8L 4P2YA 5JO5A 1TQBB 2Y6SD 3MLXH 4OLZH 4TOYL 1MCWM 4X6DA 3MLZH 3VXOB 1IM9A 2FJHB 2VC2L 1WBYB 3HG1A 2OR7A 2PW1A 4BSVA 1EHLL 3ZT5A 4J3TA 2VLKE 3BKYH 3B6SB 5GHWH 1UJ3A 4NKIL 3VFTA 3DV6B 2B0SL 4PRAB 5IBUG 2CMRH 5AYUH 4KC3B 1OPGH 3TCXA 1OT1A 1JTTA 4EXKA 4RX4D 3HI5L 4M3JA 3QDMD 2PR4L 3H42H 1LO3H 3NCMA 1P9MC 4K71B 4NKMA 4F7TA 5GGRY 2ATKA 3L95B 4CJ0A 3B9AA 2FHFA 2NX5D 4CJ1A 2JJTC 3CXHK 5LVEA 3EGSA 1HSBB 1QFUL 1RJZB 4NQED 4LSDA 5DMGC 1JHLH 2DF3A 5IOPA 3AVEA 4QRRB 1CDYA 5IVXE 4XMPL 4ZOEA 3IFOB 1BQUA 1F4WL 1HHHB 1W0YT 1EEUA 2F19H 4DJMA 4EI5A 1EHAA 2UYLB 1AE6L 2R2HB 4AYFA 5J9PA 2QSCH 4K3HA 3QULB 5FYKH 4XB8A 1U36A 1Q0XL 1Z0MA 1MAMH 3LMJH 5HVGB 2UV3A 1FO0A 3THMH 1JMXA 3A0OA 4P5TA 4HZLB 4L4VA 3GO1H 3GHEL 2H32A 3C08L 5BMFH 1GC1L 3HC4H 2GI7A 4WU7A 2A2QT 4M7KH 1BAFL 3WFZA 2YXMA 4PJAE 2ZOLB 4KVNL 4G43A 4QOKD 2X4QB 4NO0D 1QFPA 3U9PH 2AV1B 2ICES 4WW1A 1IM9B 1ZVSA 2EIEA 3V52L 1IGTA 3DWTA 4AQOA 5F1NA 5BRZA 4DGIH 2I9LB 2FATL 2PW1B 1KYOK 4LLAA 1N0XH 4NQXA 1T1XB 5EN2B 4OIIL 4DZBB 4M7ZC 1NMBH 5HDLA 5C0IB 5DK0A 4FZEL 3BJ91 4JPWH 4ONHA 5GGSA 4ZYKA 3X11A 1LDPL 3F58H 3W9DA 3LAFA 1H5BC 3MBEA 4JM4H 4WFFD 3FT3A 1MY5A 3HNVL 3GMOB 1OTTC 4F3FA 1S7WA 1CQYA 1MAJA 4F7TB 2GJJA 1NQBA 1N5YL 2HWZH 1XZ0B 5J11C 5EC1A 1NUGA 1GL4B 3I02A 4C56E 1A1OB 2BNRD 3BPLB 3MJ8B 1MRCL 4EN3D 1SHMA 1E6OL 4LCWA 4PGBA 5FYLH 3H3PH 3N85H 4EI5B 1RUAL 3TBSB 4PV8A 4PTUA 3WXWL 4JDTL 3BGAA 3QHZL 1BEYL 4FFWC 1XR9A 4KJWD 3B3IB 3T2PA 4QEGA 3JV5A 1VHPA 5F7HA 1H3TA 1WGOA 4QO1A 4TULL 1XGUA 1VGKA 4KUCD 4U1SB 3P0VL 4XMKL 3O9WB 4L4JA 3RVWC 2IAMA 1P7HL 4G43B 5A2IH 5A2KH 4PGJA 2VWEE 5E1AA 3RIAF 4HKZA 2DLGA 2VAJA 1QSEB 5DRZB 3RVXC 4KQ3H 1AQKH 1T7ZA 5DK0B 1DBKH 4FFZH 4LLUA 1ZLVK 4OKVB 5C8JB 3KGRA 4FXKA 4FQCH 4TNVF 4LCYA 3I9GL 1EDQA 3MBEB 1BF8A 2AJYH 4LHUB 4G8GA 4L9DA 4R6UA 4IJ3C 4QXTB 4RGNB 1YY8A 3GGWA 5C0GB 3S37L 1HHGA 4X4XB 1T03L 1DBBH 3VGAB 1MFAL 3H9SB 3PWNA 3QI9C 2R0KH 4LLWA 1S7QA 5C0NC 4X6FA 5LBSH 5FUCE 1P1ZB 3RWEB 1CLCA 1ND0B 3X17A 1E4XH 4Z7QE 4N0UA 1IGFL 2VLMD 5KVDH 4FOMA 5EIIB 1D6VH 1ES0B 5KSBB 4L8SC 3VXRE 4A2LA 3WDIA 5IFJB 3VXUA 3KPRA 5FYKE 3WSQH 2ICWI 1VGKB 2DOCA 2HT4C 3B43A 2VE6B 2VABB 3WIIL 3K46A 5C0EB 1REIA 4MJ6A 5CJQH 2X6MA 3MRFB 5CLTA 4HJJH 1U6AL 3T3PF 1R5VB 5FDWA 5E1AB 2HT2D 5CD5D 1WF5A 5K9OA 1W0VB 2W92A 4KDTA 1MCFA 1A3RL 4R97C 4UIMA 3OR7A 1L6ZA 3ULUL 5D2NA 5FYJH 3P30L 2QR0B 1JRHL 5EOQL 3VXQA 4N8PA 4JCMA 3FRUB 4UT6H 4M62L 3OG4B 5L2KB 4YR6A 1RPQA 4MVBD 4NN5B 1J0IA 5EU4A 3T1FA 4JJHA 4GXVH 4LCYB 4LLQA 1NL0L 1B0WA 4FQPA 1P4LA 1NAKL 4G8GB 3TLRA 1AKJA 1MI5E 3GGWB 1AI1L 2DRUA 3FRPA 2DI7A 3HA0A 2MQ3A 1QSVA 1DL7H 4M5YH 5IW3A 3DSFL 2EYTB 2DWEA 5KS9A 1WZ1L 4LQFH 1J1PH 5F88A 3SPVA 3TBVA 4XXDB 4ZPVB 4G9FA 4X6FB 5KN5B 3IU3A 3OAZH 2D2OA 1J05A 1DANU 2EDLA 3MRGB 5HHMB 3VA6A 4MS8C 4G42A 4N0UB 5CAYB 1JHTA 1G6RB 3W9EB 2VL5A 2XTJE 2XY2A 5FYLE 2W65A 4K8RH 5HDBF 3S36X 3CH8A 3NAAL 3FQWA 4Y5YB 3L3GA 4OZIB 2X4NA 3VFGL 5C9KA 3RL1B 3VDBA 4GW4A 3AGVA 1XCTA 1FE8L 1EERB 3HZMA 5B21A 4OZFA 1IILE 4MJ6B 1N64L 3ZKMC 4OQTA 3DUUA 4XPTL 1YNKH 2V9QA 5GRWA 3QFJD 1A7PL 1PBYA 1C5DB 5DVLA 1NGQL 4MB4A 3V5DA 1Z9MA 4NQDA 4G7YL 3U0PA 1LMKA 3ULVF 4K94C 3OB0K 2P47B 5E8OB 5HDOA 4YHLL 3QIWA 1BFVH 4FQXD 1V7MH 1NGYB 1RZGA 3D25B 5DVKA 4H20H 1N4XH 2R69L 2NY3B 2QQNL 3CDCA 1G7HA 4R9HA 4I0PD 2YWZA 2NY2D 1I8MB 4JGJA 5F93C 4KZEL 1LE5B 1YYML 1C5BH 3NACH 1YC7A 1HI6B 5INCB 5GGUB 3ARED 4GKZA 3SKMA 1EGJH 1DQTA 4K3EL 3QIUC 1ZANL 1IAOB 5CIPA 3CVIH 3NZ8A 1TZHB 2C9AA 5TDNA 4GRMB 4HSQA 5KS9B 2VL4A 3TBVB 1XF5A 2IFFL 3IU3B 4PJEB 2EDHA 1S5HA 2C3WA 3L3IB 1G9EA 2VL5B 1L9MA 4HHAB 4CDGC 1UKQA 4JKWA 1T2QL 3KPNB 3UX9B 5J6GB 1BD2A 3NZHH 3NFPA 5L8JB 1JGDA 1AY1H 3L5WA 4O2EA 3O3AB 4JKKA 1WC7A 1HHKB 4X8XA 2LE9A 2X1QA 2FB4L 4OLYL 5FUZL 5TE6L 4HS3B 3VRIA 4GW4B 4OB5L 5GRUL 2FH8A 3ALXA 4OZFB 4CVXB 2CKBA 1A4JA 1I3UA 3RUGA 4OZ4A 4HLZH 1H3XA 1DQML 4XTRD 5HHNB 3DUUB 3CFKA 2IGFH 2P42B 3GI9H 4M5ZH 1U93B 4CUCA 1S9YA 4KK9D 4WFGD 4ODXA 4Y4KC 4PRPB 4NQDB 3QCUL 5L6YH 5E00B 4D0CB 1MCQA 4Q6IA 4JO3H 1GHFH 1G9ML 1VACA 4PRIB 1QLFA 1JZ6A 3MNZA 2YS4A 1M6OB 3CU1A 4UTBL 2X44D 2BY1A 2IJ0C 5F7YC 2GTWB 4AH2A 4P23D 3FN3A 4XPGL 4I18C 4OZGB 4KI1A 4U1HA 2Y7QB 1JF5A 5E6ZA 1WEJL 3VFSA 3SKMB 4OGAC 4RFOH 2Z92A 4JO2L 3AS2A 2WUBH 4ZUSA 2GSGA 2I5YL 1CFQA 1L0YA 1SMOA 2E9WA 2GCYA 3Q48A 4N1CA 3PJSA 4XHJC 1XF5B 5A40E 3WJLA 3HI1B 1U8NB 2I26N 1S5HB 4ONFL 1G7MB 3KDMB 1IGML 2Q7NA 1G7LB 1JPGA 2JIXB 4XAWL 5EO1A 1JGDB 2C1OA 4IMKC 2ZCHL 5MI0C 1VFOA 1QR1B 5AD0A 3U0WH 1MWAB 4JG0H 1D5XB 5GJSH 5KVEL 3CLFH 5CINL 4ONOA 4X5WA 2QQLH 4OD2B 2CKBB 3TO4D 1ORSB 4Y1AD 5DUBA 1Q9WA 3DYPA 5D93C 4HS8H 3PP3K 5GGQL 1DJSA 3IDJA 3HE6B 4FP8H 3T3PE 4Z6AT 2A74A 1I3GL 4PJ9D 1K2DB 1E4KA 4RWYL 4Z78B 5ID1B 5IHZA 3ARDC 5IW1B 4XP6L 2EKJA 4TOYH 3VH8G 2YR3A 2EECA 2DD8H 2OL3B 2XA8L 2VC2H 5C07B 4XVSL 5E9DB 4KUZL 1F5WA 1EHLH 5DEFB 3RU8L 2B0SH 4WW2B 1KXTB 3QDGA 1ULVA 5DSCA 1JE6A 3RTQC 4QKXB 2Z4QA 1ZLUK 4I2XA 1I3RA 1KSRA 3AY4A 1C8PA 3HI5H 3PWPD 2XWTB 2ZJSH 3HC3L 2PR4H 4UMGA 1KIQB 5H37H 2P7TA 2GCYB 5BOPA 1EFXB 5I1AA 4HWEL 3EW3B 2I27N 3LKQA 4JDVB 3X14B 1TQBC 3BWAB 1FGNL 3BVNB 3VE0A 4ODUA 4PG9B 3LKRB 1KJ3L 2C5DC 5D7LA 5FOJA 4Q9QL 3QG6A 2QL1A 3D87B 5EORL 4JQVA 2HYMA 5C0AE 4XMPH 5E0QA 5HYIA 4Y16A 4N8VG 1F4WH 5AD0B 2VDML 5EU6B 3HNSH 4MCZA 3ULVC 3MUHL 4F57L 5DHXB 1OTTD 1JNJA 5GGVL 3CFDA 1Q0XH 3LB6D 3JVGA 1TXKA 3QNZA 4F8QA 2BNUB 5K9JL 3GHEH 5F9JB 4KKAD 4RAUB 3C08H 3PNWA 3AC0A 1GC1H 4GUPB 4PJXB 4PP1C 1BAFH 2J1KA 3BKJL 5H37G 1AC6A 1U2HA 4KVNH 1U58A 4X7TB 5IHZB 3C5SA 1NUNB 1S7SB 3V52H 4RMWA 3K2UL 3E6HB 4FFWD 4Y19D 3EYVA 3IDNA 5ENWB 3UTSD 2FATH 4LLDB 4OAWA 4OIIH 4U1JA 4LKXB 3GFUA 4TUKL 4MHHI 7CGTA 3QDGB 5DSCB 1YY9D 4FZEH 3OGCB 3BH9B 1LDPH 3ALPA 1X5YA 3VCLB 3LHPL 3TIDB 3LSOA 3GSNA 3HKFA 2YD7A 3HNVH 4H0HB 4HH8A 4JRYD 2OTUA 4EI6A 5I1AB 1F3JA 2R1WB 2Z91B 4MNQE 2APFA 2WBKA 4XT1C 5D1ZB 1FYTE 3TN0D 4JZJA 1UZ6F 2ZUYA 4QXUL 4XAKE 1JPFA 4ODUB 5K59F 2HLAA 5BQ7A 5T1KD 1AXSB 1MCNA 1YEKL 4HPYH 3T0XA 3TZVA 1EV2E 1D3CA 1MRCH 5D1QD 5IBLD 3WN5B 1E6OH 2PYFB 4Y16B 4MD4B 2AEPL 5LAXA 3MV7D 1RUAH 4MCZB 1FVDA 2QSTA 3WXWH 4OZIF 1JRHI 4JDTH 1JNHA 4URTB 1BEYH 2IQAB 5F89A 1NGWA 3S5LG 1KOAA 4JFEB 1GZQA 4DCQA 3DNKA 2H8PA 5HHOD 3LQAL 4FMFA 4TULH 4M43L 1N2RB 3P0VH 5C0ND 4XMKH 2UWEF 4KROD 3O8XD 4MJ4A 3RZCA 3V6FA 3VFOA 1CR9L 4OKDA 2FJFB 3K80A 3K4DA 5GSVB 4E9LA 1MEXL 1XIWB 1NEZG 2XXMB 3BPLC 3VXSD 2ZSVA 5CMAA 4OAWB 3UTQA 2DWDA 4A6YL 4ZSOA 1TVHA 5B4MC 4PRNA 3DMMA 3EZ8A 2DMBA 2AXFA 4EI5C 1AQDA 2YEZB 3HAEA 4UILH 2V9RA 3LY6A 4LNRA 3ZE0E 4Z7OF 3LSOB 3I9GH 3F7QA 5J1SC 3SE4A 5D5MF 2D4DA 3GSVA 1F3JB 4X99B 4OF3A 1KJVB 1T03H 4H1LG 3L3OA 2ICWJ 4JZJB 1MFAH 1MHPL 4F7EA 3FB8A 5JXAL 1A4KA 4PJEF 1KV3A 5BQ7B 3CZFB 5BS0D 2J4WL 3UP1A 4PP2B 4YX2H 2E9BA 3TZVB 4AEEA 1FG2A 2Z9TA 3VFPB 3HPJA 4U1IB 3KXFA 4X7SL 4ZDHA 1G9NL 4NT6B 3OKNA 1LE9B 1N59A 3OKEA 5I9QB 1U8LB 1JNHB 2NX5E 5I74C 4DW2L 4HIEA 4L8BB 2H41A 4JZOA 3OBAA 4UUJA 4DCQB 5D1XD 3QIBA 1QHOA 3SCMA 1OCWL 5T5NF 3MBEC 5IQ7H 5DJCA 5FK9B 2R15A 3OXSB 2ZZUT 2WLZA 3WIIH 2BRQA 2FDBP 1UZ8A 1S9VB 4JDZB 3WFDL 3H3KA 2R39A 4MS8D 3VGAC 1U6AH 3K1DA 3VD5A 1E27B 1JP5A 4PY7B 1BVZA 4M61B 5F9DC 2BXZA 2Y06H 3DX6A 1A3RH 5ERWB 3RWIA 2ZSVB 5I76B 1CD0A 4JHWL 4CDHA 5DRNA 3ULUH 1TVHB 3P30H 4PRNB 4LF3A 1JRHH 5EOQH 1RZJC 1PFCA 4OZGF 3RGVA 4DK3A 4M62H 2BVEA 3SDAA 4IMLA 1WBZB 2I07A 2EYRB 4QOKE 2GJZA 5I1HL 2Y36L 4RZCA 1J8HD 4RGNE 4BM7A 1NL0H 4HKJB 1NAKH 2OQJB 3GSVB 4ZMAT 1FPTL 1TJGL 1KXVC 2VDQL 5T3ZD 2LAAA 5FGBA 1C16A 3FB8B 3G5ZA 3JV4A 2IAMC 3DSFH 4B50A 1CXEA 3GMNB 4JHZA 4CKVX 1WZ1H 4M7JH 1N5AA 5D2LF 1FG2B 1JF1B 4WFFE 2JE8A 1A7NH 3KXFB 1T7WA 1C08A 1PQZB 2OTWA 2MJWA 3OKEB 1MPAL 2DQTL 4P9MH 2FL5B 2ADIA 3SDYH 3BD4A 1JNLL 2BNRE 1KN4L 1A6TA 2AK4A 2CR6A 4AL8H 4NN5C 5HDQL 1XF3B 5HY9A 3VFGH 3I85A 3A67H 1EBPA 4JJ5A 5KZCB 1FE8H 2X1OA 4Z0BH 4PGDA 4X4ME 1WVZA 2OJZH 2Q76B 2JF1A 4XPTH 2IBZY 1A7PH 1NGQH 4KKLC 4G8IA 1S5IL 1T0MA 4G7YH 2P8PA 1RZFL 1OGAA 3OMZA 3L3HA 5L2KE 3RGVB 1VFBA 2QLVB 1MFBL 4IMLB 1XR8B 1WJ3A 4WW2F 1EHXA 2R69H 2QQNH 4WUUA 4L3CB 3MOQA 3BSZH 2EEBA 4Y5YC 3PABA 3EDJA 4KZEH 1YYMH 4H0GA 1NJ9B 3DXAA 3T04D 1UWEL 4KWUA 5LGJB 3G5ZB 3DBXA 4KRMB 1U3HB 3U4BL 1UZ6E 1TZGL 2V7NB 3LV3A 1BX2A 1F13A 1QQDA 5BO1L 5K59E 1CFSA 4KDTC 1KGCD 2IFFH 2XPGB 3MSPA 1A9BB 3HLAB 3O6ML 4U2YA 2DMKA 1F6FB 2OTWB 2WANA 3U2SA 1C1EL 1YMMD 2DL9A 5IIEA 3JTTA 2ED7A 1BFSA 3BDXA 1T2QH 2N4IA 1ZHKB 4OZIE 4C83B 5F8QC 3MROB 1A6TB 2YZ1A 2CO7B 1KJ2A 3IDMB 4YGAB 1YPZA 3FO9A 5HY9B 1RZ8B 2E3VA 2YBRB 2F5AH 2AKRB 3MTRA 4OLYH 2FB4H 5FUZH 1HWHB 5TE6H 4OB5H 2IANA 5FA3A 4MMXC 3PF2A 3RIFK 1OP5K 3QQ3B 2VLME 4YDIL 1DQMH 1U8HA 2UWEE 3EO0B 4DN4L 2ICEB 1XGQA 4M4RA 1OARL 1PAMA 4JY5L 4NM4L 4LLYB 1BGXL 2AAVA 5I8KL 3U6RB 4MDJA 1JZ8A 4HK3N 4NDMA 3LEXB 3QCUH 4H88L 1EAPB 4UBDC 2LU3A 2YPLD 4PS4L 3QHTC 1OGAB 1OTSD 3D3VD 3QNXB 1G9MH 1MJJB 2YC1A 3PWJA 2DMCA 1YNLL 1BHGA 5J12B 5HI3D 4UTBH 3Q1SH 3BZFB 4POZC 2IF7A 4NRYB 3S35L 3V5KB 2CLZA 5CCKH 4Z7OE 2K7PA 4M8QA 4Y5VA 4NQCD 4YBQC 5D5ME 3WUWG 1KIRB 3DBXB 4R4BA 4JO2H 4GG6F 3FB6B 3BH8A 2B1AL 2I5YH 2R9HC 4KRPD 3SDXB 5C2BH 4UIKL 2WBJD 1BX2B 5FV1L 1TQCC 1VKXA 1P4BL 3HZKA 4PJEE 2ED9A 2ESVA 4U1NB 3UXFA 3VJ6A 4ONFH 3GBMH 2EDJA 3CU7A 4J1UA 1IGMH 1BBDL 1KNOA 3ILPA 3QDHA 4XAWH 3I2CL 4ETYA 1H8NA 5ETUA 1JGVL 4LPXA 4R4NC 4JGUA 1NGXB 1I8LA 2ZCHH 3VA2C 1KB5L 1BQSA 5IV2A 4YXKH 3P4NB 1ADQA 2HJLA 4EXPX 1IAMA 5CHNB 5KVEH 5E8PA 5CINH 4K23L 2IANB 2JJVA 1M4KA 5AUMB 2R23B 2GY5A 1OWWA 3IETA 5TH2A 3IDGA 3STLA 3FOMA 1DE4A 1A3LL 1G7JA 2FH6A 3N0PB 1Z9SA 1JI1A 4PREB 2P45B 2DJ4A 3P4MA 2G60L 2OI9B 3P73A 1I3GH 4RWYH 5I19L 1X3DA 4XP6H 4PRIE 4CNIB 3BEVA 4FXGA 3EJYC 1IC1A 2YC1B 1OHQA 4GG8B 2NY4D 2XA8H 1T89A 5CZXD 3D0LB 4XVSH 3K8LA 1CDHA 3QFJE 4KUZH 5J4MA 3FFCA 2A73B 4KJQC 4M1CD 4U2ZA 2MSPA 4WI4A 3RU8H 1IM3B 3BQUD 4M8QB 3PL6B 5IVZA 2IH1A 4F7PA 3OF6A 2WWKT 3O3UN 1MIML 1LP9A 3BH8B 4BZ2L 3ARBB 2GW5A 5MHSD 5JZ7C 5TQ2H 5E2JA 4NSKA 1VKXB 3R8QA 4HWEH 2P5WA 2F54B 4ZQKB 5GISL 5DA4A 3HE7A 1FZMB 2J88L 3HE6C 3GRWL 5D2LE 1FGNH 3SE3A 1KNOB 1KJ3H 4Q9QH 1JYWA 4HUKB 5F44A 5ETUB 3ZYZA 4WFHE 1CXFA 3O2DL 1FORL 1SJHB 1LK2A 4LLMB 3EOBA 5T3XE 2VDMH 4RMQA 2A1WL 2NXYB 4F57H 3QUMA 5GGVH 1FZOB 3WE6B 4HG4K 3FT4B 4WW2C 2MCPL 3MV01 5K9JH 1DE4B 2APVA 4AT6B 2AK1L 5KVFL 4PJFF 3BKJH 5HGDA 1CFTA 5EOTB 3HG1D 4O2CA 1S78D 3WKNA 3CX5K 2RAMA 5JORA 1NC2A 4Z7WE 3MREA 4ZAKA 4M8VA 5I1KH 2CIIB 3GBLA 5J3HC 5GS1A 5E9DE 2GIYA 4XBPB 3PWUA 2X41A 3EFFA 3FFCB 4WFGE 1HYSC 1PW3A 1WWAX 4TUKH 4GAGH 5I1EL 3BPNB 3OZ9L 3U0TA 3LOWA 1LEIA 3T77B 3CCHB 3LHPH 4R3SB 1A8JH 3Q6FA 1K8IA 3C6SA 4XVJH 4RA3A 1Q0YL 2LVCA 3NN8B 3CVHA 1M7IB 3C5ZA 3RKPA 3HE7B 4QXUH 1KCRH 1J86A 1X4ZA 2W9EL 3F7YB 5IB3A 4LSTL 1QRKA 4AMKL 5IBTL 2XWBA 3OX8A 4XCEB 2WSKA 1B4RA 2AEPH 1F42A 4P5TD 3MRMA 3BRGC 3X13A 4L4VD 3GUTB 5EG6C 4TUJA 3WEXA 3RWHB 2VSCA 2HN7B 3BXNB 5IHBA 4R8WL 2UVEA 4NQVB 1FO0L 4LRIC 2LTQB 1KENL 4MGXA 5EZJA 3LQAH 4M43H 4X7FC 1S8DA 4S1RL 1CVSC 4BFIB 2A6IB 2NTFA 3MRLA 3GMQB 1ACYL 5FAAA 1BZ7A 4U6XB 1QACA 5D1ZC 5BRZD 5IJKA 1NFDB 1EVTC 5LWYH 3SDCB 1YUHA 1G6VK 1CR9H 5IHLB 1KTLB 1CZ8L 3EKCA 1MEXH 3MNWA 5IUSA 1HXYB 3JWOC 4Y1AE 5A3IC 5LCVL 4LSRH 1JHKL 4JQVC 3SY0A 4P4RA 4HIIB 4A6YH 5DD0H 3WN5C 4DKAA 3WDHA 4Y16C 1IKFL 2B39A 1A6VH 1DLHA 5EO9A 5HHXL 4LPYA 2XKSA 2ZCKL 5EUKA 4D3CL 4EEEA 2GY7B 2GK0A 2NR6D 1DN0B 5C09B 5IWLA 3JVGC 2DQIH 1KT2A 1XFPA 2FIKB 4GG6E 3WMSA 3OKDB 3EDKA 4N5EC 4U3CA 4X9HA 5JXEA 5JXAH 4LCWD 3NFSL 1PEWA 4O2FB 4OF8A 1RFDL 2J4WH 5JOFA 3FMGL 2XWBB 3FFDA 5JHDA 4PYHA 1XEDA 2VXVL 2XN9B 5MP6L 1XIWC 4NGHL 1UM4L 4P2QA 3U36A 2N7BA 4X7SH 4KKBD 1WSST 1G9NH 2F8XC 2HA1A 3MRMB 1SBBA 3UTOA 3X13B 1RZJL 4TUJB 3T8XB 1UM6L 4L9LB 3RIAK 5ANME 3MFGB 4ELKA 3G5YA 3KLHD 1B9ZA 1U8OB 1JWSB 2IAMD 2X4UA 2HFGH 1WFUA 3BMVA 4YQXL 4PJDA 5CGYD 3AAZB 1K8DA 1S8DB 1D5BA 2R29L 3Q3GA 4YE4L 3B5HA 1AO7B 1UQSA 2V17L 3WFDH 4TNVK 5C08B 4W81A 5DEGA 4CW1B 4JZJC 3O3DB 4ENED 1I8KB 1I7ZA 3BT2L 5GS0C 3WS3B 5DJYB 5HYJA 5FFLA 5FYKU 3TZVC 2X70A 3PGCA 5TF0A 4JHWH 4P5KA 3I50L 3CX2A 4WEUD 4ELMF 5T1DL 1CICB 4LEXL 5KVGH 1BREA 1J9CT 4WO4A 3S36L 3EDDA 2Y36H 3OAZK 1F3DH 1AD0B 4OT1H 4P4KB 4BUHA 1VADA 1BFOB 1FPTH 1TJGH 2UUDH 1EH9A 2VDQH 2BMKB 3ROOB 4KKLD 1WK0A 3O45A 4Q9CA 3MLWL 1A7RL 3V6OC 2EDQA 3JV0A 5C70A 3F5WB 4WWKD 4ALAL 5FECA 5JPMB 5T3ZH 4JM2B 4R26L 2OS7A 5CJXC 2EDYA 1QFWM 3HZVA 4NO2A 1PLGL 3RQ3A 3VXUD 3KPRD 2AQ2A 1MPAH 1GGTA 2DQTH 4JQIL 1G6RL 1GAFL 2P49B 1XGYL 4S1QL 1C12A 5I0DA 1Y0LB 5F3HA 2FBJL 1KN4H 5FF6B 5HDQH 2HTLD 2NLJB 4PJDB 1NUFA 3RX5A 1DUYB 4N0CD 2VZ1A 3BP4A 3MV7E 2BY2A 4PJFE 1YN6A 2D7TL 3RBSA 4LCUB 4K7PL 3VWKB 3C5JA 4KMQA 3O41A 4NCC1 5HYJB 3I3EA 2X4RA 5HHOE 1S5IH 4P5KB 4U3HA 4XP4L 3MRPA 3MX0A 5BZDA 2LVEA 1RZFH 1F6AA 1WCBB 3QDJB 1AKJD 1MFBH 4JREB 2J8OA 4I3RL 4R2GB 1OP3H 3TNNB 4XNMA 3HNTH 1AHWA 3BZEA 3QIBC 4HIJB 1CDBA 3VXSE 2EXWD 1T1ZA 2PXYA 4I4WA 4JN1L 1UWEH 2EDRA 2ILLA 1IC4H 4G9FD 4BZ1L 2EO9A 3HR6A 3U4BH 3DX7B 3C8KB 4QGTA 4IRZL 1TZGH 2IBGA 2HLFD 3MRBA 3HPLA 1UXWA 5BO1H 5DYOA 4GBXB 1I1RA 3WJJC 1CT8A 2CDGA 2P8MA 1L6XA 1OAQL 1RQ5A 4U1GB 1C1EH 1CFVL 3B9EA 4YC2B 4PJCE 3RDTA 3RGVC 3WFCL 2I60L 5BS0E 3UPRB 1TVBA 1HH6A 4YDVB 1YC8A 3QPQD 4RIRB 2R9HD 4M6AA 4XCFL 5I75B 1RHHB 5I8CA 3WFHA 1RZKC 5H8DA 4UINL 1GVIA 4JRXB 3EYOA 3BP7A 2GT9B 4YDIH 4PJ7B 1HHJA 2D0GA 3BO8B 4OQTL 5I2IA 1OARH 3B9KA 4JY5H 4GW5B 3MUGA 1U3HC 4PJBA 2EIBA 1MCPL 3PWVB 3QIWD 1JK8B 1P7KA 3VGBA 4H88H 1DQQA 4ZUUB 5JIIA 3DTXA 2AW2A 4NZTL 4IM8A 3MRJB 1YNLH 2DQFA 1ZT7A 3MV8A 5ITBL 1T21B 4XNMB 3S35H 3EIFA 2LU7A 1TCRB 3DO7A 1CE6A 2HRPL 5FB8A 4ODTH 1T6VN 4I4WB 1A0QL 1CWVA 3CMGA 1QRNB 5D96C 3LKOB 3DGGA 2B1AH 1PKQB 2DKMA 2V5YA 4UIKH 12E8L 1EK3A 1P4BH 1VESA 1J8HE 1T4KA 2D9CA 1YQ2A 1BD2D 1MELA 3TBTB 3Q5TA 2CDGB 4OCXL 2XFXA 2PO6D 5T3ZE 1BBDH 1I9RL 1R3LB 3MRCB 4FABL 3AUVA 3I2CH 3FQXB 1JGVH 4H5SB 1ZAGA 5J12C 5DHVB 1KB5H 1AXTL 2AJZA 4PR5B 5JIKA 4DKEL 3KPSA 4TYUA 2ATPA 4JE4B 5SWZB 5I8CB 1QO3A 4K23H 3WFHB 1T20A 4UZGA 1WAAA 4LVOC 2ZP0T 2CKBL 4WJ5B 3O4OB 1A3LH 3VFMB 4PRHA 5TFSL 1PYWA 2DM7A 4PJIA 2PF6A 3QZWA 4JANA 2G60H 3WV0A 2C7UA 4N0YL 3GJEB 2EDBA 4E5XB 3SE8H 5I1LA 5C0BB 1YDPB 1AP2A 4U1KA 4M48H 1S9XB 2KBGA 4HFWB 1DN2A 3MA7A 3U83A 4ELME 3NTCL 4GXUN 1FNGA 1J87A 2RFXB 5DD1L 1DANT 2A0LC 2F53D 5CS7A 3ZE2F 5ICZA 2DTML 2P5EB 4P59L 5FB8B 1SY6A 4POUB 3MRNA 2APTA 1IEBA 4QNPF 1MIMH 5EBMA 2FNBA 5EBWB 4BKLA 5FGRA 4JFZH 1JYNA 2J8UB 2CJUL 5GISH 2W0PA 1N6QL 1KCSH 2J88H 3GRWH 2OI9C 3L3JA 5DQ9B 2XFXB 3ZDZE 1NFIA 2C1PA 2IPUK 4M03A 3UZEA 3WFEL 3O2DH 1FORH 2CUMA 2A1WH 1KGCE 1NC4B 1OAUL 3UBXG 1T20B 1XF4B 1I8IA 3H0TB 4RAVA 2XA3A 2BVPA 2J2ZA 1RIUL 2MCPH 1KB9K 1YMME 4X9IA 2YD1A 1QSFB 3PL6C 3SQBA 1QA9A 1PYWB 2AK1H 2EIDA 5KVFH 4PJIB 1UWGL 3ARBC 4I48B 1MCHA 4OD1L 1JWMB 3QCVL 2YRPA 4JANB 4PUBL 4JVUA 4MQ7B 3FTGA 3T3MF 1U3JA 3VXMA 3EAKA 4L4TB 1U8JA 3LN5B 1MH5A 3ARGB 1NCAL 3HZYB 3SDDA 3PDOB 1IARB 3QO0A 3IJHB 4MX7A 4HK3J 5EU7E 3T0AA 3WO3B 4YHIA 5CWSA 1I8LC 5I1EH 4QRUB 3UTTA 1L7TL 3OZ9H 3R06A 5ISZA 5DGRA 1YA5A 1IEBB 1ZHLA 4M3KB 4TUOA 1BFTA 3QUXD 4CU6A 1BBJA 3TF7C 2KDGA 4HGWA 3O6KH 2F54E 2H2SD 4EDXA 5D7LD 1C5CH 1Q0YH 1F3DJ 1K4CA 4TNWK 4JM2F 4XVUC 3L3JB 4X4ZA 2H45A 2DLHA 4BSWA 2W9EH 3MV9A 4M7LT 1Q94B 4LSTH 3SHSA 4AMKH 2V2TA 2ADJA 2NY1D 5IBTH 2AXGB 3EUUA 1AGDA 5DJZA 1T0PB 3CDFA 2YZ8A 3MR9A 5MEPB 1T89C 2B1HL 3EO9L 3I6LD 4XNQB 4K7FA 4ZNEE 2YD9A 4M6NL 3ARYA 2X4OA 2YKLL 3RGHA 4Z77A 1H0DB 2FR4A 3BPNC 1GCFA 4GH7B 2IADB 4R8WH 2C4FU 5I30H 3IFLL 4OLUH 1FO0H 1OQXA 1KENH 1BZ9A 1QA9B 3MJ7A 5D6CA 2H32H 4S1RH 1IZJA 1R3KA 2J7LA 3VH8A 1ACYH 1TITA 4OFYA 1MH5B 5CZVL 3HE7C 4XRCA 1VERA 4IDJH 1AD9A 3HB3C 3SDDB 1CZ8H 2ZKHL 4I1NB 1Q9LA 1S9WA 5JHLL 5LCVH 4UV4H 1JHKH 3KPLA 5MEOA 5I8EB 2NY6B 5A1AA 4M9OA 1LK3L 4KK8C 1OQOA 5E8NA 3QNYB 4MXVF 1IKFH 1NAMA 3OJMB 2R4SL 5HHXH 4S2SA 5DJAA 2ZCKH 4D3CH 3MFFA 2BVOB 4KDVA 1T1WA 1LILA 3GSNL 4QWWD 1F58L 4PJGB 4XCYB 1OW0C 4LCIL 2DM4A 4LVEA 3W39B 5C86A 4KKCD 2VLJA 2Z31A 3RJDA 5GS0L 1RFDH 3KLAA 3SDCC 3FMGH 4XGZB 5FKPA 4S10A 2VXVH 3MGTA 5MP6H 3L5IA 4LU5H 3ESVF 3QUXB 4DN3L 1I1YB 1MCRA 1IJ9A 4E41A 3KLSA 4K7FB 3TO2B 3DOSA 1UM6H 3WL9B 3IXAA 2X4OB 4Z77B 1D9KD 1KCUL 1A6ZA 1BIHA 3QJFB 3RZCD 3MLTA 3KJ4B 4YQXH 2KZWA 3D39A 5DR5L 2R29H 1R3KB 3Q5OA 4MA7H 4UNVA 4LHUG 5I1DA 2V17H 2VDKL 3L7FA 1HSAB 2ITDB 4XRCB 1KG0A 3S97C 2KUTA 1S7UA 2IPKA 3CZJA 4OBSA 4GRWH 4WI7A 3BT2H 4Y4FB 3L3DB 3DMMD 4LSVL 4CMMB 5DRXB 4GAYA 3LRHA 3I50H 4GJTB 1Q1JL 4TSCL 4ZFZB 3WKML 3ZHDA 2Z8WC 5T1DH 4LEXH 4X6DE 2J8HA 4FQHB 1FCGA 3NIFE 4X6BA 3BAEL 4LPUA 4S2SB 2W9LA 3HG1E 3S36H 3DVIA 3MLUL 4L9LC 2NW2B 3ZE2E 2PUQT 3TT3L 3FHAA 3QUZA 5T1MB 2EDKA 2E7MA 1DVFB 1T1WB 5IMMB 1J5OL 2GJ6D 2M8XA 2VKXA 3IAQA 1ZSDB 3KPOA 3H9YA 2ITCA 2AQ1A 3MRQB 4QNPE 1ODAA 2ARWA 4KHTL 1AGEA 3ZSSA 1VPOL 1FL6A 3BMWA 3BPCA 3MLWH 1A7RH 1U42A 4ODWB 1WWBX 4ALAH 1BVKB 4XC3H 2FZ3A 4P46B 2XN9E 1FN4A 3MGTB 4R26H 1T5WB 1PLGH 3TYGH 5FM8A 4WHYG 4MXQC 3F7PC 1D6EB 4MQXD 3QIBD 2CD0A 3IXAB 4JQIH 2M1KA 4WVRA 4O51A 1CICC 3S5LA 3SCMD 1XCQB 3FQRA 1XGYH 2MMXA 4S1QH 1FL3B 3M17A 4F2MB 1CDJA 2FBJH 3ROLB 3VMPA 5HHQA 1T2XA 3GMPB 1EUTA 5IWLC 1MQKL 4JQXC 5H94A 3TWCH 1ZWIA 3DIFB 4GFTB 1MVUA 4HUNB 4P4KC 3MZTA 4L8CB 3K3QA 2D7TH 1BQHB 2H6PA 1NEZA 2IMMA 3T3ME 1U8MA 1S7UB 4K7PH 1XGPA 1FIGL 4O4YL 2PW2A 5KG9A 5JQ6L 1HWGB 3SDAD 4FTVB 2EXYC 4XP4H 3P0YL 3ZT6A 5J6HB 5C0CB 35C8L 4X6BB 4HBQA 1FV1B 5BRZE 1YNTA 2YUZA 2BC4A 5F8RC 4I3RH 2W59A 3QUZB 4IIQA 2XYCA 4OCMC 3WHXA 4W6YB 3SKUD 4RA0C 4H1LA 5EIQA 2C3VA 3VFNA 1RZKL 1RIHL 4FFVD 5E2TL 1FL6B 3QEHB 4JN1H 1ZA3A 3BPCB 4MHHG 5HYSB 2HT3C 5F9OL 4ZXBB 3REWA 4BZ1H 5GZOC 5INDB 4J4PC 2R4RL 4IRZH 3PGFL 3GMRB 3RVVC 1JGEB 5L8LB 1TNMA 5B3NA 4XCNB 2Z8VC 1P53A 1IGJA 3FHQA 3MNVA 1CXIA 3OKYA 4QHNB 2AK4D 1OAQH 1CFVH 5F1OB 1IGCL 1H15A 1P5VA 1IAIL 2BSTB 5ECJE 4LCWE 3LCYA 3WFCH 2I60H 4JREC 3LRSB 1MJUL 3NVQA 3LN4B 2VH5L 4PLJC 1TENA 3ARFA 4XWGL 5H94B 3EJJX 1ZWIB 3G6JA 4UINH 5IGXL 2I25N 3DLQR 4QT5B 4GKNA 5FO9A 3UO1L 3RUGF 3FRPG 4OQTH 5DURB 3V0AC 2Q8BL 3QHFL 1FGVL 4V2CB 4RDQF 4HMDA 3PV6B 4GRWE 5EUOA 4NZTH 1R3JA 4WUUD 3VRJA 1A02N 4U1GC 32C2A 3VI3F 1DQLL 3DXAD 5M95B 5ITBH 3C60A 5KSVB 2GKIA 4XPBL 2HRPH 1UACL 1KJMA 5SWSA 5I75C 1A0QH 3U7AA 1VFAA 1I9IL 4MAYA 2WWKO 4I9WD 4OZFG 5CIPH 4ZODA 12E8H 2XZZA 3E8UL 4IRJD 2ZPKL 4MNHA 4WIQA 4JY6A 4YGVB 4FXLA 3I6GA 3FT2B 4OCXH 2G75B 3PG2A 1I9RH 3QQ4A 4FABH 4J8RA 3JV6A 3K8KA 5HJ3A 1ZGLP 4Q6YA 4E0RB 2V2XB 2ZCLL 1DDHB 1AXTH 3G9AB 3EJZC 3I75A 4DKEH 1KJ2L 2EDOA 1F4AA 5DFVC 5IMOB 4NO5A 1OAXL 2CUHA 5MENA 4CAGA 3G6DL 2CLRA 3VXUE 1UWXH 4GW1B 3RY6A 2CRYA 4I13B 3FB7B 2XQBL 3RKDD 4JFQA 5TFSH 4QHKI 4OLWL 2V2WB 4LDEB 2JK5B 1YEHL 4N0YH 3U48A 4YPGA 1LQSR 3DI2B 4ZTPH 4J23A 3I6KB 5EUOB 5IFAL 4Z7UA 1B0RA 3BW9A 5DMIL 2QSVA 4RRPA 3NTCH 3O4LB 3B9DA 4M4PA 4HV8A 2D7OA 3RWGA 3ZMRA 5D2NE 5DD1H 5DZOA 3QXVA 2R2EB 3UJTL 3DSNA 2DTMH 4KK6D 4P59H 1KPVB 5FOBB 3GBNL 2VITA 5ESAA 3S37X 4PJGF 4DGVL 3T0EB 4KI5D 3MMEA 4O58L 5D72L 4YO0A 1PKQE 2ESVD 5HD8D 4OM0L 4NC1C 3GKWL 1NANH 3EHBD 4LDOB 3U46A 4MJIA 4MD5B 3NA9L 4MNHB 3B9KC 3H7BA 3MLVL 1FAKT 2CJUH 1E4JA 3RP1A 1N6QH 3P9MB 4TVPD 4TSBL 3VFVA 4P2OA 4TTGA 2J6EA 4ERSL 3SGJC 4G9FE 1UM5H 5T1LB 4YNYB 3F6LA 1A3QA 4TVPL 5CJOL 1ADQL 4NO5B 3UZQA 3ECBA 3GJFA 3N50A 1RIUH 4Z5RB 5J1AB 3D85B 2HVKA 3WNLA 5IMLA 1NBVL 2JTDA 3DARA 1UWGH 3QCVH 3TESA 1EXUA 3LDBB 3ESUF 4WV1A 1NCAH 1S7RA 1B0RB 3T65A 3SQOH 3ZKXB 4BH8B 2DBLH 3S3PA 1CIDA 3BW9B 4XI5D 3T2OA 5EC2B 1RK1A 2R8SL 4GKOA 2EE3A 4YH6A 4HEPG 2NW3A 1FZJA 2MOVA 1ED3B 4V1DA 1LO4L 2OSLB 4U49A 3WUWA 2PCPA 1E28B 1WISA 4P2RA 4IS6A 3CH1A 3MA9L 1L7TH 2FLBT 3OJ2C 3MMEB 2P5WD 5CBEB 4UU9B 2WW8A 1MLCB 2PYEB 3OG6B 4GSDL 2FSEB 2HMID 1YEDB 2A6JB 1IC7L 4HEME 3H7BB 3JXAA 4JFFA 1L0XA 3WLBB 1GGCH 2X05A 1ZT4B 2HFFA 1H9VA 5KW9L 4P2OB 2XWJA 3V7AG 3IGAA 2VUOA 3ZT7A 3ARGC 2XXCB 2FWOA 2R1YB 3FB5A 3FQUA 5HVHB 5IJVB 1PZ5B 4ZUWB 5GGRA 4JFDA 3IFPB 4HFUL 2BFVH 3ARZA 3RWCA 2P8LB 2B1HH 5HGAA 2WNGA 5JW5A 4K2UL 1U91A 3QUYB 3MLSL 4JZNA 4M6NH 4KFZC 1BD2E 2YKLH 3QUML 2NZIA 3QEQB 4HH9B 1MJ7H 4Y2DA 1A7OL 3IFLH 4PV9B 3S34L 2FEEL 3HC0A 15C8L 5DRWA 2XZQL 5IMLB 2BSRA 4HWBH 3RUGE 5AYQA 4Q9RL 1NC2D 5E99L 4ZAKD 4G8FB 1Q9KB 4M93B 4JFPB 5K9QI 1YJDL 5C0FB 1T5XA 4NRXA 4F7CA 4AEHL 2ZKHH 1ZVHA 5LGKA 5LXGL 3AXLB 4JG1L 2WINA 2NW3B 3GK8L 1I9EA 5JHLH 1CGXA 3GI8H 5FXCH 1LK3H 3VI3E 4NN7B 2QADB 2WBWB 3Q0HA 3BI9X 4MWFB 3NCFB 4IS6B 2R4SH 2VLRB 3KJ6L 3QXAA 3W81A 4QTHA 5DFTA 2OP4L 4LVNB 1RJYA 3KR3L 3C5ZD 3IJYA 3QJHA 1P9MA 4S1DC 3V4PL 4C54A 1U3YA 2VISA 3GSNH 3QG7L 1F58H 2X10A 4GRLA 4LLVA 2HKFL 4EDWL 2F53E 2MTPA 4LCIH 2JJTA 3ARVA 5B3JF 3CVHL 3MRKB 2DM2A 4PJAA 2QQKL 4PLKD 3G08A 5IROA 4N9GA 3X12B 2W1NA 3SDDC 5C9JB 2E7HA 2BXYA 3DX9A 2O5XL 1HILB 5E70A 4DN3H 5J89A 4WFED 1I1AB 2NY6C 4JZNB 5JR1L 3LD8B 4G6FD 2VLKB 1B2WL 2CLVA 4F33A 1IE5A 4XCCH 4Y2DB 3W0WA 3OAYK 5ELIA 2BNQA 1FFNB 5LJYH 3HC0B 5DRWB 5I16A 1H3UA 4XBGA 1W72A 4NO3B 1FNLA 2XNAB 2YRLA 5DR5H 4JY4A 5E2UL 1CQKA 2BOCB 1LO5A 1B90A 2VDKH 5DC4B 4G6AD 3IVKB 3ME0A 2QV2A 4LSVH 2G5BA 4P9HC 3WNOA 1FHGA 2UUDK 3CFEA 2H3NA 3J7HA 4N5UA 5ESVA 2WIMA 4TSCH 1Q1JH 3WKMH 2DN7A 5DI8A 5IVXB 2YHGA 1NCNA 3QUKB 3BAEH 4QTHB 3MLUH 1HCVA 3TT3H 3HAEH 3G04A 1H5BA 3EYQC 4YHPB 1CFBA 1J5OH 3WYRA 3IKCA 3DVFA 4NNYB 4PJGE 5JXED 4KK5D 3VWJB 3OAUL 4LLVB 2VMFA 4X98A 4KHTH 3KJ4C 1VPOH 1N7ML 4I2XE 3WCYA 5JHDD 4H26A 2EXYD 3TPUA 3GSWA 4P2QD 5BOZG 5B38A 2FX8L 2X4PB 4NUGL 1CGVA 3D2UB 4Y4HB 3FJTA 3ZHKA 4CBPA 3STZB 1BLNB 2X4TA 1D5ZA 4Y4FC 3TNMB 3GSXA 3CLEL 1KEMH 3C6LA 5D7LE 2VQTA 1CG9B 1NCDH 2Z35B 1GYAA 4TQEL 4XH2A 5JIPA 3HAEG 5JDJA 1DVFC 1MQKH 3C09B 3B2VL 3E6FB 4XHQA 4UQ3B 4OFDA 5EFIA 5JW3L 3CD4A 4Q58C 3UJIL 1V05A 3RVVD 5IESH 3I6LE 4NOBA 4OGXL 1OP3K 3WLWC 3V6ZA 2YUXA 1S7VA 3FO0L 5DS8A 3PWLB 1FIGH 4O4YH 2RR3A 4C56B 5HYEA 4QRTA 3ZDYF 4P46C 1LO2L 2HVJA 5JQ6H 4WO4D 5ESVB 1UB5B 4PGEB 4ZFOA 3ULSA 2R2BB 3P0YH 4Z7VA 3CFJB 1U9KA 5JW4M 3QR2A 4HPOH 4JFHD 35C8H 1NDMA 5JIHA 2ADGA 5C0JB 5CFHA 3G04B 1WITA 4OV6F 3STBA 1U8PA 2NZ9D 4BFGA 1RZKH 5E2TH 1SYVA 1E4WL 1WIPA 1QSZA 3ZTNL 3QI9A 4H26B 1Q72L 2CK0H 5DJ6A 3RNQB 2GQHA 5F9OH 1LD9A 3TPUB 3GSWB 1VA9A 5JDSB 3PGFH 1HEZB 3DI3B 8FABA 2DQGL 1D5ZB 4K9EC 2DQEL 4LVHB 3C6LB 4Y89A 1Z5LA 3QDAA 4WEBL 2LV4A 5MERB 2Y5TB 4NJ9L 1IC5H 2VN7A 1KACB 1IGCH 4BK4A 1KF9B 4L8SA 2SEBB 1IAIH 3U4EA 2WIIA 3LEYL 1FNEB 1MJUH 2X89A 3QUZC 1A6AB 2VH5H 2DLTA 4XWGH 2QQQA 3V0VB 4PJ5A 1HZHL 3CSYA 4RQQB 5IGXH 1N8ZA 3V6BR 5LGHL 5EPMA 4J3VA 2CIKA 2DYPB 1S7VB 3KPQA 2Q8BH 3E0GA 4K3DL 3QHFH 1FGVH 4BSJA 3K74B 4MCYA 1MVFA 1YMHA 4XPAL 5DJDA 4BELD 3NIGF 4XVTH 5A16A 4NFBA 5SX5K 5F7NC 4R4FL 4ZD3L 4L3EA 3NMEA 1AGFA 3KVQA 2PXYD 1DQLH 4ZSOE 5D70L 3VXRB 4P48A 1OF2A 4FQQB 4XPBH 1UACH 4Y2OA 1SEBA 3C2SA 4N90D 1N26A 4RSVA 2DKUA 3QRFM 1DQDH 1I9IH 3TBWB 4U0RC 4APQA 1YYLL 1FH5L 4QF1A 1IEAB 4KJYA 5B3JE 1R3HA 4F58L 3E8UH 1EFQA 4IRSA 3DJ9A 5BZWA 2GJ6E 2ZPKH 5TDOA 3INUL 1I7RB 4QHKJ 3RDTD 1XMWA 3D0VA 3BP6B 1NPUA 3DRQA 1QPXA 3BX7C 1U41A 4TTDC 2XZCL 3RNKA 3U4EB 4ETQA 5D7IA 1FFQA 4KTDL 2HJKB 3KNBB 1ZHNA 4IIQC 1NMCC 1KJ2H 3W11D 4Z0XB 1OAXH 3B9KD 1O5DT 1MI5B 3UPCA 1K5NB 5DK2A 3G6DH 2X4SA 1KBGL 2CIKB 2EKSB 3RZWA 2GEEA 2XQBH 3DVGB 4EUPA 3O3EB 3SN6N 1FFPA 4OLWH 3WIFB 1YEHH 4CU8A 5A16B 5DJXB 2E9JA 2NXZD 5IFAH 3FO2A 3MV8D 1S7TB 4NRZB 1QLRA 5I73B 1R5WA 1A1MA 3UJJL 5DMIH 5EZIL 1UKSA 5DC0A 2XTJB 5FM4A 1MCJA 1G0XA 4GKSB 2X9YA 3G5XB 5KSAB 3UJTH 4WTWA 1T0NB 3C9NA 3IFNL 4FHBD 5D6DA 3PHOB 4YHNA 3GBNH 4DGVH 2B20A 3QIUA 2Z8SA 4O58H 5GQBA 3GNML 4PIRF 4X5XB 3W5NA 4RNRA 3GKWH 3ZKQD 3JTSA 1R3HB 1I7UB 1LP9F 1OGTB 4IRSB 3NA9H 3MLVH 4YDKL 4B41A 2BOBB 5CP3A 4X8JA 2EDTA 3T4YB 4TSBH 2VERN 2DQCL 3KPSD 4BUGA 1NCBL 4ERSH 4F9LA 3BP5B 1A9EA 1JFQL 3IRPX 4LPWA 1F45A 1T3FA 5I1IL 4TVPH 2W60A 5CJOH 5CJ8A 1SYSA 2DICA 4OM1L 2D3VA 4YZFE 4G9DA 5CUSH 4PRHD 5HHPB 2CDEA 2YD5A 4LKCB 1BOGA 2AK4E 1P84J 3BN9C 4MB5A 3T0EC 5E4IA 1NBVH 1LEKB 5J7CC 4Y4KA 1UJTA 3CIQA 2JCCF 5JPNB 1YZZA 3DRTA 3N1QC 2ZG1A 3V79C 4QY8A 2VXQL 2Q86B 3VD9A 2FX9L 3DX8B 2EC9U 3GMLA 2XT1B 1KPUA 3FO2B 4UAOC 3ZDYE 5J57B 4WTZA 2A9ML 3O4LE 3V5HB 3KPMB 3B5GA 5GJTL 4LSSL 2R8SH 4QYOB 1K3IA 4DUXA 5F6HJ 3ALWA 2DM3A 2O61A 5DHYB 4HDIA 3O6FB 4ORGB 1LO4H 3C9NB 3MA9H 3UYRL 1SY6L 4XX1G 3VG0L 4L5FH 5CD3A 3HCVA 5AG9A 1G7PB 4WUUE 3H9ZA 1HOCA 4PTTB 1CDIA 4GSDH 4DEPB 5JOPD 4LK4A 2BSED 2OJEA 4NCC2 3GIVA 4BQBA 4GQ9L 3DXAE 4N0FB 1IC7H 4NHUB 1I7TA 2W9DL 3JZ7A 4L29B 4NM8L 4P3CL 4JLRA 4U1MA 1UVQA 3KPPA 1EO7A 3LDBC 4FQIL 4O00A 5KW9H 4NKDB 1HHIB 5JUEL 2NNAA 3ZKXC 4LNVA 4OCWL 3PQYA 1OD9A 2Z93A 1BM3L 4HFUH 3WFBL 5C0RL 5C6WH 1IAKA 3QSKB 1P7QA 1QP1A 2RIKA 3MLSH 3MYJA 3AFLA 2VZVA 3QUMH 2CGRL 5ESQA 2CDEB 3F7VA 1A7OH 1YPZE 3VXMD 3S34H 2XZQH 3B8YA 3LPWA 4D9RD 2VZOA 3QA3B 4TVSa 4YEFA 3BZ4B 3OKLB 5E99H 2PN5A 3ARDA 3CFBB 1WZLA 1DCLA 1EGJA 1S9KC 1YJDH 5BV7H 2VDRL 3ZKND 4ZS6C 3RX7A 4AEHH 4PJHF 5ID0A 3NIGE 4P2OC 4JG1H 5DO2C 3GK8H 2EC8A 3UTTD 2O61B 5ISZD 5HVHC 4Q2ZA 3S3SA 5C0AA 4L1HA 3BJLA 1GXEA 3KJ6H 3VXNA 2NY7L 1U8KA 2OP4H 3KR3H 1HOCB 1OM3H 2HH0L 4YHML 4M9PA 3GSQB 2VQ1B 5F7EH 3GMMB 3VXTA 4W4NA 3QG7H 3MV9D 2MFNA 2XKUA 3U1SL 3F12B 2HKFH 1DTUA 2YPKB 5SWQA 4YK4B 4EDWH 3RY4A 2RBLA 3CVHH 3KPPB 2QQKH 2QHRL 4M93C 4S1SL 5EA0L 4KI5E 4P9HL 2IC2A 3VXOA 2ESVE 2FJHA 1PEZA 4GQPH 2O5XH 1WBYA 4LQ1A 5D7JA 3LKSB 1RVFL 5E94B 3B6SA 5JR1H 4NN7C 1B2WH 2QADC 3QEQE 3DV6A 5B39B 4PRAA 4TVPE 1ZT1B 4D8PB 4HJ0D 4AIZB 1OD7A 1MRDL 4OFYD 4LVNC 5F7FA 2ICWB 4OJFL 2GAZB 3CC5B 3ARWA 5KOVC 1Y6MR 2JELH 4QCIB 5F7LB 3L95A 1W0WA 1FDLL 4MNQA 1XF2B 1FYTA 2GUOB 1A2YB 4HKXB 1X5AA 4PRBA 1HSBA 1ZEAL 3MO1A 1A5FL 1RJZA 3QXDA 2GK2A 4QTIL 2BHZA 1WCQA 4QRRA 4G6KL 3EYUL 2CXGA 5C0AB 3IFOA 1HHHA 2RCSL 2XRAL 4QHUB 3C8DA 2VLRE 2UYLA 2HG5B 1NAML 5KANG 3RY5A 3LD8C 5T5FL 5JQHC 3GIZL 4W4OA 7FABH 4Y2DC 4HZLA 1IBGL 2VLJD 2Z31D 1PX3A 3DUSB 3OAUH 1CF8L 2EIZB 5SWQB 2YUVA 1N7MH 2UY7A 2ZOLA 4YWGL 3CAFA 2VXTL 4LFHG 1LP9E 2E7LA 3QB7C 5F9WB 5AG8A 2FX7L 2X4QA 5C7XL 4NUGH 1ZXQA 2P5WE 4E41D 2AV1A 1A6PA 2DBJA 3X3GL 4EOWL 1VEOA 5HI5C 2D7NA 5EZOL 2I9LA 3CLEH 5D7JB 3TVMA 4P3DB 1D5MA 1T1XA 2VZUA 4X0KB 1EEQA 5EN2A 5AWNL 4DZBA 1WT5C 1BQLL 2DLFH 2FGZA 5C0IA 1A47A 2J5LB 3D39D 3P3YA 4DQOL 2C26A 3IDYB 4QRQB 4TQEH 1K9TA 3B2VH 5JW3H 3GMOA 1FC2D 4M00A 1OWRM 4IOFD 1P2CB 4C58B 3UJIH 2YA2A 4GRLC 4J12A 3VWJC 4KXZI 1XZ0A 1W0WB 2GFBA 4MNQB 1FYTB 2JCCE 4PRBB 3FZUC 3MO1B 2FEDC 4UV7L 1KCVL 3QXDB 1A1OA 1SVZA 4NPYB 4Y88A 3MJ8A 5IROC 1YQVH 1LO2H 4HUMB 2GITB 1PG7L 4RX4A 3KHOA 2GTZB 3NOIA 1JPSH 3TBSA 4LPTA 2I9TA 4U6VL 5E6IB 1GOHA 1UEYA 2ID5A 1T80A 3B3IA 4YFLI 2WM0A 3TM6A 3I3DA 4U1SA 5DXWA 3C09C 2WQ8A 1E4WH 1ZA6B 3ZTNH 4NZRH 3O9WA 4GMSL 2H2PD 3DUHA 2DQGH 3VG9B 2DQEH 2GHWB 1B88A 3OGOE 3TVMB 1D5MB 1V3KA 5CP7B 1K85A 1QSEA 4XP5L 5DRZA 4WEBH 1E4XI 4NJ9H 4N8VB 3Q5YA 4OKVA 5C8JA 2YSSB 3LEYH 2L4OA 1OLZA 4YFLF 1MHHB 3TH3T 4LHUA 4OZHB 1HZHH 4QXTA 3UYPA 5C0GA 4WFEE 4X4XA 2GFBB 3FONB 3H9SA 3MJ6A 2YUWA 1N3NA 4DKFL 3AU1A 4MNGB 5DD3L 3WNKA 3K0WA 4KZDL 4HT1L 1ETZB 2KL6A 4XPAH 4PJ8D 2VWEC 2WLYA 2YMXL 4PJHE 4JFXA 4S0TD 3UYOD 5ILTL 4LVHC 1P1ZA 3RWEA 1SMAA 3VFUB 1PKOA 1ND0A 3QDMB 1MCDA 3C6LC 4C55A 4R4FH 4TN9A 2I9TB 4ZD3H 2IFGA 3BEWB 1QPPA 1GJIA 1LNUA 1I9JL 3S4SB 1UCBL 5EIIA 5KSBA 1ES0A 1FNSL 4X4YB 2NX5B 3E2HB 2X7LB 2VDNH 5D70H 1OVZA 5IFJA 1F90L 4NQEB 4X83A 1U3ZA 4KXZH 2VE6A 5C0DB 2APWA 2VABA 5TGBB 5C0EA 1M7DB 1FH5H 5F7DB 3MOBH 3MRFA 4OCYH 4X4MA 5AEAA 1R5VA 4F58H 3R0MA 1BVLB 1W0VA 2EEAA 3VFWB 3WO4C 2A83B 1ROWA 1UWXK 2MKLC 3FQNB 1OT2A 3E1F1 1FNAA 2QR0A 3HMWL 4OFVA 4JAMB 3ARFD 3U9UA 5FUCC 3FRUA 5IF0B 2XZCH 1JI2A 1UFUA 3L5JA 4P2QE 5L2KA 1TDQA 3QQ9C 5JLZB 4KTDH 4QOKB 4NO0B 1T83C 3EYFA 4XNUL 4ACPA 4RFEB 3BDYL 2F9BT 2EZ0C 1N3NB 4UOW1 3AU1B 2D31B 2EYTA 5FA4B 3TA3D 4JHAL 3MLYL 5IB5B 3QAZB 3R1GL 4CMHC 3PHQB 3KWWB 4XXDA 4ZPVA 4JB9H 4WY7L 2OR8A 4JFXB 5KN5A 4Z76B 4DOHE 3G6AB 3MRGA 4YHOL 5D4QA 3C60D 3IS0X 5GZNC 1G6RA 3W9EA 2QKIB 2MNUA 3TBYB 5EZIH 1LNUB 3ZKSD 5DUML 3K4AA 5SWSD 4JPKL 4WUKL 2CK2A 4HUWB 5HI4C 1CFNA 4JRWA 4Y5YA 4OZIA 2BNRB 4MAYD 1UXSB 3IFNH 2NYYD 3RL1A 5LKNA 3S88L 4EN3B 3IU4L 3VXPB 1T66C 4JFHE 3GNMH 3ULUD 3QH3B 1MHCB 3V0WL 4PLOB 1DEEB 1JZ7A 4QRPD 4P0DA 2AABL 2UWEA 1FVEB 2MQCA 1C5DA 4LCCB 4YDKH 3BHBB 2PTVA 4PG2C 1KCLA 2DQCH 3ZDXF 4UQ2B 1NCBH 3U9UB 2ZUQC 5E8OA 4ISVB 3C8HA 2DS4A 3TFKC 1JFQH 3NCJH 4LSUL 1NGYA 2NPLX 3D25A 5MEND 2XTJC 1M05B 3TT1L 3OV6A 4DTGL 5DQJB 4OM1H 4J6RL 5IKCB 1I8MA 3EYFB 5KSAC 1LE5A 3QEUB 2OCFD 1HI6A 2ZG3A 5INCA 5GGUA 1F97A 3BKCH 1NCWL 5ALBL 1IAOA 2C3GA 1TZHA 4APQC 5ICXA 2AJ3B 4GRMA 3D69B 2DDQL 5IB2B 5EB9A 1JUFA 4IRSC 3J8F7 1XGRB 2VXQH 4PJEA 2FX9H 3L3IA 2A9MH 4LEOB 4HHAA 5GJTH 4LSSH 1ZLVH 3QEGL 3KPNA 5K33A 3PGDB 5KJRL 5J6GA 1HDMB 1V3JA 1CFNB 5JW4Q 2ZSWB 3O3AA 4NKOB 1ZLWK 3K7UA 1HHKA 1RHFA 3VMOA 4XNYL 4HS3A 3UYRH 1SY6H 1F2QA 5EDXA 3EZJB 4MJID 4CVXA 4AIXA 1T22B 4U6YB 2G5RA 5HHNA 2XICA 1R24B 1NBZA 1U93A 2UWEB 5H35A 5GIRB 4GQ9H 4YIQB 5BVJB 3LEVL 1ZGLB 3IT8D 5C3TA 1KTKE 5J13B 2W9DH 4NM8H 2G9HB 4PRPA 3QZWG 4AG4L 4FQIH 5E00A 5F6IB 4D0CA 2F5BL 3DETC 5JUEH 2VDOL 3LQZB 1ZS8B 4PRIA 1KIPB 2F74B 2ZUUA 2J6EL 2FHCA 4OCWH 5CEZD 1M6OA 1RIVH 3VI4F 2GTWA 1BM3H 5C0RH 2FJGA 3HMXA 4OZGA 3O6FC 4WGWB 1SEQL 2CGRH 5CEZL 2Y7QA 5D6DC 4MYWB 1QBML 5D5MB 5ICXB 4K7PX 4DEPC 3E3QE 4ZFFB 3TYFB 1JUFB 3GB7A 1MCOL 2NY0D 4I5BB 3HI1A 1U8NA 3GSRB 2WP3T 1G7MA 2VDRH 4M6ML 4I0PA 2X09A 3KDMA 1FLRL 1BIIB 4U6HB 4V1DD 5D2LA 5CEXB 1G7LA 3L9RB 2JIXA 3SKNB 4WI5A 1HNFA 4P2RD 4NNXB 4F9LC 3S96B 2HJFB 1QR1A 1MWAA 4QRSB 1D5XA 4HC1A 2NY7H 4OD2A 2PTTB 3MV8E 3H6JA 4XWOC 4DGYL 4JFFD 4YHMH 1ORSA 2CKNA 2F8OA 1NBZB 4FQ2L 4TRPL 2COQA 1PY9A 5H35B 3U1SH 1MFEL 3HE6A 1K2DA 3U7WL 4CVWA 4Z78A 5ID1A 3ELAT 4JFDD 5IW1A 3UTZB 4IOIA 3EFDL 4S1SH 1FFOB 1RZ7L 4P9HH 2XOTA 1G1YA 4NFDA 4NQSB 4HJGB 2FRGP 2OL3A 1IQWL 5FYJE 5C07A 5E9DA 2FJGB 3S6CA 4KY1L 1OAKL 4IOSD 3QFJB 3T0VA 3S3JA 5CEYA 5DEFA 4WW2A 5DJ0B 3ZE0F 3M1BB 4OZHF 4K8RC 1MRDH 2EH8L 1MUJB 4OJFH 3N9GL 4CVZB 2XWTA 4F9PA 1NCUA 1KIQA 4S0SD 2J12B 1EFXA 4FQXB 2VSDA 3GB7B 3SJVD 1MCCA 4FNLL 1FDLH 4YK4C 4X6EB 4I0PB 3MACH 4JDVA 3X14A 3BWAA 2NY2B 3AROA 3BVNA 1ZEAH 5D2LB 4PG9A 1A5FH 3LKRA 2IH3A 4QTIH 1PX4A 3AREB 3V2AR 5L88L 2ENSA 4G6KH 3EYUH 4OV5B 3CDYA 2RCSH 2XRAH 5EU6A 3P40A 3W82A 1NAMH 3ILQC 3PIQB 4GRLD 3ES6B 2C3HA 5E4EB 5T5FH 3GIZH 4YPJA 3HTLX 2BNUA 2W0LA 1IBGH 5GGTA 1JV5B 5F9JA 1RZIA 3FZUD 4RAUA 4X5LA 5DMGD 4YAQB 1CF8H 4GUPA 4PJXA 4YHKL 1AGCB 4YWGH 2VXTH 2E27L 4X7TA 4QHLA 4IOIB 3RVTC 1SVCP 3X3GH 4EOWH 4UOW0 2V5MA 4W6XB 5JOPE 1S7SA 2C4XA 3E6HA 3D5OF 3TO4A 1DQJB 4Z7WB 5EZOH 3BGMB 4RMUA 4Z95L 5ENWA 3ZDXE 1K4DB 5B8CB 4LLDA 3W0WD 1CGSL 2FECL 2D4FA 2YRZA 2BNQD 5DZNA 5AWNH 4BFBD 3O11B 1BQLH 4LKXA 2Q8AL 5CEYB 4NKIH 3T4AB 3OQ3B 1PSKL 3OGCA 1FRGL 4LHJB 4DQOH 3BH9A 4LRIA 4IDLA 1FNHA 3VCLA 4WGVB 3TIDA 4HBCL 3DVNB 2R1WA 1W72L 4UI2A 2Z91A 5D1ZA 4P23B 3ZTJG 5IB4B 4HCRA 3QO1B 1QFUH 4GMTL 3EYSL 4RGOL 4JO4L 4UV7H 1KCVH 5F9WC 2BJML 3TC9A 1AXSA 2IH3B 2BVYA 1QBAA 3RJQB 3WN5A 4D9RE 3WBDA 2PYFA 3L1OL 4MD4A 5EOCL 5D7JC 3BESR 5C3LD 1OB1A 1AE6H 4QXGL 1KYOJ 5IW6B 1CL7L 43C9B 1A7QL 5IT2L 5F96L 4U6VH 5K93A 5F7MC 2IQAA 4DAGL 3SEPA 4TNWF 4XNZB 4CU7A 2J5LC 4JFEA 2K9UA 3IDYC 1AIFB 1F4XL 1K6QL 1RZIB 4XC1L 4KVCL 4RGMB 1X7QB 5ISZE 3NCEB 1N2RA 1CXKA 4K71C 4QHLB 3RWJA 2XQYK 1N0LA 1UG9A 2FJFA 2HKHL 5GSVA 3TJHC 2WUCL 4OLXL 4OF6A 1XIWA 4KUCF 1D7FA 5IEHB 2NY5C 3TO4B 4YXHL 4Y1AB 3MV9E 1FL5A 2CPCA 3MLXL 1T1YB 1VSCA 2LU4A 4XP5H 4KH2A 3VI4E 3KAAA 4GLRH 5TDPB 1LWRA 2AI0L 2YEZA 4PJ9B 1ZGLM 3RVWD 1FP5A 2H1PL 5E6IC 1JIBA 2XACC 4W4OC 1MAKA 2AEQL 3QFDB 5GHWL 3EOTL 4X99A 1FNFA 4GG6B 1N5YH 1KJVA 3G6JF 1EUUA 3V9FA 1XT5A 5DD5L 1AXIB 3RVXD 2E7LC 4JFOB 3KYNB 4DKFH 5HYSG 3CZFA 4PP2A 3H42L 5DD3H 1LO3L 3BYTA 4HT1H 3VFPA 1DFBL 1EBAA 2YMXH 4U1IA 5ILTH 3PWPB 3CSPA 4ZFOL 5KAQG 3TVMC 4NT6A 5K9QG 1OB1B 2GYSA 1LE9A 2VRAA 3CPLA 1U8LA 4BH7B 1ONQB 2AEIT 3KYMB 3QHZH 1JWUA 1I9JH 5ANMB 1FNSH 4L8BA 3U79A 2E9IA 4XP1L 2EZ0D 4M7ZB 3IAGC 3QI9D 3HN3A 2FYYB 4OFKA 4H1LH 4ZUTB 5FK9A 3V6OA 1J7VR 3OXSA 5D1QA 5DUPL 2VAAB 3RWJB 1G7IB 4OUUB 1MAML 3LMJL 1VDGA 1S9VA 2VIRB 4JDZA 4PJFA 3GO1L 4AIOA 1E27A 4MXWL 4PY7A 4M61A 5IR1B 5CJXA 4M7KL 1F00I 1Y6KR 5ERWA 2N1KA 1EAJA 5I76A 4PBWD 1FL5B 3ULUF 4AENB 2X89D 3HMWH 3U9PL 2HT4D 3FQTB 1MLBB 3O8XA 4PJ5D 1INQB 3CFIC 1WBZA 3IRZA 2EYRA 3TJEL 4E41E 4JN2B 4LPVA 3E2HC 4OZHE 1DUZA 4HKJA 2OQJA 1CK0L 2R1XB 4Y19B 3S37H 1HXMA 3BDYH 3UTSB 1ORQB 4JPWL 3MGAA 3P11L 3NPZB 4ZFGL 3O9WC 4MNGE 3D39E 1QVOA 3GMNA 4JHAH 4WI3A 3MLYH 5DMKB 4DZ8B 3KYOB 1YEFL 3R1GH 1JF1A 2ADFL 2BSSB 4L3ED 3QDME 4WY7H 4NNPL 4AZ8A 2BK8A 3IAPA 3RX8A 4YHOH 4JRYB 1IGFH 1PQZA 5FM5M 3CPLB 1JWUB 2KH2B 5DUMH 3TN0B 3VU2A 1PVHA 2FL5A 3O2VL 4WUKH 1EEYB 1LVEA 4NQEE 4HK0B 2FGWL 4APQD 5T1KB 2AV7B 1WLHA 1XF3A 1D5IL 1V3MA 4AM0B 2XKNB 2A6KB 3S88H 3ZL4L 1QUNA 5D1QB 5DJ8B 4RGNC 3IU4H 3HRPA 1FC1A 3MV7B 4PJFB 2Q76A 2XY1A 4M02A 3V8OA 3V0WH 1KLGB 1T04B 2AABH 2DL2A 3MYZA 5IM7B 3WS6C 1WZKA 2BVQB 1FIEA 3WJJA 4HKBB 3QAZC 2V5RA 4KAQL 5HHOB 4QHMB 1MIEL 1ZKAA 1N6UA 3BZDA 2VKWA 4LDLB 4KROB 5HBBA 3O8XB 3PP4L 1XR8A 4LSUH 3ZYOA 4HWZB 4A6YB 3TT1H 3ZKMD 5HGBB 3CSBA 4KRNA 5EZLB 4L3CA 1DUZB 4J6RH 2VOTA 3BGFB 5DC9B 2VLLB 1HXMB 5FCUL 1AI1H 1DBKL 1NJ9A 4JPIB 3VXSB 1SJEB 4LGPB 5CGTA 1PDKA 3FN0L 4Z7NE 4EN3C 5LGJA 3MV11 1NCWH 5ALBH 5GRJL 3VGHA 1TTUA 4FQCL 3PDDA 3UCRA 1U3HA 5ACZB 1NGZB 1QVOB 1R3IL 2V7NA 4HGMA 2DDQH 1P6FA 3RI5F 5JMOC 1J0JA 2XPGA 1J0ZA 4LCCC 1A9BA 1J8HA 4KJWC 3HLAA 3WNMA 1F3RB 2J3SA 2ZWLT 4K94L 3MCG1 1F6LL 2VDPL 3QEGH 1B4JL 5KJRH 3ZZ1A 1ZHKA 4PJCB 4C83A 3NAAH 3QIUD 3MROA 5LBSL 2FO1A 3IDMA 5BS0B 1FVCB 1RZ8A 1HH9B 2YBRA 4I3SL 1F11B 4PBVC 2AKRA 1IRAY 4XNYH 2WV3A 5D7SL 2FLRT 3QQ3A 1N64H 2O5ZL 4PY8J 3EO0A 2D7PA 2ICEA 1XGTB 1INEL 4LLYA 3LEVH 3U6RA 4NQUA 5D1XB 1I85C 3LEXA 5IK3B 4Z7WF 3IXTB 1EAPA 2F5BH 4J3UA 2VDOH 3QNXA 2YA0A 1MJJA 5H2BB 4YHLH 2J6EH 1J8KA 3OJVC 1NKOA 4ELMA 3BZFA 3KS0H 2Q7YB 4RRPG 4NRYA 3V5KA 5M94B 1TZIB 3VRLE 2ZG2A 2VXSL 5ICYA 4PYGA 1SEQH 3HS0B 4Y4KD 5CEZH 3SGDH 1SBSL 3GJFH 1KIRA 1QBMH 2CRZA 4G3YL 4K3EH 1ZANH 4J3SA 4RBPH 3FB6A 5F1KC 3AM8C 2V7HB 3SDXA 3G6JE 1Q38A 5DA0B 1QBLL 5EU5A 3TP4A 3UDWA 1MCOH 3MRDA 1KXQE 4U1NA 1J8HB 4N1HB 1W2KT 4H25B 4M6MH 4D9QD 1DL7L 1FLRH 1P5UA 3VFRB 5F6IC 2W91A 2EDFA 2Q1EA 3V4VL 4OGAD 1NGXA 1UEMA 4U7SA 2EE2A 3P4NA 1L4IA 2FECI 1CD1A 2NY3C 3OKKB 5CHNA 3CSGA 5CD5C 4OF0A 4XHJD 5GRUH 1Y18B 5FGCE 5AUMA 4DGYH 2R23A 2RQ8A 1WZMA 5DTFB 5ITFA 4Z8FL 1YMMA 4FQ2H 2BP3A 5SWSE 3C2AL 1A1NB 4PREA 1AH1A 1MFEH 1R5IB 3MRRB 3U7WH 3PQYD 4MVBC 4CNIA 1P7QD 3EFDH 1RZ7H 3RVUC 5D9SB 5FUOL 4GG8A 3ULUE 4ELMB 4QRPE 3ABZA 3D0LA 4RMTA 5E95B 4YXLL 2A73A 1OAKH 5ICYB 4XPGH 4HIHB 3LH2L 1CTNA 3D9AL 2MCG1 1CL7I 1IM3A 3HUJF 5DD6A 5E7FA 1BFVL 1WEJH 1X5IA 2HAZA 3PL6A 1V8HA 3ARDD 1OSPL 4H20L 2EH8H 4AK1A 3ARBA 4UDUB 3RWFB 4UOJA 5EU5B 5MENE 4WDIB 2AQ3A 5DVMA 4JFYB 2F54A 3MRDB 4FNLH 4ZQKA 4J3XA 1FZMA 1EGJL 5JTWA 3V8CA 4E42B 4FZ8L 5L88H 3RTQD 4RWHA 2OBGA 4Z7UE 1SJHA 4LLMA 4NBZB 1CD1B 1PZUB 2RGSA 4U31A 1FZOA 3OR6A 2ENYA 3WE6A 3FT4A 1Q9OA 5ITFB 1YMMB 1DLFL 4G6JL 4HXBL 4AT6A 1M7XA 2I24N 4IHOB 4YHKH 5GGQH 1MRFL 4HUXB 4FQXC 5EOTA 1F4HA 1H3GA 1DSFL 3ULVD 1BECA 2IGFL 4I0PC 3GI9L 4M5ZL 1QLEL 2NY2C 1M71B 2CIIA 3PHSA 5F1IB 1JYVA 2V9TA 5HYQB 4XBPA 4Z95H 3AREC 1CGSH 5L6YL 3FAXA 2EC9T 3ULVL 2Q8AH 3NIDF 3LQMA 1NMAL 4PP1D 3H2WA 3FO1B 3OXRB 2ARJB 5DD6B 1PSKH 1FRGH 3T77A 1HYRC 3CCHA 2YPLB 4OF7A 5E4EC 2CH8A 1YEEL 4WENB 3D3VB 2AGJL 3GDBA 4HBCH 4R3SA 3HC3H 1MCBA 4LIQL 1W72H 1NSNL 3NN8A 1M7IA 1IL1A 4QRRD 2WUBL 3EYSH 3F7YA 1HQRB 4RGOH 4JO4H 2BJMH 4TSAL